Energy Technology Data Exchange (ETDEWEB)
Neumann, G. [Oesterreichische Elektrizitaetswirtschaft-AG (Verbund), Vienna (Austria)
1998-12-01
The Austrian network has pledged itself in all areas of activity to a responsible, enduring relationship with the environment and, consequently, has introduced an environmental management system which embraces all undertakings. The input and output organization is described in relation to the new companies` structure. The establishment of an environmental information system, as well as documentation (required by EMAS) and communications with the public in the form of an annual environmental report may be cited as some of the concrete results. (orig.) [Deutsch] Der oesterreichische Verbund hat sich in allen Taetigkeitsbereichen zu einem verantwortungsvollen, an Nachhaltigkeit orientierten Umgang mit der Umwelt verpflichtet und daher ein - das gesamte Unternehmen umfassendes - Umweltmanagementsystem eingefuehrt. Beschrieben wird die Aufbau- und Ablauforganisation in Verbindung mit der neuen Firmenstruktur. Als konkrete Ergebnisse seien der Aufbau eines Umweltinformationssystems sowie die (vom EMAS geforderte) Dokumentation und Kommunikation mit der Oeffentlichkeit in Form eines jaehrlichen Umweltberichtes erwaehnt. (orig.)
ITN Expo 2009 Infrastrutture, telematica e navigazione si incontrano
Directory of Open Access Journals (Sweden)
Gianluca Pititto
2009-03-01
Full Text Available ITN EXPO 2009From the 15th to the 16th of October the first edition of ITN EXPO: INFRASTRUCTURES, TELEMATICS AND NAVIGATION was held in Turin (Lingotto. ITN 2009 was developed from the combination of two existing events: Infrastructura, an international biennial show dedicated to infrastructural facilities and the conference&expo Telemobility Forum. ITN 2009 offered visitors two days of conferences, informative workshops and seminars of high-level content around the main topics: Infomobility, Infrastructures, Navigation. Workshop conference meetings have been organized with industry managers and public administrators, while thousands of visitors were visiting stands and meeting professionals of the main sectors.
ITN Expo 2009 Infrastrutture, telematica e navigazione si incontrano
Directory of Open Access Journals (Sweden)
Gianluca Pititto
2009-03-01
Full Text Available ITN EXPO 2009 From the 15th to the 16th of October the first edition of ITN EXPO: INFRASTRUCTURES, TELEMATICS AND NAVIGATION was held in Turin (Lingotto. ITN 2009 was developed from the combination of two existing events: Infrastructura, an international biennial show dedicated to infrastructural facilities and the conference&expo Telemobility Forum. ITN 2009 offered visitors two days of conferences, informative workshops and seminars of high-level content around the main topics: Infomobility, Infrastructures, Navigation. Workshop conference meetings have been organized with industry managers and public administrators, while thousands of visitors were visiting stands and meeting professionals of the main sectors.
Dosanjh, Manjit
2013-01-01
PARTNER (Particle Training Network for European Radiotherapy) is a project funded by the European Commission’s Marie Curie-ITN funding scheme through the ENLIGHT Platform for 5.6 million Euro. PARTNER has brought together academic institutes, research centres and leading European companies, focusing in particular on a specialized radiotherapy (RT) called hadron therapy (HT), interchangeably referred to as particle therapy (PT). The ultimate goal of HT is to deliver more effective treatment to cancer patients leading to major improvement in the health of citizens. In Europe, several hundred million Euro have been invested, since the beginning of this century, in PT. In this decade, the use of HT is rapidly growing across Europe, and there is an urgent need for qualified researchers from a range of disciplines to work on its translational research. In response to this need, the European community of HT, and in particular 10 leading academic institutes, research centres, companies and small and medium-sized en...
Correlates of Intra-Household ITN Use in Liberia: A Multilevel Analysis of Household Survey Data.
Babalola, Stella; Ricotta, Emily; Awantang, Grace; Lewicky, Nan; Koenker, Hannah; Toso, Michael
2016-01-01
Malaria is a major cause of morbidity and mortality in Liberia. At the same time, insecticide-treated net (ITN) ownership and use remain low. Access is a key determinant of ITN use but it is not the only one; prior studies have identified factors that affect the use of ITNs in households with at least one ITN. These factors operate at the individual, household, and community levels. However, studies have generally not assessed the psychosocial or ideational determinants of ITN use. Using 2014 household survey data, this manuscript examines the socio-demographic, ideational, household, and community factors associated with household member use of ITNs in Liberia. Multilevel modeling was used to assess fixed effects at the individual, household, and community levels, and random effects at the household and cluster levels. The data showed significant residual clustering at the household level, indicating that there were unmeasured factors operating at this level that are associated with ITN use. The association of age with ITN use was moderated by sex such that men, older children, and teenagers were less likely to sleep under an ITN compared to women and children under five years old. Female caregivers' perceived severity of malaria, perceived self-efficacy to detect a complicated case of malaria, and exposure to the "Take Cover" communication campaign were positively associated with ITN use by members of her household. The association with household size was negative, while the relationship with the number of ITNs was positive. Programs should seek to achieve universal coverage (that is, one ITN for every two household members) and promote the notion that everyone needs to sleep under an ITN every night. Programs should also seek to strengthen perceived severity of malaria and educate intended audience groups on the signs of malaria complications. Given the significance of residual clustering at the household level, interventions that engage men as heads of
Dosanjh, Manjit; Magrin, Giulio
2013-07-01
PARTNER (Particle Training Network for European Radiotherapy) is a project funded by the European Commission's Marie Curie-ITN funding scheme through the ENLIGHT Platform for 5.6 million Euro. PARTNER has brought together academic institutes, research centres and leading European companies, focusing in particular on a specialized radiotherapy (RT) called hadron therapy (HT), interchangeably referred to as particle therapy (PT). The ultimate goal of HT is to deliver more effective treatment to cancer patients leading to major improvement in the health of citizens. In Europe, several hundred million Euro have been invested, since the beginning of this century, in PT. In this decade, the use of HT is rapidly growing across Europe, and there is an urgent need for qualified researchers from a range of disciplines to work on its translational research. In response to this need, the European community of HT, and in particular 10 leading academic institutes, research centres, companies and small and medium-sized enterprises, joined together to form the PARTNER consortium. All partners have international reputations in the diverse but complementary fields associated with PT: clinical, radiobiological and technological. Thus the network incorporates a unique set of competencies, expertise, infrastructures and training possibilities. This paper describes the status and needs of PT research in Europe, the importance of and challenges associated with the creation of a training network, the objectives, the initial results, and the expected long-term benefits of the PARTNER initiative.
International Nuclear Information System (INIS)
Dosanjh, Manjit; Magrin, Giulio
2013-01-01
PARTNER (Particle Training Network for European Radiotherapy) is a project funded by the European Commission's Marie Curie-ITN funding scheme through the ENLIGHT Platform for 5.6 million Euro. PARTNER has brought together academic institutes, research centres and leading European companies, focusing in particular on a specialized radiotherapy (RT) called hadron therapy (HT), interchangeably referred to as particle therapy (PT). The ultimate goal of HT is to deliver more effective treatment to cancer patients leading to major improvement in the health of citizens. In Europe, several hundred million Euro have been invested, since the beginning of this century, in PT. In this decade, the use of HT is rapidly growing across Europe, and there is an urgent need for qualified researchers from a range of disciplines to work on its translational research. In response to this need, the European community of HT, and in particular 10 leading academic institutes, research centres, companies and small and medium-sized enterprises, joined together to form the PARTNER consortium. All partners have international reputations in the diverse but complementary fields associated with PT: clinical, radiobiological and technological. Thus the network incorporates a unique set of competencies, expertise, infrastructures and training possibilities. This paper describes the status and needs of PT research in Europe, the importance of and challenges associated with the creation of a training network, the objectives, the initial results, and the expected long-term benefits of the PARTNER initiative. (author)
Energy Technology Data Exchange (ETDEWEB)
Sakamoto, Hikaru [Department of Bioproduction, Faculty of Bioindustry, Tokyo University of Agriculture, 196 Yasaka, Abashiri-shi, Hokkaido 093-2422 (Japan); Sakata, Keiko; Kusumi, Kensuke [Department of Biology, Faculty of Sciences, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Kojima, Mikiko; Sakakibara, Hitoshi [RIKEN Plant Science Center, 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama 230-0045 (Japan); Iba, Koh, E-mail: koibascb@kyushu-u.org [Department of Biology, Faculty of Sciences, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan)
2012-06-29
Highlights: Black-Right-Pointing-Pointer ITN1, a plasma membrane ankyrin protein, interacts with a nuclear DNA-binding protein RTV1. Black-Right-Pointing-Pointer The nuclear transport of RTV1 is partially inhibited by interaction with ITN1. Black-Right-Pointing-Pointer RTV1 can promote the nuclear localization of ITN1. Black-Right-Pointing-Pointer Both overexpression of RTV1 and the lack of ITN1 increase salicylic acids sensitivity in plants. -- Abstract: The increased tolerance to NaCl 1 (ITN1) protein is a plasma membrane (PM)-localized protein involved in responses to NaCl stress in Arabidopsis. The predicted structure of ITN1 is composed of multiple transmembrane regions and an ankyrin-repeat domain that is known to mediate protein-protein interactions. To elucidate the molecular functions of ITN1, we searched for interacting partners using a yeast two-hybrid assay, and a nuclear-localized DNA-binding protein, RTV1, was identified as a candidate. Bimolecular fluorescence complementation analysis revealed that RTV1 interacted with ITN1 at the PM and nuclei in vivo. RTV1 tagged with red fluorescent protein localized to nuclei and ITN1 tagged with green fluorescent protein localized to PM; however, both proteins localized to both nuclei and the PM when co-expressed. These findings suggest that RTV1 and ITN1 regulate the subcellular localization of each other.
Ehlers, Mario R; Nepom, Gerald T
2012-01-01
Reestablishing immune tolerance in type 1 diabetes (T1D), a chronic autoimmune disease, is a major goal. The Immune Tolerance Network (ITN) has initiated eight clinical trials of immunomodulatory therapies in recent-onset T1D over the past decade. Results have been mixed in terms of clinical efficacy, but the studies have provided valuable mechanistic insight that are enhancing our understanding of the disease and guiding the design of future trials. Trials of non-Fc-binding anti-CD3 mAbs have revealed that modulation of this target leads to partial responses, and ITN's AbATE trial led to identification of a robust responder group that could be distinguished from non-responders by baseline metabolic and immunologic features. A pilot study of the combination of IL-2 and rapamycin gave the first demonstration that frequency and function of regulatory T cells (Tregs) can be enhanced in T1D subjects, although the therapy triggered the activation of effectors with transient β-cell dysfunction. Similarly, therapy with anti-thymocyte globulin led to substantial lymphocyte depletion, but also to the activation of the acute-phase response with no clinical benefit during preliminary analyses. These and other results provide mechanistic tools that can be used as biomarkers for safety and efficacy in future trials. Furthermore, our results, together with those of other organizations, notably TrialNet, delineate the roles of the major components of the immune response in T1D. This information is setting the stage for future combination therapy trials. The development of disease-relevant biomarkers will also enable the implementation of innovative trial designs, notably adaptive trials, which will increase efficiencies in terms of study duration and sample size, and which will expedite the conduct of trials in which there are uncertainties about dose response and effect size.
Directory of Open Access Journals (Sweden)
Monica Shah
Full Text Available Despite the clear public health benefit of insecticide-treated bednets (ITNs, the impact of malaria transmission-reduction by vector control on the spread of drug resistance is not well understood. In the present study, the effect of sustained transmission reduction by ITNs on the prevalence of Plasmodium falciparum gene mutations associated with resistance to the antimalarial drugs sulfadoxine-pyrimethamine (SP and chloroquine (CQ in children under the age of five years was investigated during an ITN trial in Asembo area, western Kenya. During the ITN trial, the national first line antimalarial treatment changed from CQ to SP. Smear-positive samples collected from cross sectional surveys prior to ITN introduction (baseline, n = 250 and five years post-ITN intervention (year 5 survey, n = 242 were genotyped for single nucleotide polymorphisms (SNPs at dhfr-51, 59, 108, 164 and dhps-437, 540 (SP resistance, and pfcrt-76 and pfmdr1-86 (CQ resistance. The association between the drug resistance mutations and epidemiological variables was evaluated. There were significant increases in the prevalence of SP dhps mutations and the dhfr/dhps quintuple mutant, and a significant reduction in the proportion of mixed infections detected at dhfr-51, 59 and dhps-437, 540 SNPs from baseline to the year 5 survey. There was no change in the high prevalence of pfcrt-76 and pfmdr1-86 mutations. Multivariable regression analysis further showed that current antifolate use and year of survey were significantly associated with more SP drug resistance mutations. These results suggest that increased antifolate drug use due to drug policy change likely led to the high prevalence of SP mutations 5 years post-ITN intervention and reduced transmission had no apparent effect on the existing high prevalence of CQ mutations. There is no evidence from the current study that sustained transmission reduction by ITNs reduces the prevalence of genes associated with malaria
Ownership and utilization of insecticide-treated nets (ITNs) for ...
African Journals Online (AJOL)
Though ITNs are the most prominent measure for large-scale deployment in highly endemic areas their compliance in terms of ownership and usage needs attention. The aim of this study was therefore to ... included from malarious areas. Data were collected by using structured questionnaires and observational checklist.
Faccenna, C.; Funiciello, F.
2012-04-01
EC-Marie Curie Initial Training Networks (ITN) projects aim to improve the career perspectives of young generations of researchers. Institutions from both academic and industry sectors form a collaborative network to recruit research fellows and provide them with opportunities to undertake research in the context of a joint research training program. In this frame, TOPOMOD - one of the training activities of EPOS, the new-born European Research Infrastructure for Geosciences - is a funded ITN project designed to investigate and model how surface processes interact with crustal tectonics and mantle convection to originate and develop topography of the continents over a wide range of spatial and temporal scales. The multi-disciplinary approach combines geophysics, geochemistry, tectonics and structural geology with advanced geodynamic numerical/analog modelling. TOPOMOD involves 8 European research teams internationally recognized for their excellence in complementary fields of Earth Sciences (Roma TRE, Utrecht, GFZ, ETH, Cambridge, Durham, Rennes, Barcelona), to which are associated 5 research institutions (CNR-Italy, Univ. Parma, Univ. Lausanne, Univ. Montpellier, Univ. Mainz) , 3 high-technology enterprises (Malvern Instruments, TNO, G.O. Logical Consulting) and 1 large multinational oil and gas company (ENI). This unique network places emphasis in experience-based training increasing the impact and international visibility of European research in modeling. Long-term collaboration and synergy are established among the overmentioned research teams through 15 cross-disciplinary research projects that combine case studies in well-chosen target areas from the Mediterranean, the Middle and Far East, west Africa, and South America, with new developments in structural geology, geomorphology, seismology, geochemistry, InSAR, laboratory and numerical modelling of geological processes from the deep mantle to the surface. These multidisciplinary projects altogether aim to
Tuba, Mary; Sandoy, Ingvild F; Bloch, Paul; Byskov, Jens
2010-11-01
Malaria is the leading cause of morbidity and the second leading cause of mortality in Zambia. Perceptions of fairness and legitimacy of decisions relating to treatment of malaria cases within public health facilities and distribution of ITNs were assessed in a district in Zambia. The study was conducted within the framework of REsponse to ACcountable priority setting for Trust in health systems (REACT), a north-south collaborative action research study, which evaluates the Accountability for Reasonableness (AFR) approach to priority setting in Zambia, Tanzania and Kenya. This paper is based on baseline in-depth interviews (IDIs) conducted with 38 decision-makers, who were involved in prioritization of malaria services and ITN distribution at district, facility and community levels in Zambia, one Focus Group Discussion (FGD) with District Health Management Team managers and eight FGDs with outpatients' attendees. Perceptions and attitudes of providers and users and practices of providers were systematized according to the four AFR conditions relevance, publicity, appeals and leadership. Conflicting criteria for judging fairness were used by decision-makers and patients. Decision-makers argued that there was fairness in delivery of malaria treatment and distribution of ITNs based on alleged excessive supply of free malaria medicines, subsidized ITNs, and presence of a qualified health-provider in every facility. Patients argued that there was unfairness due to differences in waiting time, distances to health facilities, erratic supply of ITNs, no responsive appeal mechanisms, inadequate access to malaria medicines, ITNs and health providers, and uncaring providers. Decision-makers only perceived government bodies and donors/NGOs to be legitimate stakeholders to involve during delivery. Patients found government bodies, patients, indigenous healers, chiefs and politicians to be legitimate stakeholders during both planning and delivery. Poor status of the AFR
Directory of Open Access Journals (Sweden)
Bloch Paul
2010-11-01
Full Text Available Abstract Background Malaria is the leading cause of morbidity and the second leading cause of mortality in Zambia. Perceptions of fairness and legitimacy of decisions relating to treatment of malaria cases within public health facilities and distribution of ITNs were assessed in a district in Zambia. The study was conducted within the framework of REsponse to ACcountable priority setting for Trust in health systems (REACT, a north-south collaborative action research study, which evaluates the Accountability for Reasonableness (AFR approach to priority setting in Zambia, Tanzania and Kenya. Methods This paper is based on baseline in-depth interviews (IDIs conducted with 38 decision-makers, who were involved in prioritization of malaria services and ITN distribution at district, facility and community levels in Zambia, one Focus Group Discussion (FGD with District Health Management Team managers and eight FGDs with outpatients' attendees. Perceptions and attitudes of providers and users and practices of providers were systematized according to the four AFR conditions relevance, publicity, appeals and leadership. Results Conflicting criteria for judging fairness were used by decision-makers and patients. Decision-makers argued that there was fairness in delivery of malaria treatment and distribution of ITNs based on alleged excessive supply of free malaria medicines, subsidized ITNs, and presence of a qualified health-provider in every facility. Patients argued that there was unfairness due to differences in waiting time, distances to health facilities, erratic supply of ITNs, no responsive appeal mechanisms, inadequate access to malaria medicines, ITNs and health providers, and uncaring providers. Decision-makers only perceived government bodies and donors/NGOs to be legitimate stakeholders to involve during delivery. Patients found government bodies, patients, indigenous healers, chiefs and politicians to be legitimate stakeholders during both
International Nuclear Information System (INIS)
Almeida, M.; Dias, M.; Goncalves, A.P.; Henriques, M.S.; Lopes, E.B.; Pereira, L.C.J.; Santos, I.C.; Verbovytskyy, Y.; Waerenborgh, J.C.; Branco, J.B.; Carretas, J.M.; Cruz, A.; Ferreira, A.C.; Gasche, T.A.; Leal, J.P.; Lopes, G.; Lourenco, C.; Marcalo, J.; Maria, L.; Monteiro, B.; Mora, E.; Pereira, C.C.L.; Paiva, I.
2010-01-01
The current activities in the area of actinide chemistry at ITN, comprising basic research studies in inorganic and organometallic chemistry, catalysis, gas-phase ion chemistry, thermochemistry, and solid state chemistry, are briefly described. Actinide (and lanthanide) chemistry studies at ITN will be pursued connecting basic research with potential applications in nuclear and non-nuclear areas. (authors)
ITN utilization among pregnant women attending ANC in Etsako West Lga, Edo State, Nigeria.
Wagbatsoma, V A; Aigbe, E E
2010-06-01
To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo State. A descriptive cross-sectional study design was employed. Using a systematic sampling method, a total of 385 respondents were selected from all ANC facilities in the LGA following a verbally obtained consent. Tool for data collection was a semi-structured, researcher administered questionnaire. The respondents' knowledge of cause of malaria was good, as 269 (69%) had good knowledge but only 9 (2.3%) knew its effects on the foetus. Meanwhile, ownership of ITN and its use were very low, 36 (9.3%) and 31 (8.0) respectively. The main factor affecting the use of the commodity in the LGA was unavailability of ITNs. Other factors included belief of the women on the effectiveness of the commodity, level of education, marital status and family sizes ofrespondents. Use of Insecticide treated bed net has been hampered by unavailability of the commodity. It is therefore recommended that efforts should be made to make the commodity available to reduce morbidity and mortality among this vulnerable group.
Spatio-Temporal Patterns of the International Merger and Acquisition Network.
Dueñas, Marco; Mastrandrea, Rossana; Barigozzi, Matteo; Fagiolo, Giorgio
2017-09-07
This paper analyses the world web of mergers and acquisitions (M&As) using a complex network approach. We use data of M&As to build a temporal sequence of binary and weighted-directed networks for the period 1995-2010 and 224 countries (nodes) connected according to their M&As flows (links). We study different geographical and temporal aspects of the international M&A network (IMAN), building sequences of filtered sub-networks whose links belong to specific intervals of distance or time. Given that M&As and trade are complementary ways of reaching foreign markets, we perform our analysis using statistics employed for the study of the international trade network (ITN), highlighting the similarities and differences between the ITN and the IMAN. In contrast to the ITN, the IMAN is a low density network characterized by a persistent giant component with many external nodes and low reciprocity. Clustering patterns are very heterogeneous and dynamic. High-income economies are the main acquirers and are characterized by high connectivity, implying that most countries are targets of a few acquirers. Like in the ITN, geographical distance strongly impacts the structure of the IMAN: link-weights and node degrees have a non-linear relation with distance, and an assortative pattern is present at short distances.
Owusu Adjah, Ebenezer S; Panayiotou, Andrie G
2014-01-01
Background: Media messages have been used in Ghana to promote insecticide-treated net (ITN)/bed net usage in an effort to impact on malaria prevention. The aim of this study was to assess the effect of such malaria-related messages delivered through electronic/print media and by volunteers/health workers on the use of ITNs by children living in a household. Methods: Data was collected from September to November of 2008 using a structured, interviewer-administered questionnaire by the Ghana St...
Randomizing world trade. II. A weighted network analysis
Squartini, Tiziano; Fagiolo, Giorgio; Garlaschelli, Diego
2011-10-01
Based on the misleading expectation that weighted network properties always offer a more complete description than purely topological ones, current economic models of the International Trade Network (ITN) generally aim at explaining local weighted properties, not local binary ones. Here we complement our analysis of the binary projections of the ITN by considering its weighted representations. We show that, unlike the binary case, all possible weighted representations of the ITN (directed and undirected, aggregated and disaggregated) cannot be traced back to local country-specific properties, which are therefore of limited informativeness. Our two papers show that traditional macroeconomic approaches systematically fail to capture the key properties of the ITN. In the binary case, they do not focus on the degree sequence and hence cannot characterize or replicate higher-order properties. In the weighted case, they generally focus on the strength sequence, but the knowledge of the latter is not enough in order to understand or reproduce indirect effects.
Evolution of international trade and investment networks
Zhang, Shuhong; Wang, Lin; Liu, Zhixin; Wang, Xiaofan
2016-11-01
In this paper, an evolving two-layer international economy network (IEN) consisting of international trade network (ITN) and international investment network (IIN) as layers, is constructed to investigate the world economy from 2001 to 2010. First, the structure analysis shows that the average partner numbers for both trade and investment are increasing year by year, and the average volume has a significant decrease in 2008 for investment and 2009 for trade. The IIN has longer average path length and dramatically lower edge density compared with the ITN, yet its clustering coefficient is larger in all years. Then, the regional relativity indicates that the longer the distance between two countries, the smaller trade and investment volumes they carry in are general, and the impact of the geographical distance gradually reduces as time goes on. Furthermore, the countries and regions are ranked by Pagerank in ITN, IIN and IEN to illustrate the roles they played. And finally, community structures are detected to visualize the global economic landscape, with countries and regions in the same community ranked according to the total volume of trade or investment.
Protas, Joyce; Tarimo, D; Moshiro, C
2016-06-21
Insecticides treated nets (ITNs) and intermittent preventive therapy with two doses of sulfadoxine-pyrimethamine (SP IPTp) are the cornerstone for malaria control in pregnancy. Despite the coverage of these interventions being high, it is not known whether they confer optimal protection time against malaria in pregnancy. This study investigated the timing and determinants of timely uptake of SP(IPTp) and ITNs and the pregnancy time protected. A health facility based cross-sectional study was carried out in Bukoba urban district from 16th April to 29 May 2013. Involving pregnant women and post natal mothers attending Reproductive and Child Health (RCH) clinics. Data on their socio-economic background, pregnancy history and attendance to RCH, receipt of a voucher and acquisition of an ITN as well as SP for IPTp were collected. Their responses were validated from the records of antenatal cards. Data was analysed using SPSS computer program version 20. A total of 530 mothers were recruited. The overall uptake of SP IPTp was 96 % and the uptake of two SP (IPTp) doses was 86 %. Timely uptake of 1st dose was predicted by early antenatal booking, [AOR 2.59; 95 % CI 1.51-4.46; P = 0.001], and the availability of SP at the facility [AOR 4.63; 95 % CI 2.51-8.54; P discount vouchers at different gestational age and of these, less than a quarter (21.4 %) received timely. Timely receipt of discount voucher was highly predicted by early antenatal booking [AOR 200; 95 % CI 80.38-498; P discount vouchers for ITNs, timely uptake and therefore optimal protection time depended on early antenatal booking, the availability of (SP IPTp) and discount voucher at the health facility.
DEFF Research Database (Denmark)
Tafur Monroy, Idelfonso
2016-01-01
Terahertz wireless communications is expected to offer the required high capacity and low latency performance required from short-range wireless access and control applications. We present an overview of some the activities in this area in the newly started H2020 ITN project CELTA: convergence of...... of electronics and photonics technologies enabling Terahertz applications...
Aufbau von regionalen Schülerforschungszentren Berichte und Praxisempfehlungen
Bayatloo, Annabel
2013-01-01
Angesichts des sich verschärfenden Fachkräftemangels ist es wichtig, die vorhandenen Begabungspotenziale noch wirkungsvoller zu identifizieren und auszuschöpfen. Vor allem im Bereich von Mathematik, Informatik, Naturwissenschaft und Technik (MINT) erweist es sich als zielführend, künftig stärker auf forschendes Lernen zu setzen. Dieser pädagogische Ansatz wird auf vorbildliche Weise an Schülerforschungszentren verwirklicht. Aufgrund der Chancen für die Nachwuchsförderung, die mit diesen außerschulischen MINT-Bildungszentren verbunden sind, haben der Deutsche Industrie- und Handelskammertag (DIHK), die IHK Darmstadt, LernortLabor - Bundesverband der Schülerlabore e. V. und die Stiftung Jugend forscht e. V. gemeinsam einen Leitfaden für den „Aufbau regionaler Schülerforschungszentren“ erarbeitet. Die neue Publikation ist als Best Practice-Handreichung konzipiert und soll vor allem regionale Entscheidungsträger in die Lage versetzen, auf diesem Feld selbst aktiv zu werden und den begonnenen Pr...
Maluck, Julian; Donner, Reik V.
2017-02-01
International trade has grown considerably during the process of globalization. Complex supply chains for the production of goods have resulted in an increasingly connected International Trade Network (ITN). Traditionally, direct trade relations between industries have been regarded as mediators of supply and demand spillovers. With increasing network connectivity the question arises if higher-order relations become more important in explaining a national sector's susceptibility to supply and demand changes of its trading partner. In this study we address this question by investigating empirically to what extent the topological properties of the ITN provide information about positive correlations in the production of two industry sectors. We observe that although direct trade relations between industries serve as important indicators for correlations in the industries' value added growth, opportunities of substitution for required production inputs as well as second-order trade relations cannot be neglected. Our results contribute to a better understanding of the relation between trade and economic productivity and can serve as a basis for the improvement of crisis spreading models that evaluate contagion threats in the case of a node's failure in the ITN.
Kariuki, Simon K; Njunge, James; Muia, Ann; Muluvi, Geofrey; Gatei, Wangeci; Ter Kuile, Feiko; Terlouw, Dianne J; Hawley, William A; Phillips-Howard, Penelope A; Nahlen, Bernard L; Lindblade, Kim A; Hamel, Mary J; Slutsker, Laurence; Shi, Ya Ping
2013-08-27
Although several studies have investigated the impact of reduced malaria transmission due to insecticide-treated bed nets (ITNs) on the patterns of morbidity and mortality, there is limited information on their effect on parasite diversity. Sequencing was used to investigate the effect of ITNs on polymorphisms in two genes encoding leading Plasmodium falciparum vaccine candidate antigens, the 19 kilodalton blood stage merozoite surface protein-1 (MSP-1(19kDa)) and the Th2R and Th3R T-cell epitopes of the pre-erythrocytic stage circumsporozoite protein (CSP) in a large community-based ITN trial site in western Kenya. The number and frequency of haplotypes as well as nucleotide and haplotype diversity were compared among parasites obtained from children diversity of > 0.7. No MSP-1(19kDa) 3D7 sequence-types were detected in 1996 and the frequency was less than 4% in 2001. The CSP Th2R and Th3R domains were highly polymorphic with a total of 26 and 14 haplotypes, respectively detected in 1996 and 34 and 13 haplotypes in 2001, with an overall haplotype diversity of > 0.9 and 0.75 respectively. The frequency of the most predominant Th2R and Th3R haplotypes was 14 and 36%, respectively. The frequency of Th2R and Th3R haplotypes corresponding to the 3D7 parasite strain was less than 4% at both time points. There was no significant difference in nucleotide and haplotype diversity in parasite isolates collected at both time points. High diversity in these two genes has been maintained overtime despite marked reductions in malaria transmission due to ITNs use. The frequency of 3D7 sequence-types was very low in this area. These findings provide information that could be useful in the design of future malaria vaccines for deployment in endemic areas with high ITN coverage and in interpretation of efficacy data for malaria vaccines based on 3D7 parasite strains.
The rise of China in the International Trade Network: a community core detection approach.
Zhu, Zhen; Cerina, Federica; Chessa, Alessandro; Caldarelli, Guido; Riccaboni, Massimo
2014-01-01
Theory of complex networks proved successful in the description of a variety of complex systems ranging from biology to computer science and to economics and finance. Here we use network models to describe the evolution of a particular economic system, namely the International Trade Network (ITN). Previous studies often assume that globalization and regionalization in international trade are contradictory to each other. We re-examine the relationship between globalization and regionalization by viewing the international trade system as an interdependent complex network. We use the modularity optimization method to detect communities and community cores in the ITN during the years 1995-2011. We find rich dynamics over time both inter- and intra-communities. In particular, the Asia-Oceania community disappeared and reemerged over time along with a switch in leadership from Japan to China. We provide a multilevel description of the evolution of the network where the global dynamics (i.e., communities disappear or reemerge) and the regional dynamics (i.e., community core changes between community members) are related. Moreover, simulation results show that the global dynamics can be generated by a simple dynamic-edge-weight mechanism.
The International Trade Network: weighted network analysis and modelling
International Nuclear Information System (INIS)
Bhattacharya, K; Mukherjee, G; Manna, S S; Saramäki, J; Kaski, K
2008-01-01
Tools of the theory of critical phenomena, namely the scaling analysis and universality, are argued to be applicable to large complex web-like network structures. Using a detailed analysis of the real data of the International Trade Network we argue that the scaled link weight distribution has an approximate log-normal distribution which remains robust over a period of 53 years. Another universal feature is observed in the power-law growth of the trade strength with gross domestic product, the exponent being similar for all countries. Using the 'rich-club' coefficient measure of the weighted networks it has been shown that the size of the rich-club controlling half of the world's trade is actually shrinking. While the gravity law is known to describe well the social interactions in the static networks of population migration, international trade, etc, here for the first time we studied a non-conservative dynamical model based on the gravity law which excellently reproduced many empirical features of the ITN
Directory of Open Access Journals (Sweden)
Nina Rannharter
2017-09-01
Full Text Available Mit Metadaten versehene, digital archivierte Bilder sind aufgrund ihrer hohen Komplexität eine ständige Herausforderung für den Aufbau von Metadatenstrukturen und für das Beibehalten von adäquaten Metadatenstandards in Bilddatenbanken. Besonders bei Bildern über eine materielle Kultur zeichnet sich diese Komplexität in den diversen Ebenen ab. Zur Verdeutlichung dieser Problematik dient ein einzelnes Monument mit seiner fotographischen Dokumentation als geisteswissenschaftliches Anwendungsbeispiel aus dem Digitalen Forschungsarchiv Byzanz (DiFAB der Universität Wien. Unter der grundsätzlichen Berücksichtigung der künftigen Anforderungen und der einfachen Navigation von Metadaten beinhaltet dieser Beitrag u. a. die Herausforderungen mit den diversen analogen und digitalen Formen der Dokumentation, der historischen Geographie, der kulturspezifischen Terminologie sowie mit der kunsthistorischen Bedeutung einer exakten und unscharfen Datierung für Forschungsarchive.
Energy Technology Data Exchange (ETDEWEB)
Bernstein, W.; Bernhard, H.; Biesinger, T.; Boos, P.; Moeckel, H.; Sauer, H.
1996-12-01
In this report, the design, manufacture and construction of the low speed compressor, the build-up of the compressor test rig and the measurement technique used are described. The first measured results obtained after setting to work and the start of experimental operation on the rotational symmetry at the compressor inlet and outlet and of a flow field behind the rotor and stator of the third stage are described. The operating period of 540 hours to the end of the subject shows faultfree operation of the experimental plant. (orig./AKF) [Deutsch] Im vorliegenden Bericht werden Konstruktion, Fertigung und Aufbau des Niedergeschwindigkeitsverdichters, der Aufbau des Verdichterpruefstandes und die verwendete Messtechnik beschrieben. Die nach der Inbetriebnahme und Aufnahme des Versuchsbetriebes erhaltenen ersten Messergebnisse zur Rotationssymmetrie am Ein- und Austritt des Verdichters und von einem Stroemungsfeld hinter dem Rotor und Stator der dritten Stufe werden geschildert. Die zum Abschluss des Themas erreichte Betriebszeit von 540 Stunden weist auf einen stoerungsfreien Betrieb der Versuchsanlage hin. (orig./AKF)
Omona, Julius
2009-12-01
This textual analyses on Social marketing, Insecticide Treated Nets (ITNs) and Population Services International (PSI) were undertaken to achieve two objectives: (a) to contribute to the continuing debate and search for a better strategy for combating malaria in sub-Saharan Africa; and (b) to contribute to theory building on social marketing. The analyses revealed that Malaria has reached an epidemic proportion and despite major inroads by PSI in combating malaria on the principles of social marketing, the strategies of pricing and segmentation of the clients are not appropriate for Sub-Saharan African countries that are mired in absolute poverty where majority of the rural communities eke a living on less than a dollar per day and the health sector does not receive priority attention from policy makers and politicians. The descriptive statistics and a one sample t test for the sampled countries suggest that sub-Saharan countries have not even met the hypothesized 5% investment of their GDP on health, compared to their counterparts, the developed countries, who are all above this figure. The null hypothesis that there is no significant different between the population and the sample means of both developed and a developing country in their investments in the health sector was also tested and rejected. Though the elements in some of the existent models and theories of social marketing such as Health Belief Model, Theory of Reasoned Action, Social Cognitive Theory and Trans-theoretical Models all attempt to advocate for elimination of constraints and barriers to effective access to a service or product, PSI is adamant to these and try to generalize these principles in all contexts, including in Sub-Saharan Africa. The African scenario, where about 90% of Malaria related deaths cases in the world occur, demands more than what these theories present. Accordingly, it was concluded that however good intentioned social marketing is, in the case of ITNs in this region, it
Laser frequency standards based on gas-filled hollow-core fibres
DEFF Research Database (Denmark)
Triches, Marco
The work presented in this thesis has been developed within the Marie-Curie Initial Training Network (ITN) called Quantum Sensor Technologies and Applications (QTea), funded under the EU-FP7 program (contract-N MCITN-317485). The ITN QTea project is aimed at preparing a cohort of early-stage rese......The work presented in this thesis has been developed within the Marie-Curie Initial Training Network (ITN) called Quantum Sensor Technologies and Applications (QTea), funded under the EU-FP7 program (contract-N MCITN-317485). The ITN QTea project is aimed at preparing a cohort of early......-stage researchers for the emerging challenges in quantum technology. The scientific scope of the network is focused on the physics of modern quantum sensors for gravitational probing, rotation sensing, field probes, magnetic surface microscopy,atomic clocks and precision spectroscopy. This work naturally falls...... realization of a portable system and on the theoretical identification of the most important parameters for in-fiber gas spectroscopy applications. The scope of the project is to reduce the gap that prevents the state of the art technology from being commercialized. This thesis aims at: (a) characterizing...
Multinetwork of international trade: A commodity-specific analysis
Barigozzi, Matteo; Fagiolo, Giorgio; Garlaschelli, Diego
2010-04-01
We study the topological properties of the multinetwork of commodity-specific trade relations among world countries over the 1992-2003 period, comparing them with those of the aggregate-trade network, known in the literature as the international-trade network (ITN). We show that link-weight distributions of commodity-specific networks are extremely heterogeneous and (quasi) log normality of aggregate link-weight distribution is generated as a sheer outcome of aggregation. Commodity-specific networks also display average connectivity, clustering, and centrality levels very different from their aggregate counterpart. We also find that ITN complete connectivity is mainly achieved through the presence of many weak links that keep commodity-specific networks together and that the correlation structure existing between topological statistics within each single network is fairly robust and mimics that of the aggregate network. Finally, we employ cross-commodity correlations between link weights to build hierarchies of commodities. Our results suggest that on the top of a relatively time-invariant “intrinsic” taxonomy (based on inherent between-commodity similarities), the roles played by different commodities in the ITN have become more and more dissimilar, possibly as the result of an increased trade specialization. Our approach is general and can be used to characterize any multinetwork emerging as a nontrivial aggregation of several interdependent layers.
Energy and angular dependence of the personal dosemeter in use at ITN-DPRSN
Energy Technology Data Exchange (ETDEWEB)
Alves, Joao G. [Departamento de Proteccao Radiologica e Seguranca Nuclear, Instituto Tecnologico e Nuclear, EN 10, 2686-953 Sacavem (Portugal)], E-mail: jgalves@itn.pt; Calado, Ana M.; Cardoso, Joao V.; Santos, Luis M. [Departamento de Proteccao Radiologica e Seguranca Nuclear, Instituto Tecnologico e Nuclear, EN 10, 2686-953 Sacavem (Portugal)
2008-02-15
In this paper the characterization of the dosimetry system and of the personal dosemeter in terms of the stability of the reader calibration factors and of the linearity of the response for the 137Cs reference radiation is presented. The energy and angular dependence of the whole body dosemeter are also shown. The energy dependence was determined performing irradiations with the X-ray narrow series beams N30, N40, N60, N80, N100, N120 and with the gamma reference radiations of 137Cs and 60Co [ISO 4037-1, 1996. X and Gamma Reference Radiation for Calibrating Dosemeters and Doserate Meters and for Determining Their Response as a Function of Photon Energy-Part 1: Radiation Characteristics and Production Methods. International Organization for Standardization, Geneva] in terms of Hp(10) incident on the ISO water slab phantom. The angular dependence of the dosemeter was determined for the angles 0 deg., {+-}20 deg., {+-}40 deg. and {+-}60 deg. with normal using the above mentioned radiation fields. All irradiations were performed at the Laboratorio de Metrologia das Radiacoes lonizantes of ITN-DPRSN. The experiments presented in this paper show the thermoluminescence dosimetry (TLD) system is stable and presents a linear behaviour over and extended dose range. The measurements allowed the determination of the energy dependence at normal incidence and of the angular dependence of the dosemeter currently in use. Further studies are being carried out in order to implement correction factors for supralinearity and low energy measurements.
Strategies to increase the ownership and use of insecticide-treated bednets to prevent malaria.
Augustincic Polec, Lana; Petkovic, Jennifer; Welch, Vivian; Ueffing, Erin; Tanjong Ghogomu, Elizabeth; Pardo Pardo, Jordi; Grabowsky, Mark; Attaran, Amir; Wells, George A; Tugwell, Peter
2015-03-30
Malaria is a life-threatening parasitic disease and 40% of the world's population lives in areas affected by malaria. Insecticide-treated bednets (ITNs) effectively prevent malaria, however, barriers to their use have been identified. To assess the evidence on the effectiveness of available strategies that focus on delivery and appropriate use of ITNs. We searched the EPOC Register of Studies, CENTRAL, MEDLINE, EMBASE, HealthStar, CINAHL, PubMed, Science Citation Index, ProQuest Dissertations and Theses, African Index Medicus (AIM), World Health Organization Library and Information Networks for Knowledge (WHOLIS), LILACS, Virtual Health Library (VHL), and the World Health Organization Library Information System (WHOLIS). Initial searches were conducted in May 2011, updated in March 2012 and February 2013. Authors contacted organizations and individuals involved in ITN distribution programs or research to identify current initiatives, studies or unpublished data, and searched reference lists of relevant reviews and studies. Randomized controlled trials, non-randomized controlled trials, controlled before-after studies, and interrupted time series evaluating interventions focused on increasing ITN ownership and use were considered. The populations of interest were individuals in malaria-endemic areas. Two authors independently screened studies to be included. They extracted data from the selected studies and assessed the risk of bias. When consensus was not reached, any disagreements were discussed with a third author. The magnitude of effect and quality of evidence for each outcome was assessed. Of the 3032 records identified, 10 studies were included in this review. Effect of ITN cost on ownership:Four studies including 4566 households and another study comprising 424 participants evaluated the effect of ITN price on ownership. These studies suggest that providing free ITNs probably increases ITN ownership when compared to subsidized ITNs or ITNs offered at full
Pišút, Peter; Břízová, Eva; Čejka, Tomáš; Pipík, Radovan
2010-12-01
Žitný ostrov, the largest island of the Danube River (SW Slovakia) gained its present shape in the Neoholocene period. As a result of increased flood and geomorphological Danube river activity dated to 1378-1528 AD, the Lower Dudváh River was abandoned and its alluvium became a part of the Žitný ostrov. Study of a Dudváh terrestrialized paleomeander by means of pollen and macrofossil analysis provides new information about the paleoenvironments of the Danubian Plain. The meander under study was cut-off during the Sub-Boreal period when the land was mostly covered by oak-dominated mixed forest with a notable high frequency of Fagus and Abies. In low-lying depressions, Alnus glutinosa formed typical alder carrs. The largest decline of the mixed forest occurred during the Sub-Atlantic period. Until the mid-19th century the region was strongly influenced by shallow groundwater and periodical floods, as reflected by pollen of aquatics and marsh species. Amongst non-arboreal taxa, pollen of Cyperaceae, Brassicaceae/Cuscuta, Poaceae and Apiaceae prevailed. Local successional changes started with i) stage of abandoned oxbow still with influx of moving water, poor in both macrophytes and molluscs, ii) shallow eutrophic oxbow lake with slowly flowing or stagnant water overgrown with aquatics (Ranunculus subgen. Batrachium, Potamogeton sp., Ceratophyllum demersum etc.) and abundant molluscs, iii) an open marsh dominated by Cyperaceae (mainly Carex riparia) with Atriplex prostrata, supporting diverse molluscan and Ostracod fauna. Present-day habitat is a result of landscape changes, which have been associated with draining, intensified agriculture, ruderalisation and spread of invasive species.
Sedlmayr, Richard; Fink, Günther; Miller, John M; Earle, Duncan; Steketee, Richard W
2013-03-18
Relatively few programmes have attempted to actively engage the private sector in national malaria control efforts. This paper evaluates the health impact of a large-scale distribution of insecticide-treated nets (ITNs) conducted in partnership with a Zambian agribusiness, and its cost-effectiveness from the perspective of the National Malaria Control Programme (NMCP). The study was designed as a cluster-randomized controlled trial. A list of 81,597 cotton farmers was obtained from Dunavant, a contract farming company in Zambia's cotton sector, in December 2010. 39,963 (49%) were randomly selected to obtain one ITN each. Follow-up interviews were conducted with 438 farmers in the treatment and 458 farmers in the control group in June and July 2011. Treatment and control households were compared with respect to bed net ownership, bed net usage, self-reported fever, and self-reported confirmed malaria. Cost data was collected throughout the programme. The distribution effectively reached target beneficiaries, with approximately 95% of households in the treatment group reporting that they had received an ITN through the programme. The average increase in the fraction of household members sleeping under an ITN the night prior to the interview was 14.6 percentage points (p-value US$ per ITN to Zambia's NMCP. The results illustrate that existing private sector networks can efficiently control malaria in remote rural regions. The intra-household allocation of ITNs distributed through this channel was comparable to that of ITNs received from other sources, and the health impact remained substantial.
Potential Vorticity Analysis of Low Level Thunderstorm Dynamics in an Idealized Supercell Simulation
2009-03-01
Johns, R.H., and C.A. Doswell, 1992: Severe local storms forecasting. Wea. Forecasting, 7, 588–612. Johns, R.A., J.A. Hart, 1993: Differentiating ...111-123 Kleinschmidt, E., 1950a: Uber Aufbau und Entstehung von Zyklonen (1. Teil). Met. Runds., 3, 1-6. Kleinschmidt, E., 1950b: Uber Aufbau...und Entstehung von Zyklonen (2. Teil). Met. Runds., 3, 54-61. Kleinschmidt, E., 1951: Uber Aufbau und Entstehung von Zyklonen (3. Teil). Met
U.S. Department of Health & Human Services — The immune tolerance data management and visualization portal for studies sponsored by the Immune Tolerance Network (ITN) and collaborating investigators. Data from...
Integrated travel network model for studying epidemics: Interplay between journeys and epidemic
Ruan, Zhongyuan; Wang, Chaoqing; Ming Hui, Pak; Liu, Zonghua
2015-06-01
The ease of travelling between cities has contributed much to globalization. Yet, it poses a threat on epidemic outbreaks. It is of great importance for network science and health control to understand the impact of frequent journeys on epidemics. We stress that a new framework of modelling that takes a traveller’s viewpoint is needed. Such integrated travel network (ITN) model should incorporate the diversity among links as dictated by the distances between cities and different speeds of different modes of transportation, diversity among nodes as dictated by the population and the ease of travelling due to infrastructures and economic development of a city, and round-trip journeys to targeted destinations via the paths of shortest travel times typical of human journeys. An example is constructed for 116 cities in China with populations over one million that are connected by high-speed train services and highways. Epidemic spread on the constructed network is studied. It is revealed both numerically and theoretically that the traveling speed and frequency are important factors of epidemic spreading. Depending on the infection rate, increasing the traveling speed would result in either an enhanced or suppressed epidemic, while increasing the traveling frequency enhances the epidemic spreading.
Determinants of insecticide-treated net ownership and utilization among pregnant women in Nigeria
Directory of Open Access Journals (Sweden)
Ankomah Augustine
2012-02-01
Full Text Available Abstract Background Malaria during pregnancy is a major public health problem in Nigeria leading to increase in the risk of maternal mortality, low birth weight and infant mortality. This paper is aimed at highlighting key predictors of the ownership of insecticide treated nets (ITNs and its use among pregnant women in Nigeria. Methods A total of 2348 pregnant women were selected by a multi-stage probability sampling technique. Structured interview schedule was used to elicit information on socio-demographic characteristics, ITN ownership, use, knowledge, behaviour and practices. Logistic regression was used to detect predictors of two indicators: ITN ownership, and ITN use in pregnancy among those who owned ITNs. Results ITN ownership was low; only 28.8% owned ITNs. Key predictors of ITN ownership included women who knew that ITNs prevent malaria (OR = 3.85; p p = 0.003. The use of ITNs was equally low with only 7.5% of all pregnant women, and 25.7% of all pregnant women who owned ITNs sleeping under a net. The predictors of ITN use in pregnancy among women who owned ITNs (N = 677 identified by logistic regression were: urban residence (OR = 1.87; p = 0.001; knowledge that ITNs prevent malaria (OR = 2.93; p p = 0.036. Educational level was not significantly related to any of the two outcome variables. Although registration at ANC is significantly associated with ownership of a bednet (perhaps through free ITN distribution this does not translate to significant use of ITNs. Conclusions ITN use lagged well behind ITN ownership. This seems to suggest that the current mass distribution of ITNs at antenatal facilities and community levels may not necessarily lead to use unless it is accompanied by behaviour change interventions that address the community level perceptions, misconceptions and positively position ITN as an effective prevention device to prevent malaria
Gas network simulations of the regional utility GVT; Gasnetzsimulation des Regionalgasversorgers GVT
Energy Technology Data Exchange (ETDEWEB)
Schacht, W. [Gasversorgung Thueringen GmbH (GVT), Erfurt (Germany)
2000-07-01
At the turn of the millenium, the German gas industry is faced with new challenges, e.g. the European single market, energy political boundary conditions, deregulation and increased competition. Flexibility, new marketing concepts and higher profitability are key concerns. Optimisation of gas supply can only be ensured by dynamic gas network simulation which also provide information on the current state of gas flow in the network. [German] Zum Beginn des neuen Jahrtausends steht die Erdgaswirtschaft in Deutschland vor voellig neuen Herausforderungen. Der EU-Binnenmarkt, die neuen energiepolitischen Rahmenbedingungen, die Oeffnung und Liberalisierung der Energiemaerkte und die damit im Zusammenhang stehende Verschaerfung des Gas-zu-Gas-Wettbewerbes zwingen zu einer hoeheren Flexibilitaet, zur Einfuehrung neuer Marketingkonzepte und zu einer weiteren Erhoehung der Rentabilitaet unserer Versorgungsunternehmen durch Nutzung von neuen oder noch nicht ausgeschoepften Kosteneinsparungspotentialen. Eine wichtige Voraussetzung fuer den Aufbau einer modernen Gasbezugsoptimierung ist die prozessbegleitende dynamische Gasnetzsimulation. Ausserdem setzen moderne Verfahren der Netzsteuerung derartige Kenntnisse ueber den aktuellen Stroemungszustand im Netz voraus. Mit den im Simulationssystem vorhandenen Zustandsbeobachtern koennen die gewonnenen Aussagen gestuetzt und praezisiert werden. Mit Blick auf die neue Marktordnung gewinnt die online Gasnetzsimulation noch zusaetzlich an Bedeutung. Aus der zeitlichen Entkopplung von Menge und Preis, der Durchleitung sowie der Speicherung und des effektiven Einsatzes von Spottmengen leiten sich voellig neue Aufgaben ab, die operativ nur mit Hilfe einer qualitativ neuen Leittechnik und einer online Gasnetzsimulation geloest werden koennen. Werden diese Aufgaben nicht adaequat geloest, steigt das wirtschaftliche Risiko eklatant an. (orig.)
A jolly good call for Marie Curie Fellows
2009-01-01
A new funding opportunity to train young researchers has just been announced by the European Commission. One of the calls within FP7 Marie Curie Actions requests proposals for Initial Training Network (ITN) projects, with a deadline of 22 December 2009. Project proposals are strongly encouraged at CERN and authors can receive support and guidance from the Marie Curie Steering Group. Winnie Wong: "I wouldn’t have considered a PhD if I hadn’t been a Marie Curie fellow" Dan Savu: "It’s the best of both worlds: training plus working in an international organisation" ITN projects have one key aim: training. Academic and industrial partners work together to form a network to recruit and train Marie Curie Fellows. Fellows are young researchers (typically PhD-level) from any country who combine project-based research with tailor-made training programmes, ...
ENLIGHT: European network for Light ion hadron therapy.
Dosanjh, Manjit; Amaldi, Ugo; Mayer, Ramona; Poetter, Richard
2018-04-03
The European Network for Light Ion Hadron Therapy (ENLIGHT) was established in 2002 following various European particle therapy network initiatives during the 1980s and 1990s (e.g. EORTC task group, EULIMA/PIMMS accelerator design). ENLIGHT started its work on major topics related to hadron therapy (HT), such as patient selection, clinical trials, technology, radiobiology, imaging and health economics. It was initiated through CERN and ESTRO and dealt with various disciplines such as (medical) physics and engineering, radiation biology and radiation oncology. ENLIGHT was funded until 2005 through the EC FP5 programme. A regular annual meeting structure was started in 2002 and continues until today bringing together the various disciplines and projects and institutions in the field of HT at different European places for regular exchange of information on best practices and research and development. Starting in 2006 ENLIGHT coordination was continued through CERN in collaboration with ESTRO and other partners involved in HT. Major projects within the EC FP7 programme (2008-2014) were launched for R&D and transnational access (ULICE, ENVISION) and education and training networks (Marie Curie ITNs: PARTNER, ENTERVISION). These projects were instrumental for the strengthening of the field of hadron therapy. With the start of 4 European carbon ion and proton centres and the upcoming numerous European proton therapy centres, the future scope of ENLIGHT will focus on strengthening current and developing European particle therapy research, multidisciplinary education and training and general R&D in technology and biology with annual meetings and a continuously strong CERN support. Collaboration with the European Particle Therapy Network (EPTN) and other similar networks will be pursued. Copyright © 2018 CERN. Published by Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Alves, J.G.; Novais, I.; Rangel, S.; Flores, E. [Instituto Tecnologico e Nuclear, Dept. de Proteccao Radiologica e Seguranca Nuclear Estrada Nacional, Sacavem (Portugal)
2006-07-01
The Individual Monitoring Service (I.M.S.) of the Departamento de Proteccao Radiologica e Seguranca Nuclear (D.P.R.S.N.) at the Instituto Tecnologico e Nuclear (I.T.N.) in Portugal operates a thermoluminescence dosimetry system to monitor approximately 3,000 workers for external radiation exposure on a monthly basis. The workers come from nearly 230 facilities in the medical, research and conventional industry fields of activity and almost 85% of the people monitored in 2005 are from medical facilities. The TLD system in use is based on two Harshaw 6600 automatic readers and on the Harshaw 8814 T.L. card and holder containing two detector elements of LiF:Mg,Ti (TLD-100) for the evaluation of Hp(10) and Hp(0.07). All the workers are monitored on a monthly basis using whole body dosemeters. The I.M.S. has implemented a Quality Assurance and Quality Control (Q.A./Q.C.) programme that covers all the aspects of monitoring, from the monitoring request of a customer to the final issue of a dose report. The main aspects of the Q.A./Q.C. programme implemented at the I.M.S. will be presented in this paper using fluxograms and schemes. Several issues will be addressed, e.g., administrative procedures, technical procedures, dealing with complaints, training of staff, etc. The relationship of the I.M.S. with external entities like the customer, the regulatory authority, the central dose registry, the calibration facility, suppliers, maintenance providers, etc. will be mentioned on the administrative procedures described as well as on the technical procedures where applicable. The main technical procedures will be presented in this paper and references will be made to a TLD Quality Control database internally developed and designed for the storage of important Q.C. parameters like the element correction coefficients, reader calibration factors, electronic quality control data generated on a daily basis, and the study of their evolution with time. (author)
International Nuclear Information System (INIS)
Alves, J.G.; Novais, I.; Rangel, S.; Flores, E.
2006-01-01
The Individual Monitoring Service (I.M.S.) of the Departamento de Proteccao Radiologica e Seguranca Nuclear (D.P.R.S.N.) at the Instituto Tecnologico e Nuclear (I.T.N.) in Portugal operates a thermoluminescence dosimetry system to monitor approximately 3,000 workers for external radiation exposure on a monthly basis. The workers come from nearly 230 facilities in the medical, research and conventional industry fields of activity and almost 85% of the people monitored in 2005 are from medical facilities. The TLD system in use is based on two Harshaw 6600 automatic readers and on the Harshaw 8814 T.L. card and holder containing two detector elements of LiF:Mg,Ti (TLD-100) for the evaluation of Hp(10) and Hp(0.07). All the workers are monitored on a monthly basis using whole body dosemeters. The I.M.S. has implemented a Quality Assurance and Quality Control (Q.A./Q.C.) programme that covers all the aspects of monitoring, from the monitoring request of a customer to the final issue of a dose report. The main aspects of the Q.A./Q.C. programme implemented at the I.M.S. will be presented in this paper using fluxograms and schemes. Several issues will be addressed, e.g., administrative procedures, technical procedures, dealing with complaints, training of staff, etc. The relationship of the I.M.S. with external entities like the customer, the regulatory authority, the central dose registry, the calibration facility, suppliers, maintenance providers, etc. will be mentioned on the administrative procedures described as well as on the technical procedures where applicable. The main technical procedures will be presented in this paper and references will be made to a TLD Quality Control database internally developed and designed for the storage of important Q.C. parameters like the element correction coefficients, reader calibration factors, electronic quality control data generated on a daily basis, and the study of their evolution with time. (author)
Honjo, Keita; Satake, Akiko
2014-02-07
Many governmental and non-governmental organizations have distributed insecticide-treated nets (ITNs) to malaria endemic areas, which contributed to the reduction of malaria deaths. However, some people in malaria endemic areas used ITNs for alternative purposes such as fishery and agriculture. It is unclear why people threatened by malaria misuse ITNs. Here we develop a N-player mosquito net game, and theoretically show that the misuse of ITNs might be underpinned by individual and social rationality. In the mosquito net game, each player uses ITNs for malaria prevention or alternative purposes. The proper ITN use decreases the probability of malaria infection, while the improper ITN use increases the player's labor productivity. Each player's expected payoff is influenced by other players' strategies. We found that the misuse of ITNs can be a Pareto efficient Nash equilibrium. The maximum number of players using ITNs for malaria prevention is limited by insecticidal effectiveness of ITNs and extra income from ITN misuse. Furthermore, we found that players in a low-income community are attracted to the misuse of ITNs even if the probability of malaria infection is high. Introduction of a tax on ITN misuse was shown to be effective to motivate the players to use ITNs for malaria prevention. Our results demonstrate that understanding decision making of people in malaria endemic areas is essential to design more effective malaria control programs. © 2013 Published by Elsevier Ltd. All rights reserved.
2010-01-01
Background Scaling up insecticide-treated mosquito net (ITN) coverage is a key malaria control strategy even in conflict-affected countries [1,2]. Socio-economic factors influence access to ITNs whether subsidized or provided free to users. This study examines reported ITN purchasing, coverage, and usage in eastern Afghanistan and explores women's access to health information during the Taliban regime (1996-2001). This strengthens the knowledge base on household-level health choices in complex-emergency settings. Methods Fifteen focus group discussions (FGDs) and thirty in-depth interviews were conducted with men and women from ITN-owning and non-owning households. FGDs included rank ordering, pile sorting and focused discussion of malaria knowledge and ITN purchasing. Interviews explored general health issues, prevention and treatment practices, and women's malaria knowledge and concerns. Seven key informant interviews with health-related workers and a concurrent survey of 200 ITN-owning and 214 non-owning households were used to clarify or quantify findings. Results Malaria knowledge was similar among men and women and ITN owners and non-owners. Women reported obtaining health information through a variety of sources including clinic staff, their husbands who had easier access to information, and particularly female peers. Most participants considered ITNs very desirable, though not usually household necessities. ITN owners reported more household assets than non-owners. Male ITN owners and non-owners ranked rugs and ITNs as most desired, while women ranked personal assets such as jewellery highest. While men were primarily responsible for household decision-making and purchasing, older women exerted considerable influence. Widow-led and landless households reported most difficulties purchasing ITNs. Most participants wanted to buy ITNs only if they could cover all household members. When not possible, preferential usage was given to women and children
Kilian, Albert; Koenker, Hannah; Baba, Ebenezer; Onyefunafoa, Emmanuel O; Selby, Richmond A; Lokko, Kojo; Lynch, Matthew
2013-09-10
Until recently only two indicators were used to evaluate malaria prevention with insecticide-treated nets (ITN): "proportion of households with any ITN" and "proportion of the population using an ITN last night". This study explores the potential of the expanded set of indicators recommended by the Roll Back Malaria Monitoring and Evaluation Reference Group (MERG) for comprehensive analysis of universal coverage with ITN by applying them to the Nigeria 2010 Malaria Indicator Survey data. The two additional indicators of "proportion of households with at least one ITN for every two people" and "proportion of population with access to an ITN within the household" were calculated as recommended by MERG. Based on the estimates for each of the four ITN indicators three gaps were calculated: i) households with no ITN, ii) households with any but not enough ITN, iii) population with access to ITN not using it. In addition, coverage with at least one ITN at community level was explored by applying Lot Quality Assurance Sampling (LQAS) decision rules to the cluster level of the data. All outcomes were analysed by household background characteristics and whether an ITN campaign had recently been done. While the proportion of households with any ITN was only 42% overall, it was 75% in areas with a recent mass campaign and in these areas 66% of communities had coverage of 80% or better. However, the campaigns left a considerable intra-household ownership gap with 66% of households with any ITN not having enough for every family member. In contrast, the analysis comparing actual against potential use showed that ITN utilization was good overall with only 19% of people with access not using the ITN, but with a significant difference between the North, where use was excellent (use gap 11%), and the South (use gap 36%) indicating the need for enhanced behaviour change communication. The expanded ITN indicators to assess universal coverage provide strong tools for a comprehensive
Energy Technology Data Exchange (ETDEWEB)
Pflaum, H.; Guderian, J.; Kuemmel, R. [UMSICHT, Inst. fuer Umwelt-, Sicherheits- und Energietechnik e.V., Oberhausen (Germany)
1997-09-01
liegt zum einen daran, dass kein gesetzlicher Auftrag zur Implementierung eines BUIS besteht. Zum anderen existiert kaum eine konsensfaehige, theoretisch fundierte Definition fuer Anforderungen und strukturellen Aufbau eines BUIS. Dieses Problem hat dazu gefuehrt, dass in Unternehmen oft ueberstuerzt ineffiziente Inselloesungen implementiert werden. Vor dem Hintergrund eines praezisierten Anforderungsprofils an ein BUIS werden Betrachtungen zur Unternehmensumwelt, zum Zielsystem von Unternehmen und zur organisatorischen Einbindung von Umweltschutzaufgaben angestellt. Durch Operationalisierung in typische Funktionsbereiche koennen ein grobes Unternehmensmodell entwickelt, Informationsfluesse analysiert und umweltrelevante Informationen sowie ihre Wege selektiert werden. Aus diesen Grundlagen laesst sich die Systemarchitektur (Struktur und Organisation) fuer ein BUIS entwickeln, dessen praktische Umsetzung schliesslich durch einen Zehn-Punkte-Plan unterstuetzt wird. Dabei werden vorhandene EDV-Loesungen bewusst nicht beruecksichtigt, um die Allgemeingueltigkeit der Systemarchitektur sicherzustellen, Handlungsspielraeume zu schaffen und Kreativitaetspotentiale zu entdecken. Das vorgestellte Entwicklungskonzept fuer ein BUIS bedarf nun der Umsetzung in die betriebliche Praxis, d.h. der Anpassung, Ausfuellung und Verknuepfung von Systemelementen auf Grundlage unternehmensspezifischer Rahmenbedingungen. (orig.)
Directory of Open Access Journals (Sweden)
Kindie Fentahun Muchie
2017-11-01
Full Text Available Abstract Background Malaria is the leading cause of disease burden across the world, especially in African countries. Ethiopia has designed a five year (2011–2015 plan to cover 100% of the households in malarious areas with one insecticide treated net (ITN for every two persons, and to raise consistent ITN utilization to at least 80%. However, evidence on ownership of ITN among malarious rural households in northwest Ethiopia is quite limited. Hence, the present study aimed at assessing ownership of ITN and associated factors among rural households at risk of malaria at Dabat Health and Demographic Surveillance System site, northwest Ethiopia. Methods A cross sectional re-census was carried out in Dabat Health and Demographic Surveillance System site during peak malaria seasons from October to December, 2014. Data for 15,088 households at Dabat Health and Demographic Surveillance System site were used for the analysis. Descriptive measures and binary logistic regression were carried out. Results Among those who owned at least one ITN, 53.4% were living at an altitude >2500 m above sea level. However, out of households living at an altitude <2000 m above sea level, 15.8% (95% CI 14.4%, 17.3% owned ITN at an average of 4.3 ± 2.1 persons per ITN. Of these, 69.5% (95% CI 64.7%, 74.1% used the ITN. Among utilizing households at malarious areas, 23.7% prioritized pregnant women and 31.4% children to use ITN. The availability of radio receiver/mobile (AOR 1.60, 95%CI 1.08, 2.35 and secondary/above educational status of household member (AOR 1.54, 95%CI 1.19, 2.04 were predictors of ownership of ITN. Conclusion Rural households at risk of malaria did not own a sufficient number of ITN though the utilization is promising. Moreover, prioritizing children and pregnant women to sleep under ITN remains public health problems. Programmers, partners and implementers should consider tailored intervention strategy stratified by altitude in distributing
Le Menach, Arnaud; Takala, Shannon; McKenzie, F Ellis; Perisse, Andre; Harris, Anthony; Flahault, Antoine; Smith, David L
2007-01-25
Insecticide Treated Nets (ITNs) are an important tool for malaria control. ITNs are effective because they work on several parts of the mosquito feeding cycle, including both adult killing and repelling effects. Using an elaborated description of the classic feeding cycle model, simple formulas have been derived to describe how ITNs change mosquito behaviour and the intensity of malaria transmission, as summarized by vectorial capacity and EIR. The predicted changes are illustrated as a function of the frequency of ITN use for four different vector populations using parameter estimates from the literature. The model demonstrates that ITNs simultaneously reduce mosquitoes' lifespans, lengthen the feeding cycle, and by discouraging human biting divert more bites onto non-human hosts. ITNs can substantially reduce vectorial capacity through small changes to all of these quantities. The total reductions in vectorial capacity differ, moreover, depending on baseline behavior in the absence of ITNs. Reductions in lifespan and vectorial capacity are strongest for vector species with high baseline survival. Anthropophilic and zoophilic species are affected differently by ITNs; the feeding cycle is lengthened more for anthrophilic species, and the proportion of bites that are diverted onto non-human hosts is higher for zoophilic species. This model suggests that the efficacy of ITNs should be measured as a total reduction in transmission intensity, and that the quantitative effects will differ by species and by transmission intensity. At very high rates of ITN use, ITNs can generate large reductions in transmission intensity that could provide very large reductions in transmission intensity, and effective malaria control in some areas, especially when used in combination with other control measures. At high EIR, ITNs will probably not substantially reduce the parasite rate, but when transmission intensity is low, reductions in vectorial capacity combine with reductions in
Diabaté, Souleymane; Druetz, Thomas; Bonnet, Emmanuel; Kouanda, Seni; Ridde, Valéry; Haddad, Slim
2014-09-04
Periodic mass distributions contribute significantly to universal access to insecticide-treated nets (ITNs). However, due to the limited number of nets distributed, needs remain unsatisfied, particularly in large households. This study was conducted in Kaya health district following the 2010 mass distribution of ITNs in Burkina Faso. Data were collected on the socio-economic and geo-spatial characteristics and ITN possession and utilization levels of 2,004 households. The study explored: 1) ITN access, in terms of intra-household saturation with ITNs (households with at least one ITN for every two members) correctly installed and in very good physical condition; and 2) factors influencing the decision to place under-five children under a net. Particular attention was given to vector control activities undertaken by mothers. Of the 2,004 households, 90% possessed at least one ITN. However, intra-household saturation with ITNs was below 60% in small households and below 20% in large ones (>6 members). Crude proportion ratios comparing possession and levels of intra-household saturation with ITNs varied between 1.5 (small households) and 7.8 (large households). The proportions of households with ITNs for every two members that were correctly hung or in very good physical condition ranged from 0% to 6.5% in large households and 27.8% to 40.7% in small ones. ITN use to protect under-five children was lower in large households; it was significantly higher when there was at least one ITN for every two members. In large households, it was significantly higher when a child had experienced an episode of any illness in the previous two weeks and when the mother had taken actions to control vector proliferation. In small households, ITN use was significantly higher in families with agricultural land and children aged 12-23 months. Ownership rates were high, but real access to bed nets remained limited. The allocation process disadvantages large families. Real access to bed
Muchie, Kindie Fentahun; Alemu, Kassahun; Tariku, Amare; Tsegaye, Adino Tesfahun; Abebe, Solomon Mekonnen; Yitayal, Mezgebu; Awoke, Tadesse; Biks, Gashaw Andargie
2017-11-21
Malaria is the leading cause of disease burden across the world, especially in African countries. Ethiopia has designed a five year (2011-2015) plan to cover 100% of the households in malarious areas with one insecticide treated net (ITN) for every two persons, and to raise consistent ITN utilization to at least 80%. However, evidence on ownership of ITN among malarious rural households in northwest Ethiopia is quite limited. Hence, the present study aimed at assessing ownership of ITN and associated factors among rural households at risk of malaria at Dabat Health and Demographic Surveillance System site, northwest Ethiopia. A cross sectional re-census was carried out in Dabat Health and Demographic Surveillance System site during peak malaria seasons from October to December, 2014. Data for 15,088 households at Dabat Health and Demographic Surveillance System site were used for the analysis. Descriptive measures and binary logistic regression were carried out. Among those who owned at least one ITN, 53.4% were living at an altitude >2500 m above sea level. However, out of households living at an altitude ownership of ITN. Rural households at risk of malaria did not own a sufficient number of ITN though the utilization is promising. Moreover, prioritizing children and pregnant women to sleep under ITN remains public health problems. Programmers, partners and implementers should consider tailored intervention strategy stratified by altitude in distributing ITN. ITN distribution should also be accompanied by using exhaustive promotion strategies that consider people without access to any source of information, and educating households to prioritize pregnant and under five children to sleep under ITN.
Directory of Open Access Journals (Sweden)
Joseph N. Inungu
2017-01-01
Full Text Available Background. Insecticide-treated mosquito nets (ITNs are one of the most effective tools for preventing malaria in sub-Saharan Africa. Objective. This study examined knowledge, attitude, and practice on the use of ITNs in the prevention of malaria among pregnant women and guardians of children under five in the Democratic Republic of the Congo. Methods. A total of 5,138 pregnant women and guardians of children under five were interviewed. Results. The majority of participants (>80% knew the signs and symptoms of malaria; 81.6% reported having an ITN in the household, but 78.4% reported using it the night before the interview. Only 71.4% of pregnant women used ITN the night compared to 68.2% of children under five. In the Logistic Regression model, women who believed that it is normal to use ITNs were 1.9 times more likely to use it than those who did not (OR: 1.930; women who were confident in their abilities to use ITNs were 1.9 times more likely than those who were not confident (OR: 1.915; and women who had a good attitude towards ITNs were also more likely to use ITNs compared to those who did not (OR: 1.529. Conclusion. New and innovative evidence-based behavior change interventions are needed to increase the utilization of ITNs among vulnerable groups.
Directory of Open Access Journals (Sweden)
Hanson Kara
2004-03-01
Full Text Available Abstract Objective To explore the equity implications of insecticide-treated nets (ITN distribution programmes that are based on user charges. Methods A questionnaire was used to collect information on previous purchase of untreated nets and hypothetical willingness to pay (WTP for ITNs from a random sample of householders. A second survey was conducted one month later to collect information on actual purchases of ITNs. An economic status index was used for characterizing inequity. Major findings The lower economic status quintiles were less likely to have previously purchased untreated nets and also had a lower hypothetical and actual WTP for ITNs. Conclusion ITN distribution programmes need to take account of the diversity in WTP for ITNs if they are to ensure equity in access to the nets. This could form part of the overall poverty reduction strategy.
Salomão, Cristolde; Sacarlal, Jahit; Gudo, Eduardo Samo
2017-05-25
Malaria during pregnancy is associated with poor maternal and pregnancy outcome and the World Health Organization recommends the administration of intermittent preventive treatment in pregnancy (IPTp) with sulfadoxine-pyrimethamine (SP) and distribution of insecticide-treated mosquito nets (ITNs) to all pregnant women attending antenatal care (ANC) services. This study was conducted with the aim to assess the uptake of IPTp and ITNs in pregnant women attending ANC services and correlate with ANC attendance and frequency of stock-outs in 22 health facilities Mozambique. A cross-sectional study was conducted between July and December 2011 in 22 health units in 11 districts situated in 11 provinces in Mozambique. Two health facilities were selected per district (one urban and one rural). Data were collected by reviewing logbooks of antenatal consultations as well as from monthly district reports. During the period under investigation, a total of 23,524 pregnant women attended their 1st antenatal care visits, of which 12,775 (54.3%) and 7581 (32.2%) received one and two doses of IPTp, respectively. In regard to ITNs, a total of 16,436 (69.9%) pregnant women received ITNs. Uptake of IPTp and ITNs by pregnant women at ANC services was higher in southern Mozambique and lower in districts situated in the northern part of the country. Stock-outs of SP and ITNs were reported in 50.0% (11/22) and 54.5% (12/22) of the health facilities, respectively. Coverage of IPTp and ITN in health facilities with stock-outs of SP and ITNs was much lower as compared to health facilities with no stock-outs. Altogether, data from this study shows that coverage of the 2nd dose of IPTp, as well as ITNs, was low in pregnant women attending ANC services in Mozambique. In addition, this data also shows that stock-outs of SP and ITNs were frequent and led to lower coverage of IPTp and ITN, representing a serious barrier for the accomplishment of targets. In conclusion, this study recommends that
Directory of Open Access Journals (Sweden)
Philippa A West
Full Text Available Insecticide treated nets (ITNs and indoor residual spraying (IRS are effective vector control tools that protect against malaria. There is conflicting evidence regarding whether using ITNs and IRS in combination provides additional benefit over using either of these methods alone. This study investigated factors that may modify the effect of the combined use of IRS and ITNs compared to using ITNs alone on malaria infection prevalence.Secondary analysis was carried out on data from a cluster randomised trial in north-west Tanzania. 50 clusters received ITNs from a universal coverage campaign; of these 25 were randomly allocated to additionally receive two rounds of IRS in 2012. In cross-sectional household surveys children 0.5-14 years old were tested for Plasmodium falciparum infections (PfPR two, six and ten months after the first IRS round.IRS protected those sleeping under nets (OR = 0.38, 95%CI 0.26-0.57 and those who did not (OR = 0.43, 95%CI 0.29-0.63. The protective effect of IRS was not modified by community level ITN use (ITN use = 50%, OR = 0.46, 95%CI 0.28-0.74. The additional protection from IRS was similar in low (<10% PfPR, OR = 0.38, 95%CI 0.19-0.75 and high transmission areas (≥10% PfPR, OR = 0.34, 95%CI 0.18-0.67. ITN use was protective at the individual-level regardless of whether the village had been sprayed (OR = 0.83, 95%CI 0.70-0.98. Living in a sprayed village was protective regardless of whether the individual slept under an ITN last night (OR = 0.41, 95%CI 0.29-0.58.Implementing IRS in addition to ITNs was beneficial for individuals from villages with a wide range of transmission intensities and net utilisation levels. Net users received additional protection from IRS. ITNs were providing some individual protection, even in this area with high levels of pyrethroid insecticide resistance. These results demonstrate that there is a supplementary benefit of IRS even when ITNs are effective.ClinicalTrials.gov NCT01697852.
Gingrich, Chris D; Hanson, Kara; Marchant, Tanya; Mulligan, Jo-Ann; Mponda, Hadji
2011-07-01
This study uses a partial equilibrium simulation model to explore how price subsidies for insecticide-treated mosquito nets (ITNs) affect households' purchases of ITNs. The model describes the ITN market in a typical developing country and is applied to the situation in Tanzania, where the Tanzania National Voucher Scheme (TNVS) provides a targeted subsidy to vulnerable population groups by means of a discount voucher. The data for this study come from a nationally-representative household survey completed July-August 2006 covering over 4300 households in 21 districts. The simulation results show the impact of the voucher program on ITN coverage among target households, namely those that experienced the birth of a child. More specifically, the share of target households purchasing an ITN increased from 18 to 62 percent because of the discount voucher. The model also suggests that the voucher program could cause the retail ITN price to rise due to an overall increase in demand. As a result, ITN purchases by households without a voucher may actually decline. The simulation model suggests that additional increases toward the stated goal of 80 percent ITN coverage for pregnant women and children could best be achieved through a combination of "catch up" mass distribution programs and expanding the target group for the voucher program to cover additional households. The model can be employed in other countries considering use of a targeted price subsidy for ITNs, and could be adapted to assess the impact of subsidies for other public health commodities. Copyright © 2011 Elsevier Ltd. All rights reserved.
Gimnig, John E.; Kolczak, Margarette S.; Hightower, Allen W.; Vulule, John M.; Schoute, Erik; Kamau, Luna; Phillips-Howard, Penelope A.; ter Kuile, Feiko O.; Nahlen, Bernard L.; Hawley, William A.
2003-01-01
The effect of insecticide (permethrin)-treated bed nets (ITNs) on the spatial distribution of malaria vectors in neighboring villages lacking ITNs was studied during a randomized controlled trial of ITNs in western Kenya. There was a trend of decreased abundance of Anopheles gambiae with decreasing
Aung, Tin; Wei, Chongyi; McFarland, Willi; Aung, Ye Kyaw; Khin, Hnin Su Su
2016-01-01
Myanmar has the highest burden of malaria in the Greater Mekong. However, there is limited information on ownership and use of insecticide-treated nets (ITNs) in areas of Myanmar most severely affected by malaria. We describe ownership and use of ITNs among people in the malaria-endemic eastern parts of Myanmar and factors associated with ITN use. A cross-sectional household survey using a multi-stage cluster design was conducted in malaria-endemic townships in eastern Myanmar during the high malaria season of August to September, 2014. An effective ITN was defined as 1) a long-lasting insecticide-treated net obtained within the past three years, or 2) any net treated with insecticide within the past year. In 4,679 households, the average number of ITNs per household was higher in rural compared to urban areas (0.6 vs. 0.4, p Myanmar in comparison to the goal of one for every two household members. Use of ITNs was low even when present. Findings are of concern given the study areas were part of enhanced efforts to reduce artemisinin-resistant malaria. Nonetheless, groups vulnerable to malaria such as individuals in rural settings, lower socio-economic households, and workers in high mosquito exposure jobs, had higher rates of ITN ownership. Malaria knowledge was linked to effective ITN use suggesting that distribution campaigns should be complemented by behavior change communications.
Factors Influencing the Usage of Insecticide Treated Mosquito Nets ...
African Journals Online (AJOL)
Purpose: Malaria in Sudan is a leading cause of morbidity and mortality. ... treated mosquito nets (ITNs) for prevention of malaria among pregnant women. ... on malaria causes, 103 (99%) had good knowledge on malaria complications and ... and accessibility to ITNs were significantly associated with current usage of ITNs.
Hawley, William A.; Phillips-Howard, Penelope A.; ter Kuile, Feiko O.; Terlouw, Dianne J.; Vulule, John M.; Ombok, Maurice; Nahlen, Bernard L.; Gimnig, John E.; Kariuki, Simon K.; Kolczak, Margarette S.; Hightower, Allen W.
2003-01-01
Spatial analyses of the effect of insecticide (permethrin)-treated bed nets (ITNs) on nearby households both with and without ITNs was performed in the context of a large-scale, group-randomized, controlled mortality trial in Asembo, western Kenya. Results illustrate a protective effect of ITNs on
Alaii, Jane A.; Hawley, William A.; Kolczak, Margarette S.; ter Kuile, Feiko O.; Gimnig, John E.; Vulule, John M.; Odhacha, Amos; Oloo, Aggrey J.; Nahlen, Bernard L.; Phillips-Howard, Penelope A.
2003-01-01
Adherence with permethrin-treated bed net (ITN) use and their proper deployment was directly observed in 2,178 individuals (784 households) participating in a large-scale trial of ITNs on child mortality in western Kenya. The ITNs were distributed free of charge to ensure high coverage, resulting in
Efficacy of malaria prevention during pregnancy in an area of low and unstable transmission
DEFF Research Database (Denmark)
Ndyomugyenyi, Richard; Clarke, Siân E; Hutchison, Coll L.
2011-01-01
-randomised placebo-controlled trial involving 5775 women of all parities examined the effect of IPTp, ITNs alone, or ITNs used in combination with IPTp on maternal anaemia and low birth weight (LBW) in a highland area of southwestern Uganda. The overall prevalence of malaria infection, maternal anaemia and LBW...... services was observed. With ITNs offering a number of advantages over IPTp, yet showing comparable efficacy, we discuss why ITNs could be an appropriate preventive strategy for malaria control during pregnancy in areas of low and unstable transmission....
De Allegri, Manuela; Marschall, Paul; Flessa, Steffen; Tiendrebéogo, Justin; Kouyaté, Bocar; Jahn, Albrecht; Müller, Olaf
2010-01-01
Insecticide-treated nets (ITNs) are effective in substantially reducing malaria transmission. Still, ITN coverage in sub-Saharan Africa (SSA) remains extremely low. Policy makers are concerned with identifying the most suitable delivery mechanism to achieve rapid yet sustainable increases in ITN coverage. Little is known, however, on the comparative costs of alternative ITN distribution strategies. This paper aimed to fill this gap in knowledge by developing such a comparative cost analysis, looking at the cost per ITN distributed for two alternative interventions: subsidized sales supported by social marketing and free distribution to pregnant women through antenatal care (ANC). The study was conducted in rural Burkina Faso, where the two interventions were carried out alongside one another in 2006/07. Cost information was collected prospectively to derive both a financial analysis adopting a provider's perspective and an economic analysis adopting a societal perspective. The average financial cost per ITN distributed was US$8.08 and US$7.21 for sales supported by social marketing and free distribution through ANC, respectively. The average economic cost per ITN distributed was US$4.81 for both interventions. Contrary to common belief, costs did not differ substantially between the two interventions. Due to the district's ability to rely fully on the use of existing resources, financial costs associated with free ITN distribution through ANC were in fact even lower than those associated with the social marketing campaign. This represents an encouraging finding for SSA governments and points to the possibility to invest in programmes to favour free ITN distribution through existing health facilities. Given restricted budgets, however, free distribution programmes are unlikely to be feasible.
Directory of Open Access Journals (Sweden)
Amoran Olorunfemi E
2012-08-01
Full Text Available Abstract Background ITN use is generally poor in Nigeria among all categories of people. Although use of ITNs has been shown to reduce malarial morbidity and mortality, this measure needs to be supported by an adequate healthcare system providing ITN possibly at the household level. This study was therefore designed to determine the effect of health education on the uptake of ITN among nursing mothers in rural communities in Nigeria. Methods The study design was a quasi-experimental study carried out in Ijebu North Local Government Area of Ogun State. A multistage random sampling technique was used in choosing the required samples for this study and a semi- structured questionnaire was used to collect relevant information. The intervention consisted of a structured educational programme based on a course content adapted from the national malaria control programme. A total of 400 respondents were recruited into the study with 200 each in both the experimental and control groups and were followed up for a period of 3 months when the knowledge and uptake of ITN was reassessed. Result There was no significant difference (P >0.05 observed between the experimental and control groups in terms of socio-dermographic characteristics such as age, marital status, religion, and income. The ITN ever users in experimental group were 59 [29.5%] and 138 [72.6%] in pre and post intervention period, respectively (p value =0.0001. These proportions of ITN ever users were 55 [27.5%] and 57 [31.6%] in control group, during the pre and post intervention periods (p = 0.37. Post health education intervention, degree of change in knowledge of ITN re-treatment [37.0%] and mounting [33.5%], readiness to use if given free [30.5%] and belief in efficacy [36.9%] improved significantly in the experimental group while there was no significant change in the control group [p = 0.84, 0.51, 0.68 &0.69 respectively]. Majority [89%] of the respondents were willing to buy
Directory of Open Access Journals (Sweden)
Abdisalan M Noor
2007-08-01
Full Text Available Inexpensive and efficacious interventions that avert childhood deaths in sub-Saharan Africa have failed to reach effective coverage, especially among the poorest rural sectors. One particular example is insecticide-treated bed nets (ITNs. In this study, we present repeat observations of ITN coverage among rural Kenyan homesteads exposed at different times to a range of delivery models, and assess changes in coverage across socioeconomic groups.We undertook a study of annual changes in ITN coverage among a cohort of 3,700 children aged 0-4 y in four districts of Kenya (Bondo, Greater Kisii, Kwale, and Makueni annually between 2004 and 2006. Cross-sectional surveys of ITN coverage were undertaken coincidentally with the incremental availability of commercial sector nets (2004, the introduction of heavily subsidized nets through clinics (2005, and the introduction of free mass distributed ITNs (2006. The changing prevalence of ITN coverage was examined with special reference to the degree of equity in each delivery approach. ITN coverage was only 7.1% in 2004 when the predominant source of nets was the commercial retail sector. By the end of 2005, following the expansion of heavily subsidized clinic distribution system, ITN coverage rose to 23.5%. In 2006 a large-scale mass distribution of ITNs was mounted providing nets free of charge to children, resulting in a dramatic increase in ITN coverage to 67.3%. With each subsequent survey socioeconomic inequity in net coverage sequentially decreased: 2004 (most poor [2.9%] versus least poor [15.6%]; concentration index 0.281; 2005 (most poor [17.5%] versus least poor [37.9%]; concentration index 0.131, and 2006 with near-perfect equality (most poor [66.3%] versus least poor [66.6%]; concentration index 0.000. The free mass distribution method achieved highest coverage among the poorest children, the highly subsidised clinic nets programme was marginally in favour of the least poor, and the commercial
Directory of Open Access Journals (Sweden)
Ye Yazoume
2012-02-01
Full Text Available Abstract Background Insecticide-treated nets (ITNs are effective tools for malaria prevention and can significantly reduce severe disease and mortality due to malaria, especially among children under five in endemic areas. However, ITN coverage and use remain low and inequitable among different socio-economic groups in sub-Saharan Africa, particularly in Nigeria. Several strategies have been proposed to increase coverage and use and reduce inequity in Nigeria, including free distribution campaigns recently conducted by the Nigerian federal government. Using data from the first post-campaign survey, the authors investigated the effect of the mass free distribution campaigns in achieving equity in household ownership and use of ITNs. Methods A post-campaign survey was undertaken in November 2009 in northern Nigeria to assess the effect of the campaigns in addressing equity across different socio-economic groups. The survey included 987 households randomly selected from 60 clusters in Kano state. Using logistic regression and the Lorenz concentration curve and index, the authors assessed equity in ITN coverage and use. Results ITN ownership coverage increased from 10% before the campaigns to 70%-a more than fivefold increase. The campaigns reduced the ownership coverage gap by 75%, effectively reaching parity among wealth quintiles (Concentration index 0.02, 95% CI (-0.02 ; 0.05 versus 0.21 95%CI (0.08 ; 0.34 before the campaigns. ITN use (individuals reporting having slept under an ITN the night before the survey visit among individuals from households owning at least one ITN, was 53.1% with no statistically significant difference between the lowest, second, third and fourth wealth quintiles and the highest wealth quintile (lowest: odds ratio (OR 0.87, 95% confidence interval (CI (0.67 ; 1.13; second: OR 0.85, 95% CI (0.66 ; 1.24; third: OR 1.10 95% CI (0.86 ; 1.4 and fourth OR 0.91 95% CI (0.72 ; 1.15. Conclusion The campaign had a significant
Low Utilization of Insecticide-Treated Bed Net among Pregnant Women in the Middle Belt of Ghana
Directory of Open Access Journals (Sweden)
Grace Manu
2017-01-01
Full Text Available Background. Malaria in pregnancy leads to low birth weight, premature birth, anaemia, and maternal and neonatal mortality. Use of insecticide-treated nets (ITNs during pregnancy is one of the proven interventions to reduce the malaria burden. However, Ghana has not achieved its target for ITN use among pregnant women. Methods. A qualitative study was conducted in seven communities purposively selected from the middle belt of Ghana. Participants who had delivered in the six months prior to this study were selected. In all, seven focus group discussions and twenty-four in-depth interviews were conducted between June and August 2010. Results. Respondents knew of the importance of ITNs and other malaria-preventive strategies. Factors such as financial access and missed opportunities of free distribution denied some pregnant women the opportunity to own or use an ITN. Reasons for not using ITNs during pregnancy included discomfort resulting from heat, smell of the net, and difficulty in hanging the net. Participants maintained their ITNs by preventing holes in the nets, retreatment, and infrequent washing. Conclusion. Pregnant women know about the causes and prevention of malaria. However, this knowledge is not transformed into practice due to lack of access to ITNs and sleeping discomforts among other logistical constraints.
Energy Technology Data Exchange (ETDEWEB)
Nagel, M.; Ay, P. [Brandenburgische Technische Univ. Cottbus (Germany). Lehrstuhl Aufbereitungstechnik
1999-07-01
Aimed building-up of aggregates as they originate in flocculation processes, for instance in sewage and sludge treatment, have especially lately been meeting with increasing resonance: they permit to influence, inter alia, important properties (e.g., the dewatering properties) of such systems. As conventional mathematical methods for the characterization of flocs - as a basis for process optimization - are inadequate or flawed, a concept for the effective characterization of the inner getup of such structures needs to be sought. One approach is cluster analysis, which is demonstrated and discussed in the present paper by means of the evaluation of sectional views of floc structures. (orig.) [German] Der gezielte Aufbau von Aggregaten, wie sie bei Flockungsprozessen z.B. in der Abwasser- und Schlammbehandlung entstehen, findet besonders in juengerer Zeit zunehmend Beachtung, da sich damit unter anderem wichtige Eigenschaften (z.B. die Entwaesserungseigenschaften) dieser Systeme beeinflussen lassen. Da herkoemmliche mathematische Methoden zur Charakterisierung von Flocken - als Basis fuer eine Prozessoptimierung - nur unzureichend bzw. fehlerbehaftet sind, ergibt sich daraus die Notwendigkeit, nach einem Konzept zur effektiven Charakterisierung des inneren Aufbaus solcher Strukturen zu suchen. Ein Ansatz ist die Clusteranalyse, die im Beitrag durch die Auswertung von Schnittbildern von Flockenstrukturen vorgestellt und diskutiert wird. (orig.)
DEFF Research Database (Denmark)
Bhattacharya, Debopam; Dupas, Pascaline; Kanaya, Shin
and its neighbors. Using experimental data from Kenya where subsidies were randomized, coupled with GPS-based location information, we show how to estimate aggregate ITN use resulting from means-tested subsidies in the presence of such spatial spillovers. Accounting for spillovers introduces infinite......-dimensional estimated regressors corresponding to continuously distributed location coordinates and makes the inference problem novel. We show that even if individual ITN use unambiguously increases with increasing incidence of subsidy in the neighborhood, ignoring spillovers may over- or under-predict overall ITN use...... resulting from a specific targeting rule, depending on the resulting aggregate incidence of subsidy. Applying our method to the Kenyan data, we find that (i) individual ITN use rises with neighborhood subsidy-rates, (ii) under means-testing, predicted ITN use is a convex increasing function of the subsidy...
Directory of Open Access Journals (Sweden)
Mathenge Evan
2006-11-01
Full Text Available Abstract Background African malaria vectors bite predominantly indoors at night so sleeping under an Insecticide-Treated Net (ITN can greatly reduce malaria risk. Behavioural adaptation by mosquitoes to increasing ITN coverage could allow vector mosquitoes to bite outside of peak sleeping hours and undermine efficacy of this key malaria prevention measure. Methods High coverage with largely untreated nets has been achieved in the Kilombero Valley, southern Tanzania through social marketing programmes. Direct surveys of nightly biting activity by An. gambiae Giles were conducted in the area before (1997 and after (2004 implementation of ITN promotion. A novel analytical model was applied to estimate the effective protection provided by an ITN, based on published experimental hut trials combined with questionnaire surveys of human sleeping behaviour and recorded mosquito biting patterns. Results An. gambiae was predominantly endophagic and nocturnal in both surveys: Approximately 90% and 80% of exposure occurred indoors and during peak sleeping hours, respectively. ITNs consistently conferred >70% protection against exposure to malaria transmission for users relative to non-users. Conclusion As ITN coverage increases, behavioural adaptation by mosquitoes remains a future possibility. The approach described allows comparison of mosquito biting patterns and ITN efficacy at multiple study sites and times. Initial results indicate ITNs remain highly effective and should remain a top-priority intervention. Combined with recently developed transmission models, this approach allows rapid, informative and cost-effective preliminary comparison of diverse control strategies in terms of protection against exposure before more costly and intensive clinical trials.
Altered regional homogeneity of spontaneous brain activity in idiopathic trigeminal neuralgia.
Wang, Yanping; Zhang, Xiaoling; Guan, Qiaobing; Wan, Lihong; Yi, Yahui; Liu, Chun-Feng
2015-01-01
The pathophysiology of idiopathic trigeminal neuralgia (ITN) has conventionally been thought to be induced by neurovascular compression theory. Recent structural brain imaging evidence has suggested an additional central component for ITN pathophysiology. However, far less attention has been given to investigations of the basis of abnormal resting-state brain activity in these patients. The objective of this study was to investigate local brain activity in patients with ITN and its correlation with clinical variables of pain. Resting-state functional magnetic resonance imaging data from 17 patients with ITN and 19 age- and sex-matched healthy controls were analyzed using regional homogeneity (ReHo) analysis, which is a data-driven approach used to measure the regional synchronization of spontaneous brain activity. Patients with ITN had decreased ReHo in the left amygdala, right parahippocampal gyrus, and left cerebellum and increased ReHo in the right inferior temporal gyrus, right thalamus, right inferior parietal lobule, and left postcentral gyrus (corrected). Furthermore, the increase in ReHo in the left precentral gyrus was positively correlated with visual analog scale (r=0.54; P=0.002). Our study found abnormal functional homogeneity of intrinsic brain activity in several regions in ITN, suggesting the maladaptivity of the process of daily pain attacks and a central role for the pathophysiology of ITN.
The costs and effects of a nationwide insecticide-treated net programme: the case of Malawi
Directory of Open Access Journals (Sweden)
Ortiz Juan
2005-05-01
Full Text Available Abstract Background Insecticide-treated nets (ITNs are a proven intervention to reduce the burden of malaria, yet there remains a debate as to the best method of ensuring they are universally utilized. This study is a cost-effectiveness analysis of an intervention in Malawi that started in 1998, in Blantyre district, before expanding nationwide. Over the 5-year period, 1.5 million ITNs were sold. Methods The costs were calculated retrospectively through analysis of expenditure data. Costs and effects were measured as cost per treated-net year (cost/TNY and cost per net distributed. Results The mean cost/TNY was calculated at $4.41, and the mean cost/ITN distributed at $2.63. It also shows evidence of economies of scale, with the cost/TNY falling from $7.69 in year one (72,196 ITN to $3.44 in year five (720,577 ITN. Cost/ITN distributed dropped from $5.04 to $1.92. Conclusion Combining targeting and social marketing has the potential of being both cost-effective and capable of achieving high levels of coverage, and it is possible that increasing returns to scale can be achieved.
Directory of Open Access Journals (Sweden)
Watiro AH
2016-05-01
Full Text Available Aklilu Habte Watiro,1 Worku Awoke,2 1Médecins Sans Frontières OCA (MSF Holland Ethiopia Mission, Addis Ababa, 2Department of Epidemiology, School of Public Health, College of Medicine and Health Sciences, Bahir Dar University, Bahir Dar, Ethiopia Background: Malaria remains a major public health problem in Ethiopia. Consequently, Ethiopia designed the 2011–2015, Malaria Prevention and Control Strategic Plan to fight the vector. It was discovered that most of the studies conducted on the use of insecticide-treated nets (ITNs were not in line with the strategic plan of the country. This study aimed to assess ITN ownership and utilization, and includes barriers related to its use among the target-area population at household (HH level. Materials and methods: A cross-sectional design was employed in Itang for this study. Data were collected by trained nurses through face-to-face interview and observation. A total of 845 participants were selected through multistage sampling, and the size was determined by using a single-population proportion formula. EPI Info and SPSS was used for analysis, and all necessary statistical association was computed in order to explain the outcome variable through explanatory variables of this study. Results: Among 845 HHs interviewed, 81.7% (690 had at least one ITN, while 52.3% (361 had used the ITN the night preceding the data-collection day. HH awareness of malaria prevention, number of ITNs, family size, number of family members sharing sleeping area/beds, sleeping patterns of adolescents, HH-head age, and inconvenience of using ITNs were found to be barriers to the use of ITNs in this study. Conclusion and recommendation: The study concluded that very few HHs owned ITNs and there was very low usage of ITNs. In recommendation, the regional health bureau and district health office should consider bigger nets that can accommodate family members who share the same sleeping area/bed in the area. Keywords: consistent
Lifescience Database Archive (English)
Full Text Available sequence sknfiql*itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn* liqkkykkpeifclerklkkfm*wvelesqiktiiqs...C: sknfiql*itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn* liqkkykkpeifclerklkkfm*wvelesqiktiiqsipfiltq
Zegers de Beyl, Celine; Koenker, Hannah; Acosta, Angela; Onyefunafoa, Emmanuel Obi; Adegbe, Emmanuel; McCartney-Melstad, Anna; Selby, Richmond Ato; Kilian, Albert
2016-02-03
The use of insecticide-treated nets (ITNs) is widely recognized as one of the main interventions to prevent malaria. High ITN coverage is needed to reduce transmission. Mass distribution campaigns are the fastest way to rapidly scale up ITN coverage. However, the best strategy to distribute ITNs to ensure household coverage targets are met is still under debate. This paper presents results from 14 post-campaign surveys in five African countries to assess whether the campaign strategy used had any effect on distribution outcome. Data from 13,901 households and 14 campaigns from Ghana, Nigeria, Senegal, South Sudan and Uganda, were obtained through representative cross-sectional questionnaire surveys, conducted three to 16 months after ITN distribution. All evaluations used a multi-stage sampling approach and similar methods for data collection. Key outcomes examined were the proportion of households having received a net from the campaign and the proportion of households with one net for every two people. Household registration rates proved to be the most important determinant of a household receiving any net from the campaign (adjusted odds ratio [OR] 74.8; 95 % confidence interval [CI]: 55.3-101.1) or had enough ITNs for all household members (adjusted OR 19.1; 95 % CI: 55.34-101.05). Factors that positively influenced registration were larger household size (adjusted OR 1.7; 95 % CI: 1.5-2.1) and families with children under five (adjusted OR 1.4; 95 % CI: 1.2-1.6). Urban residence was negatively associated with receipt of a net from the campaign (adjusted OR 0.73; 95 % CI: 0.58-0.92). Registration was equitable in most campaigns except for Uganda and South Sudan, where the poorest wealth quintiles were less likely to have been reached. After adjusting for other factors, delivery strategy (house-to-house vs. fixed point) and distribution approach (integrated versus stand-alone) did not show a systematic impact on registration or owning any ITN. Campaigns that
Photo-acoustic imaging of coronary arteries with polymer optical fibers
DEFF Research Database (Denmark)
Woyessa, Getinet; Broadway, Christian; Lamela, Horacio
2014-01-01
, Universidad Carlos III de Madrid under the TRIPOD project. TRIPOD (http://www.tripod-itn.eu) is a Marie Curie Initial Training Network located in the field of optical fibre sensors - an area where Europe has developed internationally competitive research and commercial activity. The aim is to significantly...... extend the range of appli cation of optical fibre grating sensors by developing a mature version of the technology in polymer optical fibres and thereby increase European competitiveness....
Monroe, April; Harvey, Steven A; Lam, Yukyan; Muhangi, Denis; Loll, Dana; Kabali, Asaph Turinde; Weber, Rachel
2014-03-06
Despite increased access and ownership, barriers to insecticide-treated bed net (ITN) use persist. While barriers within the home have been well documented, the challenges to net use when sleeping away from home remain relatively unexplored. This study examines common situations in which people sleep away from home and the barriers to ITN use in those situations. To explore these issues, a group of researchers conducted 28 in-depth interviews and four focus groups amongst adults from net-owning households in four Ugandan districts. In addition to sleeping outside during hot season, participants identified social events, livelihood activities, and times of difficulty as circumstances in which large numbers of people sleep away from home. Associated challenges to ITN use included social barriers such as fear of appearing proud, logistical barriers such as not having a place to hang a net, and resource limitations such as not having an extra net with which to travel. Social disapproval emerged as an important barrier to ITN use in public settings. Unique barriers to ITN use exist when people spend the night away from home. It is essential to identify and address these barriers in order to reduce malaria exposure in such situations. For events like funerals or religious "crusades" where large numbers of people sleep away from home, alternative approaches, such as spatial repellents may be more appropriate than ITNs. Additional research is required to identify the acceptability and feasibility of alternative prevention strategies in situations where ITNs are unlikely to be effective.
Effect of Investment in Malaria Control on Child Mortality in Sub-Saharan Africa in 2002–2008
Akachi, Yoko; Atun, Rifat
2011-01-01
Background Around 8.8 million children under-five die each year, mostly due to infectious diseases, including malaria that accounts for 16% of deaths in Africa, but the impact of international financing of malaria control on under-five mortality in sub-Saharan Africa has not been examined. Methods and Findings We combined multiple data sources and used panel data regression analysis to study the relationship among investment, service delivery/intervention coverage, and impact on child health by observing changes in 34 sub-Saharan African countries over 2002–2008. We used Lives Saved Tool to estimate the number of lives saved from coverage increase of insecticide-treated nets (ITNs)/indoor residual spraying (IRS). As an indicator of outcome, we also used under-five mortality rate. Global Fund investments comprised more than 70% of the Official Development Assistance (ODA) for malaria control in 34 countries. Each $1 million ODA for malaria enabled distribution of 50,478 ITNs [95%CI: 37,774–63,182] in the disbursement year. 1,000 additional ITNs distributed saved 0.625 lives [95%CI: 0.369–0.881]. Cumulatively Global Fund investments that increased ITN/IRS coverage in 2002–2008 prevented an estimated 240,000 deaths. Countries with higher malaria burden received less ODA disbursement per person-at-risk compared to lower-burden countries ($3.90 vs. $7.05). Increased ITN/IRS coverage in high-burden countries led to 3,575 lives saved per 1 million children, as compared with 914 lives in lower-burden countries. Impact of ITN/IRS coverage on under-five mortality was significant among major child health interventions such as immunisation showing that 10% increase in households with ITN/IRS would reduce 1.5 [95%CI: 0.3–2.8] child deaths per 1000 live births. Conclusions Along with other key child survival interventions, increased ITNs/IRS coverage has significantly contributed to child mortality reduction since 2002. ITN/IRS scale-up can be more efficiently
Effect of investment in malaria control on child mortality in sub-Saharan Africa in 2002-2008.
Directory of Open Access Journals (Sweden)
Yoko Akachi
Full Text Available BACKGROUND: Around 8.8 million children under-five die each year, mostly due to infectious diseases, including malaria that accounts for 16% of deaths in Africa, but the impact of international financing of malaria control on under-five mortality in sub-Saharan Africa has not been examined. METHODS AND FINDINGS: We combined multiple data sources and used panel data regression analysis to study the relationship among investment, service delivery/intervention coverage, and impact on child health by observing changes in 34 sub-Saharan African countries over 2002-2008. We used Lives Saved Tool to estimate the number of lives saved from coverage increase of insecticide-treated nets (ITNs/indoor residual spraying (IRS. As an indicator of outcome, we also used under-five mortality rate. Global Fund investments comprised more than 70% of the Official Development Assistance (ODA for malaria control in 34 countries. Each $1 million ODA for malaria enabled distribution of 50,478 ITNs [95%CI: 37,774-63,182] in the disbursement year. 1,000 additional ITNs distributed saved 0.625 lives [95%CI: 0.369-0.881]. Cumulatively Global Fund investments that increased ITN/IRS coverage in 2002-2008 prevented an estimated 240,000 deaths. Countries with higher malaria burden received less ODA disbursement per person-at-risk compared to lower-burden countries ($3.90 vs. $7.05. Increased ITN/IRS coverage in high-burden countries led to 3,575 lives saved per 1 million children, as compared with 914 lives in lower-burden countries. Impact of ITN/IRS coverage on under-five mortality was significant among major child health interventions such as immunisation showing that 10% increase in households with ITN/IRS would reduce 1.5 [95%CI: 0.3-2.8] child deaths per 1000 live births. CONCLUSIONS: Along with other key child survival interventions, increased ITNs/IRS coverage has significantly contributed to child mortality reduction since 2002. ITN/IRS scale-up can be more efficiently
CuInGaAlSe2 Solar Absorbers On Flexible High-Temperature Substrates, Phase I
National Aeronautics and Space Administration — ITN Energy Systems (ITN) proposes to take the next step in spacecraft solar array development, building upon previous development and new findings to make the...
CuInGaAlSe2 Solar Absorbers On Flexible High-Temperature Substrates, Phase II
National Aeronautics and Space Administration — ITN Energy Systems (ITN) proposes to take the next step in spacecraft solar array development, building upon previous development and new findings to make the...
Guide to Your Health Care: After Heart Transplantation
... same low prices, vast selection and convenient shopping experience as Amazon.com, with the added bonus that Amazon will donate .5% of the purchase price to ITNS. ITNS Awards Transplant Nurses Day ...
Efficacy of New Measures Saving Time in Acute Stroke Management: A Quantified Analysis.
Iglesias Mohedano, Ana María; García Pastor, Andrés; Díaz Otero, Fernando; Vázquez Alen, Pilar; Vales Montero, Marta; Luque Buzo, Elisa; Redondo Ráfales, Nuria; Chavarria Cano, Beatriz; Fernández Bullido, Yolanda; Villanueva Osorio, Jose Antonio; Gil Núñez, Antonio
2017-08-01
Time to treatment remains the most important factor in acute ischemic stroke prognosis. We quantified the effect of new interventions reducing in-hospital delays in acute stroke management and assessed its repercussion on door-to-imaging (DTI), imaging-to-needle (ITN), and door-to-needle (DTN) times. Prospective registry of consecutive stroke patients who were candidates for reperfusion therapy attended in a tertiary care hospital from February 1 to December 31, 2014. A series of measures aimed at reducing in-hospital delays were implemented. We compared DTI, ITN, and DTN times between patients who underwent the interventions and those who did not. 231 patients. DTI time was lower when personal history was reviewed and tests were ordered before patient arrival (2.5 minutes saved, P = .016) and when electrocardiogram was not made (5.4 minutes saved, P time significantly (14 and 12 minutes saved, respectively, P time. Completing all steps resulted in the lowest DTI and ITN times (13 and 19 minutes, respectively). Every measure is an important part of a chain focused on saving time in acute stroke: the lowest DTI and ITN times were obtained when all steps were completed. Measures shortening ITN time produced a greater impact on DTN time reduction; therefore, ITN interventions should be considered a critical part of new protocols and guidelines. Copyright © 2017. Published by Elsevier Inc.
Ownership and use of insecticide-treated nets during pregnancy in sub-Saharan Africa: a review.
Singh, Megha; Brown, Graham; Rogerson, Stephen J
2013-08-01
Over the past decade, significant gains have been made in the implementation of malaria prevention measures in pregnancy in sub-Saharan Africa, including the distribution of insecticide-treated nets (ITNs). These have been shown to cause a reduction in the incidence of malaria and its consequences such as maternal anaemia, stillbirths and intrauterine growth restriction. Currently most nations in Africa have policies for distributing ITNs to pregnant women through various mechanisms, however coverage remains well below the targets. This review summarizes recent evidence regarding the correlation between ownership and use of ITNs and the determinants of both, in pregnancy in sub-Saharan Africa, and reviews interventions directed at improving coverage. A review of the literature using Pubmed, CINAHL and scanning of reference lists was conducted in October 2012 and 59 articles were selected for final review. The research obtained was a mixture of national and district level surveys, and a narrative synthesis of the data was undertaken. Ownership of ITNs varied from as low as 3% to greater than 80%, and the main determinants were found to be education level, knowledge of malaria, community involvement, socio-economic status and parity, although the significance of each varied between the different settings and studies reviewed. In more than half the settings where data were available, the combination of lack of availability and lack of use of an available net meant that less than half of all pregnancies received the recommended intervention. Supply and cost remain major barriers to achieving optimal coverage, but the additional important contributor to reduced efficiency of intervention was the clear discrepancy between ownership and use, with available ITN use below 60% in several settings. Cited reasons for not using an ITN, where one was available, included discomfort, problems with hanging up nets and lack of space, low awareness of need, and seasonal variations in
Petter Sejrup, Hans; Oline Hjelstuen, Berit
2015-04-01
GLANAM (Glaciated North Atlantic Margins) is an Initial Training Network (ITN) funded under the EU Marie Curie Programme. It comprises 10 research partners from Norway, UK and Denmark, including 7 University research teams, 1 industrial full partner and 2 industrial associate partners. The GLANAM network will employ and train 15 early career researchers (Fellows). The aim of GLANAM is to improve the career prospects and development of young researchers in both the public and private sector within the field of earth science, focusing on North Atlantic glaciated margins. The young scientists will perform multi-disciplinary research and receive training in geophysics, remote sensing, GIS, sedimentology, geomorphology, stratigraphy, geochemistry and numerical modeling through three interconnected work packages that collectively address knowledge gaps related to the large, glacial age, sedimentary depocentres on the North Atlantic margin. The 15 Fellows will work on projects that geographically extend from Ireland in the south to the High Arctic. Filling these gaps will not only result in major new insights regarding glacial age processes on continental margins in general, but will also provide paleoclimate information essential for understanding the role of marine-based ice sheets in the climate system and for the testing of climate models. GLANAM brings together leading European research groups working on glaciated margins in a coordinated and collaborative research and training project. Focusing on the North Atlantic margins, this coordinated approach will lead to a major advance in the understanding of glaciated margins more widely and will fundamentally strengthen European research and build capacity in this field.
Directory of Open Access Journals (Sweden)
John E Gimnig
Full Text Available Insecticide treated nets (ITNs and indoor residual spraying (IRS have been scaled up for malaria prevention in sub-Saharan Africa. However, there are few studies on the benefit of implementing IRS in areas with moderate to high coverage of ITNs. We evaluated the impact of an IRS program on malaria related outcomes in western Kenya, an area of intense perennial malaria transmission and moderate ITN coverage (55-65% use of any net the previous night.The Kenya Division of Malaria Control, with support from the US President's Malaria Initiative, conducted IRS in one lowland endemic district with moderate coverage of ITNs. Surveys were conducted in the IRS district and a neighboring district before IRS, after one round of IRS in July-Sept 2008 and after a second round of IRS in April-May 2009. IRS was conducted with pyrethroid insecticides. At each survey, 30 clusters were selected for sampling and within each cluster, 12 compounds were randomly selected. The primary outcomes measured in all residents of selected compounds included malaria parasitemia, clinical malaria (P. falciparum infection plus history of fever and anemia (Hb<8 of all residents in randomly selected compounds. At each survey round, individuals from the IRS district were matched to those from the non-IRS district using propensity scores and multivariate logistic regression models were constructed based on the matched dataset.At baseline and after one round of IRS, there were no differences between the two districts in the prevalence of malaria parasitemia, clinical malaria or anemia. After two rounds of IRS, the prevalence of malaria parasitemia was 6.4% in the IRS district compared to 16.7% in the comparison district (OR = 0.36, 95% CI = 0.22-0.59, p<0.001. The prevalence of clinical malaria was also lower in the IRS district (1.8% vs. 4.9%, OR = 0.37, 95% CI = 0.20-0.68, p = 0.001. The prevalence of anemia was lower in the IRS district but only in children under 5 years of age (2
Admasie, Amha; Zemba, Amanuel; Paulos, Wondimagegn
2018-01-01
Malaria can be prevented using cost-effective interventions. It can be prevented at large via the use of insecticide-treated mosquito nets (ITNs). The use of ITNs decreases malaria mortality rates by 55% in under-5 years old children in Africa, Ethiopia, realizing the effectiveness, scaling up distribution and utilization of ITNs to cover 100% of children less than 5 years of age. However, little is known about ITNs utilization and factors associated with the utilization in under-5 years old children in the study area yet. The purpose of this study was to assess the level and associated factors of ITNs utilization in under-5 years old children among households with under-5 years old children of Mirab Abaya District, Gamo Gofa Zone, Ethiopia. A community-based cross-sectional study was conducted during August-September, 2016. Six study Kebeles were identified by simple random sampling technique and 398 households with at least one under-5 years old children were selected by random sampling technique using computer generated random numbers from health post family folders. Structured, interviewer questionnaire was administered to mothers or care givers of the children. Data were entered to Epi Info Version 3.5 and analyzed in SPSS version 21 statistical software. Bivariate and multivariate logistic regression analysis was done. P -value used for the determination of associations between dependent and predictor variables. Results were presented in narrations, tables, and graph. Among 398 under-5 years old children assessed, the majority, 362 (91.0%) of them had access to ITN, but only 137 (37.2%) of the child had ITNs utilization during the previous night prior to the survey. Households with age of mothers or caretakers 31-44 years, AOR = 0.03, 95% CI (0.01-0.07) and ≥45 years of age; AOR = 0.05, 95% CI (0.01-0.58); households with family size ≤5 members, AOR = 11.23, 95% CI (4.31-29.24); and households with sleeping space ≥2, AOR
Altered regional homogeneity of spontaneous brain activity in idiopathic trigeminal neuralgia
Directory of Open Access Journals (Sweden)
Wang Y
2015-10-01
Full Text Available Yanping Wang,1,2 Xiaoling Zhang,2 Qiaobing Guan,2 Lihong Wan,2 Yahui Yi,2 Chun-Feng Liu1 1Department of Neurology, The Second Affiliated Hospital of Soochow University, Suzhou, Jiangsu Province, 2Department of Neurology, The Second Hospital of Jiaxing City, Jiaxing, Zhejiang Province, People’s Republic of China Abstract: The pathophysiology of idiopathic trigeminal neuralgia (ITN has conventionally been thought to be induced by neurovascular compression theory. Recent structural brain imaging evidence has suggested an additional central component for ITN pathophysiology. However, far less attention has been given to investigations of the basis of abnormal resting-state brain activity in these patients. The objective of this study was to investigate local brain activity in patients with ITN and its correlation with clinical variables of pain. Resting-state functional magnetic resonance imaging data from 17 patients with ITN and 19 age- and sex-matched healthy controls were analyzed using regional homogeneity (ReHo analysis, which is a data-driven approach used to measure the regional synchronization of spontaneous brain activity. Patients with ITN had decreased ReHo in the left amygdala, right parahippocampal gyrus, and left cerebellum and increased ReHo in the right inferior temporal gyrus, right thalamus, right inferior parietal lobule, and left postcentral gyrus (corrected. Furthermore, the increase in ReHo in the left precentral gyrus was positively correlated with visual analog scale (r=0.54; P=0.002. Our study found abnormal functional homogeneity of intrinsic brain activity in several regions in ITN, suggesting the maladaptivity of the process of daily pain attacks and a central role for the pathophysiology of ITN. Keywords: trigeminal neuralgia, resting fMRI, brain, chronic pain, local connectivity
African Journals Online (AJOL)
User
because they cannot appreciate the extra protection afforded by ITN. ... To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo. State. A descriptive cross-sectional study design was employed. Using a ...
Okafor, I P; Odeyemi, K A
2012-01-01
Insecticide-treated nets (ITNs) have proven to be one of the most effective means of reducing malaria morbidity and mortality in children and pregnant women. This study is carried out to determine the practice and determinants of ITN use for children under five years among care givers in an urban area of Lagos State. A community-based, cross sectional study was carried out in Lagos State in April 2007 among three hundred and forty (340) care givers primarily responsible for child care at home. They were selected by a multi-stage sampling method using a pre-tested, interviewer-administered, structured questionnaire. ITN use rate for under-fives was high (61.8%) and this was significantly determined by care giver's marital status (P level of care giver and occupation of head of the household were not significant determinants. There is need for health campaigns on ITNs targeted at unmarried care givers of young children. In addition, we also recommend social marketing of modern family planning methods to reduce family size, thereby increasing chances of ITN use among children less than five years to reduce malaria burden.
Douglas, Jessica D.
2012-05-22
A series of low band gap isothianaphthene-based (ITN) polymers with various electron-withdrawing substituents and intrinsic quinoidal character were synthesized, characterized, and tested in organic photovoltaic (OPV) devices. The three investigated ITN cores contained either ester, imide, or nitrile functionalities and were each synthesized in only four linear steps. The relative electron-withdrawing strength of the three substituents on the ITN moiety was evaluated and correlated to the optical and electronic properties of ITN-based copolymers. The ester- and imide-containing p-type polymers reached device efficiencies as high as 3% in bulk heterojunction blends with phenyl C 61-butyric acid methyl ester (PC 61BM), while the significantly electron-deficient nitrile-functionalized polymer behaved as an n-type material with an efficiency of 0.3% in bilayer devices with poly(3-(4-n-octyl)phenylthiophene) (POPT). © 2012 American Chemical Society.
Das, Pradeep; Ghosh, Debashis; Priyanka, Jyoti; Matlashewski, Greg; Kroeger, Axel; Upfill-Brown, Alexander
2016-01-01
Background We investigated the efficacy, safety and cost of lime wash of household walls plus treatment of sand fly breeding places with bleach (i.e. environmental management or EM), insecticide impregnated durable wall lining (DWL), and bed net impregnation with slow release insecticide (ITN) for sand fly control in the Indian sub-continent. Methods This multi-country cluster randomized controlled trial had 24 clusters in each three sites with eight clusters per high, medium or low sand fly density stratum. Every cluster included 45–50 households. Five households from each cluster were randomly selected for entomological measurements including sand fly density and mortality at one, three, nine and twelve months post intervention. Household interviews were conducted for socioeconomic information and intervention acceptability assessment. Cost for each intervention was calculated. There was a control group without intervention. Findings Sand fly mortality [mean and 95%CI] ranged from 84% (81%-87%) at one month to 74% (71%-78%) at 12 months for DWL, 75% (71%-79%) at one month to 49% (43%-55%) at twelve months for ITN, and 44% (34%-53%) at one month to 22% (14%-29%) at twelve months for EM. Adjusted intervention effect on sand fly density measured by incidence rate ratio ranged from 0.28 (0.23–0.34) at one month to 0.62 (0.51–0.75) at 12 months for DWL; 0.72 (0.62–0.85) at one month to 1.02 (0.86–1.22) at 12 months for ITN; and 0.89 (0.76–1.03) at one months to 1.49 (1.26–1.74) at 12 months for EM. Household acceptance of EM was 74% compared to 94% for both DWL and ITN. Operational cost per household in USD was about 5, 8, and 2 for EM, DWL and ITN, respectively. Minimal adverse reactions were reported for EM and ITN while 36% of households with DWL reported transient itching. Interpretation DWL is the most effective, durable and acceptable control method followed by ITN. The Visceral Leishmaniasis (VL) Elimination Program in the Indian sub
Lifescience Database Archive (English)
Full Text Available w*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwy...ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwyssylfrs**ys...scsqnfis rkc*ny*sntkdwcsw*TSCFLTSKINEWCFSRIRRKIKIIYRIFFKKK--- ---lnk**ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**t sess*twcnn
Entomological determinants of insecticide-treated bed net effectiveness in Western Myanmar
Smithuis, Frank M.; Kyaw, Moe Kyaw; Phe, U. Ohn; van der Broek, Ingrid; Katterman, Nina; Rogers, Colin; Almeida, Patrick; Kager, Piet A.; Stepniewska, Kasia; Lubell, Yoel; Simpson, Julie A.; White, Nicholas J.
2013-01-01
In a large cluster randomized control trial of insecticide-treated bed nets (ITN) in Western Myanmar the malaria protective effect of ITN was found to be highly variable and, in aggregate, the effect was not statistically significant. A coincident entomological investigation measured malaria vector
Assessing Payment and Community Based Distribution Issues in ...
African Journals Online (AJOL)
Methods: Questionnaire interviews were conducted with randomly selected household heads or their representatives in five malaria holo-endemic communities of Southeast Nigeria. Interviews were also held with community leaders before and after ITNs sales. The sale of ITNs was based on the communities' distribution ...
Wilson, A.L.; Dhiman, R.C.; Kitron, U.; Scott, T.W.; Berg, van den H.; Lindsay, S.W.
2014-01-01
Introduction Insecticide-treated nets (ITNs) are one of the main interventions used for malaria control. However, these nets may also be effective against other vector borne diseases (VBDs). We conducted a systematic review and meta-analysis to estimate the efficacy of ITNs, insecticide-treated
Hawley, William A.; ter Kuile, Feiko O.; Steketee, Richard S.; Nahlen, Bernard L.; Terlouw, Dianne J.; Gimnig, John E.; Shi, Ya Ping; Vulule, John M.; Alaii, Jane A.; Hightower, Allen W.; Kolczak, Margarette S.; Kariuki, Simon K.; Phillips-Howard, Penelope A.
2003-01-01
The fifth, and probably last, large-scale, group-randomized, controlled trial of insecticide (permethrin)-treated bed nets (ITNs) showed that ITNs are efficacious in reducing all-cause post-neonatal mortality in an area of intense, perennial malaria transmission. The trial helped to define pregnant
DEFF Research Database (Denmark)
Askjaer, N; Maxwell, C; Chambo, W
2001-01-01
The use of insecticide-treated bed nets (ITN) has been documented to reduce malaria morbidity and mortality in areas with endemic malaria, but concerns have been raised that ITN usage could affect the acquisition of malaria immunity. Several lines of evidence have indicated that antibodies against...... variant surface antigens (VSA) are important in the development of naturally acquired immunity to Plasmodium falciparum malaria and may thus be good indicators of immune status. We have compared the levels of VSA antibodies in plasma from children who have used ITN for 4 years to levels in plasma from...
Directory of Open Access Journals (Sweden)
Laith Yakob
Full Text Available Integrated vector management for malaria control has received a lot of recent interest. Attacking multiple points in the transmission cycle is hoped to act synergistically and improve upon current single-tool interventions based on the use of insecticide-treated bed nets (ITNs. In the present study, we theoretically examined the application of larval habitat source reduction with ITNs in reducing malaria transmission. We selected this type of environmental management to complement ITNs because of a potential secondary mode of action that both control strategies share. In addition to increasing vector mortality, ITNs reduce the rate at which female mosquitoes locate human hosts for blood feeding, thereby extending their gonotrophic cycle. Similarly, while reducing adult vector emergence and abundance, source reduction of larval habitats may prolong the cycle duration by extending delays in locating oviposition sites. We found, however, that source reduction of larval habitats only operates through this secondary mode of action when habitat density is below a critical threshold. Hence, we illustrate how this strategy becomes increasingly effective when larval habitats are limited. We also demonstrate that habitat source reduction is better suited to human populations of higher density and in the presence of insecticide resistance or when the insecticidal properties of ITNs are depleted.
What has driven the decline of infant mortality in Kenya in the 2000s?
Demombynes, Gabriel; Trommlerová, Sofia Karina
2016-05-01
Substantial declines in early childhood mortality have taken place in many countries in Sub-Saharan Africa. Kenya's infant mortality rate fell by 7.6 percent per year between 2003 and 2008, the fastest rate of decline among the 20 countries in the region for which recent Demographic and Health Survey (DHS) data are available. The average rate of decline across all 20 countries was 3.6 percent per year. Among the possible causes of the observed decline in Kenya is a large-scale campaign to distribute insecticide-treated bednets (ITN) which started in 2004. A Oaxaca-Blinder decomposition using DHS data shows that the increased ownership of bednets in endemic malaria zones explains 79 percent of the decline in infant mortality. Although the Oaxaca-Blinder method cannot identify causal effects, given the wide evidence basis showing that ITN usage can reduce malaria prevalence and the huge surge in ITN ownership in Kenya, it is likely that the decomposition results reflect at least in part a causal effect. The widespread ownership of ITNs in areas of Kenya where malaria is rare suggests that better targeting of ITN provision could improve the cost-effectiveness of such programs. Copyright © 2016. Published by Elsevier B.V.
Malaria and protective behaviours: is there a malaria trap?
Berthélemy, Jean-Claude; Thuilliez, Josselin; Doumbo, Ogobara; Gaudart, Jean
2013-06-13
In spite of massive efforts to generalize efficient prevention, such as insecticide-treated mosquito nets (ITN) or long-lasting insecticidal nets (LLINs), malaria remains prevalent in many countries and ITN/LLINs are still only used to a limited extent. This study proposes a new model for malaria economic analysis by combining economic epidemiology tools with the literature on poverty traps. A theoretical model of rational protective behaviour in response to malaria is designed, which includes endogenous externalities and disease characteristics. Survey data available for Uganda provide empirical support to the theory of prevalence-elastic protection behaviours, once endogeneity issues related to epidemiology and poverty are solved. Two important conclusions emerge from the model. First, agents increase their protective behaviour when malaria is more prevalent in a society. This is consistent with the literature on "prevalence-elastic behaviour". Second, a 'malaria trap' defined as the result of malaria reinforcing poverty while poverty reduces the ability to deal with malaria can theoretically exist and the conditions of existence of the malaria trap are identified. These results suggest the possible existence of malaria traps, which provides policy implications. Notably, providing ITN/LLINs at subsidized prices is not sufficient. To be efficient an ITN/LLINs dissemination campaigns should include incentive of the very poor for using ITN/LLINs.
Directory of Open Access Journals (Sweden)
Mtei Frank
2009-04-01
Full Text Available Abstract Background There is no clear consensus on the most sustainable and effective distribution strategy for insecticide treated bed nets (ITNs. Tanzania has been a leader in social marketing but it is still not clear if this can result in high and equitable levels of coverage. Methods A cluster-randomized survey of ITN and bed net ownership and use was conducted in a rural area exposed to intense Plasmodium falciparum transmission in NE Tanzania where ITN distribution had been subject to routine delivery of national strategies and episodic free distribution through local clinics. Data were collected on household assets to assess equity of ITN coverage and a rapid diagnostic test for malaria (RDT was performed in all ages. Results Among 598 households in four villages the use of any or insecticidal bed nets in children less than five years of age was 71% and 54% respectively. However there was a 19.8% increase in the number of bed nets per person (p Conclusion Marked inequity persists with the poorest households still experiencing the highest risk of malaria and the lowest ITN coverage. Abolition of this inequity within the foreseeable future is likely to require mass or targeted free distribution, but risks damaging what is otherwise an effective commercial market.
Directory of Open Access Journals (Sweden)
Andrew A Obala
Full Text Available Insecticide-treated nets are the cornerstone of global malaria control and have been shown to reduce malaria morbidity by 50-60%. However, some areas are experiencing a resurgence in malaria following successful control. We describe an efficacy decay framework to understand why high malaria burden persists even under high ITN coverage in a community in western Kenya.We enrolled 442 children hospitalized with malaria and paired them with age, time, village and gender-matched controls. We completed comprehensive household and neighborhood assessments including entomological surveillance. The indicators are grouped into five domains in an efficacy decay framework: ITN ownership, compliance, physical integrity, vector susceptibility and facilitating factors. After variable selection, case-control data were analyzed using conditional logistic regression models and mosquito data were analyzed using negative binomial regression. Predictive margins were calculated from logistic regression models.Measures of ITN coverage and physical integrity were not correlated with hospitalized malaria in our study. However, consistent ITN use (Adjusted Odds Ratio (AOR = 0.23, 95%CI: 0.12-0.43, presence of nearby larval sites (AOR = 1.137, 95%CI: 1.02-1.27, and specific types of crops (AOR (grains = 0.446, 95%CI: 0.24-0.82 were significantly correlated with malaria amongst children who owned an ITN. The odds of hospitalization for febrile malaria nearly tripled when one other household member had symptomatic malaria infection (AOR-2.76, 95%CI:1.83-4.18. Overall, perfect household adherence could reduce the probability of hospitalization for malaria to less than 30% (95%CI:0.12-0.46 and adjusting environmental factors such as elimination of larval sites and growing grains nearby could reduce the probability of hospitalization for malaria to less than 20% (95%CI:0.04-0.31.Availability of ITNs is not the bottleneck for malaria prevention in this community. Behavior
Obala, Andrew A; Mangeni, Judith Nekesa; Platt, Alyssa; Aswa, Daniel; Abel, Lucy; Namae, Jane; Prudhomme O'Meara, Wendy
2015-01-01
Insecticide-treated nets are the cornerstone of global malaria control and have been shown to reduce malaria morbidity by 50-60%. However, some areas are experiencing a resurgence in malaria following successful control. We describe an efficacy decay framework to understand why high malaria burden persists even under high ITN coverage in a community in western Kenya. We enrolled 442 children hospitalized with malaria and paired them with age, time, village and gender-matched controls. We completed comprehensive household and neighborhood assessments including entomological surveillance. The indicators are grouped into five domains in an efficacy decay framework: ITN ownership, compliance, physical integrity, vector susceptibility and facilitating factors. After variable selection, case-control data were analyzed using conditional logistic regression models and mosquito data were analyzed using negative binomial regression. Predictive margins were calculated from logistic regression models. Measures of ITN coverage and physical integrity were not correlated with hospitalized malaria in our study. However, consistent ITN use (Adjusted Odds Ratio (AOR) = 0.23, 95%CI: 0.12-0.43), presence of nearby larval sites (AOR = 1.137, 95%CI: 1.02-1.27), and specific types of crops (AOR (grains) = 0.446, 95%CI: 0.24-0.82) were significantly correlated with malaria amongst children who owned an ITN. The odds of hospitalization for febrile malaria nearly tripled when one other household member had symptomatic malaria infection (AOR-2.76, 95%CI:1.83-4.18). Overall, perfect household adherence could reduce the probability of hospitalization for malaria to less than 30% (95%CI:0.12-0.46) and adjusting environmental factors such as elimination of larval sites and growing grains nearby could reduce the probability of hospitalization for malaria to less than 20% (95%CI:0.04-0.31). Availability of ITNs is not the bottleneck for malaria prevention in this community. Behavior change
Hill, Jenny; Hoyt, Jenna; van Eijk, Anna Maria; D'Mello-Guyett, Lauren; Ter Kuile, Feiko O; Steketee, Rick; Smith, Helen; Webster, Jayne
2013-01-01
Malaria in pregnancy has important consequences for mother and baby. Coverage with the World Health Organization-recommended prevention strategy for pregnant women in sub-Saharan Africa of intermittent preventive treatment in pregnancy (IPTp) and insecticide-treated nets (ITNs) is low. We conducted a systematic review to explore factors affecting delivery, access, and use of IPTp and ITNs among healthcare providers and women. We searched the Malaria in Pregnancy Library and Global Health Database from 1 January 1990 to 23 April 2013, without language restriction. Data extraction was performed by two investigators independently, and data was appraised for quality and content. Data on barriers and facilitators, and the effect of interventions, were explored using content analysis and narrative synthesis. We conducted a meta-analysis of determinants of IPTp and ITN uptake using random effects models, and performed subgroup analysis to evaluate consistency across interventions and study populations, countries, and enrolment sites. We did not perform a meta-ethnography of qualitative data. Ninety-eight articles were included, of which 20 were intervention studies. Key barriers to the provision of IPTp and ITNs were unclear policy and guidance on IPTp; general healthcare system issues, such as stockouts and user fees; health facility issues stemming from poor organisation, leading to poor quality of care; poor healthcare provider performance, including confusion over the timing of each IPTp dose; and women's poor antenatal attendance, affecting IPTp uptake. Key determinants of IPTp coverage were education, knowledge about malaria/IPTp, socio-economic status, parity, and number and timing of antenatal clinic visits. Key determinants of ITN coverage were employment status, education, knowledge about malaria/ITNs, age, and marital status. Predictors showed regional variations. Delivery of ITNs through antenatal clinics presents fewer problems than delivery of IPTp. Many
Directory of Open Access Journals (Sweden)
Jenny Hill
Full Text Available Malaria in pregnancy has important consequences for mother and baby. Coverage with the World Health Organization-recommended prevention strategy for pregnant women in sub-Saharan Africa of intermittent preventive treatment in pregnancy (IPTp and insecticide-treated nets (ITNs is low. We conducted a systematic review to explore factors affecting delivery, access, and use of IPTp and ITNs among healthcare providers and women.We searched the Malaria in Pregnancy Library and Global Health Database from 1 January 1990 to 23 April 2013, without language restriction. Data extraction was performed by two investigators independently, and data was appraised for quality and content. Data on barriers and facilitators, and the effect of interventions, were explored using content analysis and narrative synthesis. We conducted a meta-analysis of determinants of IPTp and ITN uptake using random effects models, and performed subgroup analysis to evaluate consistency across interventions and study populations, countries, and enrolment sites. We did not perform a meta-ethnography of qualitative data. Ninety-eight articles were included, of which 20 were intervention studies. Key barriers to the provision of IPTp and ITNs were unclear policy and guidance on IPTp; general healthcare system issues, such as stockouts and user fees; health facility issues stemming from poor organisation, leading to poor quality of care; poor healthcare provider performance, including confusion over the timing of each IPTp dose; and women's poor antenatal attendance, affecting IPTp uptake. Key determinants of IPTp coverage were education, knowledge about malaria/IPTp, socio-economic status, parity, and number and timing of antenatal clinic visits. Key determinants of ITN coverage were employment status, education, knowledge about malaria/ITNs, age, and marital status. Predictors showed regional variations.Delivery of ITNs through antenatal clinics presents fewer problems than delivery
Insecticide-treated nets usage and malaria episodes among ...
African Journals Online (AJOL)
... is urgent need on the part of all the three tiers of Government for public health awareness campaigns through information, education and communication (IEC) to create positive ITN culture and usage. It is also suggested that ITN usage among boarding school pupils should be incorporated into school health service.
Developments in damage assessment by Marie Skłodowska-Curie TRUSS ITN project
González, A.
2017-05-01
The growth of cities, the impacts of climate change and the massive cost of providing new infrastructure provide the impetus for TRUSS (Training in Reducing Uncertainty in Structural Safety), a €3.7 million Marie Skłodowska-Curie Action Innovative Training Network project funded by EU’s Horizon 2020 programme, which aims to maximize the potential of infrastructure that already exists (http://trussitn.eu). For that purpose, TRUSS brings together an international, inter-sectoral and multidisciplinary collaboration between five academic and eleven industry institutions from five European countries. The project covers rail and road infrastructure, buildings and energy and marine infrastructure. This paper reports progress in fields such as advanced sensor-based structural health monitoring solutions - unmanned aerial vehicles, optical backscatter reflectometry, monitoring sensors mounted on vehicles, … - and innovative algorithms for structural designs and short- and long-term assessments of buildings, bridges, pavements, ships, ship unloaders, nuclear components and wind turbine towers that will support infrastructure operators and owners in managing their assets.
Energy Technology Data Exchange (ETDEWEB)
Wang, Yuan; Bao, Faxiu; Ma, Shaohui; Guo, Chenguang; Jin, Chenwang; Zhang, Ming [First Affiliated Hospital of Xi' an Jiaotong University, Department of Medical Imaging, Xi' an, Shaanxi (China); Li, Dan [First Affiliated Hospital of Xi' an Jiaotong University, Department of Respiratory and Critical Care Medicine, Xi' an, Shaanxi (China)
2014-08-15
Although abnormalities in metabolite compositions in the thalamus are well described in patients with idiopathic trigeminal neuralgia (ITN), differences in distinct thalamic subregions have not been measured with proton magnetic resonance spectroscopy ({sup 1}H-MRS), and whether there are correlations between thalamic metabolites and cognitive function still remain unknown. Multivoxel MRS was recorded to investigate the metabolic alterations in the thalamic subregions of patients with ITN. The regions of interest were localized in the anterior thalamus (A-Th), intralaminar portion of the thalamus (IL-Th), posterior lateral thalamus (PL-Th), posterior medial thalamus (PM-Th), and medial and lateral pulvinar of the thalamus (PuM-Th and PuL-Th). The N-acetylaspartate to creatine (NAA/Cr) and choline to creatine (Cho/Cr) ratios were measured in the ITN and control groups. Scores of the visual analogue scale (VAS) and the Montreal Cognitive Assessment (MoCA) were analyzed to correlate with the neuroradiological findings. The NAA/Cr ratio in the affected side of PM-Th and PL-Th in ITN patients was statistically lower than that in the corresponding regions of the thalamus in controls. The NAA/Cr ratio in the affected PM-Th was negatively associated with VAS and disease duration. Furthermore, decreases of NAA/Cr and Cho/Cr were detected in the affected side of IL-Th, and lower Cho/Cr was positively correlated with MoCA values in the ITN group. Our result of low level of NAA/Cr in the affected PM-Th probably serves as a marker of the pain-rating index, and decreased Cho/Cr in IL-Th may be an indicator of cognitive disorder in patients with ITN. (orig.)
Beiersmann, Claudia; De Allegri, Manuela; Tiendrebéogo, Justin; Yé, Maurice; Jahn, Albrecht; Mueller, Olaf
2010-12-04
Insecticide-treated nets (ITNs) have been confirmed to be a very effective tool in malaria control. Two different delivery strategies for roll-out of ITN programmes have been the focus of debate in the last years: free distribution and distribution through commercial marketing systems. They are now seen as complementary rather than opponent. Acceptance of these programmes by the community and involved providers is an important aspect influencing their sustainability. This paper looks at how providers perceived, understood and accepted two interventions involving two different delivery strategies (subsidized sales supported by social marketing and free distribution to pregnant women attending antenatal care services). The interventions took place in one province of north-western Burkina Faso in 2006 in the frame of a large randomized controlled ITN intervention study. For this descriptive qualitative study data were collected through focus group discussions and individual interviews. A total of four focus group discussions and eleven individual interviews have been conducted with the providers of the study interventions. The free distribution intervention was well accepted and perceived as running well. The health care staff had a positive and beneficial view of the intervention and did not feel overwhelmed by the additional workload. The social marketing intervention was also seen as positive by the rural shopkeepers. However, working in market economy, shopkeepers feared the risk of unsold ITNs, due to the low demand and capacity to pay for the product in the community. The combination of ITN free distribution and social marketing was in general well accepted by the different providers. However, low purchasing power of clients and the resulting financial insecurities of shopkeepers remain a challenge to ITN social marketing in rural SSA.
Phillips-Howard, Penelope A.; Nahlen, Bernard L.; Kolczak, Margarette S.; Hightower, Allen W.; ter Kuile, Feiko O.; Alaii, Jane A.; Gimnig, John E.; Arudo, John; Vulule, John M.; Odhacha, Amos; Kachur, S. Patrick; Schoute, Erik; Rosen, Daniel H.; Sexton, John D.; Oloo, Aggrey J.; Hawley, William A.
2003-01-01
A group-randomized controlled trial of insecticide (permethrin)-treated bed nets (ITNs) was conducted in an area of high perennial malaria transmission in western Kenya to test the effect of ITNs on all-cause mortality in children 1-59 months of age. Child deaths were monitored over a two-year
African Journals Online (AJOL)
ebutamanya
2015-05-25
May 25, 2015 ... Abstract. Introduction: insecticide-treated nets (ITNs) stood at center in the current efforts to prevent and control malaria at community and individual levels. Though ITNs are the most prominent measure for large-scale deployment in highly endemic areas their compliance in terms of ownership and usage ...
Directory of Open Access Journals (Sweden)
Carol Gamble
2007-03-01
Full Text Available BACKGROUND: Protection from malaria with insecticide-treated bednets (ITNs during pregnancy is widely advocated, but evidence of benefit has been inconsistent. We undertook a systematic review of randomised trials. METHODS AND FINDINGS: Three cluster-randomised and two individually randomised trials met the inclusion criteria; four from Africa (n = 6,418 and one from Thailand (n = 223. In Africa, ITNs compared to no nets increased mean birth weight by 55 g (95% confidence interval [CI] 21-88, reduced low birth weight by 23% (relative risk [RR] 0.77, 95% CI 0.61-0.98, and reduced miscarriages/stillbirths by 33% (RR 0.67, 0.47-0.97 in the first few pregnancies. Placental parasitaemia was reduced by 23% in all gravidae (RR 0.77, 0.66-0.90. The effects were apparent in the cluster-randomised trials and the one individually randomised trial in Africa. The trial in Thailand, which randomised individuals to ITNs or untreated nets, showed reductions in anaemia and fetal loss in all gravidae, but not reductions in clinical malaria or low birth weight. CONCLUSIONS: ITNs used throughout pregnancy or from mid-pregnancy onwards have a beneficial impact on pregnancy outcome in malaria-endemic Africa in the first few pregnancies. The potential impact of ITNs in pregnant women and their newborns in malaria regions outside Africa requires further research.
Parents' perception on use of insecticide-treated bed net in Port ...
African Journals Online (AJOL)
It involved the distribution of 15-itemed questionnaires to 212 parents (with at least one under five aged child), who brought their children to the Paediatrics outpatient clinic of University of Port Harcourt Teaching Hospital. Questions asked covered: the awareness of ITN, the number of ITN owned by each participant and the ...
Costs and effects of the Tanzanian national voucher scheme for insecticide-treated nets
Directory of Open Access Journals (Sweden)
Hanson Kara
2008-02-01
Full Text Available Abstract Background The cost-effectiveness of insecticide-treated nets (ITNs in reducing morbidity and mortality is well established. International focus has now moved on to how best to scale up coverage and what financing mechanisms might be used to achieve this. The approach in Tanzania has been to deliver a targeted subsidy for those most vulnerable to the effects of malaria while at the same time providing support to the development of the commercial ITN distribution system. In October 2004, with funds from the Global Fund to Fight AIDS Tuberculosis and Malaria, the government launched the Tanzania National Voucher Scheme (TNVS, a nationwide discounted voucher scheme for ITNs for pregnant women and their infants. This paper analyses the costs and effects of the scheme and compares it with other approaches to distribution. Methods Economic costs were estimated using the ingredients approach whereby all resources required in the delivery of the intervention (including the user contribution are quantified and valued. Effects were measured in terms of number of vouchers used (and therefore nets delivered and treated nets years. Estimates were also made for the cost per malaria case and death averted. Results and Conclusion The total financial cost of the programme represents around 5% of the Ministry of Health's total budget. The average economic cost of delivering an ITN using the voucher scheme, including the user contribution, was $7.57. The cost-effectiveness results are within the benchmarks set by other malaria prevention studies. The Government of Tanzania's approach to scaling up ITNs uses both the public and private sectors in order to achieve and sustain the level of coverage required to meet the Abuja targets. The results presented here suggest that the TNVS is a cost-effective strategy for delivering subsidized ITNs to targeted vulnerable groups.
Directory of Open Access Journals (Sweden)
Jahn Albrecht
2010-12-01
Full Text Available Abstract Background Insecticide-treated nets (ITNs have been confirmed to be a very effective tool in malaria control. Two different delivery strategies for roll-out of ITN programmes have been the focus of debate in the last years: free distribution and distribution through commercial marketing systems. They are now seen as complementary rather than opponent. Acceptance of these programmes by the community and involved providers is an important aspect influencing their sustainability. This paper looks at how providers perceived, understood and accepted two interventions involving two different delivery strategies (subsidized sales supported by social marketing and free distribution to pregnant women attending antenatal care services. Methods The interventions took place in one province of north-western Burkina Faso in 2006 in the frame of a large randomized controlled ITN intervention study. For this descriptive qualitative study data were collected through focus group discussions and individual interviews. A total of four focus group discussions and eleven individual interviews have been conducted with the providers of the study interventions. Results The free distribution intervention was well accepted and perceived as running well. The health care staff had a positive and beneficial view of the intervention and did not feel overwhelmed by the additional workload. The social marketing intervention was also seen as positive by the rural shopkeepers. However, working in market economy, shopkeepers feared the risk of unsold ITNs, due to the low demand and capacity to pay for the product in the community. Conclusion The combination of ITN free distribution and social marketing was in general well accepted by the different providers. However, low purchasing power of clients and the resulting financial insecurities of shopkeepers remain a challenge to ITN social marketing in rural SSA.
Gender and willingness to pay for insecticides treated bed nets in a poor rural area in Tanzania.
Mujinja, P G M; Makwaya, C K; Sauerborn, R
2004-12-01
To examine socio-economic and malaria related differences between males and females that may cause gender differences in willingness to pay (WTP) for insecticide treated bed nets in a poor rural area. A two-week-interval (test re-test) cross-sectional study. Kisarawe District in coastal Tanzania. Two hundred and fifty one males and two hundred dollars females were interviewed. Females had about 50% of the males' income. The monthly average income was about US dollars 10.50 for females and US dollars 20.20 for males. The proportion of respondents willing to pay for an ITN, for both males and females, declined as the ITN prices increased (Pdifference between men and women, between both rounds were not statistically significant (p>0.05). Male respondents reported a higher mean number of own underfives living in the household compared to women, the difference was not statistically significant (P>0.8). Willingness to pay for ITN was found to be independent of having an under five child with recent history of malaria. Among both males and females, there was an association between a recent experience with malaria episode and WTP, p=0.05 and p=0.02 respectively. Among females, the proportion of those willing to pay for another person, at the lowest ITN price, was significantly higher in those with under five children in their households than in those with no underfives. This was not the case among the male respondents as the association was not statistically significant. Contrary to expectations were was no statistically significant difference in WTP for an ITN between females and males. Further studies that link willingness and ability to pay are required in rural poor population, such studies may be valuable inputs to government policy on and planning of ITN interventions in the public and private sector.
Use of insecticide-treated mosquito nets for children under five years ...
African Journals Online (AJOL)
2011-06-13
Jun 13, 2011 ... Background: Insecticide-treated nets (ITNs) have proven to be one of the most effective means of reducing malaria morbidity and mortality in children and pregnant women. This study is carried out to determine the practice and determinants of ITN use for children under five years among care givers in an ...
15 CFR Appendix D to Part 30 - AES Filing Citation, Exemption and Exclusion Legends
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false AES Filing Citation, Exemption and... Appendix D to Part 30—AES Filing Citation, Exemption and Exclusion Legends I. USML Proof of Filing Citation AES ITN Example: AES X20060101987654. II. AES Proof of Filing Citation subpart A § 30.7 AES ITN...
African Journals Online (AJOL)
2005-08-11
Aug 11, 2005 ... Health workers can increase acceptability of ITN by promoting its use and serving as role model. ... In the homes where they were currently using ITN, children were the main users (59%). ... people and by serving as role models . Since studies .... willing to use it, 31.6% were willing to pay less than. N200 ...
Njagi, Joseph Kiambo; Magnussen, Pascal; Estambale, Benson; Ouma, John; Mugo, Benbolt
2003-01-01
To compare the effects of intermittent treatment with sulfadoxine-pyrimethamine (SP) given during the second and third trimester of pregnancy, the use of insecticide-treated nets (ITN), or the combination of both on haemoglobin (Hb) levels during pregnancy, a randomized, placebo-controlled intervention trial was conducted in a malaria-endemic area of western Kenya from July 1997 to September 1999. Primigravidae and secundigravidae were enrolled into the study and randomized into 4 intervention groups: (i) ITNs and SP, (ii) ITNs and placebo SP, (iii) SP alone, and (iv) placebo SP. All groups were offered case management and iron and folic acid supplementation. Seven hundred and fifty-two women were followed until delivery (53.2% were primigravidae and 46.8% secundigravidae). Among primigravidae in all the groups there was a significant improvement in Hb levels at delivery (107.6 g/L) compared with recruitment (101.9 g/L) (P anaemia was 55.8% (95% CI 30.6-71.8), of SP alone 50.9% (95% CI 22.2-69.0), and of ITNs 41.6% (95% CI 9.8-62.3). Among secundigravidae, Hb levels were slightly lower at delivery compared with recruitment (P = 0.03). It was concluded that malaria is a major cause of anaemia in primigravidae but that other causes play a more significant role in secundigravidae, and that intermittent treatment with SP or use of ITNs benefits primigravidae more than secundigravidae.
Directory of Open Access Journals (Sweden)
Novak Robert J
2009-11-01
Full Text Available Abstract Background Insecticide-treated bed nets (ITNs, including long-lasting insecticidal nets (LLINs, play a primary role in global campaigns to roll back malaria in tropical Africa. Effectiveness of treated nets depends on direct impacts on individual mosquitoes including killing and excite-repellency, which vary considerably among vector species due to variations in host-seeking behaviours. While monitoring and evaluation programmes of ITNs have focuses on morbidity and all-cause mortality in humans, local entomological context receives little attention. Without knowing the dynamics of local vector species and their responses to treated nets, it is difficult to predict clinical outcomes when ITN applications are scaled up across African continent. Sound model frameworks incorporating intricate interactions between mosquitoes and treated nets are needed to develop the predictive capacity for scale-up applications of ITNs. Methods An established agent-based model was extended to incorporate the direct outcomes, e.g. killing and avoidance, of individual mosquitoes exposing to ITNs in a hypothetical village setting with 50 houses and 90 aquatic habitats. Individual mosquitoes were tracked throughout the life cycle across the landscape. Four levels of coverage, i.e. 40, 60, 80 and 100%, were applied at the household level with treated houses having only one bed net. By using Latin hypercube sampling scheme, parameters governing killing, diverting and personal protection of net users were evaluated for their relative roles in containing mosquito populations, entomological inoculation rates (EIRs and malaria incidence. Results There were substantial gaps in coverage between households and individual persons, and 100% household coverage resulted in circa 50% coverage of the population. The results show that applications of ITNs could give rise to varying impacts on population-level metrics depending on values of parameters governing interactions of
Gu, Weidong; Novak, Robert J
2009-11-16
Insecticide-treated bed nets (ITNs), including long-lasting insecticidal nets (LLINs), play a primary role in global campaigns to roll back malaria in tropical Africa. Effectiveness of treated nets depends on direct impacts on individual mosquitoes including killing and excite-repellency, which vary considerably among vector species due to variations in host-seeking behaviours. While monitoring and evaluation programmes of ITNs have focuses on morbidity and all-cause mortality in humans, local entomological context receives little attention. Without knowing the dynamics of local vector species and their responses to treated nets, it is difficult to predict clinical outcomes when ITN applications are scaled up across African continent. Sound model frameworks incorporating intricate interactions between mosquitoes and treated nets are needed to develop the predictive capacity for scale-up applications of ITNs. An established agent-based model was extended to incorporate the direct outcomes, e.g. killing and avoidance, of individual mosquitoes exposing to ITNs in a hypothetical village setting with 50 houses and 90 aquatic habitats. Individual mosquitoes were tracked throughout the life cycle across the landscape. Four levels of coverage, i.e. 40, 60, 80 and 100%, were applied at the household level with treated houses having only one bed net. By using Latin hypercube sampling scheme, parameters governing killing, diverting and personal protection of net users were evaluated for their relative roles in containing mosquito populations, entomological inoculation rates (EIRs) and malaria incidence. There were substantial gaps in coverage between households and individual persons, and 100% household coverage resulted in circa 50% coverage of the population. The results show that applications of ITNs could give rise to varying impacts on population-level metrics depending on values of parameters governing interactions of mosquitoes and treated nets at the individual level
Matoke-Muhia, Damaris; Gimnig, John E; Kamau, Luna; Shililu, Josephat; Bayoh, M Nabie; Walker, Edward D
2016-06-10
The 2La chromosomal inversion, a genetic polymorphism in An. gambiae (sensu stricto) (s.s.), is associated with adaptation to microclimatic differences in humidity and desiccation resistance and mosquito behaviors. Ownership of insecticide-treated bed nets (ITNs) for malaria control has increased markedly in western Kenya in the last 20 years. An increase in the frequency of ITNs indoors could select against house entering or indoor resting of Anopheles mosquitoes. Thus, the frequency of the 2La inversion is postulated to change in An. gambiae (s.s.) with the increase of ITN ownership over time. Anopheles gambiae mosquitoes were sampled between 1994 and 2011 using pyrethrum knockdown, bednet traps and human landing catches (HLC) from Asembo and Seme, western Kenya. The 2La inversion was detected by a PCR assay with primers designed for proximal breakpoints of the 2La/a and 2L+(a)/+(a) chromosomal conformation. Mosquitoes were tested for malaria parasite infection by sporozoite ELISA. The frequency of the 2La chromosomal inversion declined from 100 % of all chromosomes in 1994 to 17 % in 2005 and remained low through 2011 (21 %). ITN ownership increased from 0 to > 90 % of houses in the study area during this interval. The decline in the frequency of the 2La chromosomal inversion was significantly, negatively correlated with year (r = -0.93) and with increase in ITN ownership (r = -0.96). The frequency of the homo- and heterokaryotypes departed significantly from Hardy-Weinberg equilibrium, suggesting that 2La/a karyotype was under selection, earlier in its favor and later, against it. Precipitation and maximum monthly temperature did not vary over time, therefore there was no trend in climate that could account for the decline. There was no significant difference in frequency of the 2La inversion in An. gambiae (s.s.) females sampled indoors or outdoors in HCL in 2011, nor was there an association between the 2La inversion and infection with Plasmodium
DEFF Research Database (Denmark)
Jordan, Ulrike; Vajen, Klaus; Bales, Chris
2014-01-01
-accompanying Master courses, placements of internships, and PhD scholarship projects. A new scholarship project, “SHINE”, was launched in autumn 2013 in the frame work of the Marie Curie program of the European Union (Initial Training Network, ITN). 13 PhD-scholarships on solar district heating, solar heat......SolNet, founded in 2006, is the first coordinated International PhD education program on Solar Thermal Engineering. The SolNet network is coordinated by the Institute of Thermal Engineering at Kassel University, Germany. The network offers PhD courses on solar heating and cooling, conference...... for industrial processes, as well as sorption stores and materials started in December 2013. Additionally, the project comprises a training program with five PhD courses and several workshops on solar thermal engineering that will be open also for other PhD students working in the field. The research projects...
Natural gas as fuel - chances and risks; Erdgas als Kraftstoff-Chancen und Risiken.
Energy Technology Data Exchange (ETDEWEB)
Wackertapp, H.; Wember, G. [Ruhrgas AG, Essen (Germany)
2001-11-01
By reducing the tax payable on natural gas as part of the ecological tax reform, the German government has created the economic framework for the break-through of the automotive fuel, natural gas. Consequently, natural gas has since become much more popular for driving motor engines. The gas industry sees its main task as the development of a natural gas filling station network. There are currently about 200 filling stations with natural gas fuelling facilities in Germany. (orig.) [German] Die Bundesregierung hat mit der in der oekologischen Steuerreform verankerten Mineraloelsteuerbeguenstigung fuer Erdgas die wirtschaftlichen Voraussetzungen fuer einen Durchbruch des neuen Kraftstoffs ''Erdgas'' geschaffen. Demzufolge hat der mobile Einsatz von Erdgas deutlich an Bedeutung gewonnen. Die Gaswirtschaft sieht den Aufbau der Betankungsinfrastruktur als ihre Hauptaufgabe an. Aktuell kann an etwa 200 Tankstellen Erdgas getankt werden. (orig.)
The perceptual influence of the cabin acoustics on the reproduced sound of a car audio system
DEFF Research Database (Denmark)
Kaplanis, Neofytos; Bech, Søren; Sakari, Tervo
2015-01-01
-end car audio system was performed for different physical settings of the car's cabin. A novel spatial auralization methodology was then used, and participants were asked to describe verbally the perceived acoustical characteristics of the stimuli. The elicited attributes were then analyzed following...... a previous review [Kaplanis et al., in 55th Int. Conf. Aud. Eng. Soc. (2014)] and possible links to the acoustical properties of the car cabin are discussed. [This study is a part of Marie Curie Network on Dereverberation and Reverberation of Audio, Music, and Speech. EU-FP7 under agreement ITN-GA-2012-316969.]...
Directory of Open Access Journals (Sweden)
Crowell Valerie
2013-01-01
Full Text Available Abstract Background Past experience and modelling suggest that, in most cases, mass treatment strategies are not likely to succeed in interrupting Plasmodium falciparum malaria transmission. However, this does not preclude their use to reduce disease burden. Mass screening and treatment (MSAT is preferred to mass drug administration (MDA, as the latter involves massive over-use of drugs. This paper reports simulations of the incremental cost-effectiveness of well-conducted MSAT campaigns as a strategy for P. falciparum malaria disease-burden reduction in settings with varying receptivity (ability of the combined vector population in a setting to transmit disease and access to case management. Methods MSAT incremental cost-effectiveness ratios (ICERs were estimated in different sub-Saharan African settings using simulation models of the dynamics of malaria and a literature-based MSAT cost estimate. Imported infections were simulated at a rate of two per 1,000 population per annum. These estimates were compared to the ICERs of scaling up case management or insecticide-treated net (ITN coverage in each baseline health system, in the absence of MSAT. Results MSAT averted most episodes, and resulted in the lowest ICERs, in settings with a moderate level of disease burden. At a low pre-intervention entomological inoculation rate (EIR of two infectious bites per adult per annum (IBPAPA MSAT was never more cost-effective than scaling up ITNs or case management coverage. However, at pre-intervention entomological inoculation rates (EIRs of 20 and 50 IBPAPA and ITN coverage levels of 40 or 60%, respectively, the ICER of MSAT was similar to that of scaling up ITN coverage further. Conclusions In all the transmission settings considered, achieving a minimal level of ITN coverage is a “best buy”. At low transmission, MSAT probably is not worth considering. Instead, MSAT may be suitable at medium to high levels of transmission and at moderate ITN coverage
Ferreira, Claudia P; Lyra, Silas P; Azevedo, Franciane; Greenhalgh, David; Massad, Eduardo
2017-09-15
Evidence of changing in biting and resting behaviour of the main malaria vectors has been mounting up in recent years as a result of selective pressure by the widespread and long-term use of insecticide-treated bed nets (ITNs), and indoor residual spraying. The impact of resistance behaviour on malaria intervention efficacy has important implications for the epidemiology and malaria control programmes. In this context, a theoretical framework is presented to understand the mechanisms determining the evolution of feeding behaviour under the pressure of use of ITNs. An agent-based stochastic model simulates the impact of insecticide-treated bed nets on mosquito fitness by reducing the biting rates, as well as increasing mortality rates. The model also incorporates a heritability function that provides the necessary genetic plasticity upon which natural selection would act to maximize the fitness under the pressure of the control strategy. The asymptotic equilibrium distribution of mosquito population versus biting time is shown for several daily uses of ITNs, and the expected disruptive selection on this mosquito trait is observed in the simulations. The relative fitness of strains that bite at much earlier time with respect to the wild strains, when a threshold of about 50% of ITNs coverage highlights the hypothesis of a behaviour selection. A sensitivity analysis has shown that the top three parameters that play a dominant role on the mosquito fitness are the proportion of individuals using bed nets and its effectiveness, the impact of bed nets on mosquito oviposition, and the mosquito genetic plasticity related to changing in biting time. By taking the evolutionary aspect into account, the model was able to show that the long-term use of ITNs, although representing an undisputed success in reducing malaria incidence and mortality in many affected areas, is not free of undesirable side effects. From the evolutionary point of view of the parasite virulence, it
Lives saved from malaria prevention in Africa--evidence to sustain cost-effective gains
Directory of Open Access Journals (Sweden)
Korenromp Eline L
2012-03-01
Full Text Available Abstract Lives saved have become a standard metric to express health benefits across interventions and diseases. Recent estimates of malaria-attributable under-five deaths prevented using the Lives Saved tool (LiST, extrapolating effectiveness estimates from community-randomized trials of scale-up of insecticide-treated nets (ITNs in the 1990s, confirm the substantial impact and good cost-effectiveness that ITNs have achieved in high-endemic sub-Saharan Africa. An even higher cost-effectiveness would likely have been found if the modelling had included the additional indirect mortality impact of ITNs on preventing deaths from other common child illnesses, to which malaria contributes as a risk factor. As conventional ITNs are being replaced by long-lasting insecticidal nets and scale-up is expanded to target universal coverage for full, all-age populations at risk, enhanced transmission reduction may--above certain thresholds--enhance the mortality impact beyond that observed in the trials of the 1990s. On the other hand, lives saved by ITNs might fall if improved malaria case management with artemisinin-based combination therapy averts the deaths that ITNs would otherwise prevent. Validation and updating of LiST's simple assumption of a universal, fixed coverage-to-mortality-reduction ratio will require enhanced national programme and impact monitoring and evaluation. Key indicators for time trend analysis include malaria-related mortality from population-based surveys and vital registration, vector control and treatment coverage from surveys, and parasitologically-confirmed malaria cases and deaths recorded in health facilities. Indispensable is triangulation with dynamic transmission models, fitted to long-term trend data on vector, parasite and human populations over successive phases of malaria control and elimination. Sound, locally optimized budget allocation including on monitoring and evaluation priorities will benefit much if policy
Directory of Open Access Journals (Sweden)
M. Nsakashalo-Senkwe
2017-11-01
Full Text Available Lymphatic filariasis (LF is a mosquito-borne disease, broadly endemic in Zambia, and is targeted for elimination by mass drug administration (MDA of albendazole and diethylcarbamazine citrate (DEC to at-risk populations. Anopheline mosquitoes are primary vectors of LF in Africa, and it is possible that the significant scale-up of malaria vector control over the past decade may have also impacted LF transmission, and contributed to a decrease in prevalence in Zambia. We therefore aimed to examine the putative association between decreasing LF prevalence and increasing coverage of insecticide-treated mosquito nets (ITNs for malaria vector control, by comparing LF mapping data collected between 2003–2005 and 2009–2011 to LF sentinel site prevalence data collected between 2012 and 2014, before any anti-LF MDA was started. The coverage of ITNs for malaria was quantified and compared for each site in relation to the dynamics of LF. We found a significant decrease in LF prevalence from the years 2003–2005 (11.5% CI95 6.6; 16.4 to 2012–2014 (0.6% CI95 0.03; 1.1; at the same time, there was a significant scale-up of ITNs across the country from 0.2% (CI95 0.0; 0.3 to 76.1% (CI95 71.4; 80.7 respectively. The creation and comparison of two linear models demonstrated that the geographical and temporal variation in ITN coverage was a better predictor of LF prevalence than year alone. Whilst a causal relationship between LF prevalence and ITN coverage cannot be proved, we propose that the scale-up of ITNs has helped to control Anopheles mosquito populations, which have in turn impacted on LF transmission significantly before the scale-up of MDA. This putative synergy with vector control has helped to put Zambia on track to meet national and global goals of LF elimination by 2020.
Directory of Open Access Journals (Sweden)
Ayodeji M. Adebayo
2015-02-01
Full Text Available Introduction. The morbidity and mortality from malaria are still unacceptably high in the developing countries, especially among the vulnerable groups like pregnant women and under-five children, despite all control efforts. The knowledge about the preventive measures of malaria is an important preceding factor for the acceptance and use of malaria preventive measures like Insecticide Treated Nets (ITN by community members. Therefore, this study assessed the knowledge of malaria prevention among caregivers of under-five children and pregnant women in a rural community in Southwest Nigeria.Methodology. This is part of a larger malaria prevention study in rural Southwest Nigeria. A descriptive cross-sectional survey was conducted among pregnant women and caregivers of under-five children in Igbo-Ora, a rural town in Southwest Nigeria using a semi-structured, interviewer-administered questionnaire. Information was obtained on knowledge of malaria prevention, and overall composite scores were computed for knowledge of malaria prevention and ITN use. Data were analyzed using SPSS version 16. Associations between variables were tested using a Chi-square with the level of statistical significance set at 5%.Results. Of the 631 respondents, 84.9% were caregivers of under-five children and 67.7% were married. Mean age was 27.7 ± 6.3 years with 53.4% aged between 20 and 29 years. Majority (91.1% had at least primary school education and 60.2% were traders. Overall, 57.7% had poor knowledge of malaria prevention. A good proportion (83.5% were aware of the use of ITN for malaria prevention while 30.6% had poor knowledge of its use. Respondents who were younger (<30 years, had at least primary education and earn <10,000/per month had significantly poor knowledge of ITN use in malaria prevention. Majority (60.0% respondents had poor attitude regarding use of ITNs.Conclusion. This study showed that the knowledge of malaria prevention is still low among under
On extending Kohn-Sham density functionals to systems with fractional number of electrons.
Li, Chen; Lu, Jianfeng; Yang, Weitao
2017-06-07
We analyze four ways of formulating the Kohn-Sham (KS) density functionals with a fractional number of electrons, through extending the constrained search space from the Kohn-Sham and the generalized Kohn-Sham (GKS) non-interacting v-representable density domain for integer systems to four different sets of densities for fractional systems. In particular, these density sets are (I) ensemble interacting N-representable densities, (II) ensemble non-interacting N-representable densities, (III) non-interacting densities by the Janak construction, and (IV) non-interacting densities whose composing orbitals satisfy the Aufbau occupation principle. By proving the equivalence of the underlying first order reduced density matrices associated with these densities, we show that sets (I), (II), and (III) are equivalent, and all reduce to the Janak construction. Moreover, for functionals with the ensemble v-representable assumption at the minimizer, (III) reduces to (IV) and thus justifies the previous use of the Aufbau protocol within the (G)KS framework in the study of the ground state of fractional electron systems, as defined in the grand canonical ensemble at zero temperature. By further analyzing the Aufbau solution for different density functional approximations (DFAs) in the (G)KS scheme, we rigorously prove that there can be one and only one fractional occupation for the Hartree Fock functional, while there can be multiple fractional occupations for general DFAs in the presence of degeneracy. This has been confirmed by numerical calculations using the local density approximation as a representative of general DFAs. This work thus clarifies important issues on density functional theory calculations for fractional electron systems.
Ichida, Michelle Cristina; de Almeida, Antonio Nogueira; da Nobrega, Jose Claudio Marinho; Teixeira, Manoel Jacobsen; de Siqueira, José Tadeu Tesseroli; de Siqueira, Silvia R D T
2015-06-01
Idiopathic trigeminal neuralgia (iTN) is a neurological condition treated with pharmacotherapy or neurosurgery. There is a lack of comparative papers regarding the outcomes of neurosurgery in patients with iTN. The objective of this study was to investigate sensory thresholds and masticatory function in 78 patients with iTN who underwent microvascular decompression (MVD) or balloon compression (BC), and compare these treatments with carbamazepine and 30 untreated healthy controls. The authors conducted a case-controlled longitudinal study. Patients were referred to 1 of 3 groups: MVD, BC, or carbamazepine. All patients were evaluated before and after treatment with a systematic protocol composed of a clinical orofacial questionnaire, Research Diagnostic Criteria for temporomandibular disorders, Helkimo indices, and a quantitative sensory-testing protocol (gustative, olfactory, cold, warm, touch, vibration, superficial, and deep pain thresholds). Both MVD and BC were effective at reducing pain intensity (p = 0.012) and carbamazepine doses (p sweet (p = 0.014) and salty (p = 0.003) thresholds. The sour threshold decreased (p = 0.003) and cold and warm thresholds increased (p sensorial and motor deficits after BC need to be included as targets directly associated with the success of the surgery and need to be assessed and relieved as goals in the treatment of iTN.
Magnetisches Tracking für die Navigation mit dem da Vinci® Surgical System
Nickel, Felix; Wegner, Ingmar; Kenngott, Hannes; Neuhaus, Jochen; Müller-Stich, Beat P.; Meinzer, Hans-Peter; Gutt, Carsten N.
In dieser Studie wurde untersucht ob in einem typischen OP-Aufbau mit dem da Vinci® Telemanipulator elektromagnetisches Tracking für die Realisation eines Navigationssystems eingesetzt werden kann. Hierfür wurde in einem realen OP-Aufbau untersucht, wie stark metallische und ferromagnetisch wirksame Objekte wie Operationstisch und Telemanipulator das elektromagnetische Feld des Trackingsystems beeinflussen. Die Ergebnisse zeigen, dass der Telemanipulator nur unwesentlich die Störung des Magnetfeldes durch den OP-Tisch verstärkt. Insbesondere die Bewegung der Instrumente im Trackingvolumen verursachte keine zusätzliche relevante Störung des Magnetfeldes. Bei Begrenzung des Trackingvolumens auf eine Länge von 190 mm, Höhe von 200mm und Breite von 400 mm war der maximale Fehler in diesem Bereich an allen Messpunkten kleiner 10 mm. Der Einsatz von elektromagnetischem Tracking für die Navigation mit dem da Vinci® Surgical System ist somit in einem begrenzten Arbeitsvolumen mit hinreichender Genauigkeit möglich.
Malaria control. generating evidence from local to global level
Plüss, Bianca
2009-01-01
In addition of the provision of effective treatment to each case, malaria control is heavily relying on vector control with either insecticide treated mosquito nets (ITNs) or indoor residual spraying (IRS). The effectiveness of ITNs in controlling malaria in many different settings has already been comprehensively documented. On the other hand, while IRS has a long and distinguished history in malaria control, its health effects have never been properly quantified. The present thesis aimed...
Directory of Open Access Journals (Sweden)
Emmanuel A Temu
Full Text Available BACKGROUND: African countries are scaling up malaria interventions, especially insecticide treated nets (ITN and indoor residual spraying (IRS, for which ambitious coverage targets have been set. In spite of these efforts infection prevalence remains high in many parts of the continent. This study investigated risk factors for malaria infection in children using three malaria indicator surveys from Zambezia province, Mozambique. The impact of IRS and ITNs, the effects of keeping farm animals and of the construction material of roofs of houses and other potential risk factors associated with malaria infection in children were assessed. METHODS: Cross-sectional community-based surveys were conducted in October of 2006, 2007 and 2008. A total of 8338 children (ages 1-15 years from 2748 households were included in the study. All children were screened for malaria by rapid diagnostic tests. Caregiver interviews were used to assess household demographic and wealth characteristics and ITN and IRS coverage. Associations between malaria infection, vector control interventions and potential risk factors were assessed. RESULTS: Overall, the prevalence of malaria infection was 47.8% (95%CI: 38.7%-57.1% in children 1-15 years of age, less than a quarter of children (23.1%, 95%CI: 19.1%-27.6% were sleeping under ITN and almost two thirds were living in IRS treated houses (coverage 65.4%, 95%CI: 51.5%-77.0%. Protective factors that were independently associated with malaria infection were: sleeping in an IRS house without sleeping under ITN (Odds Ratio (OR= 0.6; 95%CI: 0.4-0.9; additional protection due to sleeping under ITN in an IRS treated house (OR = 0.5; 95%CI: 0.3-0.7 versus sleeping in an unsprayed house without a ITN; and parental education (primary/secondary: OR = 0.6; 95%CI: 0.5-0.7 versus parents with no education. Increased risk of infection was associated with: current fever (OR = 1.2; 95%CI: 1.0-1.5 versus no fever; pig keeping (OR
Korenromp, Eline; Hamilton, Matthew; Sanders, Rachel; Mahiané, Guy; Briët, Olivier J T; Smith, Thomas; Winfrey, William; Walker, Neff; Stover, John
2017-11-07
In malaria-endemic countries, malaria prevention and treatment are critical for child health. In the context of intervention scale-up and rapid changes in endemicity, projections of intervention impact and optimized program scale-up strategies need to take into account the consequent dynamics of transmission and immunity. The new Spectrum-Malaria program planning tool was used to project health impacts of Insecticide-Treated mosquito Nets (ITNs) and effective management of uncomplicated malaria cases (CMU), among other interventions, on malaria infection prevalence, case incidence and mortality in children 0-4 years, 5-14 years of age and adults. Spectrum-Malaria uses statistical models fitted to simulations of the dynamic effects of increasing intervention coverage on these burdens as a function of baseline malaria endemicity, seasonality in transmission and malaria intervention coverage levels (estimated for years 2000 to 2015 by the World Health Organization and Malaria Atlas Project). Spectrum-Malaria projections of proportional reductions in under-five malaria mortality were compared with those of the Lives Saved Tool (LiST) for the Democratic Republic of the Congo and Zambia, for given (standardized) scenarios of ITN and/or CMU scale-up over 2016-2030. Proportional mortality reductions over the first two years following scale-up of ITNs from near-zero baselines to moderately higher coverages align well between LiST and Spectrum-Malaria -as expected since both models were fitted to cluster-randomized ITN trials in moderate-to-high-endemic settings with 2-year durations. For further scale-up from moderately high ITN coverage to near-universal coverage (as currently relevant for strategic planning for many countries), Spectrum-Malaria predicts smaller additional ITN impacts than LiST, reflecting progressive saturation. For CMU, especially in the longer term (over 2022-2030) and for lower-endemic settings (like Zambia), Spectrum-Malaria projects larger
Low Utilization of Insecticide-Treated Bed Net among Pregnant Women in the Middle Belt of Ghana
Grace Manu; Ellen Abrafi Boamah-Kaali; Lawrence Gyabaa Febir; Emmanuel Ayipah; Seth Owusu-Agyei; Kwaku Poku Asante
2017-01-01
Background. Malaria in pregnancy leads to low birth weight, premature birth, anaemia, and maternal and neonatal mortality. Use of insecticide-treated nets (ITNs) during pregnancy is one of the proven interventions to reduce the malaria burden. However, Ghana has not achieved its target for ITN use among pregnant women. Methods. A qualitative study was conducted in seven communities purposively selected from the middle belt of Ghana. Participants who had delivered in the six months prior to th...
Directory of Open Access Journals (Sweden)
Jayne Webster
Full Text Available INTRODUCTION: The objectives of the study were to evaluate the health system effectiveness of ANC for the delivery of a dose of IPTp and an ITN to women attending ANC during eligible gestation, and to identify the predictors of systems effectiveness. METHODS: A cross sectional study was undertaken in 10 health facilities including structured non-participant observations of the ANC process for 780 pregnant women followed by exit interviews. The proportion of pregnant women receiving a dose of IPTp-SP and an ITN was assessed. Predictors of each ineffective intermediate process were identified using multivariable logistic regression. RESULTS: Overall, 0% and 24.5% of pregnant women of eligible gestation on the first visit to ANC received a dose of IPTp-SP by DOT at the district and community levels respectively. Ineffective intermediate processes were 'given IPTp-SP at the ANC' 63.9% and 74.0% (95% CI 62.0, 83.3, and 'given IPTp-SP by DOT' 0% and 34.3% (95% CI 10.5, 69.8, at district and community levels, respectively. Delivery of ITNs was effective where they were in stock; however stock-outs were a problem. Predictors of receiving IPTp-SP at the district level were 4 to 6 months gestation, not reporting symptoms of malaria at ANC visit and the amount of money spent during the visit. At the community level, the predictors were 4 to 6 months gestation, maternal education below primary level, routine ANC visit (not for an illness, palpation of the abdomen, and expenditure of money in ANC. CONCLUSION: In Segou District, the delivery of IPTp-SP was ineffective; whilst ITN delivery was effective if ITNs were in stock. Predictors of receiving IPTp-SP at the district and community levels included gestational age, the amount of expenditure during the ANC visit and no illness.
Directory of Open Access Journals (Sweden)
Clara Menéndez
2008-04-01
Full Text Available Current recommendations to prevent malaria in African pregnant women rely on insecticide treated nets (ITNs and intermittent preventive treatment (IPTp. However, there is no information on the safety and efficacy of their combined use.1030 pregnant Mozambican women of all gravidities received a long-lasting ITN during antenatal clinic (ANC visits and, irrespective of HIV status, were enrolled in a randomised, double blind, placebo-controlled trial, to assess the safety and efficacy of 2-dose sulphadoxine-pyrimethamine (SP. The main outcome was the reduction in low birth weight.Two-dose SP was safe and well tolerated, but was not associated with reductions in anaemia prevalence at delivery (RR, 0.92 [95% CI, 0.79-1.08], low birth weight (RR, 0.99 [95% CI, 0.70-1.39], or overall placental infection (p = 0.964. However, the SP group showed a 40% reduction (95% CI, 7.40-61.20]; p = 0.020 in the incidence of clinical malaria during pregnancy, and reductions in the prevalence of peripheral parasitaemia (7.10% vs 15.15% (p<0.001, and of actively infected placentas (7.04% vs 13.60% (p = 0.002. There was a reduction in severe anaemia at delivery of borderline statistical significance (p = 0.055. These effects were not modified by gravidity or HIV status. Reported ITN's use was more than 90% in both groups.Two-dose SP was associated with a reduction in some indicators, but these were not translated to significant improvement in other maternal or birth outcomes. The use of ITNs during pregnancy may reduce the need to administer IPTp. ITNs should be part of the ANC package in sub-Saharan Africa.ClinicalTrials.gov NCT00209781.
Directory of Open Access Journals (Sweden)
Sibhatu Biadgilign
2012-01-01
Full Text Available Background. Malaria remains a major cause of mortality and morbidity in the world, and particularly in sub-Saharan Africa. Objectives. The aim of this study was to determine ownership and utilization of ITNs among households with children under five in the previous night. Methods. A community based cross-sectional study was conducted in Gursum district in Eastern Ethiopia. A total of 335 households were surveyed using a pretested structured questionnaire administered though house-to-house interviews. Results. Household ownership for at least one mosquito net and use of nets were 62.4% (95% CI 57.2–67.6% and 21.5% (95% CI 17.1–25.9%, respectively. Households who received or were told about ITN in the last 6 months were three times more likely to have used it than those who were not (OR 3.25; 95% CI 1.5–7.10. Households whose heads were engaged as a farmer (adjusted OR 0.137; 95% CI: 0.04–0.50 and housewife (OR 0.26; 95% CI: 0.08–0.82 were less likely to use ITN than those of other occupations. Conclusion. The findings indicate low ITN ownership and utilization among the households. Intensive health education and community mobilization effort should be employed to increase the possession and proper utilization of insecticide treated bed nets.
Aufbau des humanoiden Roboters BART III
Resetov, Dimitri; Pietsch, Björn; Gerth, Wilfried
Der vorliegende Beitrag präsentiert den humanoiden Roboter BART III, der am Institut für Regelungstechnik als eine robuste und erweiterbare Plattform für weiterführende Grundlagenforschung zur zweibeinigen Fortbewegung entwickelt wurde. Im Gegensatz zu den bisher am IRT genutzten Robotern BARt-UH und LISA besitzt der neue Roboter einen beweglichen Oberkörper mit einem Bauchgelenk und Armen. BART III besitzt insgesamt 19 aktive Freiheitsgrade, 12 davon im Unterkörper. Ein weiteres Merkmal des Roboters ist die im gesamten Körper verteilte Ansteuerelektronik, die neben der lokalen Motorregelung diverse sicherheitsrelevante Funktionen übernimmt.
Directory of Open Access Journals (Sweden)
Blessing Uzoamaka Ejike
2017-02-01
Full Text Available Objective: To assess and compare the impact of home management of malaria prevalence amongst pregnant women in Aba South Local Government Area of Abia State, Eastern Nigeria. Methods: Blood samples from 432 pregnant women who attended Primary Health Care Centre and Abia State University Teaching Hospital were examined using Giemsa-stained thick and thin films. Structured questionnaires were also administered to the women from whom blood samples were collected. Results: Most of the respondents 192 (44.4% were found to use insecticide-treated nets (ITNs with a malaria prevalence of 27.1%. Other home management strategies used were burning of local plants 3 (0.7% with a malaria prevalence of 33.3%. Those who did not own ITNs had a malaria prevalence of 86.7%. Conclusions: The need to intensify effort on educating pregnant women on the proper use of home management strategies especially the use of ITNs and local plants that have anti mosquito activity is encouraged.
Energy Technology Data Exchange (ETDEWEB)
Nast, M. [Deutsches Zentrum fuer Luft- und Raumfahrt e.V. (DLR), Stuttgart (Germany). Abt. Systemanalyse und Technikbewertung; Boehnisch, H. [Zentrum fuer Sonnenenergie- und Wasserstoff-Forschung Baden-Wuerttemberg (ZSW), Stuttgart (Germany)
1998-02-01
District heating allows the utilization of biomass in low emission heating plants, the exploitation of solar energy and the seasonal storage of heat. If a sustainable energy supply system is to be created, district heating must not only be the system of choice for new housing districts but must also be retrofitted in existing settlements. The detailed analysis of a rural community shows that large segments of existing buildings can be connected to district heating systems even in regions with predominantly single dwellings and rural housing densities. The conditions necessary for establishing district heating systems are discussed. (orig.) [Deutsch] Nahwaermesysteme ermoeglichen, fossile und biogene Brennstoffe einzusetzen und lassen sich an saisonale Waermespeicher anschliessen. Zum Aufbau einer nachhaltigen Energieversorgung ist Nahwaerme nicht nur in Neubaugebieten notwendig sondern muss auch in den schon laenger genutzten Gebaeudebestand integriert werden. Das Beispiel einer umfassend analysierten Landgemeinde zeigt, dass ein grosser Teil des bestehenden Gebaeudebestandes an Waermenetze angeschlossen werden kann, selbst bei vorherrschender Bebauung mit Einfamilienhaeusern und laendlichen Gebaeudedichten. Die notwendigen Rahmenbedingungen fuer den Aufbau einer Nahwaermeversorgung werden erlaeutert. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Benzler, J.H.; Boess, J.; Capelle, A.; Gehrt, E.; Heineke, H.J.; Kues, J.; Mueller, U.; Oelkers, K.H.; Roeschmann, G.; Schneider, J.; Sponagel, H. [Niedersaechsisches Landesamt fuer Bodenforschung, Hannover (Germany). Abt. Bodenkunde
1997-12-31
In the first part the multitude of activities in Lower Saxony on soil information are described, in particular the structure of the NIBIS (Niedersaechsisches Bodeninformationssystem - Lower Saxony Soil Information System) and the wide range of possibilities for its usage. The second part is meant to enhance the interest in and the knowledge about soils. The history of land use and the great structural variety of soils in Lower Saxony, the complex associations and their distribution are presented in cross sections, profiles and maps. A detailed bibliography provides information about the relevant literature. (orig.) [Deutsch] Im ersten Teil werden die vielfaeltigen Aktivitaeten in Niedersachsen auf dem Gebiet der Bodeninformation verdeutlicht. Insbesondere werden der Aufbau des Niedersaechsischen Informationssystems NIBIS und seine Nutzungsmoeglichkeiten dargestellt. Im zweiten Kapitel soll das Verstaendnis fuer das Medium Boden geweckt werden. Die Geschichte der Bodennutzung sowie die Vielfalt des Aufbaues der Boeden Niedersachsens, die Komplexibilitaet ihrer Vergesellschaftung und die Vorstellungen zur Bodenverbreitung werden mit Gelaendeschnitten, Profilaufnahmen und Karten vorgestellt. Ein ausfuehrliches Literaturverzeichnis verweist auf weiterfuehrende Schriften. (orig.)
Directory of Open Access Journals (Sweden)
Tabala Martine
2008-09-01
Full Text Available Abstract Background To describe malaria knowledge, attitudes toward malaria and bed net use, levels of ownership and use of bed nets, and factors associated with ownership and use among pregnant women attending their first antenatal care (ANC visit in Kinshasa, DRC. Methods Women attending their first ANC visit at one maternity in Kinshasa were recruited to take part in a study where they were given free insecticide treated bed nets (ITNs and then followed up at delivery and 6 months post delivery to assess ITN use. This study describes the baseline levels of bed net ownership and use, attitudes towards net use and factors associated with net use Results Among 351 women interviewed at baseline, 115 (33% already owned a bed net and 86 (25% reported to have slept under the net the previous night. Cost was reported as the reason for not owning a net by 48% of the 236 women who did not own one. In multivariable analyses, women who had secondary school or higher education were 3.4 times more likely to own a net (95% CI 1.6–7.3 and 2.8 times more likely to have used a net (95% CI 1.3–6.0 compared to women with less education Conclusion Distribution of ITNs in antenatal clinics in this setting is needed and feasible. The potential for ITN use by this target population is high.
Kants Theorie der Sonne: Physikgeschichte
Jacobi, Manfred
2005-01-01
Im Rahmen seiner Kosmogonie entwickelte der junge Immanuel Kant eine Theorie der Sonne. Sie ist ein einzigartiges Zeugnis seiner intuitiven Vorstellungskraft und beweist auch die Leistungsfähigkeit der damaligen, vorwiegend von Newton geprägten Weltsicht. Entstehung, Aufbau und Dynamik der Sonne werden in Kants Theorie ebenso erklärt wie etwa das Phänomen der Sonnenflecken.
Prevention and treatment practices and implications for malaria control in Mukono District Uganda
DEFF Research Database (Denmark)
Mbonye, A K; Bygbjerg, I C; Magnussen, P
2008-01-01
and used insecticide-treated nets (ITNs) for malaria prevention. Similarly, only a few households (86, 1.5%) used indoor residual spraying. Self-treatment with home-stocked drugs was high, yet there was low awareness of the effectiveness of expired drugs on malaria treatment. Self-reported malaria...... was associated with socioeconomic, behavioural and environmental factors, but more especially with household ownership of ITNs. These results will contribute to the current debate on identifying new approaches for scaling-up prevention interventions and effective case management, as well as selection of priority...
Determinants of use of insecticide-treated nets among pregnant women in Nigeria
Directory of Open Access Journals (Sweden)
Ezire O
2015-06-01
Full Text Available Onoriode Ezire,1 Samson B Adebayo,2 Omokhudu Idogho,3 Elijah A Bamgboye,4 Ernest Nwokolo5 1Research and Evaluation Division, Society for Family Health, Abuja, 2National Agency for Food and Drug Administration and Control, Abuja, 3Enhancing Nigeria’s Response to HIV & AIDS, Abuja, 4Medical Statistics, University of Ibadan, Ibadan, 5Society for Family Health, Abuja, Nigeria Background: Malaria in pregnancy is still a major health issue in Nigeria, accounting for about 33% of cause of maternal death. Despite massive efforts to make insecticide-treated net (ITN available to pregnant women in Nigeria, the use is still low. This study was conducted to identify facilitators and inhibitors for the use of ITN/long-lasting insecticidal net (LLIN among pregnant women in Nigeria.Methods: Data were obtained from the 2011 State-Specific HIV & AIDS, Reproductive and Child Health Survey conducted in 18 states of Nigeria. The survey was a population-based study among men and women of reproductive age living in households in rural and urban areas of Nigeria. Multistage cluster sampling technique was used to select eligible respondents. The sample size per state was 960 respondents. Data were collected between October and November 2011. The analysis was done using Statistical Package for Social Sciences (SPSS version 20.Results: A total of 11.5% of the respondents were pregnant at the time of the survey of which 73.2% lived in rural location and approximately 70% were either not educated or attained at most a primary school education. A total of 93.2% of respondents have heard of net, 82.6% were confident that they can hang or use a net, and 64.6% owned an ITN/LLIN in their household while the actual use was just 19.2%. We found education, location (urban–rural, confidence to use a net, and knowledge that the use of a net can protect a pregnant woman from malaria to be significant at 5% level. The number of nets owned per household, the length of time the net
Mathematical modeling for control zika transmission
Nugraha, Edwin Setiawan; Naiborhu, Janson; Nuraini, Nuning; Ahmadin
2017-11-01
After 70 years since the zika was identified in Uganda, zika is now documented in 62 countries. In general, people infected with this disease do not experience severe conditions, but for pregnant women can cause serious problems because the zika can spread to the fetus. One result, zika can cause abnormalities in the fetal brain called microcephaly. Control and prevention are very important to reduce the spread of this disease. Here, we discussed the problem of optimal control in the model of zika transmission associated with the use of insecticide-treated nets (ITN) and indoor residual spraying (IRS). Using the approach of optimal control theory, we completed the objective function so that the infected population and its control cost are minimum. Numerically using the Forward-Backward Sweep Method, we obtained the control design of ITN and IRS as a function of time. The results show that the use of both simultaneously is more effective in reducing the population of infection than the use of ITN alone or the IRS alone.
Energy Technology Data Exchange (ETDEWEB)
Wolters, T.
2000-06-01
Reliable gas supply requires a reliable and economical organisational and procedural structure. These aspects were discussed theoretically and with the aid of examples in a diploma thesis which received a DVGW award. [German] Eine sichere Gasversorgung verlangt auch nach einer planvollen und angemessenen Aufbau- und Ablauforganisation eines Unternehmens. In einer vom DVGW ausgezeichneten Diplomarbeit wurden diese Aspekte theoretisch und an Beispielen eroertert. (orig.)
Bauernhansl, Thomas
2015-01-01
Der Vortrag "Integrated Industry: Disruptive Development for Business Models and Management Systems" behandelt folgende Themenkomplexe: - Die digitale Welt von heute und morgen - Aufbau von Eco-Systems - Design disruptiver Geschäftsmodelle - XaaS-Concept - Everything as a Service - Digitalisierung von Geschäftsmodellen - Kernthesen für Wertschöpfungsmodelle der Zukunft - Big Data - Neue Architekturen - Industrie 4.0 - Disruptive Geschäftsmodelle
Directory of Open Access Journals (Sweden)
Kolaczinski Jan H
2004-06-01
Full Text Available Abstract Background Introducing sustainability and self-reliance is essential in chronic humanitarian emergencies before financial assistance is phased out. In Pakistan-based Afghan refugee camps, this was attempted through shifting from indoor residual spraying (IRS to the subsidized sale of insecticide-treated nets (ITNs for prevention of malaria and anthroponotic cutaneous leishmaniasis (ACL. Here we outline the strategy and document the progress to provide guidance for replication of similar approaches in other chronic refugee situations. Methods The operational monitoring data presented were collected through: (i two surveys of knowledge, attitude and practice (KAP; (ii routine sales reporting of health-care providers; (iii records completed during field visits; and (iv registers used during annual re-treatment campaigns. Results From 2000 until 2003, subsidized ITN sales expanded from 17 to 44 camps. Based on 2003 sales records, maximum coverage from subsidized sales exceeded 50% in 13 camps and 20% in an additional 14 camps. Free annual treatment campaigns showed that many refugees were in possession of non-programme nets, which were either locally-made or had leaked from an ITN programme in Afghanistan. Estimated re-treatment coverage of sold and existing nets through annual campaigns exceeded 43% in all camps and was above 70% in the majority. Conclusion Subsidized sales of ITNs have effectively introduced the components of sustainability and self-reliance to the prevention of malaria and ACL in Afghan refugee camps. Similar approaches should be investigated in other chronic refugee situations to discourage expectations of continuing humanitarian donations that cannot be fulfilled.
Behavioral change communications on malaria prevention in Ghana.
Tweneboah-Koduah, Ernest Yaw; Braimah, Mahama; Otuo, Priscilla Ntriwaa
2012-01-01
The purpose of this study is to assess the various communications strategies designed to promote insecticide-treated nets (ITN) use among pregnant women and children. This study is an exploratory study into the communications activities by institutions involved in malaria prevention in Ghana. In-depth interviews were conducted and the data were analyzed. We found that most of the interventions are aimed at encouraging the target markets to acquire ITNs, although most messages on malaria prevention are not integrated. Several challenges were noted, including financial constraints, lack of human resources, cultural barriers, negative publicity, and negative perceptions on malaria.
WenJun Zhang
2016-01-01
In present study, I proposed some new sciences: network chemistry, network toxicology, network informatics, and network behavioristics. The aims, scope and scientific foundation of these sciences are outlined.
Directory of Open Access Journals (Sweden)
Lines Jo
2010-07-01
Full Text Available Abstract Background Household ownership of insecticide-treated mosquito nets (ITNs is increasing, and coverage targets have been revised to address universal coverage with ITNs. However, many households do not have enough nets to cover everyone, and the nets available vary in physical condition and insecticide treatment status. Since 2004, the Government of Tanzania has been implementing the Tanzania National Voucher Scheme (TNVS, which distributes vouchers for ITNs through antenatal clinics to target pregnant women and their infants. This analysis aimed to determine the following: (1 coverage patterns of bed nets within households according to physical condition and treatment status; (2 who might be at risk if mosquitoes were diverted from occupants of untreated nets to those not using nets? (3 the degree to which those at highest risk of malaria use the most protective nets. Methods Data from the 2006 TNVS household survey were analysed to assess within-household distribution of net use. The associations between net characteristics and net user were also evaluated. Multivariate analysis was applied to the relationship between the number of holes per net and user characteristics while adjusting for confounders. Results In households with a net:person ratio better than 1:4 (one net for every four household members, more than 80% of the people in such households reported using a net the previous night. ITNs were most likely to be used by infants, young children (1-4 y, and women of childbearing age; they were least likely to be used by older women (≥50 y, older children (5-14 y, and adult men. The nets used by infants and women of childbearing age were in better-than-average physical condition; the nets used by older women and older children were in worse-than-average condition; while young children and adult men used nets in intermediate (average condition. When adjusted for confounders, the nets used by young and older children had more holes
Oxborough, Richard M; N'Guessan, Raphael; Jones, Rebecca; Kitau, Jovin; Ngufor, Corine; Malone, David; Mosha, Franklin W; Rowland, Mark W
2015-03-24
The rapid selection of pyrethroid resistance throughout sub-Saharan Africa is a serious threat to malaria vector control. Chlorfenapyr is a pyrrole insecticide which shows no cross resistance to insecticide classes normally used for vector control and is effective on mosquito nets under experimental hut conditions. Unlike neurotoxic insecticides, chlorfenapyr owes its toxicity to disruption of metabolic pathways in mitochondria that enable cellular respiration. A series of experiments explored whether standard World Health Organization (WHO) guidelines for evaluation of long-lasting insecticidal nets, developed through testing of pyrethroid insecticides, are suitable for evaluation of non-neurotoxic insecticides. The efficacy of WHO recommended cone, cylinder and tunnel tests was compared for pyrethroids and chlorfenapyr. To establish bioassay exposure times predictive of insecticide-treated net (ITN) efficacy in experimental hut trials, standard three-minute bioassays of pyrethroid and chlorfenapyr ITNs were compared with longer exposures. Mosquito behaviour and response to chlorfenapyr ITN in bioassays conducted at night were compared to day and across a range of temperatures representative of highland and lowland transmission. Standard three-minute bioassay of chlorfenapyr produced extremely low levels of mortality compared to pyrethroids. Thirty-minute day-time bioassay produced mortality closer to hut efficacy of chlorfenapyr ITN but still fell short of the WHO threshold. Overnight tunnel test with chlorfenapyr produced 100% mortality and exceeded the WHO threshold of 80%. The endogenous circadian activity rhythm of anophelines results in inactivity by day and raised metabolism and flight activity by night. A model which explains improved toxicity of chlorfenapyr ITN when tested at night, and during the day at higher ambient temperature, is that activation of chlorfenapyr and disruption of respiratory pathways is enhanced when the insect is more metabolically
Nnko, Soori E; Whyte, Susan R; Geissler, Wenzel P; Aagaard-Hansen, Jens
2012-04-01
Despite existence of effective tools for malaria control, malaria continues to be one of the leading killer diseases especially among under-five year children and pregnant women in poor rural populations of Sub Saharan Africa. In Tanzania Mainland the disease contributes to 39.4% of the total OPD attendances. In terms of mortality, malaria is known to be responsible for more than one third of deaths among children of age below 5 years and also contributes for up to one fifth of deaths among pregnant women. This paper is based on a study conducted in a rural community along the shores of Lake Victoria in Mwanza region, North-Western Tanzania. The study explores reasons for scepticism and low uptake of insecticide treated mosquito nets (ITNs) that were promoted through social marketing strategy for malaria control prior to the introduction of long lasting nets (LLN). The paper breaks from traditional approach that tend to study low uptake of health interventions in terms of structural practical constraints--cost, accessibility, everyday priorities--or in terms of cognition--insufficient knowledge of benefits e.g. ignorance of public health messages. This paper has shown that, the majority of people who could afford the prices of ITNs and who knew where to obtain the insecticides did not necessarily buy them. This suggests that, although people tend to report cost-related factors as a barrier against the use of ITNs, there are other critical concerns at work. Without underestimating the practical factors, our study have recommended to consider critical examinations of those other concerns that hinder optimal utilization of ITN for malaria control, and the basis for those concerns.
Directory of Open Access Journals (Sweden)
Mustafa Sara
2005-12-01
Full Text Available Abstract Background In order to optimally prioritize and use public and private budgets for equitable malaria vector control, there is a need to determine the level and determinants of consumer demand for different vector control tools. Objectives To determine the demand from people of different socio-economic groups for indoor residual house-spraying (IRHS, insecticide-treated nets (ITNs, larviciding with chemicals (LWC, and space spraying/fogging (SS and the disease control implications of the result. Methods Ratings and levels of willingness-to-pay (WTP for the vector control tools were determined using a random cross-sectional sample of 720 householdes drawn from two states. WTP was elicited using the bidding game. An asset-based socio-economic status (SES index was used to explore whether WTP was related to SES of the respondents. Results IRHS received the highest proportion of highest preferred rating (41.0% followed by ITNs (23.1%. However, ITNs had the highest mean WTP followed by IRHS, while LWC had the least. The regression analysis showed that SES was positively and statistically significantly related to WTP across the four vector control tools and that the respondents' rating of IRHS and ITNs significantly explained their levels of WTP for the two tools. Conclusion People were willing to pay for all the vector-control tools, but the demand for the vector control tools was related to the SES of the respondents. Hence, it is vital that there are public policies and financing mechanisms to ensure equitable provision and utilisation of vector control tools, as well as protecting the poor from cost-sharing arrangements.
Directory of Open Access Journals (Sweden)
Mshinda Hassan
2007-09-01
Full Text Available Abstract Background Successful malaria vector control depends on understanding behavioural interactions between mosquitoes and humans, which are highly setting-specific and may have characteristic features in urban environments. Here mosquito biting patterns in Dar es Salaam, Tanzania are examined and the protection against exposure to malaria transmission that is afforded to residents by using an insecticide-treated net (ITN is estimated. Methods Mosquito biting activity over the course of the night was estimated by human landing catch in 216 houses and 1,064 residents were interviewed to determine usage of protection measures and the proportion of each hour of the night spent sleeping indoors, awake indoors, and outdoors. Results Hourly variations in biting activity by members of the Anopheles gambiae complex were consistent with classical reports but the proportion of these vectors caught outdoors in Dar es Salaam was almost double that of rural Tanzania. Overall, ITNs confer less protection against exophagic vectors in Dar es Salaam than in rural southern Tanzania (59% versus 70%. More alarmingly, a biting activity maximum that precedes 10 pm and much lower levels of ITN protection against exposure (38% were observed for Anopheles arabiensis, a vector of modest importance locally, but which predominates transmission in large parts of Africa. Conclusion In a situation of changing mosquito and human behaviour, ITNs may confer lower, but still useful, levels of personal protection which can be complemented by communal transmission suppression at high coverage. Mosquito-proofing houses appeared to be the intervention of choice amongst residents and further options for preventing outdoor transmission include larviciding and environmental management.
Ricotta, Emily E; Boulay, Marc; Ainslie, Robert; Babalola, Stella; Fotheringham, Megan; Koenker, Hannah; Lynch, Matthew
2015-01-21
SBCC campaigns are designed to act on cognitive, social and emotional factors at the individual or community level. The combination of these factors, referred to as 'ideation', play a role in determining behaviour by reinforcing and confirming decisions about a particular health topic. This study introduces ideation theory and mediation analysis as a way to evaluate the impact of a malaria SBCC campaign in Tanzania, to determine whether exposure to a communication programme influenced universal coverage through mediating ideational variables. A household survey in three districts where community change agents (CCAs) were active was conducted to collect information on ITN use, number of ITNs in the household, and perceptions about ITN use and ownership. Variables relating to attitudes and beliefs were combined to make 'net ideation'. Using an ideational framework, a mediation analysis was conducted to see the impact exposure to a CCA only, mass media and community (M & C) messaging only, or exposure to both, had on household universal coverage, through the mediating variable net ideation. All three levels of exposure (CCA, M & C messaging, or exposure to both) were significantly associated with increased net ideation (CCA: 0.283, 95% CI: 0.136-0.429, p-value: mediation analysis is an applicable new tool to assess SBCC campaigns. Ideation as a mediator of the effects of communication exposure on household universal coverage has implications for designing SBCC to support both mass and continuous distribution efforts, since both heavily rely on consumer participation to obtain and maintain ITNs. Such systems can be strengthened by SBCC programming, generating demand through improving social norms about net ownership and use, perceived benefits of nets, and other behavioural constructs.
Siviero, M; Teixeira, M J; de Siqueira, J T T; Siqueira, S R D T
2010-07-01
To determine somesthetic, olfactory, gustative and salivary abnormalities in patients with burning mouth syndrome (BMS), idiopathic trigeminal neuralgia (ITN) and trigeminal postherpetic neuralgia (PHN). Twenty patients from each group (BMS, ITN, PHN) and 60 healthy controls were evaluated with a systematized quantitative approach of thermal (cold and warm), mechanical, pain, gustation, olfaction and salivary flow; data were analyzed with ANOVA, Tukey, Kruskal-Wallis and Dunn tests with a level of significance of 5%. There were no salivary differences among the groups with matched ages; the cold perception was abnormal only at the mandibular branch of PHN (P = 0.001) and warm was abnormal in all trigeminal branches of PHN and BMS; mechanical sensitivity was altered at the mandibular branch of PHN and in all trigeminal branches of BMS. The salty, sweet and olfactory thresholds were higher in all studied groups; the sour threshold was lower and there were no differences of bitter. All groups showed abnormal thresholds of gustation and olfaction; somesthetic findings were discrete in ITN and more common in PHN and BMS; central mechanisms of balance of sensorial inputs might be underlying these observations.
Directory of Open Access Journals (Sweden)
Nganda Rhoida Y
2004-11-01
Full Text Available Abstract Background To reduce the intolerable burden of malaria in pregnancy, the Ministry of Health in Tanzania has recently adopted a policy of intermittent presumptive treatment for pregnant women using sulphadoxine-pyrimethamine (IPTp-SP. In addition, there is strong national commitment to increase distribution of insecticide treated nets (ITNs among pregnant women. This study explores the determinants of uptake for both ITNs and IPTp-SP by pregnant women and the role that individual knowledge and socio-economic status has to play for each. Methods 293 women were recruited post-partum at Kibaha District Hospital on the East African coast. The haemoglobin level of each woman was measured and a questionnaire administered. Results Use of both interventions was associated with a reduced risk of severe anaemia (Hb Conclusion Individual knowledge of malaria was an important factor for ITN uptake, but not for IPTp-SP use, which was reliant on delivery of information by MCH systems. When both these interventions were used, severe anaemia postpartum was reduced by 69% compared to use of neither, thus providing evidence of effectiveness of these interventions when used in combination.
Directory of Open Access Journals (Sweden)
Natalie J Forde
2016-08-01
Full Text Available Gilles de la Tourette Syndrome (GTS is characterised by the presence of multiple motor and phonic tics with a fluctuating course of intensity, frequency and severity. Up to 90% of patients with GTS present with comorbid conditions, most commonly attention-deficit/hyperactivity disorder (ADHD and obsessive-compulsive disorder (OCD, thus providing an excellent model for the exploration of shared aetiology across disorders. TS-EUROTRAIN (FP7-PEOPLE-2012-ITN, Grant Agr.No.316978 is a Marie Curie Initial Training Network (http://ts-eurotrain.eu that aims to elucidate the complex aetiology of the onset and clinical course of GTS, investigate the neurobiological underpinnings of GTS and related disorders, translate research findings into clinical applications and establish a pan-European infrastructure for the study of GTS. This includes the challenges of (i assembling a large genetic database for the evaluation of the genetic architecture with high statistical power; (ii exploring the role of gene-environment interactions including the effects of epigenetic phenomena; (iii employing endophenotype-based approaches to understand the shared aetiology between GTS, OCD and ADHD; (iv establishing a developmental animal model for GTS; (v gaining new insights into the neurobiological mechanisms of GTS via cross-sectional and longitudinal neuroimaging studies; and (vi partaking in outreach activities including the dissemination of scientific knowledge about GTS to the public. Fifteen partners from academia and industry and twelve PhD candidates pursue the project. Our ultimate aims are to elucidate the complex aetiology and neurobiological underpinnings of GTS, translate research findings into clinical applications and establish Pan-European infrastructure for the study of GTS and associated disorders.
Percolation of interdependent network of networks
International Nuclear Information System (INIS)
Havlin, Shlomo; Stanley, H. Eugene; Bashan, Amir; Gao, Jianxi; Kenett, Dror Y.
2015-01-01
Complex networks appear in almost every aspect of science and technology. Previous work in network theory has focused primarily on analyzing single networks that do not interact with other networks, despite the fact that many real-world networks interact with and depend on each other. Very recently an analytical framework for studying the percolation properties of interacting networks has been introduced. Here we review the analytical framework and the results for percolation laws for a Network Of Networks (NONs) formed by n interdependent random networks. The percolation properties of a network of networks differ greatly from those of single isolated networks. In particular, because the constituent networks of a NON are connected by node dependencies, a NON is subject to cascading failure. When there is strong interdependent coupling between networks, the percolation transition is discontinuous (first-order) phase transition, unlike the well-known continuous second-order transition in single isolated networks. Moreover, although networks with broader degree distributions, e.g., scale-free networks, are more robust when analyzed as single networks, they become more vulnerable in a NON. We also review the effect of space embedding on network vulnerability. It is shown that for spatially embedded networks any finite fraction of dependency nodes will lead to abrupt transition
Yoshihara, Chika; Shimizu, Shinji
2005-10-01
The national representative sample was analyzed to examine the relationship between respondents' drinking practice and the social network which was constructed of three different types of network: support network, drinking network, and intervening network. Non-parametric statistical analysis was conducted with chi square method and ANOVA analysis, due to the risk of small samples in some basic tabulation cells. The main results are as follows: (1) In the support network of workplace associates, moderate drinkers enjoyed much more sociable support care than both nondrinkers and hard drinkers, which might suggest a similar effect as the French paradox. Meanwhile in the familial and kinship network, the more intervening care support was provided, the harder respondents' drinking practice. (2) The drinking network among Japanese people for both sexes is likely to be convergent upon certain types of network categories and not decentralized in various categories. This might reflect of the drinking culture of Japan, which permits people to drink everyday as a practice, especially male drinkers. Subsequently, solitary drinking is not optional for female drinkers. (3) Intervening network analysis showed that the harder the respondents' drinking practices, the more frequently their drinking behaviors were checked in almost all the categories of network. A rather complicated gender double-standard was found in the network of hard drinkers with their friends, particularly for female drinkers. Medical professionals played a similar intervening role for men as family and kinship networks but to a less degree than friends for females. The social network is considerably associated with respondents' drinking, providing both sociability for moderate drinkers and intervention for hard drinkers, depending on network categories. To minimize the risk of hard drinking and advance self-healthy drinking there should be more research development on drinking practice and the social network.
In der Suche nach eigenem Sprachstandards
Directory of Open Access Journals (Sweden)
Lada Badurina
1992-01-01
Full Text Available Im Artikl wird dreifache Lösungsmöglichkeit des burgenländrich-kroatischen Sprachkomplexes vor-gesehen: Stützung auf den deutschen schriftsprachlichen Ausdruck, Übernahme des südlichen kroatischen Standards oder Aufbau eigener Sprachnorm. Neulich veröffentlichtes Werk Gradis6anskohrvatski-hrvatsko-nim§ki rjeönik zeugt über die Anbahnung der schwierigten aber zugleich annehmbarsten Lösung: Standardisierung der eigenen Sprache.
Klingmann, Raoul
2005-01-01
In der vorliegenden Arbeit wurde die Regenerierung fester Katalysatoren für die Isobutan/Buten-Alkylierung durch hydrierende Behandlung in flüssiger Phase untersucht. Als Katalysatoren dienten edelmetallhaltige Zeolithe des Typs La-X (FAU). Die Alkylierungs- und Regenerierungsexperimente wurden in einer Apparatur mit kontinuierlich betriebenem Rührkesselreaktor und Analytikeinheit mit On-line-Probenahmevorrichtung durchgeführt. Zunächst wurde der Aufbau der Koksdeposite in Abhängigkeit von...
Integration einer Volltextsuchmaschine in Meta-Akad
Tuchbreiter, Jochen
2003-01-01
Das Projekt Meta-Akad hat das Ziel, Lernenden und Lehrenden den möglichst einfachen, umfassenden und schnellen Zugriff auf Lehrmaterial zu ermöglichen. Dabei werden verschiedene, über die Aspekte einer reinen Internet- Suchmaschine hinausgehende Aspekte berücksichtigt: Neben dem Aufbau einer umfangreichen und repräsentativen Sammlung von Lerndokumenten sollen diese mittels bibliothekarischer Methoden erschlossen und mit umfangreichen Metadaten, wie beispielsweise einer inhaltlichen Einordnung...
Zusammensetzung eukaryotischer RNase P aus pflanzlichen Zellkernen und Plastiden
Heubeck, Christian
2004-01-01
Ribonuklease P (RNaseP) ist eine essentielle Endonuklease, welche die 5'-Flanke von pre-tRNAs entfernt. In nahezu allen bisher untersuchten Organismen und Organellen besteht das Holoenzym aus einer RNA-Untereinheit und einer Protein-Komponente. Nur die Zusammensetzung des Enzyms in den Chloroplasten und Mitochochondrien mehrzelliger Eukaryonten scheint unklar. Eine RNA-Untereinheit konnte hier bis jetzt nicht nachgewiesen werden. Um den Aufbau der RNaseP aus photosynthetischen...
Publikationsunterstützung: Die Bibliothek ist nicht genug
Directory of Open Access Journals (Sweden)
Christian Kaier
2017-06-01
Full Text Available Für wissenschaftliche Bibliotheken bedeutet der Aufbau publikationsunterstützender Services eine lohnende Erweiterung ihres Aufgabengebietes, die auf ihren traditionellen Kompetenzen aufbaut. Um überzeugende und umfassende Services zum Thema wissenschaftliches Publizieren anbieten zu können ist es jedoch notwendig, noch stärker als bisher mit verschiedensten Partnern zusammenzuarbeiten. Dieser Beitrag legt dar, welche Kompetenzen es zu entwickeln und welche Partner es vorrangig anzusprechen gilt.
Jasnoch, U.; Göbel, S.; Balfanz, D.
1999-01-01
Das InGeoForum versteht sich als Informations- und Kooperationsforum zwischen Geodatenanbietern und Geodatennutzern. Das grundlegende Ziel des InGeoForum besteht darin, basierend auf dem derzeitigen Geodatenmarkt, den Aufbau einer "Nationalen Infrastruktur für Geodaten" zu forcieren. Als zentrale Dienstleistung bietet das InGeoForum ein sogenanntes Information Center (InGeo-IC) an, in dem einerseits Datenanbieter ihr Datensortiment vermarkten können, andererseits Anwender (z.B. GIS - Dienstle...
Psychologie - Fachdatenbank mit europäischem Fokus
Schön, Dana
2010-01-01
Die Sichtbarkeit von europäischer Wissenschaftsliteratur ist notwendige Voraussetzung für deren Rezeption im internationalen Kontext. Ein bibliographisches Nachweissystem psychologischer Fachliteratur auf der Basis moderner Suchtechnologie mit Fokus auf europäischen Werken kann einen wichtigen Beitrag dazu leisten. Mehrere europäische Institute stellen ihre bibliographischen Datenbestände zum Aufbau einer umfassenden europäischen Fachdatenbank für die Psychologie zur Verfügung. Die Bereitstel...
Akzeptanz von Location Based Services
Bauer, Hans H.; Haber, Tobias E.; Reichardt, Tina; Bökamp, Marten
2006-01-01
Die enormen Investitionen in UMTS-Lizenzen und den Aufbau einer neuen Netzinfrastruktur zwingen die Mobilfunkanbieter zur Erschließung neuer Umsatzpotenziale. Durch Entwicklung neuer mobiler Mehrwertdienste hoffen sie, die „Killerapplikation“ der 3. Mobilfunkgeneration zu finden, die ähnlich wie der Short Message Service (SMS) für GSM, zum Treiber des UMTS-Markterfolges werden kann. Nach Meinung vieler Marktbeobachter könnten Location Based Services, d.h. mobile Dienste, die ...
T-Zell-Zytokinexpression bei gestillten vs. nicht-gestillten Kindern
Aulenbach, Julia
2015-01-01
Das Bestreben, den Aufbau, die Funktion sowie die Entwicklung des Immunsystems zu verstehen, steht schon lange Zeit im Zentrum des Interesses vieler Forschungsarbeiten, insbesondere um auf Grundlage der gewonnenen Erkenntnisse neue Behandlungsansätze für immunologisch relevante Krankheitsbilder zu entwickeln. Stillen könnte ein wichtiger Faktor sein, der bei der Entwicklung und Differenzierung von T-Zell-Subpopulationen und Zytokinmustern im Säuglings- und Kindesalter eine bedeutende Roll...
Lifescience Database Archive (English)
Full Text Available n*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKYK KPEILSGKETEEVHVMGRIRKSNKDYNPKYSFHIDPDTVTFFSMAIEVCD... Frame B: *itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKYK KPEILSGKETEEVHVMGRIRKSNKDYNPKYSFHIDPD
Vulnerability of network of networks
Havlin, S.; Kenett, D. Y.; Bashan, A.; Gao, J.; Stanley, H. E.
2014-10-01
Our dependence on networks - be they infrastructure, economic, social or others - leaves us prone to crises caused by the vulnerabilities of these networks. There is a great need to develop new methods to protect infrastructure networks and prevent cascade of failures (especially in cases of coupled networks). Terrorist attacks on transportation networks have traumatized modern societies. With a single blast, it has become possible to paralyze airline traffic, electric power supply, ground transportation or Internet communication. How, and at which cost can one restructure the network such that it will become more robust against malicious attacks? The gradual increase in attacks on the networks society depends on - Internet, mobile phone, transportation, air travel, banking, etc. - emphasize the need to develop new strategies to protect and defend these crucial networks of communication and infrastructure networks. One example is the threat of liquid explosives a few years ago, which completely shut down air travel for days, and has created extreme changes in regulations. Such threats and dangers warrant the need for new tools and strategies to defend critical infrastructure. In this paper we review recent advances in the theoretical understanding of the vulnerabilities of interdependent networks with and without spatial embedding, attack strategies and their affect on such networks of networks as well as recently developed strategies to optimize and repair failures caused by such attacks.
Tian, Wei; Weng, Chong; Liu, Bo; Li, Qin; Sun, Yu-Qing; Yuan, Qiang; Zhang, Bo; Wang, Yong-Qing; He, Da
2013-08-01
A retrospective clinical study was conducted. The purpose of this study was to describe the clinical outcomes of intraoperative 3D navigation (ITN) and ultrasonography during posterior decompression and instrumented fusion for thoracic myelopathy due to ossification of the posterior longitudinal ligament (OPLL). The symptoms caused by thoracic-ossification of the posterior longitudinal ligament (T-OPLL) are usually progressive and do not respond to conservative treatment-surgical intervention is the only effective treatment option. Various methods have been described for the treatment of symptomatic T-OPLL, all of which have limitations. The study included 18 patients with T-OPLL who underwent posterior decompression with instrumented fusion from 2006 to 2011. A staged operative procedure was used. First, pedicle screws were placed with ITN and a wide laminectomy was performed with resection of ossification of the ligamentum flavum (if present). With insufficient decompression on intraoperative ultrasonography, additional circumferential decompression was performed through a transpedicular approach. ITN-guided OPLL resection was performed using a burr attached to a navigational tracker. In all cases, posterior instrumented fusion was performed in situ. The outcomes were evaluated with the modified Japanese Orthopaedic Association scores and recovery rates. Intraoperative ultrasonography showed that posterior laminectomy was sufficient in 6 patients; the remaining 12 were treated with additional circumferential decompression. The follow-up period ranged from 1 to 6 years (mean period, 2.8 y). Postoperative transient neurological deterioration occurred in 1 patient, and cerebrospinal fluid leakage occurred in 4 patients. All patients showed neurological recovery with a mean Japanese Orthopaedic Association score that improved from 5.5 points preoperatively to 8.5 points at the final follow-up and a mean recovery rate of 54.5%. Intraoperative ultrasonography and ITN
Directory of Open Access Journals (Sweden)
Marta Ferreira Maia
Full Text Available Classic vector control strategies target mosquitoes indoors as the main transmitters of malaria are indoor-biting and -resting mosquitoes. However, the intensive use of insecticide-treated bed-nets (ITNs and indoor residual spraying have put selective pressure on mosquitoes to adapt in order to obtain human blood meals. Thus, early-evening and outdoor vector activity is becoming an increasing concern. This study assessed the effect of a deltamethrin-treated net (100 mg/m(2 attached to a one-meter high fence around outdoor cattle enclosures on the number of mosquitoes landing on humans. Mosquitoes were collected from four cattle enclosures: Pen A - with cattle and no net; B - with cattle and protected by an untreated net; C - with cattle and protected by a deltamethrin-treated net; D - no cattle and no net. A total of 3217 culicines and 1017 anophelines were collected, of which 388 were Anopheles gambiae and 629 An. ziemanni. In the absence of cattle nearly 3 times more An. gambiae (p<0.0001 landed on humans. The deltamethrin-treated net significantly reduced (nearly three-fold, p<0.0001 culicine landings inside enclosures. The sporozoite rate of the zoophilic An. ziemanni, known to be a secondary malaria vector, was as high as that of the most competent vector An. gambiae; raising the potential of zoophilic species as secondary malaria vectors. After deployment of the ITNs a deltamethrin persistence of 9 months was observed despite exposure to African weather conditions. The outdoor use of ITNs resulted in a significant reduction of host-seeking culicines inside enclosures. Further studies investigating the effectiveness and spatial repellence of ITNs around other outdoor sites, such as bars and cooking areas, as well as their direct effect on vector-borne disease transmission are needed to evaluate its potential as an appropriate outdoor vector control tool for rural Africa.
Directory of Open Access Journals (Sweden)
Roche Jesús
2006-02-01
Full Text Available Abstract Background On the island of Bioko (Equatorial Guinea, insecticide-treated nets (ITNs have been the main tool used to control malaria over the last 13 years. In 2004, started an indoor residual spraying (IRS campaign to control malaria. The purpose of this study is to asses the impact of the two control strategies on the island of Bioko (Equatorial Guinea, with regards to Plasmodium infection and anaemia in the children under five years of age. Methods Two transversal studies, the first one prior to the start of the IRS campaign and the second one year later. Sampling was carried out by stratified clusters. Malaria infection was measured by means of thick and thin film, and the packed cell volume (PCV percentage. Data related to ITN use and information regarding IRS were collected. The Pearson's chi-square and logistic regression statistical tests were used to calculate odds ratios (OR Results In the first survey, 168 children were sampled and 433 children in the second one. The prevalence of infection was 40% in 2004, and significantly lower at 21.7% in 2005. PCV was 41% and 39%, respectively. 58% of the children surveyed in 2004 and 44.3% in 2005 had slept under an ITN. 78% of the dwellings studied in 2005 had been sprayed. In the 2005 survey, sleeping without a mosquito net meant a risk of infection 3 times greater than sleeping protected with a net hanged correctly and with no holes (p Conclusion IRS and ITNs have proven to be effective control strategies on the island of Bioko. The choice of one or other strategy is, above all, a question of operational feasibility and availability of local resources.
Directory of Open Access Journals (Sweden)
Agnès Le Port
Full Text Available BACKGROUND: The association between placental malaria (PM and first peripheral parasitaemias in early infancy was assessed in Tori Bossito, a rural area of Benin with a careful attention on transmission factors at an individual level. METHODOLOGY: Statistical analysis was performed on 550 infants followed weekly from birth to 12 months. Malaria transmission was assessed by anopheles human landing catches every 6 weeks in 36 sampling houses and season defined by rainfall. Each child was located by GPS and assigned to the closest anopheles sampling house. Data were analysed by survival Cox models, stratified on the possession of insecticide-treated mosquito nets (ITNs at enrolment. PRINCIPAL FINDINGS: Among infants sleeping in a house with an ITN, PM was found to be highly associated to first malaria infections, after adjusting on season, number of anopheles, antenatal care (ANC visits and maternal severe anaemia. Infants born from a malaria infected placenta had a 2.13 fold increased risk to present a first malaria infection than those born from a non infected placenta ([1.24-3.67], p<0.01 when sleeping in a house with an ITN. The risk to present a first malaria infection was increased by 3.2 to 6.5, according to the level of anopheles exposure (moderate or high levels, compared to the absence of anopheles. CONCLUSIONS: First malaria infections in early childhood can be attributed simultaneously to both PM and high levels of exposure to infected anopheles. Protective measures as Intermittent Preventive Treatment during pregnancy (IPTp and ITNs, targeted on both mothers and infants should be reinforced, as well as the research on new drugs and insecticides. In parallel, investigations on placental malaria have to be strengthened to better understand the mechanisms involved, and thus to protect adequately the infants high risk group.
Patel, Anita; Pulugundla, Gautam; Smolentsev, Sergey; Abdou, Mohamed; Bhattacharyay, Rajendraprasad
2018-04-01
Following the magnetohydrodynamic (MHD) code validation and verification proposal by Smolentsev et al. (Fusion Eng Des 100:65-72, 2015), we perform code to code and code to experiment comparisons between two computational solvers, FLUIDYN and HIMAG, which are presently considered as two of the prospective CFD tools for fusion blanket applications. In such applications, an electrically conducting breeder/coolant circulates in the blanket ducts in the presence of a strong plasma-confining magnetic field at high Hartmann numbers, it{Ha} (it{Ha}^2 is the ratio between electromagnetic and viscous forces) and high interaction parameters, it{N} (it{N} is the ratio of electromagnetic to inertial forces). The main objective of this paper is to provide the scientific and engineering community with common references to assist fusion researchers in the selection of adequate computational means to be used for blanket design and analysis. As an initial validation case, the two codes are applied to the classic problem of a laminar fully developed MHD flows in a rectangular duct. Both codes demonstrate a very good agreement with the analytical solution for it{Ha} up to 15, 000. To address the capabilities of the two codes to properly resolve complex geometry flows, we consider a case of three-dimensional developing MHD flow in a geometry comprising of a series of interconnected electrically conducting rectangular ducts. The computed electric potential distributions for two flows (Case A) it{Ha}=515, it{N}=3.2 and (Case B) it{Ha}=2059, it{N}=63.8 are in very good agreement with the experimental data, while the comparisons for the MHD pressure drop are still unsatisfactory. To better interpret the observed differences, the obtained numerical data are analyzed against earlier theoretical and experimental studies for flows that involve changes in the relative orientation between the flow and the magnetic field.
Directory of Open Access Journals (Sweden)
Gerry F Killeen
2007-07-01
Full Text Available Malaria prevention in Africa merits particular attention as the world strives toward a better life for the poorest. Insecticide-treated nets (ITNs represent a practical means to prevent malaria in Africa, so scaling up coverage to at least 80% of young children and pregnant women by 2010 is integral to the Millennium Development Goals (MDG. Targeting individual protection to vulnerable groups is an accepted priority, but community-level impacts of broader population coverage are largely ignored even though they may be just as important. We therefore estimated coverage thresholds for entire populations at which individual- and community-level protection are equivalent, representing rational targets for ITN coverage beyond vulnerable groups.Using field-parameterized malaria transmission models, we show that high (80% use but exclusively targeted coverage of young children and pregnant women (representing <20% of the population will deliver limited protection and equity for these vulnerable groups. In contrast, relatively modest coverage (35%-65% use, with this threshold depending on ecological scenario and net quality of all adults and children, rather than just vulnerable groups, can achieve equitable community-wide benefits equivalent to or greater than personal protection.Coverage of entire populations will be required to accomplish large reductions of the malaria burden in Africa. While coverage of vulnerable groups should still be prioritized, the equitable and communal benefits of wide-scale ITN use by older children and adults should be explicitly promoted and evaluated by national malaria control programmes. ITN use by the majority of entire populations could protect all children in such communities, even those not actually covered by achieving existing personal protection targets of the MDG, Roll Back Malaria Partnership, or the US President's Malaria Initiative.
Networks of networks – An introduction
International Nuclear Information System (INIS)
Kenett, Dror Y.; Perc, Matjaž; Boccaletti, Stefano
2015-01-01
Graphical abstract: Interdependent network reciprocity. Only those blue cooperative domains that are initially present on both networks survive. Abstract: This is an introduction to the special issue titled “Networks of networks” that is in the making at Chaos, Solitons & Fractals. Recent research and reviews attest to the fact that networks of networks are the next frontier in network science [1–7]. Not only are interactions limited and thus inadequately described by well-mixed models, it is also a fact that the networks that should be an integral part of such models are often interconnected, thus making the processes that are unfolding on them interdependent. From the World economy and transportation systems to social media, it is clear that processes taking place in one network might significantly affect what is happening in many other networks. Within an interdependent system, each type of interaction has a certain relevance and meaning, so that treating all the links identically inevitably leads to information loss. Networks of networks, interdependent networks, or multilayer networks are therefore a much better and realistic description of such systems, and this Special Issue is devoted to their structure, dynamics and evolution, as well as to the study of emergent properties in multi-layered systems in general. Topics of interest include but are not limited to the spread of epidemics and information, percolation, diffusion, synchronization, collective behavior, and evolutionary games on networks of networks. Interdisciplinary work on all aspects of networks of networks, regardless of background and motivation, is very welcome.
Network Coded Software Defined Networking
DEFF Research Database (Denmark)
Krigslund, Jeppe; Hansen, Jonas; Roetter, Daniel Enrique Lucani
2015-01-01
Software Defined Networking (SDN) and Network Coding (NC) are two key concepts in networking that have garnered a large attention in recent years. On the one hand, SDN's potential to virtualize services in the Internet allows a large flexibility not only for routing data, but also to manage....... This paper advocates for the use of SDN to bring about future Internet and 5G network services by incorporating network coding (NC) functionalities. The inherent flexibility of both SDN and NC provides a fertile ground to envision more efficient, robust, and secure networking designs, that may also...
Directory of Open Access Journals (Sweden)
Ahmed Syed M
2011-12-01
Full Text Available Abstract Background BRAC, an indigenous non-governmental development organization (NGO, has been implementing a programme to prevent and control malaria in the 13 malaria-endemic districts of Bangladesh since 2007. One of the critical preventive interventions is the distribution of insecticidal bed nets (long-lasting insecticide-treated nets, LLINs and insecticide-treated ordinary nets, ITNs to the community free of cost. This study aimed to assess progress in the possession, preferential use, and knowledge on use of the LLIN/ITNs including the programme's avowed pro-poor inclination one and three and half years after intervention began. Methods A convenient sampling strategy based on malaria endemicity in the districts was adopted. First, thirty upazila (sub-district, with a population around 250,000s were selected at random, with high prevalent districts contributing more upazilas; second, from each upazila, one (2008 to two (2011 villages (covered by insecticidal bed net distribution programme were selected. From each village, households that had either one under-five child and/or a pregnant woman were included in the survey, one household being included only once. Data were collected using a pre-tested structured questionnaire. Results In all, 3,760 households in 2008 and 7,895 households in 2011 were surveyed for collecting relevant information. Proportion of households with at least one LLIN, and at least one LLIN/ITN increased (22-59 to 62-67% and 22-64% to 74-76% respectively over time, including increase in the mean number of LLIN/ITNs per household (≤ 1 to 1 +. The programme achieved > 80% coverage in sleeping under an LLIN/ITN in the case of under-five children and pregnant women, especially in the high-endemic districts. Knowledge regarding critical time of hanging the net also increased over time (7-22 to 44-54%, but remained low. The pro-poor inclination of the programme is reflected in the status of relevant indicators according
United States Air Force Summer Research Program - 1993. Volume 5B. Wright Laboratory
1993-12-01
Konstruktion mit Katalogen." Feinwerktechnik 75, pp. 337-345. [ROTH741 K. Roth. "Aufbau and Handhabung von Konstruktionskatalogen," VDI -Berichte 219...Dusseldorf: VDI -Verlag, 1974. ISTAU891 L. A. Stauffer. R. A. Slughterbeck-Hyde. "The nature of constraints and their effect on quality and satisficing...Electrolyte Experimental Calculated NMP 1690 2048 DMAC 1648 1979 DMF 1679 1995 BL 1774 2123 VL 1770 2121 PC 1802 2163 2. Simulation of Li-Polymer
Modeling the citation network by network cosmology.
Xie, Zheng; Ouyang, Zhenzheng; Zhang, Pengyuan; Yi, Dongyun; Kong, Dexing
2015-01-01
Citation between papers can be treated as a causal relationship. In addition, some citation networks have a number of similarities to the causal networks in network cosmology, e.g., the similar in-and out-degree distributions. Hence, it is possible to model the citation network using network cosmology. The casual network models built on homogenous spacetimes have some restrictions when describing some phenomena in citation networks, e.g., the hot papers receive more citations than other simultaneously published papers. We propose an inhomogenous causal network model to model the citation network, the connection mechanism of which well expresses some features of citation. The node growth trend and degree distributions of the generated networks also fit those of some citation networks well.
Lifescience Database Archive (English)
Full Text Available 1997.12.25 Translated Amino Acid sequence itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKIQK ARDIL...iny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKIQK ARDILSGKETEEVHVMGRIRKSNKDYNPKYSFHIDPDTVTFFSMAIEVCDATA
Dauerhafter Zugriff auf digitale Publikationen – das DFG-Projekt NatHosting
Directory of Open Access Journals (Sweden)
Hildegard Schäffler
2015-12-01
Full Text Available Das Arbeiten mit digitalen Veröffentlichungen und Daten in Forschung, Lehre und Studium erfordert eine kontinuierliche und möglichst störungsfreie Verfügbarkeit dieser Inhalte. Bei Publikationen, die von wissenschaftlichen Fachverlagen lizenzpflichtig vertrieben werden, können verschiedene Typen von Störungsfällen wie temporäre oder längerfristige Ausfälle von Verlagsservern, der Transfer von Zeitschriftentiteln zu anderen Verlagen, das komplette Ausscheiden von Verlagen aus dem Markt oder die Abbestellung der elektronischen Ressourcen durch die lizenznehmende Einrichtung zu Zugriffsunterbrechungen führen. Das DFG-Projekt „Nationales Hosting elektronischer Ressourcen“ (NatHosting untersucht, wie unter Berücksichtigung bereits existierender Lösungsansätze eine nationale Strategie zur Absicherung des dauerhaften Zugriffs auf digitale Publikationen entwickelt werden kann. Das vom Projekt erarbeitete Lösungskonzept umfasst eine zweigleisige Strategie der Teilnahme eines nationalen Konsortiums bei Portico bei gleichzeitigem Aufbau eines „Private LOCKSS Networks“ für die durch Portico nicht abgedeckten Inhalte. Weitere Komponenten sind der Aufbau eines rechnergestützten Rechtemanagements und die Einrichtung einer „Hosting-Agentur“ mit Koordinationsaufgaben für das nationale Hosting. In order to work with digital publications and data in a reliable and sustainable way, researchers need to be sure that access to and immediate availability of the content is provided continuously and free of faults. An interruption of access to licensed content can occur for various reasons such as temporary or long-term breakdown of publishers’ servers, the transfer of journals to another publisher, the withdrawal of publishers from the market or the termination of electronic resource subscriptions by the licensee. Against the background of existing solutions, the project NatHosting (National Hosting of Electronic Resources aims at
Network Coded Software Defined Networking
DEFF Research Database (Denmark)
Hansen, Jonas; Roetter, Daniel Enrique Lucani; Krigslund, Jeppe
2015-01-01
Software defined networking has garnered large attention due to its potential to virtualize services in the Internet, introducing flexibility in the buffering, scheduling, processing, and routing of data in network routers. SDN breaks the deadlock that has kept Internet network protocols stagnant...... for decades, while applications and physical links have evolved. This article advocates for the use of SDN to bring about 5G network services by incorporating network coding (NC) functionalities. The latter constitutes a major leap forward compared to the state-of-the- art store and forward Internet paradigm...
Green mobile networks a networking perspective
Ansari, Nirwan
2016-01-01
Combines the hot topics of energy efficiency and next generation mobile networking, examining techniques and solutions. Green communications is a very hot topic. Ever increasing mobile network bandwidth rates significantly impacts on operating costs due to aggregate network energy consumption. As such, design on 4G networks and beyond has increasingly started to focus on 'energy efficiency' or so-called 'green' networks. Many techniques and solutions have been proposed to enhance the energy efficiency of mobile networks, yet no book has provided an in-depth analysis of the energy consumption issues in mobile networks nor offers detailed theories, tools and solutions for solving the energy efficiency problems.
Directory of Open Access Journals (Sweden)
Clare Strode
2014-03-01
Full Text Available Pyrethroid insecticide-treated bed nets (ITNs help contribute to reducing malaria deaths in Africa, but their efficacy is threatened by insecticide resistance in some malaria mosquito vectors. We therefore assessed the evidence that resistance is attenuating the effect of ITNs on entomological outcomes.We included laboratory and field studies of African malaria vectors that measured resistance at the time of the study and used World Health Organization-recommended impregnation regimens. We reported mosquito mortality, blood feeding, induced exophily (premature exit of mosquitoes from the hut, deterrence, time to 50% or 95% knock-down, and percentage knock-down at 60 min. Publications were searched from 1 January 1980 to 31 December 2013 using MEDLINE, Cochrane Central Register of Controlled Trials, Science Citation Index Expanded, Social Sciences Citation Index, African Index Medicus, and CAB Abstracts. We stratified studies into three levels of insecticide resistance, and ITNs were compared with untreated bed nets (UTNs using the risk difference (RD. Heterogeneity was explored visually and statistically. Included were 36 laboratory and 24 field studies, reported in 25 records. Studies tested and reported resistance inconsistently. Based on the meta-analytic results, the difference in mosquito mortality risk for ITNs compared to UTNs was lower in higher resistance categories. However, mortality risk was significantly higher for ITNs compared to UTNs regardless of resistance. For cone tests: low resistance, risk difference (RD 0.86 (95% CI 0.72 to 1.01; moderate resistance, RD 0.71 (95% CI 0.53 to 0.88; high resistance, RD 0.56 (95% CI 0.17 to 0.95. For tunnel tests: low resistance, RD 0.74 (95% CI 0.61 to 0.87; moderate resistance, RD 0.50 (95% CI 0.40 to 0.60; high resistance, RD 0.39 (95% CI 0.24 to 0.54. For hut studies: low resistance, RD 0.56 (95% CI 0.43 to 0.68; moderate resistance, RD 0.39 (95% CI 0.16 to 0.61; high resistance, RD 0
Masó, Joan; Serral, Ivette; McCallum, Ian; Blonda, Palma; Plag, Hans-Peter
2016-04-01
ConnectinGEO (Coordinating an Observation Network of Networks EnCompassing saTellite and IN-situ to fill the Gaps in European Observations" is an H2020 Coordination and Support Action with the primary goal of linking existing Earth Observation networks with science and technology (S&T) communities, the industry sector, the Group on Earth Observations (GEO), and Copernicus. The project will end in February 2017. ConnectinGEO will initiate a European Network of Earth Observation Networks (ENEON) that will encompass space-based, airborne and in-situ observations networks. ENEON will be composed of project partners representing thematic observation networks along with the GEOSS Science and Technology Stakeholder Network, GEO Communities of Practices, Copernicus services, Sentinel missions and in-situ support data representatives, representatives of the European space-based, airborne and in-situ observations networks. This communication presents the complex panorama of Earth Observations Networks in Europe. The list of networks is classified by discipline, variables, geospatial scope, etc. We also capture the membership and relations with other networks and umbrella organizations like GEO. The result is a complex interrelation between networks that can not be clearly expressed in a flat list. Technically the networks can be represented as nodes with relations between them as lines connecting the nodes in a graph. We have chosen RDF as a language and an AllegroGraph 3.3 triple store that is visualized in several ways using for example Gruff 5.7. Our final aim is to identify gaps in the EO Networks and justify the need for a more structured coordination between them.
National Aeronautics and Space Administration — ITN Energy Systems, Inc., along with the Energy and Environmental Research Center (EERC), proposes to develop a highly efficient power generation system capable of...
Informationsdesign von Bildungsportalen : Struktur und Aufbau netzbasierter Bildungsressourcen
Panke, Stefanie
2009-01-01
Sowohl Unternehmen als auch Bildungseinrichtungen, Verlage, politische Organisationen, Verbände, Interessengruppen und Privatpersonen nutzen das Internet, um Informationen zu verbreiten. Die Varianz an Akteuren, Adressaten und Botschaften spiegelt sich wider in einem wachsenden Spektrum an Web-Genres: Suchmaschine, E-Commerce-Auftritt und Online-Zeitung teilen sich die Aufmerksamkeit der Leser unter anderem mit privaten Weblogs und kollaborativen Wissenssammlungen wie der Enzyklopädie Wikiped...
Optimaler Aufbau von Batteriesystemen für Windkraftanlagen
König, Sebastian; Leibfried, Thomas; Wandschneider, Frank; Röhm, Simon; Fischer, Peter
2013-01-01
Die Modellierung, Simulation und Optimierung eines großen Batteriespeichersystems wird am Beispiel der Vanadium-Redox-Flow-Batterie (VRFB) präsentiert. Das vorgestellte multiphysikalische Gesamtmodell spiegelt das elektrochemi-sche und das hydraulische Verhalten der Batterie wieder. Der elektrische Teil enthält auch eine in Zusammenarbeit mit dem Fraunhofer ICT in Pfinztal/Berghausen entworfene Modellierung der sogenannten Streustromverluste, welche in Flussbatterien auftreten. Das Energiewan...
Cloud networking understanding cloud-based data center networks
Lee, Gary
2014-01-01
Cloud Networking: Understanding Cloud-Based Data Center Networks explains the evolution of established networking technologies into distributed, cloud-based networks. Starting with an overview of cloud technologies, the book explains how cloud data center networks leverage distributed systems for network virtualization, storage networking, and software-defined networking. The author offers insider perspective to key components that make a cloud network possible such as switch fabric technology and data center networking standards. The final chapters look ahead to developments in architectures
Directory of Open Access Journals (Sweden)
Feng HE
2017-12-01
Full Text Available The state of the art avionics system adopts switched networks for airborne communications. A major concern in the design of the networks is the end-to-end guarantee ability. Analytic methods have been developed to compute the worst-case delays according to the detailed configurations of flows and networks within avionics context, such as network calculus and trajectory approach. It still lacks a relevant method to make a rapid performance estimation according to some typically switched networking features, such as networking scale, bandwidth utilization and average flow rate. The goal of this paper is to establish a deterministic upper bound analysis method by using these networking features instead of the complete network configurations. Two deterministic upper bounds are proposed from network calculus perspective: one is for a basic estimation, and another just shows the benefits from grouping strategy. Besides, a mathematic expression for grouping ability is established based on the concept of network connecting degree, which illustrates the possibly minimal grouping benefit. For a fully connected network with 4 switches and 12 end systems, the grouping ability coming from grouping strategy is 15â20%, which just coincides with the statistical data (18â22% from the actual grouping advantage. Compared with the complete network calculus analysis method for individual flows, the effectiveness of the two deterministic upper bounds is no less than 38% even with remarkably varied packet lengths. Finally, the paper illustrates the design process for an industrial Avionics Full DupleX switched Ethernet (AFDX networking case according to the two deterministic upper bounds and shows that a better control for network connecting, when designing a switched network, can improve the worst-case delays dramatically. Keywords: Deterministic bound, Grouping ability, Network calculus, Networking features, Switched networks
Cascading Failures and Recovery in Networks of Networks
Havlin, Shlomo
Network science have been focused on the properties of a single isolated network that does not interact or depends on other networks. In reality, many real-networks, such as power grids, transportation and communication infrastructures interact and depend on other networks. I will present a framework for studying the vulnerability and the recovery of networks of interdependent networks. In interdependent networks, when nodes in one network fail, they cause dependent nodes in other networks to also fail. This is also the case when some nodes like certain locations play a role in two networks -multiplex. This may happen recursively and can lead to a cascade of failures and to a sudden fragmentation of the system. I will present analytical solutions for the critical threshold and the giant component of a network of n interdependent networks. I will show, that the general theory has many novel features that are not present in the classical network theory. When recovery of components is possible global spontaneous recovery of the networks and hysteresis phenomena occur and the theory suggests an optimal repairing strategy of system of systems. I will also show that interdependent networks embedded in space are significantly more vulnerable compared to non embedded networks. In particular, small localized attacks may lead to cascading failures and catastrophic consequences.Thus, analyzing data of real network of networks is highly required to understand the system vulnerability. DTRA, ONR, Israel Science Foundation.
Kirchner, Stefan
Im Jahre 1953 wurde von James Watson und Francis Crick erstmalig der strukturelle Aufbau der sogenannten DNA (Desoxyribonukleinsäure) beschrieben, welche das Erbgut jedes Lebewesens enthält. Der wesentliche Teil des Erbguts wird dabei durch eine sehr lange Folge der vier Basen Adenin (A), Cytosin (C), Guanin (G) und Thymin (T) codiert. Seit einigen Jahren ist es möglich, die Folge der vier Basen zu einer gegebenen DNA zu bestimmen. Biologen bezeichnen diesen Vorgang als Sequenzierung.
Schulze, Céline
2016-01-01
Die Optische Kohärenztomografie (OCT) ist eine neue Methode der Bilddarstellung, welche bereits erfolgreich in der humanmedizinischen Ophthalmologie etabliert wurde. Sie bietet die Möglichkeit, den Aufbau und die Morphologie der Retina in Querschnitten darzustellen und dies nicht-invasiv, kontaktfrei und in vivo in annähernd histologischer Auflösung. In der aviären Ophthalmologie wurde die OCT bisher kaum angewendet. Das Ziel der vorliegenden Arbeit war es daher, die OCT als ein geeignete...
National Aeronautics and Space Administration — ITN proposes to create an innovative anode supported membrane electrode assembly (MEA) for solid oxide fuel cells (SOFCs) that is capable of long-term operation at...
Data center networks and network architecture
Esaki, Hiroshi
2014-02-01
This paper discusses and proposes the architectural framework, which is for data center networks. The data center networks require new technical challenges, and it would be good opportunity to change the functions, which are not need in current and future networks. Based on the observation and consideration on data center networks, this paper proposes; (i) Broadcast-free layer 2 network (i.e., emulation of broadcast at the end-node), (ii) Full-mesh point-to-point pipes, and (iii) IRIDES (Invitation Routing aDvertisement for path Engineering System).
Peak, Corey M; Thuan, Phung Duc; Britton, Amadea; Nguyen, Tran Dang; Wolbers, Marcel; Thanh, Ngo Viet; Buckee, Caroline O; Boni, Maciej F
2015-04-01
In addition to being effective, fast-acting, and well tolerated, artemisinin-based combination therapies (ACTs) are able to kill certain transmission stages of the malaria parasite. However, the population-level impacts of ACTs on reducing malaria transmission have been difficult to assess. In this study on the history of malaria control in Vietnam, we assemble annual reporting on malaria case counts, coverage with insecticide-treated nets (ITN) and indoor residual spraying (IRS), and drug purchases by provincial malaria control programs from 1991 to 2010 in Vietnam's 20 southern provinces. We observe a significant negative association between artemisinin use and malaria incidence, with a 10% absolute increase in the purchase proportion of artemisinin-containing regimens being associated with a 29.1% (95% confidence interval: 14.8-41.0%) reduction in slide-confirmed malaria incidence, after accounting for changes in urbanization, ITN/IRS coverage, and two indicators of health system capacity. One budget-related indicator of health system capacity was found to have a smaller association with malaria incidence, and no other significant factors were found. Our findings suggest that including an artemisinin component in malaria drug regimens was strongly associated with reduced malaria incidence in southern Vietnam, whereas changes in urbanization and coverage with ITN or IRS were not. © The American Society of Tropical Medicine and Hygiene.
Directory of Open Access Journals (Sweden)
A. Ankomah
2014-01-01
Full Text Available Background. Malaria during pregnancy is a major public health problem in Nigeria especially in malaria-endemic areas. It increases the risk of low birth weight and child/maternal morbidity/mortality. This paper addresses the impact of radio campaigns on the use of insecticide-treated bed nets among pregnant women in Nigeria. Methods. A total of 2,348 pregnant women were interviewed during the survey across 21 of Nigeria’s 36 states. Respondents were selected through a multistage sampling technique. Analysis was based on multivariate logistic regression. Results. Respondents who knew that sleeping under ITN prevents malaria were 3.2 times more likely to sleep under net (OR: 3.15; 95% CI: 2.28 to 4.33; P<0.0001. Those who listened to radio are also about 1.6 times more likely to use ITN (OR: 1.56; 95% CI: 1.07 to 2.28; P=0.020, while respondents who had heard of a specific sponsored radio campaign on ITN are 1.53 times more likely to use a bed net (P=0.019. Conclusion. Pregnant women who listened to mass media campaigns were more likely to adopt strategies to protect themselves from malaria. Therefore, behavior change communication messages that are aimed at promoting net use and antenatal attendance are necessary in combating malaria.
Vulnerability and controllability of networks of networks
International Nuclear Information System (INIS)
Liu, Xueming; Peng, Hao; Gao, Jianxi
2015-01-01
Network science is a highly interdisciplinary field ranging from natural science to engineering technology and it has been applied to model complex systems and used to explain their behaviors. Most previous studies have been focus on isolated networks, but many real-world networks do in fact interact with and depend on other networks via dependency connectivities, forming “networks of networks” (NON). The interdependence between networks has been found to largely increase the vulnerability of interacting systems, when a node in one network fails, it usually causes dependent nodes in other networks to fail, which, in turn, may cause further damage on the first network and result in a cascade of failures with sometimes catastrophic consequences, e.g., electrical blackouts caused by the interdependence of power grids and communication networks. The vulnerability of a NON can be analyzed by percolation theory that can be used to predict the critical threshold where a NON collapses. We review here the analytic framework for analyzing the vulnerability of NON, which yields novel percolation laws for n-interdependent networks and also shows that percolation theory of a single network studied extensively in physics and mathematics in the last 50 years is a specific limited case of the more general case of n interacting networks. Understanding the mechanism behind the cascading failure in NON enables us finding methods to decrease the vulnerability of the natural systems and design of more robust infrastructure systems. By examining the vulnerability of NON under targeted attack and studying the real interdependent systems, we find two methods to decrease the systems vulnerability: (1) protect the high-degree nodes, and (2) increase the degree correlation between networks. Furthermore, the ultimate proof of our understanding of natural and technological systems is reflected in our ability to control them. We also review the recent studies and challenges on the
Network coding at different layers in wireless networks
2016-01-01
This book focuses on how to apply network coding at different layers in wireless networks – including MAC, routing, and TCP – with special focus on cognitive radio networks. It discusses how to select parameters in network coding (e.g., coding field, number of packets involved, and redundant information ration) in order to be suitable for the varying wireless environments. The book explores how to deploy network coding in MAC to improve network performance and examines joint network coding with opportunistic routing to improve the successful rate of routing. In regards to TCP and network coding, the text considers transport layer protocol working with network coding to overcome the transmission error rate, particularly with how to use the ACK feedback of TCP to enhance the efficiency of network coding. The book pertains to researchers and postgraduate students, especially whose interests are in opportunistic routing and TCP in cognitive radio networks.
Overlay networks toward information networking
Tarkoma, Sasu
2010-01-01
With their ability to solve problems in massive information distribution and processing, while keeping scaling costs low, overlay systems represent a rapidly growing area of R&D with important implications for the evolution of Internet architecture. Inspired by the author's articles on content based routing, Overlay Networks: Toward Information Networking provides a complete introduction to overlay networks. Examining what they are and what kind of structures they require, the text covers the key structures, protocols, and algorithms used in overlay networks. It reviews the current state of th
Exploring network operations for data and information networks
Yao, Bing; Su, Jing; Ma, Fei; Wang, Xiaomin; Zhao, Xiyang; Yao, Ming
2017-01-01
Barabási and Albert, in 1999, formulated scale-free models based on some real networks: World-Wide Web, Internet, metabolic and protein networks, language or sexual networks. Scale-free networks not only appear around us, but also have high qualities in the world. As known, high quality information networks can transfer feasibly and efficiently data, clearly, their topological structures are very important for data safety. We build up network operations for constructing large scale of dynamic networks from smaller scale of network models having good property and high quality. We focus on the simplest operators to formulate complex operations, and are interesting on the closeness of operations to desired network properties.
Energy Technology Data Exchange (ETDEWEB)
Hiddemann, Wolfgang [Muenchen Univ. Klinikum Grosshadern (Germany). Medizinische Klinik und Poliklinik III; Bartram Claus R. (eds.) [Heidelberg Univ. (Germany). Inst. fuer Humangenetik
2010-07-01
The book Oncology is aimed to communicate the compiled knowledge on tumor development and cancer: fundamental knowledge base, practice related know-how for diagnostics and therapy. Part 1 includes the following chapters: epidemiology and pathogenesis, basic principles of diagnostics, basic principles of therapy, complication of malign growth, tumors in the gastrointestinal tract, female genital carcinomas, kidney and urinary tract carcinomas, respiratory tract and lung carcinomas, carcinomas in the head - neck area, bone and soft tissue carcinomas, pediatric tumors, hematological neoplasm, other carcinomas. The book can be used as reference for clinical work. [German] Die gesamte Onkologie - verlaessliches Wissen fuer Ihre Kompetenz. ''Die Onkologie'' stellt sich der Herausforderung, das staendig wachsende Wissen ueber Tumorerkrankungen in seiner Gesamtheit zu vermitteln. Sowohl inhaltlich als auch didaktisch auf hoechsten Niveau: Fundiertes Grundlagenwissen zum umfassenden Nachschlagen Praxisrelevantes Know-how fuer Diagnostik und Therapie Systematischer Aufbau fuer das Verstaendnis der komplexen Zusammenhaenge Die Onkologie - eine Enzyklopaedie der modernen klinischen Tumorlehre. Angesehene Experten aus Klinik, Forschung und Praxis liefern Ihnen in Teil1 klinisches Grundlagenwissen zu den Grundprinzipien der Therapie, Epidemiologie, Aetiologie und Pathogenese, sowie zu Komplikationen des malignen Wachstums. Zum Nachschlagen und Anwenden: finden Sie alle Optionen - auch fuer Ihren schwierigsten Fall. Der uebersichtliche Aufbau und die exzellenten Abbildungen erleichtern Ihnen das schnelle Auffinden und Verstaendnis der gesuchten Informationen. Fuer den Alltag onkologisch taetiger Aerzte ist Die Onkologie ein unentbehrlicher Meilenstein. (orig.)
Directory of Open Access Journals (Sweden)
Azizi Salum
2011-04-01
Full Text Available Abstract Background Insecticide-treated nets (ITNs and indoor residual spraying (IRS represent the front-line tools for malaria vector control globally, but are optimally effective where the majority of baseline transmission occurs indoors. In the surveyed area of rural southern Tanzania, bed net use steadily increased over the last decade, reducing malaria transmission intensity by 94%. Methods Starting before bed nets were introduced (1997, and then after two milestones of net use had been reached-75% community-wide use of untreated nets (2004 and then 47% use of ITNs (2009-hourly biting rates of malaria vectors from the Anopheles gambiae complex and Anopheles funestus group were surveyed. Results In 1997, An. gambiae s.l. and An. funestus mosquitoes exhibited a tendency to bite humans inside houses late at night. For An. gambiae s.l., by 2009, nocturnal activity was less (p = 0.0018. At this time, the sibling species composition of the complex had shifted from predominantly An. gambiae s.s. to predominantly An. arabiensis. For An. funestus, by 2009, nocturnal activity was less (p = 0.0054 as well as the proportion biting indoors (p An. funestus s.s. remained the predominant species within this group. As a consequence of these altered feeding patterns, the proportion (mean ± standard error of human contact with mosquitoes (bites per person per night occurring indoors dropped from 0.99 ± 0.002 in 1997 to 0.82 ± 0.008 in 2009 for the An. gambiae complex (p = 0.0143 and from 1.00 ± An. funestus complex (p = 0.0004 over the same time period. Conclusions High usage of ITNs can dramatically alter African vector populations so that intense, predominantly indoor transmission is replaced by greatly lowered residual transmission, a greater proportion of which occurs outdoors. Regardless of the underlying mechanism, the residual, self-sustaining transmission will respond poorly to further insecticidal measures within houses. Additional vector control
Hamilton, Matthew; Mahiane, Guy; Werst, Elric; Sanders, Rachel; Briët, Olivier; Smith, Thomas; Cibulskis, Richard; Cameron, Ewan; Bhatt, Samir; Weiss, Daniel J; Gething, Peter W; Pretorius, Carel; Korenromp, Eline L
2017-02-10
Scale-up of malaria prevention and treatment needs to continue but national strategies and budget allocations are not always evidence-based. This article presents a new modelling tool projecting malaria infection, cases and deaths to support impact evaluation, target setting and strategic planning. Nested in the Spectrum suite of programme planning tools, the model includes historic estimates of case incidence and deaths in groups aged up to 4, 5-14, and 15+ years, and prevalence of Plasmodium falciparum infection (PfPR) among children 2-9 years, for 43 sub-Saharan African countries and their 602 provinces, from the WHO and malaria atlas project. Impacts over 2016-2030 are projected for insecticide-treated nets (ITNs), indoor residual spraying (IRS), seasonal malaria chemoprevention (SMC), and effective management of uncomplicated cases (CMU) and severe cases (CMS), using statistical functions fitted to proportional burden reductions simulated in the P. falciparum dynamic transmission model OpenMalaria. In projections for Nigeria, ITNs, IRS, CMU, and CMS scale-up reduced health burdens in all age groups, with largest proportional and especially absolute reductions in children up to 4 years old. Impacts increased from 8 to 10 years following scale-up, reflecting dynamic effects. For scale-up of each intervention to 80% effective coverage, CMU had the largest impacts across all health outcomes, followed by ITNs and IRS; CMS and SMC conferred additional small but rapid mortality impacts. Spectrum-Malaria's user-friendly interface and intuitive display of baseline data and scenario projections holds promise to facilitate capacity building and policy dialogue in malaria programme prioritization. The module's linking to the OneHealth Tool for costing will support use of the software for strategic budget allocation. In settings with moderately low coverage levels, such as Nigeria, improving case management and achieving universal coverage with ITNs could achieve
Gradient networks on uncorrelated random scale-free networks
International Nuclear Information System (INIS)
Pan Guijun; Yan Xiaoqing; Huang Zhongbing; Ma Weichuan
2011-01-01
Uncorrelated random scale-free (URSF) networks are useful null models for checking the effects of scale-free topology on network-based dynamical processes. Here, we present a comparative study of the jamming level of gradient networks based on URSF networks and Erdos-Renyi (ER) random networks. We find that the URSF networks are less congested than ER random networks for the average degree (k)>k c (k c ∼ 2 denotes a critical connectivity). In addition, by investigating the topological properties of the two kinds of gradient networks, we discuss the relations between the topological structure and the transport efficiency of the gradient networks. These findings show that the uncorrelated scale-free structure might allow more efficient transport than the random structure.
Reconfigurable network systems and software-defined networking
Zilberman, N.; Watts, P. M.; Rotsos, C.; Moore, A. W.
2015-01-01
Modern high-speed networks have evolved from relatively static networks to highly adaptive networks facilitating dynamic reconfiguration. This evolution has influenced all levels of network design and management, introducing increased programmability and configuration flexibility. This influence has extended from the lowest level of physical hardware interfaces to the highest level of network management by software. A key representative of this evolution is the emergence of software-defined n...
Improving network management with Software Defined Networking
International Nuclear Information System (INIS)
Dzhunev, Pavel
2013-01-01
Software-defined networking (SDN) is developed as an alternative to closed networks in centers for data processing by providing a means to separate the control layer data layer switches, and routers. SDN introduces new possibilities for network management and configuration methods. In this article, we identify problems with the current state-of-the-art network configuration and management mechanisms and introduce mechanisms to improve various aspects of network management
Network Restoration for Next-Generation Communication and Computing Networks
Directory of Open Access Journals (Sweden)
B. S. Awoyemi
2018-01-01
Full Text Available Network failures are undesirable but inevitable occurrences for most modern communication and computing networks. A good network design must be robust enough to handle sudden failures, maintain traffic flow, and restore failed parts of the network within a permissible time frame, at the lowest cost achievable and with as little extra complexity in the network as possible. Emerging next-generation (xG communication and computing networks such as fifth-generation networks, software-defined networks, and internet-of-things networks have promises of fast speeds, impressive data rates, and remarkable reliability. To achieve these promises, these complex and dynamic xG networks must be built with low failure possibilities, high network restoration capacity, and quick failure recovery capabilities. Hence, improved network restoration models have to be developed and incorporated in their design. In this paper, a comprehensive study on network restoration mechanisms that are being developed for addressing network failures in current and emerging xG networks is carried out. Open-ended problems are identified, while invaluable ideas for better adaptation of network restoration to evolving xG communication and computing paradigms are discussed.
Awareness, attitudes and prevention of malaria in the cities of Douala and Yaoundé (Cameroon
Directory of Open Access Journals (Sweden)
Menze-Djantio Benjamin
2011-09-01
Full Text Available Abstract Background There is little information on the social perception of malaria and the use of prevention methods in Cameroon. This study was designed to assess knowledge, attitude and management of malaria in households living in the cities of Douala and Yaoundé. Results Over 82% of people interviewed associated malaria transmission to mosquito bites. Methods used for malaria prevention were: environmental sanitation 1645 (76.1%, use of bed nets 1491 (69%, insecticide spray/coils 265 (12.3% and netting of doors or windows 42 (1.9%. Bed net ownership was significantly high in Yaoundé (73.8% (P Conclusion The study revealed a high awareness of populations on malaria and ITNs. However some attitudes hindering the use of ITN or related to the management of clinical cases need further attention.
Measuring of a few integral data in the ΣΣ neutron field
International Nuclear Information System (INIS)
Garlea, I.; Miron, C.; Lupu, M.; Ilie, P.; Thurzo, A.; Stanica, N.; Popa, F.
1978-01-01
Measurements of absolute reaction rates for the nonfissionable isotopes were obtained at the Institute for Nuclear Technology (ITN) Romania, using activation detector foils exposed at the centre of ΣΣ. The average microscopic integral cross sections sigma were obtained for the following reactions: 197 Au(n,γ), 115 In(n,γ), 115 In(n,n'), 27 Al(n,α), 46 Ti(n,p), 47 Ti(n,p), 48 Ti(n,p) and 58 Ni(n,p). The same data, the absolute reaction rates and the average microscopic integral cross sections, for the principal fissionable isotopes were performed in the ΣΣ-ITN facility by means of absolute fission chambers. These average fission cross sections for 235 U, 239 Pu, 238 U, 237 Np, 232 Th, 233 U, 241 Pu were determined. (author)
Zum Bau und histologischen Terminologie von Laubmoosstämmchen
Frahm, Jan-Peter; Müller, Rolf-Dieter
2012-01-01
Es wird ein historischer Abriss der Geschichte der anatomischen Forschung an Moosen gegeben, der Aufbau von Laubmoosstämmchen skizziert und speziell die unterschiedliche Terminologie der Gewebetypen diskutiert. Der weit verbreitete Ausdruck Epidermis kann nicht auf Moose angewandt werden, weil die äußerste Schicht des Stämmchens nicht die Definiton des Begriffes erfüllt, verdickt und längsgestreckt ist. Sie gehört zur äußeren Sklerodermis. Längsgestreckt ist auch das sog. Parenchym oder Mark...
Energy Technology Data Exchange (ETDEWEB)
Boettcher, R.; Hugo, K.H.; Kuhn, M.; Strauch, T. (comps.)
1999-07-01
The developments in Saarland and Rhineland-Palatinate mining are presented. Structure and responsibilities of the regional mines inspectorate are described, and their activities in the following fields are reported: industrial safety, health, mining and safety, mining and environmental protection. (orig.) [German] Nach Darstellung der bergwirtschaftlichen Entwicklung im Saarland und im Land Rheinland-Pfalz wird ueber den Aufbau und die Zustaendigkeit der Bergbehoerden sowie ueber deren Taetigkeiten auf folgenden Gebieten berichtet: Arbeits- und Gesundheitsschutz, Bergtechnik und Sicherheit, Bergbau und Umwelt. (orig.)
Learning Networks, Networked Learning
Sloep, Peter; Berlanga, Adriana
2010-01-01
Sloep, P. B., & Berlanga, A. J. (2011). Learning Networks, Networked Learning [Redes de Aprendizaje, Aprendizaje en Red]. Comunicar, XIX(37), 55-63. Retrieved from http://dx.doi.org/10.3916/C37-2011-02-05
Krioukov, Dmitri; Kitsak, Maksim; Sinkovits, Robert S; Rideout, David; Meyer, David; Boguñá, Marián
2012-01-01
Prediction and control of the dynamics of complex networks is a central problem in network science. Structural and dynamical similarities of different real networks suggest that some universal laws might accurately describe the dynamics of these networks, albeit the nature and common origin of such laws remain elusive. Here we show that the causal network representing the large-scale structure of spacetime in our accelerating universe is a power-law graph with strong clustering, similar to many complex networks such as the Internet, social, or biological networks. We prove that this structural similarity is a consequence of the asymptotic equivalence between the large-scale growth dynamics of complex networks and causal networks. This equivalence suggests that unexpectedly similar laws govern the dynamics of complex networks and spacetime in the universe, with implications to network science and cosmology.
Network marketing on a small-world network
Kim, Beom Jun; Jun, Tackseung; Kim, Jeong-Yoo; Choi, M. Y.
2006-02-01
We investigate a dynamic model of network marketing in a small-world network structure artificially constructed similarly to the Watts-Strogatz network model. Different from the traditional marketing, consumers can also play the role of the manufacturer's selling agents in network marketing, which is stimulated by the referral fee the manufacturer offers. As the wiring probability α is increased from zero to unity, the network changes from the one-dimensional regular directed network to the star network where all but one player are connected to one consumer. The price p of the product and the referral fee r are used as free parameters to maximize the profit of the manufacturer. It is observed that at α=0 the maximized profit is constant independent of the network size N while at α≠0, it increases linearly with N. This is in parallel to the small-world transition. It is also revealed that while the optimal value of p stays at an almost constant level in a broad range of α, that of r is sensitive to a change in the network structure. The consumer surplus is also studied and discussed.
Weighted Scale-Free Network Properties of Ecological Network
International Nuclear Information System (INIS)
Lee, Jae Woo; Maeng, Seong Eun
2013-01-01
We investigate the scale-free network properties of the bipartite ecological network, in particular, the plant-pollinator network. In plant-pollinator network, the pollinators visit the plant to get the nectars. In contrast to the other complex network, the plant-pollinator network has not only the trophic relationships among the interacting partners but also the complexities of the coevolutionary effects. The interactions between the plant and pollinators are beneficial relations. The plant-pollinator network is a bipartite and weighted network. The networks have two types of the nodes: plant and pollinator. We consider the visiting frequency of a pollinator to a plant as the weighting value of the link. We defined the strength of a node as the sum of the weighting value of the links. We reported the cumulative distribution function (CDF) of the degree and the strength of the plant-pollinator network. The CDF of the plants followed stretched exponential functions for both degree and strength, but the CDF of the pollinators showed the power law for both degree and strength. The average strength of the links showed the nonlinear dependence on the degree of the networks.
A Network Traffic Control Enhancement Approach over Bluetooth Networks
DEFF Research Database (Denmark)
Son, L.T.; Schiøler, Henrik; Madsen, Ole Brun
2003-01-01
This paper analyzes network traffic control issues in Bluetooth data networks as convex optimization problem. We formulate the problem of maximizing of total network flows and minimizing the costs of flows. An adaptive distributed network traffic control scheme is proposed as an approximated solu...... as capacity limitations and flow requirements in the network. Simulation shows that the performance of Bluetooth networks could be improved by applying the adaptive distributed network traffic control scheme...... solution of the stated optimization problem that satisfies quality of service requirements and topologically induced constraints in Bluetooth networks, such as link capacity and node resource limitations. The proposed scheme is decentralized and complies with frequent changes of topology as well......This paper analyzes network traffic control issues in Bluetooth data networks as convex optimization problem. We formulate the problem of maximizing of total network flows and minimizing the costs of flows. An adaptive distributed network traffic control scheme is proposed as an approximated...
Network structure exploration in networks with node attributes
Chen, Yi; Wang, Xiaolong; Bu, Junzhao; Tang, Buzhou; Xiang, Xin
2016-05-01
Complex networks provide a powerful way to represent complex systems and have been widely studied during the past several years. One of the most important tasks of network analysis is to detect structures (also called structural regularities) embedded in networks by determining group number and group partition. Most of network structure exploration models only consider network links. However, in real world networks, nodes may have attributes that are useful for network structure exploration. In this paper, we propose a novel Bayesian nonparametric (BNP) model to explore structural regularities in networks with node attributes, called Bayesian nonparametric attribute (BNPA) model. This model does not only take full advantage of both links between nodes and node attributes for group partition via shared hidden variables, but also determine group number automatically via the Bayesian nonparametric theory. Experiments conducted on a number of real and synthetic networks show that our BNPA model is able to automatically explore structural regularities in networks with node attributes and is competitive with other state-of-the-art models.
Possible oxidative effects of isotretinoin and modulatory effects of ...
African Journals Online (AJOL)
KATIA
2016-02-10
Feb 10, 2016 ... In vivo study conducted on S. cerevisiae cells was carried out with ITN. 20 µg/ml taking hydrogen ... single mutants and two double mutants Saccharomyces cerevisiae strains. ..... cytoplasma and mitochondria. The enzyme ...
Undermining and Strengthening Social Networks through Network Modification
Mellon, Jonathan; Yoder, Jordan; Evans, Daniel
2016-10-01
Social networks have well documented effects at the individual and aggregate level. Consequently it is often useful to understand how an attempt to influence a network will change its structure and consequently achieve other goals. We develop a framework for network modification that allows for arbitrary objective functions, types of modification (e.g. edge weight addition, edge weight removal, node removal, and covariate value change), and recovery mechanisms (i.e. how a network responds to interventions). The framework outlined in this paper helps both to situate the existing work on network interventions but also opens up many new possibilities for intervening in networks. In particular use two case studies to highlight the potential impact of empirically calibrating the objective function and network recovery mechanisms as well as showing how interventions beyond node removal can be optimised. First, we simulate an optimal removal of nodes from the Noordin terrorist network in order to reduce the expected number of attacks (based on empirically predicting the terrorist collaboration network from multiple types of network ties). Second, we simulate optimally strengthening ties within entrepreneurial ecosystems in six developing countries. In both cases we estimate ERGM models to simulate how a network will endogenously evolve after intervention.
Loo, Boon Thau
2012-01-01
Declarative Networking is a programming methodology that enables developers to concisely specify network protocols and services, which are directly compiled to a dataflow framework that executes the specifications. Declarative networking proposes the use of a declarative query language for specifying and implementing network protocols, and employs a dataflow framework at runtime for communication and maintenance of network state. The primary goal of declarative networking is to greatly simplify the process of specifying, implementing, deploying and evolving a network design. In addition, decla
Recent advances on failure and recovery in networks of networks
International Nuclear Information System (INIS)
Shekhtman, Louis M.; Danziger, Michael M.; Havlin, Shlomo
2016-01-01
Until recently, network science has focused on the properties of single isolated networks that do not interact or depend on other networks. However it has now been recognized that many real-networks, such as power grids, transportation systems, and communication infrastructures interact and depend on other networks. Here, we will present a review of the framework developed in recent years for studying the vulnerability and recovery of networks composed of interdependent networks. In interdependent networks, when nodes in one network fail, they cause dependent nodes in other networks to also fail. This is also the case when some nodes, like for example certain people, play a role in two networks, i.e. in a multiplex. Dependency relations may act recursively and can lead to cascades of failures concluding in sudden fragmentation of the system. We review the analytical solutions for the critical threshold and the giant component of a network of n interdependent networks. The general theory and behavior of interdependent networks has many novel features that are not present in classical network theory. Interdependent networks embedded in space are significantly more vulnerable compared to non-embedded networks. In particular, small localized attacks may lead to cascading failures and catastrophic consequences. Finally, when recovery of components is possible, global spontaneous recovery of the networks and hysteresis phenomena occur. The theory developed for this process points to an optimal repairing strategy for a network of networks. Understanding realistic effects present in networks of networks is required in order to move towards determining system vulnerability.
vhv supply networks, problems of network structure
Energy Technology Data Exchange (ETDEWEB)
Raimbault, J
1966-04-01
The present and future power requirements of the Paris area and the structure of the existing networks are discussed. The various limitations that will have to be allowed for to lay down the structure of a regional transmission network leading in the power of the large national transmission network to within the Paris built up area are described. The theoretical solution that has been adopted, and the features of its final achievement, which is planned for about the year 2000, and the intermediate stages are given. The problem of the structure of the National Power Transmission network which is to supply the regional network was studied. To solve this problem, a 730 kV voltage network will have to be introduced.
Network configuration of global R&D networks
DEFF Research Database (Denmark)
Hansen, Zaza Nadja Lee; Srai, Jagjit Singh
2011-01-01
, network configuration of global R&D has tended to focus on strategic elements with limited attention given operational effectiveness, or to interfaces with downstream manufacturing operations. Within OM literature, the drivers of configuration of global networks within, engineering, production, supply...... to R&D networks emerged, e.g. product features were more prominent in R&D networks. Furthermore, the study has shown extensive interaction with other operations, including many downstream manufacturing operations. By extending the OM configuration concepts to the configuration of R&D networks......Companies are increasingly globalising their R&D activities, both within the firms and with external partners, with consequent implications for their interaction with manufacturing operations. Previous research in R&D networks has focused on coordination, governance and support elements. However...
Directory of Open Access Journals (Sweden)
Davide Viaggi
2013-02-01
Full Text Available In the paper we examine the issue of food systems in which farms participate in multiple networks that, for their part, tend also to be members of networks of networks. The issue is addressed through a descriptive analysis of the fruit sector in Emilia‐Romagna (Italy. The farms in the area tend to join a different network for each product/product type. Innovation networks are embedded in commercialization or input provider networks, but separate (parallel networks also exist, particularly for basic research activities. Networks of networks are largely a product of the cooperative system. The paper concludes by emphasising the need for further research in multiple networking strategies and the connection betweencommercialisation networks and innovation.
Applying Physical-Layer Network Coding in Wireless Networks
Directory of Open Access Journals (Sweden)
Liew SoungChang
2010-01-01
Full Text Available A main distinguishing feature of a wireless network compared with a wired network is its broadcast nature, in which the signal transmitted by a node may reach several other nodes, and a node may receive signals from several other nodes, simultaneously. Rather than a blessing, this feature is treated more as an interference-inducing nuisance in most wireless networks today (e.g., IEEE 802.11. This paper shows that the concept of network coding can be applied at the physical layer to turn the broadcast property into a capacity-boosting advantage in wireless ad hoc networks. Specifically, we propose a physical-layer network coding (PNC scheme to coordinate transmissions among nodes. In contrast to "straightforward" network coding which performs coding arithmetic on digital bit streams after they have been received, PNC makes use of the additive nature of simultaneously arriving electromagnetic (EM waves for equivalent coding operation. And in doing so, PNC can potentially achieve 100% and 50% throughput increases compared with traditional transmission and straightforward network coding, respectively, in 1D regular linear networks with multiple random flows. The throughput improvements are even larger in 2D regular networks: 200% and 100%, respectively.
Cavalcanti, Tiago Vanderlei; Giannitsarou, Chrysi; Johnson, CR
2017-01-01
We define a measure of network cohesion and show how it arises naturally in a broad class of dynamic models of endogenous perpetual growth with network externalities. Via a standard growth model, we show why network cohesion is crucial for conditional convergence and explain that as cohesion increases, convergence is faster. We prove properties of network cohesion and define a network aggregator that preserves network cohesion.
Prevention and management of malaria in under-five children in ...
African Journals Online (AJOL)
Tanzania Journal of Health Research ... The objective of this article was to provide a systematic review of the literature to summarize the ... the magnitude of the gap between ownership and use of insecticide treated mosquito nets (ITNs).
Knowledge, Attitudes and Practices (KAP) about malaria among ...
African Journals Online (AJOL)
Institutional affiliation. 1Orotta School of Medicine, P.O.Box 10549, Asmara, Eritrea ... insecticide-treated nets (ITNs) and prompt and effective case management. This health ... three or more of the classical symptoms including fever. More than ...
International Journal of Health Research
African Journals Online (AJOL)
HP
childbirth. Just under 10% of women have a skilled birth attendant during delivery [1]. This high level of ... other child survival interventions (de-worming, ITN distribution, ... behind the country's high rates of maternal, newborn, and child ...
Factors influencing the usage of different types of malaria prevention ...
African Journals Online (AJOL)
Objective: To examine factors which influence the use of different types of malaria prevention ... risk areas, religion, education and income influenced ITN usage, whereas only age, malaria .... the uptake of IPTp given that the person would not.
Barthélemy, Marc
2011-02-01
Complex systems are very often organized under the form of networks where nodes and edges are embedded in space. Transportation and mobility networks, Internet, mobile phone networks, power grids, social and contact networks, and neural networks, are all examples where space is relevant and where topology alone does not contain all the information. Characterizing and understanding the structure and the evolution of spatial networks is thus crucial for many different fields, ranging from urbanism to epidemiology. An important consequence of space on networks is that there is a cost associated with the length of edges which in turn has dramatic effects on the topological structure of these networks. We will thoroughly explain the current state of our understanding of how the spatial constraints affect the structure and properties of these networks. We will review the most recent empirical observations and the most important models of spatial networks. We will also discuss various processes which take place on these spatial networks, such as phase transitions, random walks, synchronization, navigation, resilience, and disease spread.
Novel methods in computational finance
Günther, Michael; Maten, E
2017-01-01
This book discusses the state-of-the-art and open problems in computational finance. It presents a collection of research outcomes and reviews of the work from the STRIKE project, an FP7 Marie Curie Initial Training Network (ITN) project in which academic partners trained early-stage researchers in close cooperation with a broader range of associated partners, including from the private sector. The aim of the project was to arrive at a deeper understanding of complex (mostly nonlinear) financial models and to develop effective and robust numerical schemes for solving linear and nonlinear problems arising from the mathematical theory of pricing financial derivatives and related financial products. This was accomplished by means of financial modelling, mathematical analysis and numerical simulations, optimal control techniques and validation of models. In recent years the computational complexity of mathematical models employed in financial mathematics has witnessed tremendous growth. Advanced numerical techni...
Ranking of European Capitals According to the Impact of Future Heat Waves
Smid, M.; Costa, A. C.; Russo, S.; Pebesma, E. J.; Canut, C. G.
2017-12-01
In warming Europe, we are witnessing a growth in urban population with aging trend, which will make the society more vulnerable to extreme heat waves. In the period 1950-2015 the occurrence of extreme heat waves increased across European capitals. As an example, Moscow was hit by the strongest heat wave of the present era, killing more than ten thousand people. Here we focus on larger metropolitan areas of European capitals. By using observations and an ensemble of eight EURO-CORDEX models under the RCP8.5 scenario, we calculate a suite of temperature based climate indices. We introduce a simple ranking procedure based on ensemble predictions using the mean of metropolitan grid cells for each capital, and population density as a proxy to quantify the future impact. Results show that the selected ensemble provides solid simulation of climate characteristics over most of the targeted metropolitan areas. All the investigated European metropolitan areas will be more vulnerable to extreme heat in the coming decades. Based on the impact ranking, the results reveal that in near, but mainly in distant future, the extreme heat events in European capitals will be not exclusive to traditionally exposed areas such as the Mediterranean and the Iberian Peninsula. The ranking of European capitals based on their vulnerability to the extreme heat could be of paramount importance to the decision makers in order to mitigate the heat related mortality, especially with the foreseen increase of global mean temperature. Acknowledgments: The authors gratefully acknowledge the support of Geoinformatics: Enabling Open Cities (GEO-C), the project funded by the European Commission within the Marie Skłodowska-Curie Actions, International Training Networks (ITN), European Joint Doctorates (EJD). Grant Agreement number 642332 — GEO-C — H2020-MSCA-ITN-2014.
Directory of Open Access Journals (Sweden)
Patrick Jagoda
2015-08-01
Full Text Available The language of networks now describes everything from the Internet to the economy to terrorist organizations. In distinction to a common view of networks as a universal, originary, or necessary form that promises to explain everything from neural structures to online traffic, this essay emphasizes the contingency of the network imaginary. Network form, in its role as our current cultural dominant, makes scarcely imaginable the possibility of an alternative or an outside uninflected by networks. If so many things and relationships are figured as networks, however, then what is not a network? If a network points towards particular logics and qualities of relation in our historical present, what others might we envision in the future? In many ways, these questions are unanswerable from within the contemporary moment. Instead of seeking an avant-garde approach (to move beyond networks or opting out of networks (in some cases, to recover elements of pre-networked existence, this essay proposes a third orientation: one of ambivalence that operates as a mode of extreme presence. I propose the concept of "network aesthetics," which can be tracked across artistic media and cultural forms, as a model, style, and pedagogy for approaching interconnection in the twenty-first century. The following essay is excerpted from Network Ambivalence (Forthcoming from University of Chicago Press.
Inferring general relations between network characteristics from specific network ensembles.
Cardanobile, Stefano; Pernice, Volker; Deger, Moritz; Rotter, Stefan
2012-01-01
Different network models have been suggested for the topology underlying complex interactions in natural systems. These models are aimed at replicating specific statistical features encountered in real-world networks. However, it is rarely considered to which degree the results obtained for one particular network class can be extrapolated to real-world networks. We address this issue by comparing different classical and more recently developed network models with respect to their ability to generate networks with large structural variability. In particular, we consider the statistical constraints which the respective construction scheme imposes on the generated networks. After having identified the most variable networks, we address the issue of which constraints are common to all network classes and are thus suitable candidates for being generic statistical laws of complex networks. In fact, we find that generic, not model-related dependencies between different network characteristics do exist. This makes it possible to infer global features from local ones using regression models trained on networks with high generalization power. Our results confirm and extend previous findings regarding the synchronization properties of neural networks. Our method seems especially relevant for large networks, which are difficult to map completely, like the neural networks in the brain. The structure of such large networks cannot be fully sampled with the present technology. Our approach provides a method to estimate global properties of under-sampled networks in good approximation. Finally, we demonstrate on three different data sets (C. elegans neuronal network, R. prowazekii metabolic network, and a network of synonyms extracted from Roget's Thesaurus) that real-world networks have statistical relations compatible with those obtained using regression models.
factors influencing utilisation of insecticide treated nets
African Journals Online (AJOL)
2010-12-12
Dec 12, 2010 ... in the prevention of Malaria to children under five years. Design: A descriptive ... Malaria prevention and liking to use ITN. Insignificant ... pregnant women by 2005 (6). .... mothers were in their teenage who were the targeted.
Maximum entropy networks are more controllable than preferential attachment networks
International Nuclear Information System (INIS)
Hou, Lvlin; Small, Michael; Lao, Songyang
2014-01-01
A maximum entropy (ME) method to generate typical scale-free networks has been recently introduced. We investigate the controllability of ME networks and Barabási–Albert preferential attachment networks. Our experimental results show that ME networks are significantly more easily controlled than BA networks of the same size and the same degree distribution. Moreover, the control profiles are used to provide insight into control properties of both classes of network. We identify and classify the driver nodes and analyze the connectivity of their neighbors. We find that driver nodes in ME networks have fewer mutual neighbors and that their neighbors have lower average degree. We conclude that the properties of the neighbors of driver node sensitively affect the network controllability. Hence, subtle and important structural differences exist between BA networks and typical scale-free networks of the same degree distribution. - Highlights: • The controllability of maximum entropy (ME) and Barabási–Albert (BA) networks is investigated. • ME networks are significantly more easily controlled than BA networks of the same degree distribution. • The properties of the neighbors of driver node sensitively affect the network controllability. • Subtle and important structural differences exist between BA networks and typical scale-free networks
Network Learning and Innovation in SME Formal Networks
Directory of Open Access Journals (Sweden)
Jivka Deiters
2013-02-01
Full Text Available The driver for this paper is the need to better understand the potential for learning and innovation that networks canprovide especially for small and medium sized enterprises (SMEs which comprise by far the majority of enterprises in the food sector. With the challenges the food sector is facing in the near future, learning and innovation or more focused, as it is being discussed in the paper, ‘learning for innovation’ are not just opportunities but pre‐conditions for the sustainability of the sector. Network initiatives that could provide appropriate support involve social interaction and knowledge exchange, learning, competence development, and coordination (organization and management of implementation. The analysis identifies case studies in any of these orientations which serve different stages of the innovation process: invention and implementation. The variety of network case studies cover networks linked to a focus group for training, research, orconsulting, networks dealing with focused market oriented product or process development, promotional networks, and networks for open exchange and social networking.
2016-01-01
This volume provides an introduction to and overview of the emerging field of interconnected networks which include multi layer or multiplex networks, as well as networks of networks. Such networks present structural and dynamical features quite different from those observed in isolated networks. The presence of links between different networks or layers of a network typically alters the way such interconnected networks behave – understanding the role of interconnecting links is therefore a crucial step towards a more accurate description of real-world systems. While examples of such dissimilar properties are becoming more abundant – for example regarding diffusion, robustness and competition – the root of such differences remains to be elucidated. Each chapter in this topical collection is self-contained and can be read on its own, thus making it also suitable as reference for experienced researchers wishing to focus on a particular topic.
Eine molekulardynamische Studie von amorphem SiO2 im Bulk und unter geometrischen Einschränkungen
Geske, Julian
2017-01-01
Wasser und Silica sind beides Flüssigkeiten, die von hoher Relevanz sowohl in Anwendungen als auch in der Theorie sind. Lebewesen bestehen zu großen Teilen aus Wasser. Nicht nur dort kommt Wasser räumlich eingeschränkt vor, sondern ebenso in Gesteinen. Silica hingegen ist der bekannteste Glasbildner und hat daher vielfache Anwendungsmöglichkeiten in der Herstellung von (optischen) Gläsern. Ferner zeigen Silica und Wasser auf atomarer Ebene einen ähnlichen Aufbau. Beide Flüssigkeiten besitz...
Do Policy Networks lead to Network Governing?
DEFF Research Database (Denmark)
Damgaard, Bodil
This paper challenges the notion that creation of local policy networks necessarily leads to network governing. Through actor-centred case studies in the area of municipally implemented employment policy in Denmark it was found that the local governing mode is determined mainly by the municipality......’s approach to local co-governing as well as by the capacity and interest of key private actors. It is argued that national legislation requesting the creation of local policy networks was not enough to assure network governing and the case studies show that local policy networks may subsist also under...... hierarchical governing modes. Reasons why hierarchical governing modes prevail over network governing in some settings are identified pointing to both actor borne and structural factors. Output indicators of the four cases do not show that a particular governing mode is more efficient in its employment policy...
Application of Butterfly Clos-Network in Network-on-Chip
Directory of Open Access Journals (Sweden)
Hui Liu
2014-01-01
Full Text Available This paper studied the topology of NoC (Network-on-Chip. By combining the characteristics of the Clos network and butterfly network, a new topology named BFC (Butterfly Clos-network network was proposed. This topology integrates several modules, which belongs to the same layer but different dimensions, into a new module. In the BFC network, a bidirectional link is used to complete information exchange, instead of information exchange between different layers in the original network. During the routing period, other nondestination nodes can be used as middle stages to transfer data packets to complete the routing mission. Therefore, this topology has the characteristic of multistage. Simulation analyses show that BFC inherits the rich path diversity of Clos network, and it has a better performance than butterfly network in throughput and delay in a quite congested traffic pattern.
Directory of Open Access Journals (Sweden)
Jacques Demongeot
2018-01-01
Full Text Available Networks used in biological applications at different scales (molecule, cell and population are of different types: neuronal, genetic, and social, but they share the same dynamical concepts, in their continuous differential versions (e.g., non-linear Wilson-Cowan system as well as in their discrete Boolean versions (e.g., non-linear Hopfield system; in both cases, the notion of interaction graph G(J associated to its Jacobian matrix J, and also the concepts of frustrated nodes, positive or negative circuits of G(J, kinetic energy, entropy, attractors, structural stability, etc., are relevant and useful for studying the dynamics and the robustness of these systems. We will give some general results available for both continuous and discrete biological networks, and then study some specific applications of three new notions of entropy: (i attractor entropy, (ii isochronal entropy and (iii entropy centrality; in three domains: a neural network involved in the memory evocation, a genetic network responsible of the iron control and a social network accounting for the obesity spread in high school environment.
Saramäki, Jari
2013-01-01
The concept of temporal networks is an extension of complex networks as a modeling framework to include information on when interactions between nodes happen. Many studies of the last decade examine how the static network structure affect dynamic systems on the network. In this traditional approach the temporal aspects are pre-encoded in the dynamic system model. Temporal-network methods, on the other hand, lift the temporal information from the level of system dynamics to the mathematical representation of the contact network itself. This framework becomes particularly useful for cases where there is a lot of structure and heterogeneity both in the timings of interaction events and the network topology. The advantage compared to common static network approaches is the ability to design more accurate models in order to explain and predict large-scale dynamic phenomena (such as, e.g., epidemic outbreaks and other spreading phenomena). On the other hand, temporal network methods are mathematically and concept...
Benefit incidence analysis of free insecticide treated nets distribution ...
African Journals Online (AJOL)
2013-09-05
Sep 5, 2013 ... Student's t-test and Chi-square were used for comparison where ... Results: The respondents' mean monthly expenditures on food utilities and anti-malarials in the ..... free ITNs as compared to those who would have to travel.
Mitigating Inter-Network Interference in LoRa Networks
Voigt, Thiemo; Bor, Martin; Roedig, Utz; Alonso, Juan
2017-01-01
Long Range (LoRa) is a popular technology used to construct Low-Power Wide-Area Network (LPWAN) networks. Given the popularity of LoRa it is likely that multiple independent LoRa networks are deployed in close proximity. In this situation, neighbouring networks interfere and methods have to be found to combat this interference. In this paper we investigate the use of directional antennae and the use of multiple base stations as methods of dealing with inter-network interference. Directional a...
Maximal network reliability for a stochastic power transmission network
International Nuclear Information System (INIS)
Lin, Yi-Kuei; Yeh, Cheng-Ta
2011-01-01
Many studies regarded a power transmission network as a binary-state network and constructed it with several arcs and vertices to evaluate network reliability. In practice, the power transmission network should be stochastic because each arc (transmission line) combined with several physical lines is multistate. Network reliability is the probability that the network can transmit d units of electric power from a power plant (source) to a high voltage substation at a specific area (sink). This study focuses on searching for the optimal transmission line assignment to the power transmission network such that network reliability is maximized. A genetic algorithm based method integrating the minimal paths and the Recursive Sum of Disjoint Products is developed to solve this assignment problem. A real power transmission network is adopted to demonstrate the computational efficiency of the proposed method while comparing with the random solution generation approach.
DEFF Research Database (Denmark)
Bruun, Jesper; Evans, Robert Harry
2014-01-01
This paper describes the background for, realisation of and author reflections on a network workshop held at ESERA2013. As a new research area in science education, networks offer a unique opportunity to visualise and find patterns and relationships in complicated social or academic network data....... These include student relations and interactions and epistemic and linguistic networks of words, concepts and actions. Network methodology has already found use in science education research. However, while networks hold the potential for new insights, they have not yet found wide use in the science education...... research community. With this workshop, participants were offered a way into network science based on authentic educational research data. The workshop was constructed as an inquiry lesson with emphasis on user autonomy. Learning activities had participants choose to work with one of two cases of networks...
DEFF Research Database (Denmark)
Wang, Jiayuan; Yan, Ying; Dittmann, Lars
2013-01-01
This paper presents a Software Defined Networking (SDN) control plane based on an overlay GMPLS control model. The SDN control platform manages optical core networks (WDM/DWDM networks) and the associated access networks (GPON networks), which makes it possible to gather global information...... and enable wider areas' energy efficiency networking. The energy related information of the networks and the types of the traffic flows are collected and utilized for the end-to-end QoS provision. Dynamic network simulation results show that by applying different routing algorithms according to the type...... of traffic in the core networks, the energy efficiency of the network is improved without compromising the quality of service....
Exploring biological network structure with clustered random networks
Directory of Open Access Journals (Sweden)
Bansal Shweta
2009-12-01
Full Text Available Abstract Background Complex biological systems are often modeled as networks of interacting units. Networks of biochemical interactions among proteins, epidemiological contacts among hosts, and trophic interactions in ecosystems, to name a few, have provided useful insights into the dynamical processes that shape and traverse these systems. The degrees of nodes (numbers of interactions and the extent of clustering (the tendency for a set of three nodes to be interconnected are two of many well-studied network properties that can fundamentally shape a system. Disentangling the interdependent effects of the various network properties, however, can be difficult. Simple network models can help us quantify the structure of empirical networked systems and understand the impact of various topological properties on dynamics. Results Here we develop and implement a new Markov chain simulation algorithm to generate simple, connected random graphs that have a specified degree sequence and level of clustering, but are random in all other respects. The implementation of the algorithm (ClustRNet: Clustered Random Networks provides the generation of random graphs optimized according to a local or global, and relative or absolute measure of clustering. We compare our algorithm to other similar methods and show that ours more successfully produces desired network characteristics. Finding appropriate null models is crucial in bioinformatics research, and is often difficult, particularly for biological networks. As we demonstrate, the networks generated by ClustRNet can serve as random controls when investigating the impacts of complex network features beyond the byproduct of degree and clustering in empirical networks. Conclusion ClustRNet generates ensembles of graphs of specified edge structure and clustering. These graphs allow for systematic study of the impacts of connectivity and redundancies on network function and dynamics. This process is a key step in
Modelling dendritic ecological networks in space: anintegrated network perspective
Peterson, Erin E.; Ver Hoef, Jay M.; Isaak, Dan J.; Falke, Jeffrey A.; Fortin, Marie-Josée; Jordon, Chris E.; McNyset, Kristina; Monestiez, Pascal; Ruesch, Aaron S.; Sengupta, Aritra; Som, Nicholas; Steel, E. Ashley; Theobald, David M.; Torgersen, Christian E.; Wenger, Seth J.
2013-01-01
Dendritic ecological networks (DENs) are a unique form of ecological networks that exhibit a dendritic network topology (e.g. stream and cave networks or plant architecture). DENs have a dual spatial representation; as points within the network and as points in geographical space. Consequently, some analytical methods used to quantify relationships in other types of ecological networks, or in 2-D space, may be inadequate for studying the influence of structure and connectivity on ecological processes within DENs. We propose a conceptual taxonomy of network analysis methods that account for DEN characteristics to varying degrees and provide a synthesis of the different approaches within
Energy-aware virtual network embedding in flexi-grid networks.
Lin, Rongping; Luo, Shan; Wang, Haoran; Wang, Sheng
2017-11-27
Network virtualization technology has been proposed to allow multiple heterogeneous virtual networks (VNs) to coexist on a shared substrate network, which increases the utilization of the substrate network. Efficiently mapping VNs on the substrate network is a major challenge on account of the VN embedding (VNE) problem. Meanwhile, energy efficiency has been widely considered in the network design in terms of operation expenses and the ecological awareness. In this paper, we aim to solve the energy-aware VNE problem in flexi-grid optical networks. We provide an integer linear programming (ILP) formulation to minimize the electricity cost of each arriving VN request. We also propose a polynomial-time heuristic algorithm where virtual links are embedded sequentially to keep a reasonable acceptance ratio and maintain a low electricity cost. Numerical results show that the heuristic algorithm performs closely to the ILP for a small size network, and we also demonstrate its applicability to larger networks.
Resilient Disaster Network Based on Software Defined Cognitive Wireless Network Technology
Directory of Open Access Journals (Sweden)
Goshi Sato
2015-01-01
Full Text Available In order to temporally recover the information network infrastructure in disaster areas from the Great East Japan Earthquake in 2011, various wireless network technologies such as satellite IP network, 3G, and Wi-Fi were effectively used. However, since those wireless networks are individually introduced and installed but not totally integrated, some of networks were congested due to the sudden network traffic generation and unbalanced traffic distribution, and eventually the total network could not effectively function. In this paper, we propose a disaster resilient network which integrates various wireless networks into a cognitive wireless network that users can use as an access network to the Internet at the serious disaster occurrence. We designed and developed the disaster resilient network based on software defined network (SDN technology to automatically select the best network link and route among the possible access networks to the Internet by periodically monitoring their network states and evaluate those using extended AHP method. In order to verify the usefulness of our proposed system, a prototype system is constructed and its performance is evaluated.
Deploying temporary networks for upscaling of sparse network stations
Coopersmith, Evan J.; Cosh, Michael H.; Bell, Jesse E.; Kelly, Victoria; Hall, Mark; Palecki, Michael A.; Temimi, Marouane
2016-10-01
Soil observations networks at the national scale play an integral role in hydrologic modeling, drought assessment, agricultural decision support, and our ability to understand climate change. Understanding soil moisture variability is necessary to apply these measurements to model calibration, business and consumer applications, or even human health issues. The installation of soil moisture sensors as sparse, national networks is necessitated by limited financial resources. However, this results in the incomplete sampling of the local heterogeneity of soil type, vegetation cover, topography, and the fine spatial distribution of precipitation events. To this end, temporary networks can be installed in the areas surrounding a permanent installation within a sparse network. The temporary networks deployed in this study provide a more representative average at the 3 km and 9 km scales, localized about the permanent gauge. The value of such temporary networks is demonstrated at test sites in Millbrook, New York and Crossville, Tennessee. The capacity of a single U.S. Climate Reference Network (USCRN) sensor set to approximate the average of a temporary network at the 3 km and 9 km scales using a simple linear scaling function is tested. The capacity of a temporary network to provide reliable estimates with diminishing numbers of sensors, the temporal stability of those networks, and ultimately, the relationship of the variability of those networks to soil moisture conditions at the permanent sensor are investigated. In this manner, this work demonstrates the single-season installation of a temporary network as a mechanism to characterize the soil moisture variability at a permanent gauge within a sparse network.
NETWORK, HOW? Perceptions of business people on networking practices
Directory of Open Access Journals (Sweden)
Saskia De Klerk
2010-12-01
Full Text Available Purpose: The purpose of this paper was to contribute to literature on networking from a South African perspective. Literature on networking is mainly concentrated on the European and American contexts with homogeneous groups and traditional divisions. The business landscape of South Africa thus requires more investigation. Problem investigated: Literature regarding networking in an South African context with its dynamic business environment is limited. This article addresses the concerns of how South African business owners and managers perceive networking in their businesses and specifically focus on the South African perspective. Therefore, the focus is on the perceptions of business owners and managers on current networking practices in South Africa. Methodology: A qualitative research design to uncover the rich underlying feelings of business owners and managers was used. The qualitative enquiry consisted of five focus group discussions (n=41 participants among prominent business owners and managers in the Gauteng Province, South Africa. The Gauteng Province was selected since it is the economic and innovation hub of South Africa. Findings and implications: The main findings showed the following main themes of networking that emerged from the data, and included (1 networking as a skill versus a natural ability; (2 the motivation behind networking; (3 the loci of networking; (4 the type of relationships that determine the character of the network; and (5 the relationship characteristics of successful networking. The main contribution of this is that there seems to be different networking situations and applications for different circumstances. According to the participants, it seems that networking in the South African landscape appears to be either relationship or business based. Originality and value of the research: The value of these findings lies in the fact that they contribute to networking literature from a South African perspective
Localizing and placement of network node functions in a network
Strijkers, R.J.; Meulenhoff, P.J.
2014-01-01
The invention enables placement and use of a network node function in a second network node instead of using the network node function in a first network node. The network node function is e.g. a server function or a router function. The second network node is typically located in or close to the
Effect of the use of insecticide-treated bed nets on birth outcomes ...
African Journals Online (AJOL)
Each year in sub-Saharan Africa, where 80 to 90% of the world's malaria cases occur, approximately 19 to 24 million .... in winning the battle against malaria.16 .... tion group and given ITNs prepared in ... two doses of tetanus toxoid vaccine.
Advanced electric powertrain technology: ADEPT platform overview
Stipetic, S.; Miebach, W.; Wilkins, S.; Lomonova, E.A.; Paulides, J.J.H.; Tegenbosch, J.
2016-01-01
Design of high performance, low cost and clean propulsion systems requires multiple disciplines such as physics, mathematics, electrical engineering, mechanical engineering and specialisms like control engineering and safety. This paper details the program of EU FP7 Multi-ITN project ADvanced
Creative Network Communities in the Translocal Space of Digital Networks
Directory of Open Access Journals (Sweden)
Rasa Smite
2013-01-01
Full Text Available What should sociological research be in the age of Web 2.0? Considering that the task of “network sociology” is not only empirical research but also the interpretation of tendencies of the network culture, this research explores the rise of network communities within Eastern and Western Europe in the early Internet era. I coined the term creative networks to distinguish these early creative and social activities from today’s popular social networking. Thus I aimed to interpret the meaning of social action; the motivation of creative community actors, their main fields of activities and social organization forms; and the potential that these early developments contain for the future sustainability of networks. Data comprise interviews with networking experts and founders and members of various networks. Investigating respondents’ motivations for creating online networks and communities, and interpreting those terms, allows for comparing the creative networks of the 1990s with today’s social networks and for drawing conclusions.
Comparison analysis on vulnerability of metro networks based on complex network
Zhang, Jianhua; Wang, Shuliang; Wang, Xiaoyuan
2018-04-01
This paper analyzes the networked characteristics of three metro networks, and two malicious attacks are employed to investigate the vulnerability of metro networks based on connectivity vulnerability and functionality vulnerability. Meanwhile, the networked characteristics and vulnerability of three metro networks are compared with each other. The results show that Shanghai metro network has the largest transport capacity, Beijing metro network has the best local connectivity and Guangzhou metro network has the best global connectivity, moreover Beijing metro network has the best homogeneous degree distribution. Furthermore, we find that metro networks are very vulnerable subjected to malicious attacks, and Guangzhou metro network has the best topological structure and reliability among three metro networks. The results indicate that the proposed methodology is feasible and effective to investigate the vulnerability and to explore better topological structure of metro networks.
Symmetry structure of the periodic system of elements
International Nuclear Information System (INIS)
Kitagawara, Y.
1983-01-01
Two different, exactly soluble, quantum mechanical many-body problems are presented and their symmetry properties are analyzed. One is based on the Demkov-Ostrovskii problem which models the (n + 1)-filling rule of the atomic Aufbau principle. The invariance properties of the model differential equation are studied in detail. Contrary to commonly known quantum problems, the degeneracy structure within the quantum number (n + 1) is not described by the representation of a Lie algebra. However, it is described by a symmetry algebra which does not quite close under the commutation relations. The properties of this new algebra are closely examined. It is shown that the characteristic 'period doubling' in Aufbau chart is due to the structure of this algebra. To attain a better physical understanding of the symmetry of the periodic system of elements, the Demkov-Ostrovskii equation is transformed into a new equation, without changing some of its symmetry properites. It is found that the quantum states of the transformed equation provide reasonable approximations to the correspinding Hartree-Fock-Slater atomic orbitals. Thus the symmetry of the periodic system is approximately described by the degeneracy algebra which is obtained in this thesis. In the second part of this work, a group theoretical investigation is developed for a class of Coulomb-type N-body quantum systems in three dimensions. The dynamical algebra for these systems is found to be SO(3N + 1,2)
DEFF Research Database (Denmark)
Thomadsen, Tommy
2005-01-01
Communication networks are immensely important today, since both companies and individuals use numerous services that rely on them. This thesis considers the design of hierarchical (communication) networks. Hierarchical networks consist of layers of networks and are well-suited for coping...... with changing and increasing demands. Two-layer networks consist of one backbone network, which interconnects cluster networks. The clusters consist of nodes and links, which connect the nodes. One node in each cluster is a hub node, and the backbone interconnects the hub nodes of each cluster and thus...... the clusters. The design of hierarchical networks involves clustering of nodes, hub selection, and network design, i.e. selection of links and routing of ows. Hierarchical networks have been in use for decades, but integrated design of these networks has only been considered for very special types of networks...
Network architecture in a converged optical + IP network
Wakim, Walid; Zottmann, Harald
2012-01-01
As demands on Provider Networks continue to grow at exponential rates, providers are forced to evaluate how to continue to grow the network while increasing service velocity, enhancing resiliency while decreasing the total cost of ownership (TCO). The bandwidth growth that networks are experiencing is in the form packet based multimedia services such as video, video conferencing, gaming, etc... mixed with Over the Top (OTT) content providers such as Netflix, and the customer's expectations that best effort is not enough you end up with a situation that forces the provider to analyze how to gain more out of the network with less cost. In this paper we will discuss changes in the network that are driving us to a tighter integration between packet and optical layers and how to improve on today's multi - layer inefficiencies to drive down network TCO and provide for a fully integrated and dynamic network that will decrease time to revenue.
Iannone, Eugenio
2011-01-01
Many argue that telecommunications network infrastructure is the most impressive and important technology ever developed. Analyzing the telecom market's constantly evolving trends, research directions, infrastructure, and vital needs, Telecommunication Networks responds with revolutionized engineering strategies to optimize network construction. Omnipresent in society, telecom networks integrate a wide range of technologies. These include quantum field theory for the study of optical amplifiers, software architectures for network control, abstract algebra required to design error correction co
Holme, Petter; Saramäki, Jari
2012-10-01
A great variety of systems in nature, society and technology-from the web of sexual contacts to the Internet, from the nervous system to power grids-can be modeled as graphs of vertices coupled by edges. The network structure, describing how the graph is wired, helps us understand, predict and optimize the behavior of dynamical systems. In many cases, however, the edges are not continuously active. As an example, in networks of communication via e-mail, text messages, or phone calls, edges represent sequences of instantaneous or practically instantaneous contacts. In some cases, edges are active for non-negligible periods of time: e.g., the proximity patterns of inpatients at hospitals can be represented by a graph where an edge between two individuals is on throughout the time they are at the same ward. Like network topology, the temporal structure of edge activations can affect dynamics of systems interacting through the network, from disease contagion on the network of patients to information diffusion over an e-mail network. In this review, we present the emergent field of temporal networks, and discuss methods for analyzing topological and temporal structure and models for elucidating their relation to the behavior of dynamical systems. In the light of traditional network theory, one can see this framework as moving the information of when things happen from the dynamical system on the network, to the network itself. Since fundamental properties, such as the transitivity of edges, do not necessarily hold in temporal networks, many of these methods need to be quite different from those for static networks. The study of temporal networks is very interdisciplinary in nature. Reflecting this, even the object of study has many names-temporal graphs, evolving graphs, time-varying graphs, time-aggregated graphs, time-stamped graphs, dynamic networks, dynamic graphs, dynamical graphs, and so on. This review covers different fields where temporal graphs are considered
Sander, K F
1964-01-01
Linear Network Theory covers the significant algebraic aspect of network theory, with minimal reference to practical circuits. The book begins the presentation of network analysis with the exposition of networks containing resistances only, and follows it up with a discussion of networks involving inductance and capacity by way of the differential equations. Classification and description of certain networks, equivalent networks, filter circuits, and network functions are also covered. Electrical engineers, technicians, electronics engineers, electricians, and students learning the intricacies
From network structure to network reorganization: implications for adult neurogenesis
International Nuclear Information System (INIS)
Schneider-Mizell, Casey M; Zochowski, Michal R; Sander, Leonard M; Parent, Jack M; Ben-Jacob, Eshel
2010-01-01
Networks can be dynamical systems that undergo functional and structural reorganization. One example of such a process is adult hippocampal neurogenesis, in which new cells are continuously born and incorporate into the existing network of the dentate gyrus region of the hippocampus. Many of these introduced cells mature and become indistinguishable from established neurons, joining the existing network. Activity in the network environment is known to promote birth, survival and incorporation of new cells. However, after epileptogenic injury, changes to the connectivity structure around the neurogenic niche are known to correlate with aberrant neurogenesis. The possible role of network-level changes in the development of epilepsy is not well understood. In this paper, we use a computational model to investigate how the structural and functional outcomes of network reorganization, driven by addition of new cells during neurogenesis, depend on the original network structure. We find that there is a stable network topology that allows the network to incorporate new neurons in a manner that enhances activity of the persistently active region, but maintains global network properties. In networks having other connectivity structures, new cells can greatly alter the distribution of firing activity and destroy the initial activity patterns. We thus find that new cells are able to provide focused enhancement of network only for small-world networks with sufficient inhibition. Network-level deviations from this topology, such as those caused by epileptogenic injury, can set the network down a path that develops toward pathological dynamics and aberrant structural integration of new cells
Correlated network of networks enhances robustness against catastrophic failures.
Min, Byungjoon; Zheng, Muhua
2018-01-01
Networks in nature rarely function in isolation but instead interact with one another with a form of a network of networks (NoN). A network of networks with interdependency between distinct networks contains instability of abrupt collapse related to the global rule of activation. As a remedy of the collapse instability, here we investigate a model of correlated NoN. We find that the collapse instability can be removed when hubs provide the majority of interconnections and interconnections are convergent between hubs. Thus, our study identifies a stable structure of correlated NoN against catastrophic failures. Our result further suggests a plausible way to enhance network robustness by manipulating connection patterns, along with other methods such as controlling the state of node based on a local rule.
How to construct the statistic network? An association network of herbaceous
Directory of Open Access Journals (Sweden)
WenJun Zhang
2012-06-01
Full Text Available In present study I defined a new type of network, the statistic network. The statistic network is a weighted and non-deterministic network. In the statistic network, a connection value, i.e., connection weight, represents connection strength and connection likelihood between two nodes and its absolute value falls in the interval (0,1]. The connection value is expressed as a statistical measure such as correlation coefficient, association coefficient, or Jaccard coefficient, etc. In addition, all connections of the statistic network can be statistically tested for their validity. A connection is true if the connection value is statistically significant. If all connection values of a node are not statistically significant, it is an isolated node. An isolated node has not any connection to other nodes in the statistic network. Positive and negative connection values denote distinct connectiontypes (positive or negative association or interaction. In the statistic network, two nodes with the greater connection value will show more similar trend in the change of their states. At any time we can obtain a sample network of the statistic network. A sample network is a non-weighted and deterministic network. Thestatistic network, in particular the plant association network that constructed from field sampling, is mostly an information network. Most of the interspecific relationships in plant community are competition and cooperation. Therefore in comparison to animal networks, the methodology of statistic network is moresuitable to construct plant association networks. Some conclusions were drawn from this study: (1 in the plant association network, most connections are weak and positive interactions. The association network constructed from Spearman rank correlation has most connections and isolated taxa are fewer. From net linear correlation,linear correlation, to Spearman rank correlation, the practical number of connections and connectance in the
The Network Completion Problem: Inferring Missing Nodes and Edges in Networks
Energy Technology Data Exchange (ETDEWEB)
Kim, M; Leskovec, J
2011-11-14
Network structures, such as social networks, web graphs and networks from systems biology, play important roles in many areas of science and our everyday lives. In order to study the networks one needs to first collect reliable large scale network data. While the social and information networks have become ubiquitous, the challenge of collecting complete network data still persists. Many times the collected network data is incomplete with nodes and edges missing. Commonly, only a part of the network can be observed and we would like to infer the unobserved part of the network. We address this issue by studying the Network Completion Problem: Given a network with missing nodes and edges, can we complete the missing part? We cast the problem in the Expectation Maximization (EM) framework where we use the observed part of the network to fit a model of network structure, and then we estimate the missing part of the network using the model, re-estimate the parameters and so on. We combine the EM with the Kronecker graphs model and design a scalable Metropolized Gibbs sampling approach that allows for the estimation of the model parameters as well as the inference about missing nodes and edges of the network. Experiments on synthetic and several real-world networks show that our approach can effectively recover the network even when about half of the nodes in the network are missing. Our algorithm outperforms not only classical link-prediction approaches but also the state of the art Stochastic block modeling approach. Furthermore, our algorithm easily scales to networks with tens of thousands of nodes.
GS Department
2009-01-01
A site-wide network maintenance operation has been scheduled for Saturday 28 February. Most of the network devices of the general purpose network will be upgraded to a newer software version, in order to improve our network monitoring capabilities. This will result in a series of short (2-5 minutes) random interruptions everywhere on the CERN sites throughout the day. This upgrade will not affect the Computer Centre itself, Building 613, the Technical Network and the LHC experiments, dedicated networks at the pits. For further details of this intervention, please contact Netops by phone 74927 or e-mail mailto:Netops@cern.ch. IT/CS Group
IT Department
2009-01-01
A site wide network maintenance has been scheduled for Saturday 28 February. Most of the network devices of the General Purpose network will be upgraded to a newer software version, in order to improve our network monitoring capabilities. This will result in a series of short (2-5 minutes) random interruptions everywhere on the CERN sites along this day. This upgrade will not affect: the Computer centre itself, building 613, the Technical Network and the LHC experiments dedicated networks at the pits. Should you need more details on this intervention, please contact Netops by phone 74927 or email mailto:Netops@cern.ch. IT/CS Group
Network reconfiguration and neuronal plasticity in rhythm-generating networks.
Koch, Henner; Garcia, Alfredo J; Ramirez, Jan-Marino
2011-12-01
Neuronal networks are highly plastic and reconfigure in a state-dependent manner. The plasticity at the network level emerges through multiple intrinsic and synaptic membrane properties that imbue neurons and their interactions with numerous nonlinear properties. These properties are continuously regulated by neuromodulators and homeostatic mechanisms that are critical to maintain not only network stability and also adapt networks in a short- and long-term manner to changes in behavioral, developmental, metabolic, and environmental conditions. This review provides concrete examples from neuronal networks in invertebrates and vertebrates, and illustrates that the concepts and rules that govern neuronal networks and behaviors are universal.
Psychology and social networks: a dynamic network theory perspective.
Westaby, James D; Pfaff, Danielle L; Redding, Nicholas
2014-04-01
Research on social networks has grown exponentially in recent years. However, despite its relevance, the field of psychology has been relatively slow to explain the underlying goal pursuit and resistance processes influencing social networks in the first place. In this vein, this article aims to demonstrate how a dynamic network theory perspective explains the way in which social networks influence these processes and related outcomes, such as goal achievement, performance, learning, and emotional contagion at the interpersonal level of analysis. The theory integrates goal pursuit, motivation, and conflict conceptualizations from psychology with social network concepts from sociology and organizational science to provide a taxonomy of social network role behaviors, such as goal striving, system supporting, goal preventing, system negating, and observing. This theoretical perspective provides psychologists with new tools to map social networks (e.g., dynamic network charts), which can help inform the development of change interventions. Implications for social, industrial-organizational, and counseling psychology as well as conflict resolution are discussed, and new opportunities for research are highlighted, such as those related to dynamic network intelligence (also known as cognitive accuracy), levels of analysis, methodological/ethical issues, and the need to theoretically broaden the study of social networking and social media behavior. (PsycINFO Database Record (c) 2014 APA, all rights reserved).
Statistical network analysis for analyzing policy networks
DEFF Research Database (Denmark)
Robins, Garry; Lewis, Jenny; Wang, Peng
2012-01-01
and policy network methodology is the development of statistical modeling approaches that can accommodate such dependent data. In this article, we review three network statistical methods commonly used in the current literature: quadratic assignment procedures, exponential random graph models (ERGMs......To analyze social network data using standard statistical approaches is to risk incorrect inference. The dependencies among observations implied in a network conceptualization undermine standard assumptions of the usual general linear models. One of the most quickly expanding areas of social......), and stochastic actor-oriented models. We focus most attention on ERGMs by providing an illustrative example of a model for a strategic information network within a local government. We draw inferences about the structural role played by individuals recognized as key innovators and conclude that such an approach...
Animal transportation networks
Perna, Andrea; Latty, Tanya
2014-01-01
Many group-living animals construct transportation networks of trails, galleries and burrows by modifying the environment to facilitate faster, safer or more efficient movement. Animal transportation networks can have direct influences on the fitness of individuals, whereas the shape and structure of transportation networks can influence community dynamics by facilitating contacts between different individuals and species. In this review, we discuss three key areas in the study of animal transportation networks: the topological properties of networks, network morphogenesis and growth, and the behaviour of network users. We present a brief primer on elements of network theory, and then discuss the different ways in which animal groups deal with the fundamental trade-off between the competing network properties of travel efficiency, robustness and infrastructure cost. We consider how the behaviour of network users can impact network efficiency, and call for studies that integrate both network topology and user behaviour. We finish with a prospectus for future research. PMID:25165598
ENERGY AWARE NETWORK: BAYESIAN BELIEF NETWORKS BASED DECISION MANAGEMENT SYSTEM
Directory of Open Access Journals (Sweden)
Santosh Kumar Chaudhari
2011-06-01
Full Text Available A Network Management System (NMS plays a very important role in managing an ever-evolving telecommunication network. Generally an NMS monitors & maintains the health of network elements. The growing size of the network warrants extra functionalities from the NMS. An NMS provides all kinds of information about networks which can be used for other purposes apart from monitoring & maintaining networks like improving QoS & saving energy in the network. In this paper, we add another dimension to NMS services, namely, making an NMS energy aware. We propose a Decision Management System (DMS framework which uses a machine learning technique called Bayesian Belief Networks (BBN, to make the NMS energy aware. The DMS is capable of analysing and making control decisions based on network traffic. We factor in the cost of rerouting and power saving per port. Simulations are performed on standard network topologies, namely, ARPANet and IndiaNet. It is found that ~2.5-6.5% power can be saved.
The main steps on implementation of radiation processing technology - portuguese experience
International Nuclear Information System (INIS)
Luisa Botelho, M.
2010-11-01
The development of applications of ionizing radiation for Industrial purposes in Portugal began near of 1982 with the support of IAEA under the program of Cooperation and Technical Assistance - project POR/8/002. The IAEA program of Cooperation and Technical Assistance permitted that POR/08/002 took place between 1983 up to 1988. The collaboration of the International Experts and the personnel of National Laboratory of Industrial Engineering and Technology, nowadays Nuclear and Technologic Institute (ITN), allowed the construction of a Co-60 irradiation plant, designed by Tecnabexport (Russia). This facility is located in the ITN campus in Sacavem, Portugal. The main parameters studied prior to the implementation (sitting, design, construction, commissioning, operation, maintenance and foreseen decommission) were planned and executed according with the Portuguese legislation which is based on the International rules (IAEA Safety series) and Directive EURATOM 836/80, nowadays EURATOM 1493/93. A study of the geological stability of the site for future placement of the irradiation facility was done preceding the construction. The facility was constructed under Portuguese responsibility but designed and loaded with Co-60 by the Russian business rganization: Technabexport between 1987 and 1988. The whole process was supervised and approved by the ITN's Nuclear Protection and Safety Department. The Cobalt-60 irradiation facility was initially named GammaPi and later on Radiation Technologies Unit (UTR) and its management was under ITN's authority until 2003. Once established a quality system for the gamma facility, the following phase is to develop, validate and control the sterilization/disinfection process. In this step, a multidisciplinary approach and a continuous dialog with product managers and personnel must be taken into consideration in the experimental design for the correct and effective establishment of irradiation process. The knowledge of product's elements
Public-private delivery of insecticide-treated nets: a voucher scheme in Volta Region, Ghana
Directory of Open Access Journals (Sweden)
Taylor Ian
2007-02-01
Full Text Available Abstract Background Coverage of vulnerable groups with insecticide-treated nets (ITNs in Ghana, as in the majority of countries of sub-Saharan Africa is currently low. A voucher scheme was introduced in Volta Region as a possible sustainable delivery system for increasing this coverage through scale-up to other regions. Successful scale-up of public health interventions depends upon optimal delivery processes but operational research for delivery processes in large-scale implementation has been inadequate. Methods A simple tool was developed to monitor numbers of vouchers given to each health facility, numbers issued to pregnant women by the health staff, and numbers redeemed by the distributors back to the management agent. Three rounds of interviews were undertaken with health facility staff, retailers and pregnant women who had attended antenatal clinic (ANC. Results During the one year pilot 25,926 vouchers were issued to eligible women from clinics, which equates to 50.7% of the 51,658 ANC registrants during this time period. Of the vouchers issued 66.7% were redeemed by distributors back to the management agent. Initially, non-issuing of vouchers to pregnant women was mainly due to eligibility criteria imposed by the midwives; later in the year it was due to decisions of the pregnant women, and supply constraints. These in turn were heavily influenced by factors external to the programme: current household ownership of nets, competing ITN delivery strategies, and competition for the limited number of ITNs available in the country from major urban areas of other regions. Conclusion Both issuing and redemption of vouchers should be monitored as factors assumed to influence voucher redemption had an influence on issuing, and vice versa. More evidence is needed on how specific contextual factors influence the success of voucher schemes and other models of delivery of ITNs. Such an evidence base will facilitate optimal strategic decision making
de Savigny, Don; Webster, Jayne; Agyepong, Irene Akua; Mwita, Alex; Bart-Plange, Constance; Baffoe-Wilmot, Aba; Koenker, Hannah; Kramer, Karen; Brown, Nick; Lengeler, Christian
2012-10-01
There are striking similarities in health system and other contexts between Tanzania and Ghana that are relevant to the scaling up of continuous delivery of insecticide treated nets (ITNs) for malaria prevention. However, specific contextual factors of relevance to ITN delivery have led implementation down very different pathways in the two countries. Both countries have made major efforts and investments to address this intervention through integrating consumer discount vouchers into the health system. Discount vouchers require arrangements among the public, private and non-governmental sectors and constitute a complex intervention in both health systems and business systems. In Tanzania, vouchers have moved beyond the planning agenda, had policies and programmes formulated, been sustained in implementation at national scale for many years and have become as of 2012 the main and only publicly supported continuous delivery system for ITNs. In Ghana national-scale implementation of vouchers never progressed beyond consideration on the agenda and piloting towards formulation of policy; and the approach was replaced by mass distribution campaigns with less dependency on or integration with the health system. By 2011, Ghana entered a phase with no publicly supported continuous delivery system for ITNs. To understand the different outcomes, we compared the voucher programme timelines, phases, processes and contexts in both countries in reference to the main health system building blocks (governance, human resources, financing, informatics, technologies and service delivery). Contextual factors which provided an enabling environment for the voucher scheme in Tanzania did not do so in Ghana. The voucher scheme was never seen as an appropriate national strategy, other delivery systems were not complementary and the private sector was under-developed. The extensive time devoted to engagement and consensus building among all stakeholders in Tanzania was an important and
Analyzing Multimode Wireless Sensor Networks Using the Network Calculus
Directory of Open Access Journals (Sweden)
Xi Jin
2015-01-01
Full Text Available The network calculus is a powerful tool to analyze the performance of wireless sensor networks. But the original network calculus can only model the single-mode wireless sensor network. In this paper, we combine the original network calculus with the multimode model to analyze the maximum delay bound of the flow of interest in the multimode wireless sensor network. There are two combined methods A-MM and N-MM. The method A-MM models the whole network as a multimode component, and the method N-MM models each node as a multimode component. We prove that the maximum delay bound computed by the method A-MM is tighter than or equal to that computed by the method N-MM. Experiments show that our proposed methods can significantly decrease the analytical delay bound comparing with the separate flow analysis method. For the large-scale wireless sensor network with 32 thousands of sensor nodes, our proposed methods can decrease about 70% of the analytical delay bound.
Beetz, Jürgen
2016-01-01
Jürgen Beetz zeigt zuerst den Ursprung der erdachten Geschichten der Physik aus der Steinzeit, denn vieles ist so einfach, dass es schon Steinzeitmenschen hätten verstehen können. Im Anschluss daran erklärt der Autor den Aufbau von Atomen und sagt etwas zu ihren physikalischen Größen aus. Obwohl „Atom“ eigentlich „unteilbar“ bedeutet, bestehen Atome dennoch aus Teilen – dies erläutert er im Weiteren genau. Schließlich bespricht er die geheimnisvollen „Quanten“ und ihr merkwürdiges Verhalten.
Untersuchungen zur Durchströmung, Beladung und Regeneration eines Diesel-Partikelfilters
Höffken, Tobias
2009-01-01
Aufgrund strenger gesetzlicher Vorgaben müssen Rußpartikel aus dem Abgas moderner Diesel-PKW durch Filtration abgeschieden werden. Durch den Aufbau einer Rußschicht auf der Oberfläche des Filters nimmt der Abgasgegendruck während des Fahrzeugbetriebs zu, so dass dieser in regelmäßigen Abständen durch Abbrand des eingelagerten Rußes regeneriert werden muss. Während des Rußabbrands kann es im Filter zu Temperaturüberhöhungen kommen, die zu dessen Zerstörung führen. Gegenstand der vorliegend...
Content Management von Leittexten mit XML Topic Maps
Directory of Open Access Journals (Sweden)
Johannes Busse
2003-07-01
Full Text Available Die Autoren definieren den Umgang mit internet- basierten Informations- und Kommunikationstechnologien als Schlüsselqualifikation für Studierende aller Fachrichtungen. Im vorliegenden Aufsatz beschreiben sie ein Projekt, das der Fachbereich Erziehungswissenschaften der Universität Heidelberg seit 2001 durchführt. Hier werden Studierende der Geistes- und Sozialwissenschaften zu "Lernberatern" ausgebildet, die als Multiplikatoren die notwendigen Kenntnisse erwerben. Die Teilnehmenden erarbeiten nach der "Leittextmethode" selbstgesteuert xml-basierte Contents. Dies setzt den Erwerb von informationstechnischen Kenntnissen voraus, der neben dem Aufbau eines (sowohl technischen als auch sozialen Netzwerks einen Schwerpunkt bildet.
Local Dynamic Map als modulares Software Framework für Fahrerassistenzsysteme
Reisdorf, P.; Auerswald, A.; Wanielik, G.
2015-11-01
Moderne Fahrerassistenzsysteme basieren auf der Verarbeitung von Informationen, welche durch die Umfeldwahrnehmung mit unterschiedlicher Sensorik erfolgt. Neben den Informationen aus dem eigenen Fahrzeug ergeben sich durch unterschiedliche Kommunikationsmöglichkeiten (Car2Car, Car2X,...) erweiterte Umfeldwahrnehmungen (siehe Abb. 1). Diese Daten gilt es aufbereitet und zielorientiert einer Anwendung zur Verfügung zu stellen, was mit Hilfe einer Local Dynamic Map (LDM) erfüllt werden kann. Die vorliegende Veröffentlichung beschreibt den Aufbau, Verwendungszweck und Eigenschaften einer entwickelten LDM und geht auf einige Applikationen ein, die mit Hilfe dieser realisiert wurden.
GROSSSPRENGUN UND MIKROSEISMIK
Directory of Open Access Journals (Sweden)
E. HARDTWIG
1956-06-01
Full Text Available Uéber die bei Sprengungen entstelienden Periodenspektren ist noch
wenig bekannt, trotzdem in jedem Jahre Tausende von Sprengungen
registriert werden. Die wenigen Arbeiten, die zu diesem Gegenstand erscliienen
sind, stellen nur erste Versuche dar, den Aufbau der Spektren
zu erklaren. Wàhrend etwa George Morris (* vorwiegend die bei
Sprengungen si eh abspielenden Detonationsvorgànge zum Ausgangspunkt
der Untersuchung macht, ist es bei IT. Menzel (2 die Interferenz von
Primàrwelle und reflektierter Welle, deren Einfluss auf die Gestalt
des Spektrums untersucht wird.
Symmetriebrechung und Emergenz in der Kosmologie.
Mainzer, K.
Seit der Antike wird der Aufbau des Universums mit einfachen und regulären (symmetrischen) Grundstrukturen verbunden. Diese Annahme liegt selbst noch den Standardmodellen der relativistischen Kosmologie zugrunde. Demgegenüber läßt sich die Emergenz neuer Strukturen von den Elementarteilchen über Moleküle bis zu den komplexen Systemen des Lebens als Symmetriebrechung verstehen. Symmetriebrechung und strukturelle Komplexität bestimmen die kosmische Evolution. Damit zeichnet sich ein fachübergreifendes Forschungsprogramm von Physik, Chemie und Biologie ab, in dem die Evolution des Universums untersucht werden kann.
DEFF Research Database (Denmark)
Sapuppo, Antonio; Sørensen, Lene Tolstrup
2011-01-01
Online social networks have become essential for many users in their daily communication. Through a combination of the online social networks with opportunistic networks, a new concept arises: Local Social Networks. The target of local social networks is to promote social networking benefits...... in physical environment in order to leverage personal affinities in the users' surroundings. The purpose of this paper is to present and discuss the concept of local social networks as a new social communication system. Particularly, the preliminary architecture and the prototype of local social networks...
From Offline Social Networks to Online Social Networks: Changes in Entrepreneurship
Directory of Open Access Journals (Sweden)
Yang SONG
2015-01-01
Full Text Available The paper reviewed studies of entrepreneurship based on the emergency of online social networks. Similar to offline social networks, entrepreneurs’ online social networks have their own unique characteristics. We first reviewed the offline network based research on entrepreneurship. Then we reviewed the studies of entrepreneurship in the context of online social networks including those focusing on topics of network structures and network ties. We highlighted online network communities based on the data collected from LinkedIn, Facebook and Twitter. Our research implies that both researcher and entrepreneurs are facing new opportunities due to the emergence of online social networks.
Investigation of the network delay on Profibus-DP based network
Yılmaz, C.; Gürdal, O.; Sayan, H.H.
2008-01-01
The mathematical model of the network-induced delay control systems (NDCS) is given. Also the role of the NDCS’s components such as controller, sensor and network environment on the network-induced delay are included in the mathematical model of the system. The network delay is investigated on Profibus-DP based network application and experimental results obtained are presented graphically. The experimental results obtained show that the network induced delay is randomly changed according to ...
Hill, Jenny; Hoyt, Jenna; van Eijk, Anna Maria; D'Mello-Guyett, Lauren; ter Kuile, Feiko O.; Steketee, Rick; Smith, Helen; Webster, Jayne
2013-01-01
Malaria in pregnancy has important consequences for mother and baby. Coverage with the World Health Organization-recommended prevention strategy for pregnant women in sub-Saharan Africa of intermittent preventive treatment in pregnancy (IPTp) and insecticide-treated nets (ITNs) is low. We conducted
Hill, Jenny; Dellicour, Stephanie; Bruce, Jane; Ouma, Peter; Smedley, James; Otieno, Peter; Ombock, Maurice; Kariuki, Simon; Desai, Meghna; Hamel, Mary J.; ter Kuile, Feiko O.; Webster, Jayne
2013-01-01
Malaria in pregnancy can have devastating consequences for mother and baby. Coverage with the WHO prevention strategy for sub-Saharan Africa of intermittent-preventive-treatment (IPTp) with two doses of sulphadoxine-pyrimethamine (SP) and insecticide-treated-nets (ITNs) in pregnancy is low. We
Vulnerability of complex networks
Mishkovski, Igor; Biey, Mario; Kocarev, Ljupco
2011-01-01
We consider normalized average edge betweenness of a network as a metric of network vulnerability. We suggest that normalized average edge betweenness together with is relative difference when certain number of nodes and/or edges are removed from the network is a measure of network vulnerability, called vulnerability index. Vulnerability index is calculated for four synthetic networks: Erdős-Rényi (ER) random networks, Barabási-Albert (BA) model of scale-free networks, Watts-Strogatz (WS) model of small-world networks, and geometric random networks. Real-world networks for which vulnerability index is calculated include: two human brain networks, three urban networks, one collaboration network, and two power grid networks. We find that WS model of small-world networks and biological networks (human brain networks) are the most robust networks among all networks studied in the paper.
Friendly network robotics; Friendly network robotics
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
This paper summarizes the research results on the friendly network robotics in fiscal 1996. This research assumes an android robot as an ultimate robot and the future robot system utilizing computer network technology. The robot aiming at human daily work activities in factories or under extreme environments is required to work under usual human work environments. The human robot with similar size, shape and functions to human being is desirable. Such robot having a head with two eyes, two ears and mouth can hold a conversation with human being, can walk with two legs by autonomous adaptive control, and has a behavior intelligence. Remote operation of such robot is also possible through high-speed computer network. As a key technology to use this robot under coexistence with human being, establishment of human coexistent robotics was studied. As network based robotics, use of robots connected with computer networks was also studied. In addition, the R-cube (R{sup 3}) plan (realtime remote control robot technology) was proposed. 82 refs., 86 figs., 12 tabs.
DEFF Research Database (Denmark)
Ryberg, Thomas; Larsen, Malene Charlotte
2008-01-01
of CoPs we shall argue that the metaphor or theory of networked learning is itself confronted with some central tensions and challenges that need to be addressed. We then explore these theoretical and analytic challenges to the network metaphor, through an analysis of a Danish social networking site. We......In this article we take up a critique of the concept of Communities of Practice (CoP) voiced by several authors, who suggest that networks may provide a better metaphor to understand social forms of organisation and learning. Through a discussion of the notion of networked learning and the critique...... argue that understanding meaning-making and ‘networked identities’ may be relevant analytic entry points in navigating the challenges....
Location based Network Optimizations for Mobile Wireless Networks
DEFF Research Database (Denmark)
Nielsen, Jimmy Jessen
selection in Wi-Fi networks and predictive handover optimization in heterogeneous wireless networks. The investigations in this work have indicated that location based network optimizations are beneficial compared to typical link measurement based approaches. Especially the knowledge of geographical...
Network Performance Improvement under Epidemic Failures in Optical Transport Networks
DEFF Research Database (Denmark)
Fagertun, Anna Manolova; Ruepp, Sarah Renée
2013-01-01
In this paper we investigate epidemic failure spreading in large- scale GMPLS-controlled transport networks. By evaluating the effect of the epidemic failure spreading on the network, we design several strategies for cost-effective network performance improvement via differentiated repair times....... First we identify the most vulnerable and the most strategic nodes in the network. Then, via extensive simulations we show that strategic placement of resources for improved failure recovery has better performance than randomly assigning lower repair times among the network nodes. Our OPNET simulation...... model can be used during the network planning process for facilitating cost- effective network survivability design....
Directory of Open Access Journals (Sweden)
Laisen Nie
2018-01-01
Full Text Available Wireless mesh network is prevalent for providing a decentralized access for users and other intelligent devices. Meanwhile, it can be employed as the infrastructure of the last few miles connectivity for various network applications, for example, Internet of Things (IoT and mobile networks. For a wireless mesh backbone network, it has obtained extensive attention because of its large capacity and low cost. Network traffic prediction is important for network planning and routing configurations that are implemented to improve the quality of service for users. This paper proposes a network traffic prediction method based on a deep learning architecture and the Spatiotemporal Compressive Sensing method. The proposed method first adopts discrete wavelet transform to extract the low-pass component of network traffic that describes the long-range dependence of itself. Then, a prediction model is built by learning a deep architecture based on the deep belief network from the extracted low-pass component. Otherwise, for the remaining high-pass component that expresses the gusty and irregular fluctuations of network traffic, the Spatiotemporal Compressive Sensing method is adopted to predict it. Based on the predictors of two components, we can obtain a predictor of network traffic. From the simulation, the proposed prediction method outperforms three existing methods.
Zhao, Yongli; He, Ruiying; Chen, Haoran; Zhang, Jie; Ji, Yuefeng; Zheng, Haomian; Lin, Yi; Wang, Xinbo
2014-04-21
Software defined networking (SDN) has become the focus in the current information and communication technology area because of its flexibility and programmability. It has been introduced into various network scenarios, such as datacenter networks, carrier networks, and wireless networks. Optical transport network is also regarded as an important application scenario for SDN, which is adopted as the enabling technology of data communication networks (DCN) instead of general multi-protocol label switching (GMPLS). However, the practical performance of SDN based DCN for large scale optical networks, which is very important for the technology selection in the future optical network deployment, has not been evaluated up to now. In this paper we have built a large scale flexi-grid optical network testbed with 1000 virtual optical transport nodes to evaluate the performance of SDN based DCN, including network scalability, DCN bandwidth limitation, and restoration time. A series of network performance parameters including blocking probability, bandwidth utilization, average lightpath provisioning time, and failure restoration time have been demonstrated under various network environments, such as with different traffic loads and different DCN bandwidths. The demonstration in this work can be taken as a proof for the future network deployment.
DEFF Research Database (Denmark)
Bertelsen, Rasmus Gjedssø; Ashourizadeh, Shayegheh; Jensen, Kent Wickstrøm
2017-01-01
Purpose: Entrepreneurs are networking with others to get advice for their businesses. The networking differs between men and women; notably, men are more often networking in the public sphere and women are more often networking in the private sphere. The aim here is to account for how such gender......Purpose: Entrepreneurs are networking with others to get advice for their businesses. The networking differs between men and women; notably, men are more often networking in the public sphere and women are more often networking in the private sphere. The aim here is to account for how...... such gendering of entrepreneurs’ networks differ between societies and cultures. Research Design: Based on survey data from the Global Entrepreneurships Monitor, a sample of 16,365 entrepreneurs is used to compare the gendering of entrepreneurs’ networks in China, and five countries largely located around...... the Persian Gulf, namely Yemen, Iran, Saudi Arabia, Qatar and United Arab Emirates. Findings: Analyses show that female entrepreneurs tend to have slightly larger private sphere networks than male entrepreneurs. The differences between male and female entrepreneurs’ networking in the public sphere...
Networks: structure and action : steering in and steering by policy networks
Dassen, A.
2010-01-01
This thesis explores the opportunities to build a structural policy network model that is rooted in social network theories. By making a distinction between a process of steering in networks, and a process of steering by networks, it addresses the effects of network structures on network dynamics as
Modelling dendritic ecological networks in space: An integrated network perspective
Erin E. Peterson; Jay M. Ver Hoef; Dan J. Isaak; Jeffrey A. Falke; Marie-Josee Fortin; Chris E. Jordan; Kristina McNyset; Pascal Monestiez; Aaron S. Ruesch; Aritra Sengupta; Nicholas Som; E. Ashley Steel; David M. Theobald; Christian E. Torgersen; Seth J. Wenger
2013-01-01
Dendritic ecological networks (DENs) are a unique form of ecological networks that exhibit a dendritic network topology (e.g. stream and cave networks or plant architecture). DENs have a dual spatial representation; as points within the network and as points in geographical space. Consequently, some analytical methods used to quantify relationships in other types of...
Directory of Open Access Journals (Sweden)
Kim Hyun
2011-12-01
Full Text Available Abstract Background Genome-scale metabolic network models have contributed to elucidating biological phenomena, and predicting gene targets to engineer for biotechnological applications. With their increasing importance, their precise network characterization has also been crucial for better understanding of the cellular physiology. Results We herein introduce a framework for network modularization and Bayesian network analysis (FMB to investigate organism’s metabolism under perturbation. FMB reveals direction of influences among metabolic modules, in which reactions with similar or positively correlated flux variation patterns are clustered, in response to specific perturbation using metabolic flux data. With metabolic flux data calculated by constraints-based flux analysis under both control and perturbation conditions, FMB, in essence, reveals the effects of specific perturbations on the biological system through network modularization and Bayesian network analysis at metabolic modular level. As a demonstration, this framework was applied to the genetically perturbed Escherichia coli metabolism, which is a lpdA gene knockout mutant, using its genome-scale metabolic network model. Conclusions After all, it provides alternative scenarios of metabolic flux distributions in response to the perturbation, which are complementary to the data obtained from conventionally available genome-wide high-throughput techniques or metabolic flux analysis.
Kim, Hyun Uk; Kim, Tae Yong; Lee, Sang Yup
2011-01-01
Genome-scale metabolic network models have contributed to elucidating biological phenomena, and predicting gene targets to engineer for biotechnological applications. With their increasing importance, their precise network characterization has also been crucial for better understanding of the cellular physiology. We herein introduce a framework for network modularization and Bayesian network analysis (FMB) to investigate organism's metabolism under perturbation. FMB reveals direction of influences among metabolic modules, in which reactions with similar or positively correlated flux variation patterns are clustered, in response to specific perturbation using metabolic flux data. With metabolic flux data calculated by constraints-based flux analysis under both control and perturbation conditions, FMB, in essence, reveals the effects of specific perturbations on the biological system through network modularization and Bayesian network analysis at metabolic modular level. As a demonstration, this framework was applied to the genetically perturbed Escherichia coli metabolism, which is a lpdA gene knockout mutant, using its genome-scale metabolic network model. After all, it provides alternative scenarios of metabolic flux distributions in response to the perturbation, which are complementary to the data obtained from conventionally available genome-wide high-throughput techniques or metabolic flux analysis.
Directory of Open Access Journals (Sweden)
Misun Ahn
2017-12-01
Full Text Available This paper proposes a virtualized network function orchestration system based on Network Function Virtualization (NFV, one of the main technologies in 5G mobile networks. This system should provide connectivity between network devices and be able to create flexible network function and distribution. This system focuses more on access networks. By experimenting with various scenarios of user service established and activated in a network, we examine whether rapid adoption of new service is possible and whether network resources can be managed efficiently. The proposed method is based on Bluetooth transfer technology and mesh networking to provide automatic connections between network machines and on a Docker flat form, which is a container virtualization technology for setting and managing key functions. Additionally, the system includes a clustering and recovery measure regarding network function based on the Docker platform. We will briefly introduce the QR code perceived service as a user service to examine the proposal and based on this given service, we evaluate the function of the proposal and present analysis. Through the proposed approach, container relocation has been implemented according to a network device’s CPU usage and we confirm successful service through function evaluation on a real test bed. We estimate QR code recognition speed as the amount of network equipment is gradually increased, improving user service and confirm that the speed of recognition is increased as the assigned number of network devices is increased by the user service.
A Network of Networks Perspective on Global Trade.
Maluck, Julian; Donner, Reik V
2015-01-01
Mutually intertwined supply chains in contemporary economy result in a complex network of trade relationships with a highly non-trivial topology that varies with time. In order to understand the complex interrelationships among different countries and economic sectors, as well as their dynamics, a holistic view on the underlying structural properties of this network is necessary. This study employs multi-regional input-output data to decompose 186 national economies into 26 industry sectors and utilizes the approach of interdependent networks to analyze the substructure of the resulting international trade network for the years 1990-2011. The partition of the network into national economies is observed to be compatible with the notion of communities in the sense of complex network theory. By studying internal versus cross-subgraph contributions to established complex network metrics, new insights into the architecture of global trade are obtained, which allow to identify key elements of global economy. Specifically, financial services and business activities dominate domestic trade whereas electrical and machinery industries dominate foreign trade. In order to further specify each national sector's role individually, (cross-)clustering coefficients and cross-betweenness are obtained for different pairs of subgraphs. The corresponding analysis reveals that specific industrial sectors tend to favor distinct directionality patterns and that the cross-clustering coefficient for geographically close country pairs is remarkably high, indicating that spatial factors are still of paramount importance for the organization of trade patterns in modern economy. Regarding the evolution of the trade network's substructure, globalization is well-expressed by trends of several structural characteristics (e.g., link density and node strength) in the interacting network framework. Extreme events, such as the financial crisis 2008/2009, are manifested as anomalies superimposed to
Sie, Rory
2012-01-01
Sie, R. L. L. (2012). COalitions in COOperation Networks (COCOON): Social Network Analysis and Game Theory to Enhance Cooperation Networks (Unpublished doctoral dissertation). September, 28, 2012, Open Universiteit in the Netherlands (CELSTEC), Heerlen, The Netherlands.
Managing Network Partitions in Structured P2P Networks
Shafaat, Tallat M.; Ghodsi, Ali; Haridi, Seif
Structured overlay networks form a major class of peer-to-peer systems, which are touted for their abilities to scale, tolerate failures, and self-manage. Any long-lived Internet-scale distributed system is destined to face network partitions. Consequently, the problem of network partitions and mergers is highly related to fault-tolerance and self-management in large-scale systems. This makes it a crucial requirement for building any structured peer-to-peer systems to be resilient to network partitions. Although the problem of network partitions and mergers is highly related to fault-tolerance and self-management in large-scale systems, it has hardly been studied in the context of structured peer-to-peer systems. Structured overlays have mainly been studied under churn (frequent joins/failures), which as a side effect solves the problem of network partitions, as it is similar to massive node failures. Yet, the crucial aspect of network mergers has been ignored. In fact, it has been claimed that ring-based structured overlay networks, which constitute the majority of the structured overlays, are intrinsically ill-suited for merging rings. In this chapter, we motivate the problem of network partitions and mergers in structured overlays. We discuss how a structured overlay can automatically detect a network partition and merger. We present an algorithm for merging multiple similar ring-based overlays when the underlying network merges. We examine the solution in dynamic conditions, showing how our solution is resilient to churn during the merger, something widely believed to be difficult or impossible. We evaluate the algorithm for various scenarios and show that even when falsely detecting a merger, the algorithm quickly terminates and does not clutter the network with many messages. The algorithm is flexible as the tradeoff between message complexity and time complexity can be adjusted by a parameter.
Enabling software defined networking experiments in networked critical infrastructures
Directory of Open Access Journals (Sweden)
Béla Genge
2014-05-01
Full Text Available Nowadays, the fact that Networked Critical Infrastructures (NCI, e.g., power plants, water plants, oil and gas distribution infrastructures, and electricity grids, are targeted by significant cyber threats is well known. Nevertheless, recent research has shown that specific characteristics of NCI can be exploited in the enabling of more efficient mitigation techniques, while novel techniques from the field of IP networks can bring significant advantages. In this paper we explore the interconnection of NCI communication infrastructures with Software Defined Networking (SDN-enabled network topologies. SDN provides the means to create virtual networking services and to implement global networking decisions. It relies on OpenFlow to enable communication with remote devices and has been recently categorized as the “Next Big Technology”, which will revolutionize the way decisions are implemented in switches and routers. Therefore, the paper documents the first steps towards enabling an SDN-NCI and presents the impact of a Denial of Service experiment over traffic resulting from an XBee sensor network which is routed across an emulated SDN network.
Stefania Pandolfi
2015-01-01
TALENT is a Marie Curie Initial Training Network (ITN) project coordinated by CERN and funded under the European Commission’s Seventh Framework Programme. From 23 to 25 November, the project’s participants will present their achievements at the final event that will be held at IdeaSquare. The IBL sub-detector during its insertion in the heart of the ATLAS detector (May 2014) (Image: Heinz Pernegger/CERN). TALENT’s acronym stands for “Training for cAreer deveLopment in high-radiation ENvironment Technologies”. Launched in 2012 by a collaboration of three research centres, seven universities and eight industrial partners and led by CERN, the project had the overall objective of building up the careers of young researchers in the field of instrumentation for future tracking detectors. The test bed for TALENT’s students has been the development of the Insertable B-Layer (IBL) sub-detector of ATLAS. The high-precision pixel detect...
CERN Bulletin
2012-01-01
The first annual ARDENT workshop took place in Vienna from 20 to 23 November. The workshop gathered together the Early-Stage Researchers (ESR) and their supervisors, plus other people involved from all the participating institutions. “The meeting, which was organised with the local support of the Austrian Institute of Technology, was a nice opportunity for the ESRs to get together, meet each other, and present their research plans and some preliminary results of their work,” says Marco Silari, a member of CERN Radiation Protection Group and the scientist in charge of the programme. Two full days were devoted to a training course on radiation dosimetry, delivered by renowned experts. The workshop closed with a half-day visit to the MedAustron facility in Wiener Neustadt. ARDENT (Advanced Radiation Dosimetry European Network Training) is a Marie Curie ITN project funded under EU FP7 with €4 million. The project focuses on radiation dosimetry exploiting se...
Spatiotemporal Recurrent Convolutional Networks for Traffic Prediction in Transportation Networks
Directory of Open Access Journals (Sweden)
Haiyang Yu
2017-06-01
Full Text Available Predicting large-scale transportation network traffic has become an important and challenging topic in recent decades. Inspired by the domain knowledge of motion prediction, in which the future motion of an object can be predicted based on previous scenes, we propose a network grid representation method that can retain the fine-scale structure of a transportation network. Network-wide traffic speeds are converted into a series of static images and input into a novel deep architecture, namely, spatiotemporal recurrent convolutional networks (SRCNs, for traffic forecasting. The proposed SRCNs inherit the advantages of deep convolutional neural networks (DCNNs and long short-term memory (LSTM neural networks. The spatial dependencies of network-wide traffic can be captured by DCNNs, and the temporal dynamics can be learned by LSTMs. An experiment on a Beijing transportation network with 278 links demonstrates that SRCNs outperform other deep learning-based algorithms in both short-term and long-term traffic prediction.
Spatiotemporal Recurrent Convolutional Networks for Traffic Prediction in Transportation Networks.
Yu, Haiyang; Wu, Zhihai; Wang, Shuqin; Wang, Yunpeng; Ma, Xiaolei
2017-06-26
Predicting large-scale transportation network traffic has become an important and challenging topic in recent decades. Inspired by the domain knowledge of motion prediction, in which the future motion of an object can be predicted based on previous scenes, we propose a network grid representation method that can retain the fine-scale structure of a transportation network. Network-wide traffic speeds are converted into a series of static images and input into a novel deep architecture, namely, spatiotemporal recurrent convolutional networks (SRCNs), for traffic forecasting. The proposed SRCNs inherit the advantages of deep convolutional neural networks (DCNNs) and long short-term memory (LSTM) neural networks. The spatial dependencies of network-wide traffic can be captured by DCNNs, and the temporal dynamics can be learned by LSTMs. An experiment on a Beijing transportation network with 278 links demonstrates that SRCNs outperform other deep learning-based algorithms in both short-term and long-term traffic prediction.
Evaluation of Network Reliability for Computer Networks with Multiple Sources
Directory of Open Access Journals (Sweden)
Yi-Kuei Lin
2012-01-01
Full Text Available Evaluating the reliability of a network with multiple sources to multiple sinks is a critical issue from the perspective of quality management. Due to the unrealistic definition of paths of network models in previous literature, existing models are not appropriate for real-world computer networks such as the Taiwan Advanced Research and Education Network (TWAREN. This paper proposes a modified stochastic-flow network model to evaluate the network reliability of a practical computer network with multiple sources where data is transmitted through several light paths (LPs. Network reliability is defined as being the probability of delivering a specified amount of data from the sources to the sink. It is taken as a performance index to measure the service level of TWAREN. This paper studies the network reliability of the international portion of TWAREN from two sources (Taipei and Hsinchu to one sink (New York that goes through a submarine and land surface cable between Taiwan and the United States.
Barabasi, Albert-Laszlo
2016-01-01
Networks are everywhere, from the Internet, to social networks, and the genetic networks that determine our biological existence. Illustrated throughout in full colour, this pioneering textbook, spanning a wide range of topics from physics to computer science, engineering, economics and the social sciences, introduces network science to an interdisciplinary audience. From the origins of the six degrees of separation to explaining why networks are robust to random failures, the author explores how viruses like Ebola and H1N1 spread, and why it is that our friends have more friends than we do. Using numerous real-world examples, this innovatively designed text includes clear delineation between undergraduate and graduate level material. The mathematical formulas and derivations are included within Advanced Topics sections, enabling use at a range of levels. Extensive online resources, including films and software for network analysis, make this a multifaceted companion for anyone with an interest in network sci...
International Nuclear Information System (INIS)
Smith, David M D; Onnela, Jukka-Pekka; Johnson, Neil F
2007-01-01
Evolving out-of-equilibrium networks have been under intense scrutiny recently. In many real-world settings the number of links added per new node is not constant but depends on the time at which the node is introduced in the system. This simple idea gives rise to the concept of accelerating networks, for which we review an existing definition and-after finding it somewhat constrictive-offer a new definition. The new definition provided here views network acceleration as a time dependent property of a given system as opposed to being a property of the specific algorithm applied to grow the network. The definition also covers both unweighted and weighted networks. As time-stamped network data becomes increasingly available, the proposed measures may be easily applied to such empirical datasets. As a simple case study we apply the concepts to study the evolution of three different instances of Wikipedia, namely, those in English, German, and Japanese, and find that the networks undergo different acceleration regimes in their evolution
Thwing, Julie; Eckert, Erin; Dione, Demba Anta; Tine, Roger; Faye, Adama; Yé, Yazoume; Ndiop, Medoune; Cisse, Moustapha; Ndione, Jacques Andre; Diouf, Mame Birame; Ba, Mady
2017-09-01
Malaria is endemic in Senegal. The national malaria control strategy focuses on achieving universal coverage for major interventions, with a goal of reaching preelimination status by 2018. Senegal began distribution of insecticide-treated nets (ITNs) and introduced artemisinin-based combination therapy in 2006, then introduced rapid diagnostic tests in 2007. We evaluated the impact of these efforts using a plausibility design based on malaria's contribution to all-cause under-five mortality (ACCM) and considering other contextual factors which may influence ACCM. Between 2005 and 2010, household ownership of ITNs increased from 20% to 63%, and the proportion of people sleeping under an ITN the night prior to the survey increased from 6% to 29%. Malaria parasite prevalence declined from 6% to 3% from 2008 to 2010 among children under five. Some nonmalaria indicators of child health improved, for example, increase of complete vaccination coverage from 58% to 64%; however, nutritional indicators deteriorated, with an increase in stunting from 16% to 26%. Although economic indicators improved, environmental conditions favored an increase in malaria transmission. ACCM decreased 40% between 2005 and 2010, from 121 (95% confidence interval [CI] 113-129) to 72 (95% CI 66-77) per 1,000, and declines were greater among age groups, epidemiologic zones, and wealth quintiles most at risk for malaria. After considering coverage of malaria interventions, trends in malaria morbidity, effects of contextual factors, and trends in ACCM, it is plausible that malaria control interventions contributed to a reduction in malaria mortality and to the impressive gains in child survival in Senegal.
Directory of Open Access Journals (Sweden)
Stallworthy Guy
2007-01-01
Full Text Available Abstract Background An ITN intervention was initiated in three predominantly rural districts of Eastern Province, Zambia, that lacked commercial distribution and communication infrastructures. Social marketing techniques were used for product and message development. Public sector clinics and village-based volunteers promoted and distributed subsidized ITNs priced at $2.5 per net. A study was conducted to assess the effects of the intervention on inequities in knowledge, access, ownership and use of ITNs. Methods A post-test only quasi-experimental study design was used to compare intervention and comparison districts. A total of 2,986 respondents were interviewed. Survey respondents were grouped into four socio-economic (SES categories: low, medium-low, medium and high. Knowledge, access, ownership and use indicators are compared. Concentration index scores are calculated. Interactions between intervention status and SES help determine how different SES groups benefited from the intervention. Results Although overall use of nets remained relatively low, post-test data show that knowledge, access, ownership and use of mosquito nets was higher in intervention districts. A decline in SES inequity in access to nets occurred in intervention districts, resulting from a disproportionately greater increase in access among the low SES group. Declines in SES inequities in net ownership and use of nets were associated with the intervention. The largest increases in net ownership and use occurred among medium and high SES categories. Conclusion Increasing access to nets among the poorest respondents in rural areas may not lead to increases in net use unless the price of nets is no longer a barrier to their purchase.
Biedron, Caitlin; Pagano, Marcello; Hedt, Bethany L; Kilian, Albert; Ratcliffe, Amy; Mabunda, Samuel; Valadez, Joseph J
2010-02-01
Large investments and increased global prioritization of malaria prevention and treatment have resulted in greater emphasis on programme monitoring and evaluation (M&E) in many countries. Many countries currently use large multistage cluster sample surveys to monitor malaria outcome indicators on a regional and national level. However, these surveys often mask local-level variability important to programme management. Lot Quality Assurance Sampling (LQAS) has played a valuable role for local-level programme M&E. If incorporated into these larger surveys, it would provide a comprehensive M&E plan at little, if any, extra cost. The Mozambique Ministry of Health conducted a Malaria Indicator Survey (MIS) in June and July 2007. We applied LQAS classification rules to the 345 sampled enumeration areas to demonstrate identifying high- and low-performing areas with respect to two malaria program indicators-'household possession of any bednet' and 'household possession of any insecticide-treated bednet (ITN)'. As shown by the MIS, no province in Mozambique achieved the 70% coverage target for household possession of bednets or ITNs. By applying LQAS classification rules to the data, we identify 266 of the 345 enumeration areas as having bednet coverage severely below the 70% target. An additional 73 were identified with low ITN coverage. This article demonstrates the feasibility of integrating LQAS into multistage cluster sampling surveys and using these results to support a comprehensive national, regional and local programme M&E system. Furthermore, in the recommendations we outlined how to integrate the Large Country-LQAS design into macro-surveys while still obtaining results available through current sampling practices.
Agha, Sohail; Van Rossem, Ronan; Stallworthy, Guy; Kusanthan, Thankian
2007-01-29
An ITN intervention was initiated in three predominantly rural districts of Eastern Province, Zambia, that lacked commercial distribution and communication infrastructures. Social marketing techniques were used for product and message development. Public sector clinics and village-based volunteers promoted and distributed subsidized ITNs priced at 2.5 dollars per net. A study was conducted to assess the effects of the intervention on inequities in knowledge, access, ownership and use of ITNs. A post-test only quasi-experimental study design was used to compare intervention and comparison districts. A total of 2,986 respondents were interviewed. Survey respondents were grouped into four socio-economic (SES) categories: low, medium-low, medium and high. Knowledge, access, ownership and use indicators are compared. Concentration index scores are calculated. Interactions between intervention status and SES help determine how different SES groups benefited from the intervention. Although overall use of nets remained relatively low, post-test data show that knowledge, access, ownership and use of mosquito nets was higher in intervention districts. A decline in SES inequity in access to nets occurred in intervention districts, resulting from a disproportionately greater increase in access among the low SES group. Declines in SES inequities in net ownership and use of nets were associated with the intervention. The largest increases in net ownership and use occurred among medium and high SES categories. Increasing access to nets among the poorest respondents in rural areas may not lead to increases in net use unless the price of nets is no longer a barrier to their purchase.
Combining fungal biopesticides and insecticide-treated bednets to enhance malaria control.
Hancock, Penelope A
2009-10-01
In developing strategies to control malaria vectors, there is increased interest in biological methods that do not cause instant vector mortality, but have sublethal and lethal effects at different ages and stages in the mosquito life cycle. These techniques, particularly if integrated with other vector control interventions, may produce substantial reductions in malaria transmission due to the total effect of alterations to multiple life history parameters at relevant points in the life-cycle and transmission-cycle of the vector. To quantify this effect, an analytically tractable gonotrophic cycle model of mosquito-malaria interactions is developed that unites existing continuous and discrete feeding cycle approaches. As a case study, the combined use of fungal biopesticides and insecticide treated bednets (ITNs) is considered. Low values of the equilibrium EIR and human prevalence were obtained when fungal biopesticides and ITNs were combined, even for scenarios where each intervention acting alone had relatively little impact. The effect of the combined interventions on the equilibrium EIR was at least as strong as the multiplicative effect of both interventions. For scenarios representing difficult conditions for malaria control, due to high transmission intensity and widespread insecticide resistance, the effect of the combined interventions on the equilibrium EIR was greater than the multiplicative effect, as a result of synergistic interactions between the interventions. Fungal biopesticide application was found to be most effective when ITN coverage was high, producing significant reductions in equilibrium prevalence for low levels of biopesticide coverage. By incorporating biological mechanisms relevant to vectorial capacity, continuous-time vector population models can increase their applicability to integrated vector management.
Stephens, Judith Koryo; Ofori, Michael F; Quakyi, Isabella Akyinbah; Wilson, Mark Lee; Akanmori, Bartholomew Dicky
2014-01-01
Malaria and anaemia have adverse effects in pregnant women and on the birth weight of infants in malaria endemic areas. P. falciparum malaria, the most virulent species continues to be a major health problem in sub-Saharan Africa. This study was carried out to establish the prevalence of pregnancy-associated malaria and its associated consequences including maternal anaemia and low birthweight (LBW) deliveries and placental malaria among pregnant women in a sub-urban area in coastal Ghana. A facility-based investigation was carried out among 320 pregnant women seeking antenatal care in a hospital in suburban coastal Ghana. Information on the use of Insecticide Treated Nets (ITNs) and Intermittent Preventive Treatment in pregnancy (IPTp) were collected using a structured questionnaire at enrollment. Venous blood was collected for microscopy and screening for Glucose 6-phosphate dehydrogenase (G6PD) deficiency. Haemoglobin concentration was obtained from an automatic blood analyzer. Placental smears and birth weight measurements were taken at delivery. The prevalence of Plasmodium falciparum parasitaemia was 5%. The mean haemoglobin (Hb) level at registration was 11.44 g/dL (95% CI 11.29 - 11.80). Placental blood parasitaemia and low birthweight were 2.5% and 3% respectively. ITN possession was 31.6% with 5.4% usage. The IPTp coverage was 55%. The prevalence of malaria and anaemia among the pregnant women were low at enrollment. Placental blood parasitaemia and LBW at delivery were also low. These are clear indications of the high coverage of the IPTp. Increase in ITN use will further improve birthweight outcomes and reduce placental malaria.
Network traffic anomaly prediction using Artificial Neural Network
Ciptaningtyas, Hening Titi; Fatichah, Chastine; Sabila, Altea
2017-03-01
As the excessive increase of internet usage, the malicious software (malware) has also increase significantly. Malware is software developed by hacker for illegal purpose(s), such as stealing data and identity, causing computer damage, or denying service to other user[1]. Malware which attack computer or server often triggers network traffic anomaly phenomena. Based on Sophos's report[2], Indonesia is the riskiest country of malware attack and it also has high network traffic anomaly. This research uses Artificial Neural Network (ANN) to predict network traffic anomaly based on malware attack in Indonesia which is recorded by Id-SIRTII/CC (Indonesia Security Incident Response Team on Internet Infrastructure/Coordination Center). The case study is the highest malware attack (SQL injection) which has happened in three consecutive years: 2012, 2013, and 2014[4]. The data series is preprocessed first, then the network traffic anomaly is predicted using Artificial Neural Network and using two weight update algorithms: Gradient Descent and Momentum. Error of prediction is calculated using Mean Squared Error (MSE) [7]. The experimental result shows that MSE for SQL Injection is 0.03856. So, this approach can be used to predict network traffic anomaly.
Phoebus: Network Middleware for Next-Generation Network Computing
Energy Technology Data Exchange (ETDEWEB)
Martin Swany
2012-06-16
The Phoebus project investigated algorithms, protocols, and middleware infrastructure to improve end-to-end performance in high speed, dynamic networks. The Phoebus system essentially serves as an adaptation point for networks with disparate capabilities or provisioning. This adaptation can take a variety of forms including acting as a provisioning agent across multiple signaling domains, providing transport protocol adaptation points, and mapping between distributed resource reservation paradigms and the optical network control plane. We have successfully developed the system and demonstrated benefits. The Phoebus system was deployed in Internet2 and in ESnet, as well as in GEANT2, RNP in Brazil and over international links to Korea and Japan. Phoebus is a system that implements a new protocol and associated forwarding infrastructure for improving throughput in high-speed dynamic networks. It was developed to serve the needs of large DOE applications on high-performance networks. The idea underlying the Phoebus model is to embed Phoebus Gateways (PGs) in the network as on-ramps to dynamic circuit networks. The gateways act as protocol translators that allow legacy applications to use dedicated paths with high performance.
Identification of important nodes in directed biological networks: a network motif approach.
Directory of Open Access Journals (Sweden)
Pei Wang
Full Text Available Identification of important nodes in complex networks has attracted an increasing attention over the last decade. Various measures have been proposed to characterize the importance of nodes in complex networks, such as the degree, betweenness and PageRank. Different measures consider different aspects of complex networks. Although there are numerous results reported on undirected complex networks, few results have been reported on directed biological networks. Based on network motifs and principal component analysis (PCA, this paper aims at introducing a new measure to characterize node importance in directed biological networks. Investigations on five real-world biological networks indicate that the proposed method can robustly identify actually important nodes in different networks, such as finding command interneurons, global regulators and non-hub but evolutionary conserved actually important nodes in biological networks. Receiver Operating Characteristic (ROC curves for the five networks indicate remarkable prediction accuracy of the proposed measure. The proposed index provides an alternative complex network metric. Potential implications of the related investigations include identifying network control and regulation targets, biological networks modeling and analysis, as well as networked medicine.
Functional Module Analysis for Gene Coexpression Networks with Network Integration.
Zhang, Shuqin; Zhao, Hongyu; Ng, Michael K
2015-01-01
Network has been a general tool for studying the complex interactions between different genes, proteins, and other small molecules. Module as a fundamental property of many biological networks has been widely studied and many computational methods have been proposed to identify the modules in an individual network. However, in many cases, a single network is insufficient for module analysis due to the noise in the data or the tuning of parameters when building the biological network. The availability of a large amount of biological networks makes network integration study possible. By integrating such networks, more informative modules for some specific disease can be derived from the networks constructed from different tissues, and consistent factors for different diseases can be inferred. In this paper, we have developed an effective method for module identification from multiple networks under different conditions. The problem is formulated as an optimization model, which combines the module identification in each individual network and alignment of the modules from different networks together. An approximation algorithm based on eigenvector computation is proposed. Our method outperforms the existing methods, especially when the underlying modules in multiple networks are different in simulation studies. We also applied our method to two groups of gene coexpression networks for humans, which include one for three different cancers, and one for three tissues from the morbidly obese patients. We identified 13 modules with three complete subgraphs, and 11 modules with two complete subgraphs, respectively. The modules were validated through Gene Ontology enrichment and KEGG pathway enrichment analysis. We also showed that the main functions of most modules for the corresponding disease have been addressed by other researchers, which may provide the theoretical basis for further studying the modules experimentally.
Network Analysis Tools: from biological networks to clusters and pathways.
Brohée, Sylvain; Faust, Karoline; Lima-Mendez, Gipsi; Vanderstocken, Gilles; van Helden, Jacques
2008-01-01
Network Analysis Tools (NeAT) is a suite of computer tools that integrate various algorithms for the analysis of biological networks: comparison between graphs, between clusters, or between graphs and clusters; network randomization; analysis of degree distribution; network-based clustering and path finding. The tools are interconnected to enable a stepwise analysis of the network through a complete analytical workflow. In this protocol, we present a typical case of utilization, where the tasks above are combined to decipher a protein-protein interaction network retrieved from the STRING database. The results returned by NeAT are typically subnetworks, networks enriched with additional information (i.e., clusters or paths) or tables displaying statistics. Typical networks comprising several thousands of nodes and arcs can be analyzed within a few minutes. The complete protocol can be read and executed in approximately 1 h.
Energy-aware virtual network embedding in flexi-grid optical networks
Lin, Rongping; Luo, Shan; Wang, Haoran; Wang, Sheng; Chen, Bin
2018-01-01
Virtual network embedding (VNE) problem is to map multiple heterogeneous virtual networks (VN) on a shared substrate network, which mitigate the ossification of the substrate network. Meanwhile, energy efficiency has been widely considered in the network design. In this paper, we aim to solve the energy-aware VNE problem in flexi-grid optical networks. We provide an integer linear programming (ILP) formulation to minimize the power increment of each arriving VN request. We also propose a polynomial-time heuristic algorithm where virtual links are embedded sequentially to keep a reasonable acceptance ratio and maintain a low energy consumption. Numerical results show the functionality of the heuristic algorithm in a 24-node network.
2007-01-01
In order to optimise the management of the Technical Network (TN), to facilitate understanding of the purpose of devices connected to the TN and to improve security incident handling, the Technical Network Administrators and the CNIC WG have asked IT/CS to verify the "description" and "tag" fields of devices connected to the TN. Therefore, persons responsible for systems connected to the TN will receive e-mails from IT/CS asking them to add the corresponding information in the network database at "network-cern-ch". Thank you very much for your cooperation. The Technical Network Administrators & the CNIC WG
An examination of a reciprocal relationship between network governance and network structure
DEFF Research Database (Denmark)
Bergenholtz, Carsten; Goduscheit, René Chester
The present article examines the network structure and governance of inter-organisational innovation networks. Network governance refers to the issue of how to manage and coordinate the relational activities and processes in the network while research on network structure deals with the overall...... structural relations between the actors in the network. These streams of research do contain references to each other but mostly rely on a static conception of the relationship between network structure and the applied network governance. The paper is based on a primarily qualitative case study of a loosely...... coupled Danish inter-organisational innovation network. The proposition is that a reciprocal relation between network governance and network structure can be identified....
Statistical Network Analysis for Functional MRI: Mean Networks and Group Comparisons.
Directory of Open Access Journals (Sweden)
Cedric E Ginestet
2014-05-01
Full Text Available Comparing networks in neuroscience is hard, because the topological properties of a given network are necessarily dependent on the number of edges of that network. This problem arises in the analysis of both weighted and unweighted networks. The term density is often used in this context, in order to refer to the mean edge weight of a weighted network, or to the number of edges in an unweighted one. Comparing families of networks is therefore statistically difficult because differences in topology are necessarily associated with differences in density. In this review paper, we consider this problem from two different perspectives, which include (i the construction of summary networks, such as how to compute and visualize the mean network from a sample of network-valued data points; and (ii how to test for topological differences, when two families of networks also exhibit significant differences in density. In the first instance, we show that the issue of summarizing a family of networks can be conducted by either adopting a mass-univariate approach, which produces a statistical parametric network (SPN, or by directly computing the mean network, provided that a metric has been specified on the space of all networks with a given number of nodes. In the second part of this review, we then highlight the inherent problems associated with the comparison of topological functions of families of networks that differ in density. In particular, we show that a wide range of topological summaries, such as global efficiency and network modularity are highly sensitive to differences in density. Moreover, these problems are not restricted to unweighted metrics, as we demonstrate that the same issues remain present when considering the weighted versions of these metrics. We conclude by encouraging caution, when reporting such statistical comparisons, and by emphasizing the importance of constructing summary networks.
Network rewiring dynamics with convergence towards a star network.
Whigham, P A; Dick, G; Parry, M
2016-10-01
Network rewiring as a method for producing a range of structures was first introduced in 1998 by Watts & Strogatz ( Nature 393 , 440-442. (doi:10.1038/30918)). This approach allowed a transition from regular through small-world to a random network. The subsequent interest in scale-free networks motivated a number of methods for developing rewiring approaches that converged to scale-free networks. This paper presents a rewiring algorithm (RtoS) for undirected, non-degenerate, fixed size networks that transitions from regular, through small-world and scale-free to star-like networks. Applications of the approach to models for the spread of infectious disease and fixation time for a simple genetics model are used to demonstrate the efficacy and application of the approach.
In-Network Adaptation of Video Streams Using Network Processors
Directory of Open Access Journals (Sweden)
Mohammad Shorfuzzaman
2009-01-01
problem can be addressed, near the network edge, by applying dynamic, in-network adaptation (e.g., transcoding of video streams to meet available connection bandwidth, machine characteristics, and client preferences. In this paper, we extrapolate from earlier work of Shorfuzzaman et al. 2006 in which we implemented and assessed an MPEG-1 transcoding system on the Intel IXP1200 network processor to consider the feasibility of in-network transcoding for other video formats and network processor architectures. The use of “on-the-fly” video adaptation near the edge of the network offers the promise of simpler support for a wide range of end devices with different display, and so forth, characteristics that can be used in different types of environments.
Analysis of Semantic Networks using Complex Networks Concepts
DEFF Research Database (Denmark)
Ortiz-Arroyo, Daniel
2013-01-01
In this paper we perform a preliminary analysis of semantic networks to determine the most important terms that could be used to optimize a summarization task. In our experiments, we measure how the properties of a semantic network change, when the terms in the network are removed. Our preliminar...
Phillips-Howard, Penelope A.; ter Kuile, Feiko O.; Nahlen, Bernard L.; Alaii, Jane A.; Gimnig, John E.; Kolczak, Margarette S.; Terlouw, Dianne J.; Kariuki, Simon K.; Shi, Ya Ping; Kachur, S. Patrick; Hightower, Allen W.; Vulule, John M.; Hawley, William A.
2003-01-01
This paper describes the study design and methods used in a large community-based, group-randomized, controlled trial of permethrin-treated bed nets (ITNs) in an area with intense, perennial malaria transmission in western Kenya conducted between 1996 and 1999. A multi-disciplinary framework was
Utilisation of insecticide treated nets among pregnant women in Gulu
African Journals Online (AJOL)
EB
Results: 35% of pregnant women (95% CI 31% - 38%) had utilised ITNs. Factors that promoted ... 0.050) and being single/widow/divorced (AOR 0.22, p-value 0.000). Conclusion: .... being engaged in business (OR = 1.56, 95% CI 1.08. - 2.26 ...
Malaria in Pregnancy: Morbidities and Management | Yakasai ...
African Journals Online (AJOL)
control of malaria in the African Subregion during pregnancy has been recommended by the World Health Organization (WHO). These include intermittent preventive treatment (IPT), use of insecticide treated nets (ITNs) and access to effective case management for malaria illness and anemia. Keywords: malaria in ...
Utilization Of Malaria Prophylaxes Amongst Nigerian Urban ...
African Journals Online (AJOL)
TNHJOURNALPH
utilization of a combination of interventions such as sleeping under insecticide treated nets (ITNs),. Intermittent Preventive Treatment in pregnancy (IPTp), insecticide room spraying (IRS) and effective case management and treatment. All these strategies have been adopted in Nigeria through a national policy on malaria.
Network survivability performance
1993-11-01
This technical report has been developed to address the survivability of telecommunications networks including services. It responds to the need for a common understanding of, and assessment techniques for network survivability, availability, integrity, and reliability. It provides a basis for designing and operating telecommunications networks to user expectations for network survivability and a foundation for continuing industry activities in the subject area. This report focuses on the survivability of both public and private networks and covers a wide range of users. Two frameworks are established for quantifying and categorizing service outages, and for classifying network survivability techniques and measures. The performance of the network survivability techniques is considered; however, recommended objectives are not established for network survivability performance.
Networks and network analysis for defence and security
Masys, Anthony J
2014-01-01
Networks and Network Analysis for Defence and Security discusses relevant theoretical frameworks and applications of network analysis in support of the defence and security domains. This book details real world applications of network analysis to support defence and security. Shocks to regional, national and global systems stemming from natural hazards, acts of armed violence, terrorism and serious and organized crime have significant defence and security implications. Today, nations face an uncertain and complex security landscape in which threats impact/target the physical, social, economic
Network analysis literacy a practical approach to the analysis of networks
Zweig, Katharina A
2014-01-01
Network Analysis Literacy focuses on design principles for network analytics projects. The text enables readers to: pose a defined network analytic question; build a network to answer the question; choose or design the right network analytic methods for a particular purpose, and more.
Network-Embedded Management and Applications Understanding Programmable Networking Infrastructure
Wolter, Ralf
2013-01-01
Despite the explosion of networking services and applications in the past decades, the basic technological underpinnings of the Internet have remained largely unchanged. At its heart are special-purpose appliances that connect us to the digital world, commonly known as switches and routers. Now, however, the traditional framework is being increasingly challenged by new methods that are jostling for a position in the next-generation Internet. The concept of a network that is becoming more programmable is one of the aspects that are taking center stage. This opens new possibilities to embed software applications inside the network itself and to manage networks and communications services with unprecedented ease and efficiency. In this edited volume, distinguished experts take the reader on a tour of different facets of programmable network infrastructure and application exploit it. Presenting the state of the art in network embedded management and applications and programmable network infrastructure, the book c...
Virtualized cognitive network architecture for 5G cellular networks
Elsawy, Hesham
2015-07-17
Cellular networks have preserved an application agnostic and base station (BS) centric architecture1 for decades. Network functionalities (e.g. user association) are decided and performed regardless of the underlying application (e.g. automation, tactile Internet, online gaming, multimedia). Such an ossified architecture imposes several hurdles against achieving the ambitious metrics of next generation cellular systems. This article first highlights the features and drawbacks of such architectural ossification. Then the article proposes a virtualized and cognitive network architecture, wherein network functionalities are implemented via software instances in the cloud, and the underlying architecture can adapt to the application of interest as well as to changes in channels and traffic conditions. The adaptation is done in terms of the network topology by manipulating connectivities and steering traffic via different paths, so as to attain the applications\\' requirements and network design objectives. The article presents cognitive strategies to implement some of the classical network functionalities, along with their related implementation challenges. The article further presents a case study illustrating the performance improvement of the proposed architecture as compared to conventional cellular networks, both in terms of outage probability and handover rate.
The entire network topology display system of terminal communication access network
An Yi
2016-01-01
Now order terminal communication access network is network technology in Shanxi Province is diversiform, device type complex, lack of unified technical standard, the terminal communication access network management system of construction constitutes a great obstacle. Need to build a “unified communication interface and communication standard, unified communications network management” of the terminal communication access network cut in the integrated network management system, for the termina...
Network function virtualization concepts and applicability in 5G networks
Zhang, Ying
2018-01-01
A horizontal view of newly emerged technologies in the field of network function virtualization (NFV), introducing the open source implementation efforts that bring NFV from design to reality This book explores the newly emerged technique of network function virtualization (NFV) through use cases, architecture, and challenges, as well as standardization and open source implementations. It is the first systematic source of information about cloud technologies' usage in the cellular network, covering the interplay of different technologies, the discussion of different design choices, and its impact on our future cellular network. Network Function Virtualization: Concepts and Applicability in 5G Networks reviews new technologies that enable NFV, such as Software Defined Networks (SDN), network virtualization, and cloud computing. It also provides an in-depth investigation of the most advanced open source initiatives in this area, including OPNFV, Openstack, and Opendaylight. Finally, this book goes beyond li...
Yeh, Wei-Chang
Network reliability is an important index to the provision of useful information for decision support in the modern world. There is always a need to calculate symbolic network reliability functions (SNRFs) due to dynamic and rapid changes in network parameters. In this brief, the proposed squeezed artificial neural network (SqANN) approach uses the Monte Carlo simulation to estimate the corresponding reliability of a given designed matrix from the Box-Behnken design, and then the Taguchi method is implemented to find the appropriate number of neurons and activation functions of the hidden layer and the output layer in ANN to evaluate SNRFs. According to the experimental results of the benchmark networks, the comparison appears to support the superiority of the proposed SqANN method over the traditional ANN-based approach with at least 16.6% improvement in the median absolute deviation in the cost of extra 2 s on average for all experiments.Network reliability is an important index to the provision of useful information for decision support in the modern world. There is always a need to calculate symbolic network reliability functions (SNRFs) due to dynamic and rapid changes in network parameters. In this brief, the proposed squeezed artificial neural network (SqANN) approach uses the Monte Carlo simulation to estimate the corresponding reliability of a given designed matrix from the Box-Behnken design, and then the Taguchi method is implemented to find the appropriate number of neurons and activation functions of the hidden layer and the output layer in ANN to evaluate SNRFs. According to the experimental results of the benchmark networks, the comparison appears to support the superiority of the proposed SqANN method over the traditional ANN-based approach with at least 16.6% improvement in the median absolute deviation in the cost of extra 2 s on average for all experiments.
Low Computational Complexity Network Coding For Mobile Networks
DEFF Research Database (Denmark)
Heide, Janus
2012-01-01
Network Coding (NC) is a technique that can provide benefits in many types of networks, some examples from wireless networks are: In relay networks, either the physical or the data link layer, to reduce the number of transmissions. In reliable multicast, to reduce the amount of signaling and enable......-flow coding technique. One of the key challenges of this technique is its inherent computational complexity which can lead to high computational load and energy consumption in particular on the mobile platforms that are the target platform in this work. To increase the coding throughput several...
Computer network time synchronization the network time protocol
Mills, David L
2006-01-01
What started with the sundial has, thus far, been refined to a level of precision based on atomic resonance: Time. Our obsession with time is evident in this continued scaling down to nanosecond resolution and beyond. But this obsession is not without warrant. Precision and time synchronization are critical in many applications, such as air traffic control and stock trading, and pose complex and important challenges in modern information networks.Penned by David L. Mills, the original developer of the Network Time Protocol (NTP), Computer Network Time Synchronization: The Network Time Protocol
Resilience of networks formed of interdependent modular networks
Shekhtman, Louis M.; Shai, Saray; Havlin, Shlomo
2015-12-01
Many infrastructure networks have a modular structure and are also interdependent with other infrastructures. While significant research has explored the resilience of interdependent networks, there has been no analysis of the effects of modularity. Here we develop a theoretical framework for attacks on interdependent modular networks and support our results through simulations. We focus, for simplicity, on the case where each network has the same number of communities and the dependency links are restricted to be between pairs of communities of different networks. This is particularly realistic for modeling infrastructure across cities. Each city has its own infrastructures and different infrastructures are dependent only within the city. However, each infrastructure is connected within and between cities. For example, a power grid will connect many cities as will a communication network, yet a power station and communication tower that are interdependent will likely be in the same city. It has previously been shown that single networks are very susceptible to the failure of the interconnected nodes (between communities) (Shai et al 2014 arXiv:1404.4748) and that attacks on these nodes are even more crippling than attacks based on betweenness (da Cunha et al 2015 arXiv:1502.00353). In our example of cities these nodes have long range links which are more likely to fail. For both treelike and looplike interdependent modular networks we find distinct regimes depending on the number of modules, m. (i) In the case where there are fewer modules with strong intraconnections, the system first separates into modules in an abrupt first-order transition and then each module undergoes a second percolation transition. (ii) When there are more modules with many interconnections between them, the system undergoes a single transition. Overall, we find that modular structure can significantly influence the type of transitions observed in interdependent networks and should be
A Network of Networks Perspective on Global Trade
Maluck, Julian; Donner, Reik V.
2015-01-01
Mutually intertwined supply chains in contemporary economy result in a complex network of trade relationships with a highly non-trivial topology that varies with time. In order to understand the complex interrelationships among different countries and economic sectors, as well as their dynamics, a holistic view on the underlying structural properties of this network is necessary. This study employs multi-regional input-output data to decompose 186 national economies into 26 industry sectors and utilizes the approach of interdependent networks to analyze the substructure of the resulting international trade network for the years 1990–2011. The partition of the network into national economies is observed to be compatible with the notion of communities in the sense of complex network theory. By studying internal versus cross-subgraph contributions to established complex network metrics, new insights into the architecture of global trade are obtained, which allow to identify key elements of global economy. Specifically, financial services and business activities dominate domestic trade whereas electrical and machinery industries dominate foreign trade. In order to further specify each national sector’s role individually, (cross-)clustering coefficients and cross-betweenness are obtained for different pairs of subgraphs. The corresponding analysis reveals that specific industrial sectors tend to favor distinct directionality patterns and that the cross-clustering coefficient for geographically close country pairs is remarkably high, indicating that spatial factors are still of paramount importance for the organization of trade patterns in modern economy. Regarding the evolution of the trade network’s substructure, globalization is well-expressed by trends of several structural characteristics (e.g., link density and node strength) in the interacting network framework. Extreme events, such as the financial crisis 2008/2009, are manifested as anomalies superimposed
Dominating biological networks.
Directory of Open Access Journals (Sweden)
Tijana Milenković
Full Text Available Proteins are essential macromolecules of life that carry out most cellular processes. Since proteins aggregate to perform function, and since protein-protein interaction (PPI networks model these aggregations, one would expect to uncover new biology from PPI network topology. Hence, using PPI networks to predict protein function and role of protein pathways in disease has received attention. A debate remains open about whether network properties of "biologically central (BC" genes (i.e., their protein products, such as those involved in aging, cancer, infectious diseases, or signaling and drug-targeted pathways, exhibit some topological centrality compared to the rest of the proteins in the human PPI network.To help resolve this debate, we design new network-based approaches and apply them to get new insight into biological function and disease. We hypothesize that BC genes have a topologically central (TC role in the human PPI network. We propose two different concepts of topological centrality. We design a new centrality measure to capture complex wirings of proteins in the network that identifies as TC those proteins that reside in dense extended network neighborhoods. Also, we use the notion of domination and find dominating sets (DSs in the PPI network, i.e., sets of proteins such that every protein is either in the DS or is a neighbor of the DS. Clearly, a DS has a TC role, as it enables efficient communication between different network parts. We find statistically significant enrichment in BC genes of TC nodes and outperform the existing methods indicating that genes involved in key biological processes occupy topologically complex and dense regions of the network and correspond to its "spine" that connects all other network parts and can thus pass cellular signals efficiently throughout the network. To our knowledge, this is the first study that explores domination in the context of PPI networks.
SCM: A method to improve network service layout efficiency with network evolution
Zhao, Qi; Zhang, Chuanhao
2017-01-01
Network services are an important component of the Internet, which are used to expand network functions for third-party developers. Network function virtualization (NFV) can improve the speed and flexibility of network service deployment. However, with the evolution of the network, network service layout may become inefficient. Regarding this problem, this paper proposes a service chain migration (SCM) method with the framework of “software defined network + network function virtualization” (SDN+NFV), which migrates service chains to adapt to network evolution and improves the efficiency of the network service layout. SCM is modeled as an integer linear programming problem and resolved via particle swarm optimization. An SCM prototype system is designed based on an SDN controller. Experiments demonstrate that SCM could reduce the network traffic cost and energy consumption efficiently. PMID:29267299
SCM: A method to improve network service layout efficiency with network evolution.
Zhao, Qi; Zhang, Chuanhao; Zhao, Zheng
2017-01-01
Network services are an important component of the Internet, which are used to expand network functions for third-party developers. Network function virtualization (NFV) can improve the speed and flexibility of network service deployment. However, with the evolution of the network, network service layout may become inefficient. Regarding this problem, this paper proposes a service chain migration (SCM) method with the framework of "software defined network + network function virtualization" (SDN+NFV), which migrates service chains to adapt to network evolution and improves the efficiency of the network service layout. SCM is modeled as an integer linear programming problem and resolved via particle swarm optimization. An SCM prototype system is designed based on an SDN controller. Experiments demonstrate that SCM could reduce the network traffic cost and energy consumption efficiently.
Allocating resources between network nodes for providing a network node function
Strijkers, R.J.; Meulenhoff, P.J.
2014-01-01
The invention provides a method wherein a first network node advertises available resources that a second network node may use to offload network node functions transparently to the first network node. Examples of the first network node are a client device (e.g. PC, notebook, tablet, smart phone), a
Vaiana, Michael; Muldoon, Sarah Feldt
2018-01-01
The field of neuroscience is facing an unprecedented expanse in the volume and diversity of available data. Traditionally, network models have provided key insights into the structure and function of the brain. With the advent of big data in neuroscience, both more sophisticated models capable of characterizing the increasing complexity of the data and novel methods of quantitative analysis are needed. Recently, multilayer networks, a mathematical extension of traditional networks, have gained increasing popularity in neuroscience due to their ability to capture the full information of multi-model, multi-scale, spatiotemporal data sets. Here, we review multilayer networks and their applications in neuroscience, showing how incorporating the multilayer framework into network neuroscience analysis has uncovered previously hidden features of brain networks. We specifically highlight the use of multilayer networks to model disease, structure-function relationships, network evolution, and link multi-scale data. Finally, we close with a discussion of promising new directions of multilayer network neuroscience research and propose a modified definition of multilayer networks designed to unite and clarify the use of the multilayer formalism in describing real-world systems.
Collaborative Multi-Layer Network Coding in Hybrid Cellular Cognitive Radio Networks
Moubayed, Abdallah J.
2015-05-01
In this paper, as an extension to [1], we propose a prioritized multi-layer network coding scheme for collaborative packet recovery in hybrid (interweave and underlay) cellular cognitive radio networks. This scheme allows the uncoordinated collaboration between the collocated primary and cognitive radio base-stations in order to minimize their own as well as each other\\'s packet recovery overheads, thus by improving their throughput. The proposed scheme ensures that each network\\'s performance is not degraded by its help to the other network. Moreover, it guarantees that the primary network\\'s interference threshold is not violated in the same and adjacent cells. Yet, the scheme allows the reduction of the recovery overhead in the collocated primary and cognitive radio networks. The reduction in the cognitive radio network is further amplified due to the perfect detection of spectrum holes which allows the cognitive radio base station to transmit at higher power without fear of violating the interference threshold of the primary network. For the secondary network, simulation results show reductions of 20% and 34% in the packet recovery overhead, compared to the non-collaborative scheme, for low and high probabilities of primary packet arrivals, respectively. For the primary network, this reduction was found to be 12%. © 2015 IEEE.
Optical network control plane for multi-domain networking
DEFF Research Database (Denmark)
Manolova, Anna Vasileva
This thesis focuses on multi-domain routing for traffice engineering and survivability support in optical transport networks under the Generalized Multi-Protocol Label Switching (GMPLS) control framework. First, different extensions to the Border Gateway Protocol for multi-domain Traffic...... process are not enough for efficient TE in mesh multi-domain networks. Enhancing the protocol with multi-path dissemination capability, combined with the employment of an end-to-end TE metric proves to be a highly efficient solution. Simulation results show good performance characteristics of the proposed...... is not as essential for improved network performance as the length of the provided paths. Second, the issue of multi-domain survivability support is analyzed. An AS-disjoint paths is beneficial not only for resilience support, but also for facilitating adequate network reactions to changes in the network, which...
Resilience of networks to environmental stress: From regular to random networks
Eom, Young-Ho
2018-04-01
Despite the huge interest in network resilience to stress, most of the studies have concentrated on internal stress damaging network structure (e.g., node removals). Here we study how networks respond to environmental stress deteriorating their external conditions. We show that, when regular networks gradually disintegrate as environmental stress increases, disordered networks can suddenly collapse at critical stress with hysteresis and vulnerability to perturbations. We demonstrate that this difference results from a trade-off between node resilience and network resilience to environmental stress. The nodes in the disordered networks can suppress their collapses due to the small-world topology of the networks but eventually collapse all together in return. Our findings indicate that some real networks can be highly resilient against environmental stress to a threshold yet extremely vulnerable to the stress above the threshold because of their small-world topology.
Introductory note on Emergent Unconscious Knowledge Networks (Asygnodic Networks
Directory of Open Access Journals (Sweden)
Henry Bakis
2016-05-01
Full Text Available This note introduces the following paper on the concept of Emergent Unconscious Knowledge Networks (Asygnodic Networks created by E. Roche and M. Blaine. The concept of asyngnosis explains a large number of diverse phenomena involving organizations, groups and decision making. It will present the genesis and definition of Asygnodic Networks and will focus on how they raise challenges to traditional theories of decision making and emerging social networks.
Wei, Chengying; Xiong, Cuilian; Liu, Huanlin
2017-12-01
Maximal multicast stream algorithm based on network coding (NC) can improve the network's throughput for wavelength-division multiplexing (WDM) networks, which however is far less than the network's maximal throughput in terms of theory. And the existing multicast stream algorithms do not give the information distribution pattern and routing in the meantime. In the paper, an improved genetic algorithm is brought forward to maximize the optical multicast throughput by NC and to determine the multicast stream distribution by hybrid chromosomes construction for multicast with single source and multiple destinations. The proposed hybrid chromosomes are constructed by the binary chromosomes and integer chromosomes, while the binary chromosomes represent optical multicast routing and the integer chromosomes indicate the multicast stream distribution. A fitness function is designed to guarantee that each destination can receive the maximum number of decoding multicast streams. The simulation results showed that the proposed method is far superior over the typical maximal multicast stream algorithms based on NC in terms of network throughput in WDM networks.
The network researchers' network
DEFF Research Database (Denmark)
Henneberg, Stephan C.; Jiang, Zhizhong; Naudé, Peter
2009-01-01
The Industrial Marketing and Purchasing (IMP) Group is a network of academic researchers working in the area of business-to-business marketing. The group meets every year to discuss and exchange ideas, with a conference having been held every year since 1984 (there was no meeting in 1987). In thi......The Industrial Marketing and Purchasing (IMP) Group is a network of academic researchers working in the area of business-to-business marketing. The group meets every year to discuss and exchange ideas, with a conference having been held every year since 1984 (there was no meeting in 1987......). In this paper, based upon the papers presented at the 22 conferences held to date, we undertake a Social Network Analysis in order to examine the degree of co-publishing that has taken place between this group of researchers. We identify the different components in this database, and examine the large main...
Managerial Challenges Within Networks - Emphasizing the Paradox of Network Participation
DEFF Research Database (Denmark)
Jakobsen, Morten
2003-01-01
Flexibility and access to numerous resources are essential benefits associated with network participation. An important aspect of managing the network participation of a company is to maintain a dynamic portfolio of partners, and thereby keep up the strategic opportunities for development. However......, maintaining the dynamics within a network seems to be a complex challenge. There is a risk that the network ends up in The Paradox of Network Participation. The desired renewal and flexibility are not utilised because the involved parties preserve the existing networks structure consisting of the same...... and thereby sort out the paradox of network participation. Trust and information are mechanisms employed to absorb uncertainty. The relationship between trust and the requirement for information depends on the maturity of the relationship. When trust becomes too important as uncertainty absorption mechanism...
Managerial challenges within networks: emphasizing the paradox of network participation
DEFF Research Database (Denmark)
Jakobsen, Morten
Flexibility and access to numerous resources are essential benefits associated with network participation. An important aspect of managing the network participation of a company is to maintain a dynamic portfolio of partners, and thereby keep up the strategic opportunities for development. However......, maintaining the dynamics within a network seems to be a complex challenge. There is a risk that the network ends up in The Paradox of Network Participation. The desired renewal and flexibility are not utilised because the involved parties preserve the existing networks structure consisting of the same...... and thereby sort out the paradox of network participation. Trust and information are mechanisms employed to absorb uncertainty. The relationship between trust and the requirement for information depends on the maturity of the relationship. When trust becomes too important as uncertainty absorption mechanism...
Energy Efficient Network Protocols for Wireless and Mobile Networks
National Research Council Canada - National Science Library
Sivalingam, Krishna
2001-01-01
... (also called power aware) network protocols for wireless and mobile networks. Battery power limitations are a very serious concern, and it is essential to study energy efficient protocol design at different layers of the network protocol stack...
Holme, Petter
2017-01-01
This book covers recent developments in epidemic process models and related data on temporally varying networks. It is widely recognized that contact networks are indispensable for describing, understanding, and intervening to stop the spread of infectious diseases in human and animal populations; “network epidemiology” is an umbrella term to describe this research field. More recently, contact networks have been recognized as being highly dynamic. This observation, also supported by an increasing amount of new data, has led to research on temporal networks, a rapidly growing area. Changes in network structure are often informed by epidemic (or other) dynamics, in which case they are referred to as adaptive networks. This volume gathers contributions by prominent authors working in temporal and adaptive network epidemiology, a field essential to understanding infectious diseases in real society.
Collaborative multi-layer network coding for cellular cognitive radio networks
Sorour, Sameh
2013-06-01
In this paper, we propose a prioritized multi-layer network coding scheme for collaborative packet recovery in underlay cellular cognitive radio networks. This scheme allows the collocated primary and cognitive radio base-stations to collaborate with each other, in order to minimize their own and each other\\'s packet recovery overheads, and thus improve their throughput, without any coordination between them. This non-coordinated collaboration is done using a novel multi-layer instantly decodable network coding scheme, which guarantees that each network\\'s help to the other network does not result in any degradation in its own performance. It also does not cause any violation to the primary networks interference thresholds in the same and adjacent cells. Yet, our proposed scheme both guarantees the reduction of the recovery overhead in collocated primary and cognitive radio networks, and allows early recovery of their packets compared to non-collaborative schemes. Simulation results show that a recovery overhead reduction of 15% and 40% can be achieved by our proposed scheme in the primary and cognitive radio networks, respectively, compared to the corresponding non-collaborative scheme. © 2013 IEEE.
Fujimoto, Richard
2006-01-01
"Network Simulation" presents a detailed introduction to the design, implementation, and use of network simulation tools. Discussion topics include the requirements and issues faced for simulator design and use in wired networks, wireless networks, distributed simulation environments, and fluid model abstractions. Several existing simulations are given as examples, with details regarding design decisions and why those decisions were made. Issues regarding performance and scalability are discussed in detail, describing how one can utilize distributed simulation methods to increase the
Energy Technology Data Exchange (ETDEWEB)
Ritter, G.X.; Sussner, P. [Univ. of Florida, Gainesville, FL (United States)
1996-12-31
The theory of artificial neural networks has been successfully applied to a wide variety of pattern recognition problems. In this theory, the first step in computing the next state of a neuron or in performing the next layer neural network computation involves the linear operation of multiplying neural values by their synaptic strengths and adding the results. Thresholding usually follows the linear operation in order to provide for nonlinearity of the network. In this paper we introduce a novel class of neural networks, called morphological neural networks, in which the operations of multiplication and addition are replaced by addition and maximum (or minimum), respectively. By taking the maximum (or minimum) of sums instead of the sum of products, morphological network computation is nonlinear before thresholding. As a consequence, the properties of morphological neural networks are drastically different than those of traditional neural network models. In this paper we consider some of these differences and provide some particular examples of morphological neural network.
International Nuclear Information System (INIS)
Palla, Gergely; Farkas, Illes J; Pollner, Peter; Derenyi, Imre; Vicsek, Tamas
2007-01-01
A search technique locating network modules, i.e. internally densely connected groups of nodes in directed networks is introduced by extending the clique percolation method originally proposed for undirected networks. After giving a suitable definition for directed modules we investigate their percolation transition in the Erdos-Renyi graph both analytically and numerically. We also analyse four real-world directed networks, including Google's own web-pages, an email network, a word association graph and the transcriptional regulatory network of the yeast Saccharomyces cerevisiae. The obtained directed modules are validated by additional information available for the nodes. We find that directed modules of real-world graphs inherently overlap and the investigated networks can be classified into two major groups in terms of the overlaps between the modules. Accordingly, in the word-association network and Google's web-pages, overlaps are likely to contain in-hubs, whereas the modules in the email and transcriptional regulatory network tend to overlap via out-hubs
Dragicevic, Arnaud; Boulanger, Vincent; Bruciamacchie, Max; Chauchard, Sandrine; Dupouey, Jean-Luc; Stenger, Anne
2017-04-21
In order to unveil the value of network connectivity, we formalize the construction of ecological networks in forest environments as an optimal control dynamic graph-theoretic problem. The network is based on a set of bioreserves and patches linked by ecological corridors. The node dynamics, built upon the consensus protocol, form a time evolutive Mahalanobis distance weighted by the opportunity costs of timber production. We consider a case of complete graph, where the ecological network is fully connected, and a case of incomplete graph, where the ecological network is partially connected. The results show that the network equilibrium depends on the size of the reception zone, while the network connectivity depends on the environmental compatibility between the ecological areas. Through shadow prices, we find that securing connectivity in partially connected networks is more expensive than in fully connected networks, but should be undertaken when the opportunity costs are significant. Copyright © 2017 Elsevier Ltd. All rights reserved.
Tunable Sparse Network Coding for Multicast Networks
DEFF Research Database (Denmark)
Feizi, Soheil; Roetter, Daniel Enrique Lucani; Sørensen, Chres Wiant
2014-01-01
This paper shows the potential and key enabling mechanisms for tunable sparse network coding, a scheme in which the density of network coded packets varies during a transmission session. At the beginning of a transmission session, sparsely coded packets are transmitted, which benefits decoding...... complexity. At the end of a transmission, when receivers have accumulated degrees of freedom, coding density is increased. We propose a family of tunable sparse network codes (TSNCs) for multicast erasure networks with a controllable trade-off between completion time performance to decoding complexity...... a mechanism to perform efficient Gaussian elimination over sparse matrices going beyond belief propagation but maintaining low decoding complexity. Supporting simulation results are provided showing the trade-off between decoding complexity and completion time....
A COMPARATIVE STUDY OF SYSTEM NETWORK ARCHITECTURE Vs DIGITAL NETWORK ARCHITECTURE
Seema; Mukesh Arya
2011-01-01
The efficient managing system of sources is mandatory for the successful running of any network. Here this paper describes the most popular network architectures one of developed by IBM, System Network Architecture (SNA) and other is Digital Network Architecture (DNA). As we know that the network standards and protocols are needed for the network developers as well as users. Some standards are The IEEE 802.3 standards (The Institute of Electrical and Electronics Engineers 1980) (LAN), IBM Sta...
A research on the application of software defined networking in satellite network architecture
Song, Huan; Chen, Jinqiang; Cao, Suzhi; Cui, Dandan; Li, Tong; Su, Yuxing
2017-10-01
Software defined network is a new type of network architecture, which decouples control plane and data plane of traditional network, has the feature of flexible configurations and is a direction of the next generation terrestrial Internet development. Satellite network is an important part of the space-ground integrated information network, while the traditional satellite network has the disadvantages of difficult network topology maintenance and slow configuration. The application of SDN technology in satellite network can solve these problems that traditional satellite network faces. At present, the research on the application of SDN technology in satellite network is still in the stage of preliminary study. In this paper, we start with introducing the SDN technology and satellite network architecture. Then we mainly introduce software defined satellite network architecture, as well as the comparison of different software defined satellite network architecture and satellite network virtualization. Finally, the present research status and development trend of SDN technology in satellite network are analyzed.
Opportunistic Beacon Networks: Information Dissemination via Wireless Network Identifiers
Türkes, Okan; Scholten, Johan; Havinga, Paul J.M.
2016-01-01
This paper presents OBN, a universal opportunistic ad hoc networking model particularly intended for smart mobile devices. It enables fast and lightweight data dissemination in wireless community networks through the utilization of universally-available wireless network identifiers. As a ubiquitous
CUFID-query: accurate network querying through random walk based network flow estimation.
Jeong, Hyundoo; Qian, Xiaoning; Yoon, Byung-Jun
2017-12-28
Functional modules in biological networks consist of numerous biomolecules and their complicated interactions. Recent studies have shown that biomolecules in a functional module tend to have similar interaction patterns and that such modules are often conserved across biological networks of different species. As a result, such conserved functional modules can be identified through comparative analysis of biological networks. In this work, we propose a novel network querying algorithm based on the CUFID (Comparative network analysis Using the steady-state network Flow to IDentify orthologous proteins) framework combined with an efficient seed-and-extension approach. The proposed algorithm, CUFID-query, can accurately detect conserved functional modules as small subnetworks in the target network that are expected to perform similar functions to the given query functional module. The CUFID framework was recently developed for probabilistic pairwise global comparison of biological networks, and it has been applied to pairwise global network alignment, where the framework was shown to yield accurate network alignment results. In the proposed CUFID-query algorithm, we adopt the CUFID framework and extend it for local network alignment, specifically to solve network querying problems. First, in the seed selection phase, the proposed method utilizes the CUFID framework to compare the query and the target networks and to predict the probabilistic node-to-node correspondence between the networks. Next, the algorithm selects and greedily extends the seed in the target network by iteratively adding nodes that have frequent interactions with other nodes in the seed network, in a way that the conductance of the extended network is maximally reduced. Finally, CUFID-query removes irrelevant nodes from the querying results based on the personalized PageRank vector for the induced network that includes the fully extended network and its neighboring nodes. Through extensive
A random network based, node attraction facilitated network evolution method
Directory of Open Access Journals (Sweden)
WenJun Zhang
2016-03-01
Full Text Available In present study, I present a method of network evolution that based on random network, and facilitated by node attraction. In this method, I assume that the initial network is a random network, or a given initial network. When a node is ready to connect, it tends to link to the node already owning the most connections, which coincides with the general rule (Barabasi and Albert, 1999 of node connecting. In addition, a node may randomly disconnect a connection i.e., the addition of connections in the network is accompanied by the pruning of some connections. The dynamics of network evolution is determined of the attraction factor Lamda of nodes, the probability of node connection, the probability of node disconnection, and the expected initial connectance. The attraction factor of nodes, the probability of node connection, and the probability of node disconnection are time and node varying. Various dynamics can be achieved by adjusting these parameters. Effects of simplified parameters on network evolution are analyzed. The changes of attraction factor Lamda can reflect various effects of the node degree on connection mechanism. Even the changes of Lamda only will generate various networks from the random to the complex. Therefore, the present algorithm can be treated as a general model for network evolution. Modeling results show that to generate a power-law type of network, the likelihood of a node attracting connections is dependent upon the power function of the node's degree with a higher-order power. Matlab codes for simplified version of the method are provided.
Malaria entomological profile in Tanzania from 1950 to 2010: a ...
African Journals Online (AJOL)
2011-12-10
Dec 10, 2011 ... malaria transmission dynamics, vector biology, ecology, behaviour and ... control achieved by ITNs, as this may vary with the molecular ..... with multilocus protein electrophoresis (11.3%) and cytogenetic analysis together with PCR (2%). ... the mosquito host is one of the principal components in malaria ...
Knowledge, attitudes and practices regarding malaria and mosquito ...
African Journals Online (AJOL)
To improve control measures against malaria, Tanzania has increased the distribution of free and subsidized insecticide-treated mosquito nets (ITNs) to pregnant women. However, data on knowledge, attitudes and practices of these women regarding malaria are scarce. This study was carried out to describe knowledge, ...
ORIGINAL ARTICLES Roll back malaria - an African success story in ...
African Journals Online (AJOL)
infections, water-borne diseases and sexually transmitted diseases? ... J Mufunda, MB ChB, PhD, MBA. P Nyarango ... community protective measures such as insecticide-treated nets. (ITNs), and ... vector control and case management was integral to the programme. ..... major infectious disease in this small African country.
Financing and delivery mechanisms for mosquito control tools in ...
African Journals Online (AJOL)
Background: Malaria is a major public health problem in Sudan and causes an enormous burden of morbidity in the country. Malaria is generally controlled in Sudan using five main approaches, which are environmental management, space spraying (SS), insecticide-treated nets (ITNs), larviciding with abate (LWA) and ...
Recent trends in management of malaria in pregnancy | Jimoh ...
African Journals Online (AJOL)
... Intermittent Preventive Treatment (IPT), Insecticide Treated Nets (ITNs), good and adequate antenatal (ANC), intraparturn and postpartum care will ensure optimal health and reduction in the incidence rate of malaria infection in pregnancy. African Journal of Clinical and Experimental Microbiology Vol. 7(2) 2006: 116-124 ...
Perez, André
2014-01-01
This book introduces the security mechanisms deployed in Ethernet, Wireless-Fidelity (Wi-Fi), Internet Protocol (IP) and MultiProtocol Label Switching (MPLS) networks. These mechanisms are grouped throughout the book according to the following four functions: data protection, access control, network isolation, and data monitoring. Data protection is supplied by data confidentiality and integrity control services. Access control is provided by a third-party authentication service. Network isolation is supplied by the Virtual Private Network (VPN) service. Data monitoring consists of applying
Heterogeneous network architectures
DEFF Research Database (Denmark)
Christiansen, Henrik Lehrmann
2006-01-01
is flexibility. This thesis investigates such heterogeneous network architectures and how to make them flexible. A survey of algorithms for network design is presented, and it is described how using heuristics can increase the speed. A hierarchical, MPLS based network architecture is described......Future networks will be heterogeneous! Due to the sheer size of networks (e.g., the Internet) upgrades cannot be instantaneous and thus heterogeneity appears. This means that instead of trying to find the olution, networks hould be designed as being heterogeneous. One of the key equirements here...... and it is discussed that it is advantageous to heterogeneous networks and illustrated by a number of examples. Modeling and simulation is a well-known way of doing performance evaluation. An approach to event-driven simulation of communication networks is presented and mixed complexity modeling, which can simplify...
Network Traffic Features for Anomaly Detection in Specific Industrial Control System Network
Directory of Open Access Journals (Sweden)
Matti Mantere
2013-09-01
Full Text Available The deterministic and restricted nature of industrial control system networks sets them apart from more open networks, such as local area networks in office environments. This improves the usability of network security, monitoring approaches that would be less feasible in more open environments. One of such approaches is machine learning based anomaly detection. Without proper customization for the special requirements of the industrial control system network environment, many existing anomaly or misuse detection systems will perform sub-optimally. A machine learning based approach could reduce the amount of manual customization required for different industrial control system networks. In this paper we analyze a possible set of features to be used in a machine learning based anomaly detection system in the real world industrial control system network environment under investigation. The network under investigation is represented by architectural drawing and results derived from network trace analysis. The network trace is captured from a live running industrial process control network and includes both control data and the data flowing between the control network and the office network. We limit the investigation to the IP traffic in the traces.
Allocating resources between network nodes for providing a network node function
Strijkers, R.J.; Meulenhoff, P.J.
2014-01-01
The invention provides a method wherein a first network node advertises available resources that a second network node may use to offload network node functions transparently to the first network node. Examples of the first network node are a client device (e.g. PC, notebook, tablet, smart phone), a server (e.g. application server, a proxy server, cloud location, router). Examples of the second network node are an application server, a cloud location or a router. The available resources may b...
Tinnitus: Network pathophysiology-network pharmacology
Directory of Open Access Journals (Sweden)
Ana Belen eElgoyhen
2012-01-01
Full Text Available Tinnitus, the phantom perception of sound, is a prevalent disorder. One in 10 adults has clinically significant subjective tinnitus, and for 1 in 100, tinnitus severely affects their quality of life. Despite the significant unmet clinical need for a safe and effective drug targeting tinnitus relief, there is currently not a single FDA-approved drug on the market. The search for drugs that target tinnitus is hampered by the lack of a deep knowledge of the underlying neural substrates of this pathology. Recent studies are increasingly demonstrating that, as described for other central nervous system disorders, tinnitus is a pathology of brain networks. The application of graph theoretical analysis to brain networks has recently provided new information concerning their topology, their robustness and their vulnerability to attacks. Moreover, the philosophy behind drug design and pharmacotherapy in central nervous system pathologies is changing from that of magic bullets that target individual chemoreceptors or disease-causing genes into that of magic shotguns, promiscuous or dirty drugs that target disease-causing networks, also known as network pharmacology. In the present work we provide some insight into how this knowledge could be applied to tinnitus pathophysiology and pharmacotherapy.
Tinnitus: network pathophysiology-network pharmacology.
Elgoyhen, Ana B; Langguth, Berthold; Vanneste, Sven; De Ridder, Dirk
2012-01-01
Tinnitus, the phantom perception of sound, is a prevalent disorder. One in 10 adults has clinically significant subjective tinnitus, and for one in 100, tinnitus severely affects their quality of life. Despite the significant unmet clinical need for a safe and effective drug targeting tinnitus relief, there is currently not a single Food and Drug Administration (FDA)-approved drug on the market. The search for drugs that target tinnitus is hampered by the lack of a deep knowledge of the underlying neural substrates of this pathology. Recent studies are increasingly demonstrating that, as described for other central nervous system (CNS) disorders, tinnitus is a pathology of brain networks. The application of graph theoretical analysis to brain networks has recently provided new information concerning their topology, their robustness and their vulnerability to attacks. Moreover, the philosophy behind drug design and pharmacotherapy in CNS pathologies is changing from that of "magic bullets" that target individual chemoreceptors or "disease-causing genes" into that of "magic shotguns," "promiscuous" or "dirty drugs" that target "disease-causing networks," also known as network pharmacology. In the present work we provide some insight into how this knowledge could be applied to tinnitus pathophysiology and pharmacotherapy.
McMillan, Troy
2015-01-01
Start a career in networking Cisco Networking Essentials, 2nd Edition provides the latest for those beginning a career in networking. This book provides the fundamentals of networking and leads you through the concepts, processes, and skills you need to master fundamental networking concepts. Thinking of taking the CCENT Cisco Certified Entry Networking Technician ICND1 Exam 100-101? This book has you covered! With coverage of important topics and objectives, each chapter outlines main points and provides clear, engaging discussion that will give you a sound understanding of core topics and c
Adverse Outcome Pathway Networks II: Network Analytics.
Villeneuve, Daniel L; Angrish, Michelle M; Fortin, Marie C; Katsiadaki, Ioanna; Leonard, Marc; Margiotta-Casaluci, Luigi; Munn, Sharon; O'Brien, Jason M; Pollesch, Nathan L; Smith, L Cody; Zhang, Xiaowei; Knapen, Dries
2018-02-28
Toxicological responses to stressors are more complex than the simple one biological perturbation to one adverse outcome model portrayed by individual adverse outcome pathways (AOPs). Consequently, the AOP framework was designed to facilitate de facto development of AOP networks that can aid understanding and prediction of pleiotropic and interactive effects more common to environmentally realistic, complex exposure scenarios. The present paper introduces nascent concepts related to the qualitative analysis of AOP networks. First, graph theory-based approaches for identifying important topological features are illustrated using two example AOP networks derived from existing AOP descriptions. Second, considerations for identifying the most significant path(s) through an AOP network from either a biological or risk assessment perspective are described. Finally, approaches for identifying interactions among AOPs that may result in additive, synergistic, or antagonistic responses, or previously undefined emergent patterns of response, are introduced. Along with a companion article (Knapen et al. part I), these concepts set the stage for development of tools and case studies that will facilitate more rigorous analysis of AOP networks, and the utility of AOP network-based predictions, for use in research and regulatory decision-making. Collectively, this work addresses one of the major themes identified through a SETAC Horizon Scanning effort focused on advancing the AOP framework. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Finding quasi-optimal network topologies for information transmission in active networks.
Baptista, Murilo S; de Carvalho, Josué X; Hussein, Mahir S
2008-01-01
This work clarifies the relation between network circuit (topology) and behaviour (information transmission and synchronization) in active networks, e.g. neural networks. As an application, we show how one can find network topologies that are able to transmit a large amount of information, possess a large number of communication channels, and are robust under large variations of the network coupling configuration. This theoretical approach is general and does not depend on the particular dynamic of the elements forming the network, since the network topology can be determined by finding a Laplacian matrix (the matrix that describes the connections and the coupling strengths among the elements) whose eigenvalues satisfy some special conditions. To illustrate our ideas and theoretical approaches, we use neural networks of electrically connected chaotic Hindmarsh-Rose neurons.
Finding quasi-optimal network topologies for information transmission in active networks.
Directory of Open Access Journals (Sweden)
Murilo S Baptista
Full Text Available This work clarifies the relation between network circuit (topology and behaviour (information transmission and synchronization in active networks, e.g. neural networks. As an application, we show how one can find network topologies that are able to transmit a large amount of information, possess a large number of communication channels, and are robust under large variations of the network coupling configuration. This theoretical approach is general and does not depend on the particular dynamic of the elements forming the network, since the network topology can be determined by finding a Laplacian matrix (the matrix that describes the connections and the coupling strengths among the elements whose eigenvalues satisfy some special conditions. To illustrate our ideas and theoretical approaches, we use neural networks of electrically connected chaotic Hindmarsh-Rose neurons.
Research on Evolutionary Mechanism of Agile Supply Chain Network via Complex Network Theory
Directory of Open Access Journals (Sweden)
Nai-Ru Xu
2016-01-01
Full Text Available The paper establishes the evolutionary mechanism model of agile supply chain network by means of complex network theory which can be used to describe the growth process of the agile supply chain network and analyze the complexity of the agile supply chain network. After introducing the process and the suitability of taking complex network theory into supply chain network research, the paper applies complex network theory into the agile supply chain network research, analyzes the complexity of agile supply chain network, presents the evolutionary mechanism of agile supply chain network based on complex network theory, and uses Matlab to simulate degree distribution, average path length, clustering coefficient, and node betweenness. Simulation results show that the evolution result displays the scale-free property. It lays the foundations of further research on agile supply chain network based on complex network theory.
Seeded Bayesian Networks: Constructing genetic networks from microarray data
Directory of Open Access Journals (Sweden)
Quackenbush John
2008-07-01
Full Text Available Abstract Background DNA microarrays and other genomics-inspired technologies provide large datasets that often include hidden patterns of correlation between genes reflecting the complex processes that underlie cellular metabolism and physiology. The challenge in analyzing large-scale expression data has been to extract biologically meaningful inferences regarding these processes – often represented as networks – in an environment where the datasets are often imperfect and biological noise can obscure the actual signal. Although many techniques have been developed in an attempt to address these issues, to date their ability to extract meaningful and predictive network relationships has been limited. Here we describe a method that draws on prior information about gene-gene interactions to infer biologically relevant pathways from microarray data. Our approach consists of using preliminary networks derived from the literature and/or protein-protein interaction data as seeds for a Bayesian network analysis of microarray results. Results Through a bootstrap analysis of gene expression data derived from a number of leukemia studies, we demonstrate that seeded Bayesian Networks have the ability to identify high-confidence gene-gene interactions which can then be validated by comparison to other sources of pathway data. Conclusion The use of network seeds greatly improves the ability of Bayesian Network analysis to learn gene interaction networks from gene expression data. We demonstrate that the use of seeds derived from the biomedical literature or high-throughput protein-protein interaction data, or the combination, provides improvement over a standard Bayesian Network analysis, allowing networks involving dynamic processes to be deduced from the static snapshots of biological systems that represent the most common source of microarray data. Software implementing these methods has been included in the widely used TM4 microarray analysis package.
Hierarchical thinking in network biology: the unbiased modularization of biochemical networks.
Papin, Jason A; Reed, Jennifer L; Palsson, Bernhard O
2004-12-01
As reconstructed biochemical reaction networks continue to grow in size and scope, there is a growing need to describe the functional modules within them. Such modules facilitate the study of biological processes by deconstructing complex biological networks into conceptually simple entities. The definition of network modules is often based on intuitive reasoning. As an alternative, methods are being developed for defining biochemical network modules in an unbiased fashion. These unbiased network modules are mathematically derived from the structure of the whole network under consideration.
Introduction to computer networking
Robertazzi, Thomas G
2017-01-01
This book gives a broad look at both fundamental networking technology and new areas that support it and use it. It is a concise introduction to the most prominent, recent technological topics in computer networking. Topics include network technology such as wired and wireless networks, enabling technologies such as data centers, software defined networking, cloud and grid computing and applications such as networks on chips, space networking and network security. The accessible writing style and non-mathematical treatment makes this a useful book for the student, network and communications engineer, computer scientist and IT professional. • Features a concise, accessible treatment of computer networking, focusing on new technological topics; • Provides non-mathematical introduction to networks in their most common forms today;< • Includes new developments in switching, optical networks, WiFi, Bluetooth, LTE, 5G, and quantum cryptography.
Understanding resilience in industrial symbiosis networks: insights from network analysis.
Chopra, Shauhrat S; Khanna, Vikas
2014-08-01
Industrial symbiotic networks are based on the principles of ecological systems where waste equals food, to develop synergistic networks. For example, industrial symbiosis (IS) at Kalundborg, Denmark, creates an exchange network of waste, water, and energy among companies based on contractual dependency. Since most of the industrial symbiotic networks are based on ad-hoc opportunities rather than strategic planning, gaining insight into disruptive scenarios is pivotal for understanding the balance of resilience and sustainability and developing heuristics for designing resilient IS networks. The present work focuses on understanding resilience as an emergent property of an IS network via a network-based approach with application to the Kalundborg Industrial Symbiosis (KIS). Results from network metrics and simulated disruptive scenarios reveal Asnaes power plant as the most critical node in the system. We also observe a decrease in the vulnerability of nodes and reduction in single points of failure in the system, suggesting an increase in the overall resilience of the KIS system from 1960 to 2010. Based on our findings, we recommend design strategies, such as increasing diversity, redundancy, and multi-functionality to ensure flexibility and plasticity, to develop resilient and sustainable industrial symbiotic networks. Copyright © 2014 Elsevier Ltd. All rights reserved.
Network Experiences Lead to the Adaption of a Firm’s Network Competence
Directory of Open Access Journals (Sweden)
Bianka Kühne
2011-12-01
Full Text Available Networks become increasingly important as external sources of innovation for firms. Through networks firms get incontact with different actors with whom they can exchange information and collaborate. A firm’s ability to be asuccessful network actor depends on its network competence. This term can be defined as having the necessaryknowledge, skills and qualifications for networking as well as using them effectively. In this paper we investigate thelink between a firm’s network competence and the benefits resulting from it in a two‐way direction. First, thenetwork competence of the firm facilitates the adoption of information from other network actors which may leadto innovation success. Second the perceived network benefits shall in their turn influence the network competenceof the firm. Consequently, firms will adapt their network strategy corresponding their experiences. The objective ofthis paper is to investigate the dynamics of networking and its influence on the firm’s network competence. For thisexploratory research 3 Belgian networks are examined. In‐depth interviews are used in combination with semistructuredinterview guides to conduct the research. Our results indicate that some firms perceive benefits fromtheir network efforts, for others it is more a burden. Furthermore, in some of our cases we found that positiveexperiences with clear benefits motivate the firm to enhance its network competence. This is illustrated by the factthat collaborations are more frequently initiated, trust is more easily build, firms are more open to communicateinformation and the confidentiality threshold is overcome.
Cavalcanti, Tiago V. V.; Giannitsarou, Chryssi; Johnson, Charles R.
2016-01-01
This is the final version of the article. It first appeared from Springer via http://dx.doi.org/10.1007/s00199-016-0992-1 We define a measure of network cohesion and show how it arises naturally in a broad class of dynamic models of endogenous perpetual growth with network externalities. Via a standard growth model, we show why network cohesion is crucial for conditional convergence and explain that as cohesion increases, convergence is faster. We prove properties of network cohesion and d...
Ecological network analysis for a virtual water network.
Fang, Delin; Chen, Bin
2015-06-02
The notions of virtual water flows provide important indicators to manifest the water consumption and allocation between different sectors via product transactions. However, the configuration of virtual water network (VWN) still needs further investigation to identify the water interdependency among different sectors as well as the network efficiency and stability in a socio-economic system. Ecological network analysis is chosen as a useful tool to examine the structure and function of VWN and the interactions among its sectors. A balance analysis of efficiency and redundancy is also conducted to describe the robustness (RVWN) of VWN. Then, network control analysis and network utility analysis are performed to investigate the dominant sectors and pathways for virtual water circulation and the mutual relationships between pairwise sectors. A case study of the Heihe River Basin in China shows that the balance between efficiency and redundancy is situated on the left side of the robustness curve with less efficiency and higher redundancy. The forestation, herding and fishing sectors and industrial sectors are found to be the main controllers. The network tends to be more mutualistic and synergic, though some competitive relationships that weaken the virtual water circulation still exist.
Network motif frequency vectors reveal evolving metabolic network organisation.
Pearcy, Nicole; Crofts, Jonathan J; Chuzhanova, Nadia
2015-01-01
At the systems level many organisms of interest may be described by their patterns of interaction, and as such, are perhaps best characterised via network or graph models. Metabolic networks, in particular, are fundamental to the proper functioning of many important biological processes, and thus, have been widely studied over the past decade or so. Such investigations have revealed a number of shared topological features, such as a short characteristic path-length, large clustering coefficient and hierarchical modular structure. However, the extent to which evolutionary and functional properties of metabolism manifest via this underlying network architecture remains unclear. In this paper, we employ a novel graph embedding technique, based upon low-order network motifs, to compare metabolic network structure for 383 bacterial species categorised according to a number of biological features. In particular, we introduce a new global significance score which enables us to quantify important evolutionary relationships that exist between organisms and their physical environments. Using this new approach, we demonstrate a number of significant correlations between environmental factors, such as growth conditions and habitat variability, and network motif structure, providing evidence that organism adaptability leads to increased complexities in the resultant metabolic networks.
Logistical networking: a global storage network
International Nuclear Information System (INIS)
Beck, Micah; Moore, Terry
2005-01-01
The absence of an adequate distributed storage infrastructure for data buffering has become a significant impediment to the flow of work in the wide area, data intensive collaborations that are increasingly characteristic of leading edge research in several fields. One solution to this problem, pioneered under DOE's SciDAC program, is Logistical Networking, which provides a framework for a globally scalable, maximally interoperable storage network based on the Internet Backplane Protocol (IBP). This paper provides a brief overview of the Logistical Networking (LN) architecture, the middleware developed to exploit its value, and a few of the applications that some of research communities have made of it
Evaluating the Limits of Network Topology Inference Via Virtualized Network Emulation
2015-06-01
virtualized environment. First, we automatically build topological ground truth according to various network generation models and create emulated Cisco ...to various network generation models and create emulated Cisco router networks by leveraging and modifying existing emulation software. We then au... markets , to verifying compliance with policy, as in recent “network neutrality” rules established in the United States. The Internet is a network of
International Nuclear Information System (INIS)
Max, G
2011-01-01
Traffic models in computer networks can be described as a complicated system. These systems show non-linear features and to simulate behaviours of these systems are also difficult. Before implementing network equipments users wants to know capability of their computer network. They do not want the servers to be overloaded during temporary traffic peaks when more requests arrive than the server is designed for. As a starting point for our study a non-linear system model of network traffic is established to exam behaviour of the network planned. The paper presents setting up a non-linear simulation model that helps us to observe dataflow problems of the networks. This simple model captures the relationship between the competing traffic and the input and output dataflow. In this paper, we also focus on measuring the bottleneck of the network, which was defined as the difference between the link capacity and the competing traffic volume on the link that limits end-to-end throughput. We validate the model using measurements on a working network. The results show that the initial model estimates well main behaviours and critical parameters of the network. Based on this study, we propose to develop a new algorithm, which experimentally determines and predict the available parameters of the network modelled.
Zheng, Jun; Ansari, Nirwan
2005-06-01
Call for Papers: Optical Access Networks With the wide deployment of fiber-optic technology over the past two decades, we have witnessed a tremendous growth of bandwidth capacity in the backbone networks of today's telecommunications infrastructure. However, access networks, which cover the "last-mile" areas and serve numerous residential and small business users, have not been scaled up commensurately. The local subscriber lines for telephone and cable television are still using twisted pairs and coaxial cables. Most residential connections to the Internet are still through dial-up modems operating at a low speed on twisted pairs. As the demand for access bandwidth increases with emerging high-bandwidth applications, such as distance learning, high-definition television (HDTV), and video on demand (VoD), the last-mile access networks have become a bandwidth bottleneck in today's telecommunications infrastructure. To ease this bottleneck, it is imperative to provide sufficient bandwidth capacity in the access networks to open the bottleneck and thus present more opportunities for the provisioning of multiservices. Optical access solutions promise huge bandwidth to service providers and low-cost high-bandwidth services to end users and are therefore widely considered the technology of choice for next-generation access networks. To realize the vision of optical access networks, however, many key issues still need to be addressed, such as network architectures, signaling protocols, and implementation standards. The major challenges lie in the fact that an optical solution must be not only robust, scalable, and flexible, but also implemented at a low cost comparable to that of existing access solutions in order to increase the economic viability of many potential high-bandwidth applications. In recent years, optical access networks have been receiving tremendous attention from both academia and industry. A large number of research activities have been carried out or
Security-Enhanced Autonomous Network Management for Space Networking, Phase II
National Aeronautics and Space Administration — NASA's Space Communications and Navigation (SCaN) program is integrating its three current agency networks: Space Network (SN), Deep Space Network (DSN), and Near...
WDM Core Networks : regenerator placement and green networking
Youssef , Mayssa
2011-01-01
As Operators strive today to optimize their networks, considerations of cost, availability, eco-sustainability, and quality of service are beginning to converge. Solutions that reduce capital and operational expenditures not only save money, but also tend to reduce the environmental impact. In "opaque" networks, optical signals undergo expensive electrical regeneration systematically at each node. In "transparent" networks, signal quality deteriorates due to the accumulation of physical impai...
2007-01-01
In order to optimize the management of the Technical Network (TN), to ease the understanding and purpose of devices connected to the TN, and to improve security incident handling, the Technical Network Administrators and the CNIC WG have asked IT/CS to verify the "description" and "tag" fields of devices connected to the TN. Therefore, persons responsible for systems connected to the TN will receive email notifications from IT/CS asking them to add the corresponding information in the network database. Thank you very much for your cooperation. The Technical Network Administrators & the CNIC WG
Enhancing Sensor Network Data Quality via Collaborated Circuit and Network Operations
Directory of Open Access Journals (Sweden)
Lucas Vespa
2013-04-01
Full Text Available In many applications, the quality of data gathered by sensor networks is directly related to the signal-to-noise ratio (SNR of the sensor data being transmitted in the networks. Different from the SNR that is often used in measuring the quality of communication links, the SNR used in this work measures how accurately the data in the network packets represent the physical parameters being sensed. Hence, the signal here refers to the physical parameters that are being monitored by sensor networks; the noise is due to environmental interference and circuit noises at sensor nodes, and packet loss during network transmission. While issues affecting SNR at sensor nodes have been intensively investigated, the impact of network packet loss on data SNR has not attracted significant attention in sensor network design. This paper investigates the impact of packet loss on sensor network data SNR and shows that data SNR is dramatically affected by network packet loss. A data quality metric, based on data SNR, is developed and a cross-layer adaptive scheme is presented to minimize data quality degradation in congested sensor networks. The proposed scheme consists of adaptive downsampling and bit truncation at sensor nodes and intelligent traffic management techniques at the network level. Simulation results are presented to demonstrate the validity and effectiveness of the proposed techniques.
Bhanot, Gyan [Princeton, NJ; Blumrich, Matthias A [Ridgefield, CT; Chen, Dong [Croton On Hudson, NY; Coteus, Paul W [Yorktown Heights, NY; Gara, Alan G [Mount Kisco, NY; Giampapa, Mark E [Irvington, NY; Heidelberger, Philip [Cortlandt Manor, NY; Steinmacher-Burow, Burkhard D [Mount Kisco, NY; Takken, Todd E [Mount Kisco, NY; Vranas, Pavlos M [Bedford Hills, NY
2009-09-08
Class network routing is implemented in a network such as a computer network comprising a plurality of parallel compute processors at nodes thereof. Class network routing allows a compute processor to broadcast a message to a range (one or more) of other compute processors in the computer network, such as processors in a column or a row. Normally this type of operation requires a separate message to be sent to each processor. With class network routing pursuant to the invention, a single message is sufficient, which generally reduces the total number of messages in the network as well as the latency to do a broadcast. Class network routing is also applied to dense matrix inversion algorithms on distributed memory parallel supercomputers with hardware class function (multicast) capability. This is achieved by exploiting the fact that the communication patterns of dense matrix inversion can be served by hardware class functions, which results in faster execution times.
Properties of healthcare teaming networks as a function of network construction algorithms.
Directory of Open Access Journals (Sweden)
Martin S Zand
Full Text Available Network models of healthcare systems can be used to examine how providers collaborate, communicate, refer patients to each other, and to map how patients traverse the network of providers. Most healthcare service network models have been constructed from patient claims data, using billing claims to link a patient with a specific provider in time. The data sets can be quite large (106-108 individual claims per year, making standard methods for network construction computationally challenging and thus requiring the use of alternate construction algorithms. While these alternate methods have seen increasing use in generating healthcare networks, there is little to no literature comparing the differences in the structural properties of the generated networks, which as we demonstrate, can be dramatically different. To address this issue, we compared the properties of healthcare networks constructed using different algorithms from 2013 Medicare Part B outpatient claims data. Three different algorithms were compared: binning, sliding frame, and trace-route. Unipartite networks linking either providers or healthcare organizations by shared patients were built using each method. We find that each algorithm produced networks with substantially different topological properties, as reflected by numbers of edges, network density, assortativity, clustering coefficients and other structural measures. Provider networks adhered to a power law, while organization networks were best fit by a power law with exponential cutoff. Censoring networks to exclude edges with less than 11 shared patients, a common de-identification practice for healthcare network data, markedly reduced edge numbers and network density, and greatly altered measures of vertex prominence such as the betweenness centrality. Data analysis identified patterns in the distance patients travel between network providers, and a striking set of teaming relationships between providers in the Northeast
An examination of a reciprocal relationship between network governance and network structure
DEFF Research Database (Denmark)
Bergenholtz, Carsten; Goduscheit, René Chester
2011-01-01
In the present article, we examine the network structure and governance of inter-organisational innovation networks over time. Network governance refers to the issue of how to manage and coordinate the relational activities and processes in the network while research on network structure deals...
Correlations in star networks: from Bell inequalities to network inequalities
International Nuclear Information System (INIS)
Tavakoli, Armin; Renou, Marc Olivier; Gisin, Nicolas; Brunner, Nicolas
2017-01-01
The problem of characterizing classical and quantum correlations in networks is considered. Contrary to the usual Bell scenario, where distant observers share a physical system emitted by one common source, a network features several independent sources, each distributing a physical system to a subset of observers. In the quantum setting, the observers can perform joint measurements on initially independent systems, which may lead to strong correlations across the whole network. In this work, we introduce a technique to systematically map a Bell inequality to a family of Bell-type inequalities bounding classical correlations on networks in a star-configuration. Also, we show that whenever a given Bell inequality can be violated by some entangled state ρ , then all the corresponding network inequalities can be violated by considering many copies of ρ distributed in the star network. The relevance of these ideas is illustrated by applying our method to a specific multi-setting Bell inequality. We derive the corresponding network inequalities, and study their quantum violations. (paper)
Robust Learning of High-dimensional Biological Networks with Bayesian Networks
Nägele, Andreas; Dejori, Mathäus; Stetter, Martin
Structure learning of Bayesian networks applied to gene expression data has become a potentially useful method to estimate interactions between genes. However, the NP-hardness of Bayesian network structure learning renders the reconstruction of the full genetic network with thousands of genes unfeasible. Consequently, the maximal network size is usually restricted dramatically to a small set of genes (corresponding with variables in the Bayesian network). Although this feature reduction step makes structure learning computationally tractable, on the downside, the learned structure might be adversely affected due to the introduction of missing genes. Additionally, gene expression data are usually very sparse with respect to the number of samples, i.e., the number of genes is much greater than the number of different observations. Given these problems, learning robust network features from microarray data is a challenging task. This chapter presents several approaches tackling the robustness issue in order to obtain a more reliable estimation of learned network features.
Structural Behavioral Study on the General Aviation Network Based on Complex Network
Zhang, Liang; Lu, Na
2017-12-01
The general aviation system is an open and dissipative system with complex structures and behavioral features. This paper has established the system model and network model for general aviation. We have analyzed integral attributes and individual attributes by applying the complex network theory and concluded that the general aviation network has influential enterprise factors and node relations. We have checked whether the network has small world effect, scale-free property and network centrality property which a complex network should have by applying degree distribution of functions and proved that the general aviation network system is a complex network. Therefore, we propose to achieve the evolution process of the general aviation industrial chain to collaborative innovation cluster of advanced-form industries by strengthening network multiplication effect, stimulating innovation performance and spanning the structural hole path.
Shared protection based virtual network mapping in space division multiplexing optical networks
Zhang, Huibin; Wang, Wei; Zhao, Yongli; Zhang, Jie
2018-05-01
Space Division Multiplexing (SDM) has been introduced to improve the capacity of optical networks. In SDM optical networks, there are multiple cores/modes in each fiber link, and spectrum resources are multiplexed in both frequency and core/modes dimensions. Enabled by network virtualization technology, one SDM optical network substrate can be shared by several virtual networks operators. Similar with point-to-point connection services, virtual networks (VN) also need certain survivability to guard against network failures. Based on customers' heterogeneous requirements on the survivability of their virtual networks, this paper studies the shared protection based VN mapping problem and proposes a Minimum Free Frequency Slots (MFFS) mapping algorithm to improve spectrum efficiency. Simulation results show that the proposed algorithm can optimize SDM optical networks significantly in terms of blocking probability and spectrum utilization.
DEFF Research Database (Denmark)
2015-01-01
Fulcrum network codes, which are a network coding framework, achieve three objectives: (i) to reduce the overhead per coded packet to almost 1 bit per source packet; (ii) to operate the network using only low field size operations at intermediate nodes, dramatically reducing complexity...... in the network; and (iii) to deliver an end-to-end performance that is close to that of a high field size network coding system for high-end receivers while simultaneously catering to low-end ones that can only decode in a lower field size. Sources may encode using a high field size expansion to increase...... the number of dimensions seen by the network using a linear mapping. Receivers can tradeoff computational effort with network delay, decoding in the high field size, the low field size, or a combination thereof....
DEFF Research Database (Denmark)
Samson, Audrey; Soon, Winnie
2015-01-01
This paper examines the notion of network affordance within the context of network art. Building on Gibson's theory (Gibson, 1979) we understand affordance as the perceived and actual parameters of a thing. We expand on Gaver's affordance of predictability (Gaver, 1996) to include ecological...... and computational parameters of unpredictability. We illustrate the notion of unpredictability by considering four specific works that were included in a network art exhibiton, SPEED SHOW [2.0] Hong Kong. The paper discusses how the artworks are contingent upon the parameteric relations (Parisi, 2013......), of the network. We introduce network affordance as a dynamic framework that could articulate the experienced tension arising from the (visible) symbolic representation of computational processes and its hidden occurrences. We base our proposal on the experience of both organising the SPEED SHOW and participating...
A Quantum Cryptography Communication Network Based on Software Defined Network
Directory of Open Access Journals (Sweden)
Zhang Hongliang
2018-01-01
Full Text Available With the development of the Internet, information security has attracted great attention in today’s society, and quantum cryptography communication network based on quantum key distribution (QKD is a very important part of this field, since the quantum key distribution combined with one-time-pad encryption scheme can guarantee the unconditional security of the information. The secret key generated by quantum key distribution protocols is a very valuable resource, so making full use of key resources is particularly important. Software definition network (SDN is a new type of network architecture, and it separates the control plane and the data plane of network devices through OpenFlow technology, thus it realizes the flexible control of the network resources. In this paper, a quantum cryptography communication network model based on SDN is proposed to realize the flexible control of quantum key resources in the whole cryptography communication network. Moreover, we propose a routing algorithm which takes into account both the hops and the end-to-end availible keys, so that the secret key generated by QKD can be used effectively. We also simulate this quantum cryptography communication network, and the result shows that based on SDN and the proposed routing algorithm the performance of this network is improved since the effective use of the quantum key resources.
Analyzing the factors affecting network lifetime cluster-based wireless sensor network
International Nuclear Information System (INIS)
Malik, A.S.; Qureshi, A.
2010-01-01
Cluster-based wireless sensor networks enable the efficient utilization of the limited energy resources of the deployed sensor nodes and hence prolong the node as well as network lifetime. Low Energy Adaptive Clustering Hierarchy (Leach) is one of the most promising clustering protocol proposed for wireless sensor networks. This paper provides the energy utilization and lifetime analysis for cluster-based wireless sensor networks based upon LEACH protocol. Simulation results identify some important factors that induce unbalanced energy utilization between the sensor nodes and hence affect the network lifetime in these types of networks. These results highlight the need for a standardized, adaptive and distributed clustering technique that can increase the network lifetime by further balancing the energy utilization among sensor nodes. (author)
A Network Primer: Full-Fledged Educational Networks.
Lehrer, Ariella
1988-01-01
Discusses some of the factors included in choosing appropriate computer networks for the classroom. Describes such networks as those produced by Apple Computer, Corvus Systems, Velan, Berkeley Softworks, Tandy, LAN-TECH, Unisys, and International Business Machines (IBM). (TW)
Network on Target: Remotely Configured Adaptive Tactical Networks
National Research Council Canada - National Science Library
Bordetsky, Alex; Bourakov, Eugene
2006-01-01
The emerging tactical networks represent complex network-centric systems, in which multiple sensors, unmanned vehicles, and geographically distributed units of highly mobile decision makers, transfer...
Network planning study of the metro-optical-network-oriented 3G application
Gong, Qian; Xu, Rong; Lin, Jin Tong
2005-02-01
To compare with the 2G mobile communication, 3G technologies can supply the perfect service scope and performance. 3G is the trend of the mobile communication. So now to build the transmission network, it is needed to consider how the transmission network to support the 3G applications. For the 3G network architecture, it include the 2 part: Utran access network and core network. So the metro optical network should consider how to build the network to adapt the 3G applications. Include the metro core and access layer. In the metro core, we should consider the network should evolved towards the Mesh architecture with ASON function to realize the fast protection and restoration, quick end-to-end service provision, and high capacity cross-connect matrix etc. In the access layer, the network should have the ability to access the 3G services such as ATM interface with IMA function. In addition, the traffic grooming should be provided to improve the bandwidth utility. In this paper, first we present the MCC network situation, the network planning model will be introduced. Then we present the topology architecture, node capacity and traffic forecast. At last, based on our analysis, we will give a total solution to MCC to build their metro optical network toward to the mesh network with the consideration of 3G services.
Optical network democratization.
Nejabati, Reza; Peng, Shuping; Simeonidou, Dimitra
2016-03-06
The current Internet infrastructure is not able to support independent evolution and innovation at physical and network layer functionalities, protocols and services, while at same time supporting the increasing bandwidth demands of evolving and heterogeneous applications. This paper addresses this problem by proposing a completely democratized optical network infrastructure. It introduces the novel concepts of the optical white box and bare metal optical switch as key technology enablers for democratizing optical networks. These are programmable optical switches whose hardware is loosely connected internally and is completely separated from their control software. To alleviate their complexity, a multi-dimensional abstraction mechanism using software-defined network technology is proposed. It creates a universal model of the proposed switches without exposing their technological details. It also enables a conventional network programmer to develop network applications for control of the optical network without specific technical knowledge of the physical layer. Furthermore, a novel optical network virtualization mechanism is proposed, enabling the composition and operation of multiple coexisting and application-specific virtual optical networks sharing the same physical infrastructure. Finally, the optical white box and the abstraction mechanism are experimentally evaluated, while the virtualization mechanism is evaluated with simulation. © 2016 The Author(s).
Community Detection for Multiplex Social Networks Based on Relational Bayesian Networks
DEFF Research Database (Denmark)
Jiang, Jiuchuan; Jaeger, Manfred
2014-01-01
Many techniques have been proposed for community detection in social networks. Most of these techniques are only designed for networks defined by a single relation. However, many real networks are multiplex networks that contain multiple types of relations and different attributes on the nodes...
Networks of networks the last frontier of complexity
Scala, Antonio
2014-01-01
The present work is meant as a reference to provide an organic and comprehensive view of the most relevant results in the exciting new field of Networks of Networks (NetoNets). Seminal papers have recently been published posing the basis to study what happens when different networks interact, thus providing evidence for the emergence of new, unexpected behaviors and vulnerabilities. From those seminal works, the awareness on the importance understanding Networks of Networks (NetoNets) has spread to the entire community of Complexity Science. The reader will benefit from the experience of some of the most well-recognized leaders in this field. The contents have been aggregated under four headings; General Theory, Phenomenology, Applications and Risk Assessment. The reader will be impressed by the different applications of the general paradigm that span from physiology, to financial risk, to transports. We are currently making the first steps to reduce the distance between the language and the way of thinking o...
Evsukoff, Alexandre; González, Marta
2013-01-01
In the last decade we have seen the emergence of a new inter-disciplinary field focusing on the understanding of networks which are dynamic, large, open, and have a structure sometimes called random-biased. The field of Complex Networks is helping us better understand many complex phenomena such as the spread of deseases, protein interactions, social relationships, to name but a few. Studies in Complex Networks are gaining attention due to some major scientific breakthroughs proposed by network scientists helping us understand and model interactions contained in large datasets. In fact, if we could point to one event leading to the widespread use of complex network analysis is the availability of online databases. Theories of Random Graphs from Erdös and Rényi from the late 1950s led us to believe that most networks had random characteristics. The work on large online datasets told us otherwise. Starting with the work of Barabási and Albert as well as Watts and Strogatz in the late 1990s, we now know th...
Networking Ethics: A Survey of Bioethics Networks Across the U.S.
Fausett, Jennifer Kleiner; Gilmore-Szott, Eleanor; Hester, D Micah
2016-06-01
Ethics networks have emerged over the last few decades as a mechanism for individuals and institutions over various regions, cities and states to converge on healthcare-related ethical issues. However, little is known about the development and nature of such networks. In an effort to fill the gap in the knowledge about such networks, a survey was conducted that evaluated the organizational structure, missions and functions, as well as the outcomes/products of ethics networks across the country. Eighteen established bioethics networks were identified via consensus of three search processes and were approached for participation. The participants completed a survey developed for the purposes of this study and distributed via SurveyMonkey. Responses were obtained from 10 of the 18 identified and approached networks regarding topic areas of: Network Composition and Catchment Areas; Network Funding and Expenses; Personnel; Services; and Missions and Accomplishments. Bioethics networks are designed primarily to bring ethics education and support to professionals and hospitals. They do so over specifically defined areas-states, regions, or communities-and each is concerned about how to stay financially healthy. At the same time, the networks work off different organizational models, either as stand-alone organizations or as entities within existing organizational structures.
In-network adaptation of SHVC video in software-defined networks
Awobuluyi, Olatunde; Nightingale, James; Wang, Qi; Alcaraz Calero, Jose Maria; Grecos, Christos
2016-04-01
Software Defined Networks (SDN), when combined with Network Function Virtualization (NFV) represents a paradigm shift in how future networks will behave and be managed. SDN's are expected to provide the underpinning technologies for future innovations such as 5G mobile networks and the Internet of Everything. The SDN architecture offers features that facilitate an abstracted and centralized global network view in which packet forwarding or dropping decisions are based on application flows. Software Defined Networks facilitate a wide range of network management tasks, including the adaptation of real-time video streams as they traverse the network. SHVC, the scalable extension to the recent H.265 standard is a new video encoding standard that supports ultra-high definition video streams with spatial resolutions of up to 7680×4320 and frame rates of 60fps or more. The massive increase in bandwidth required to deliver these U-HD video streams dwarfs the bandwidth requirements of current high definition (HD) video. Such large bandwidth increases pose very significant challenges for network operators. In this paper we go substantially beyond the limited number of existing implementations and proposals for video streaming in SDN's all of which have primarily focused on traffic engineering solutions such as load balancing. By implementing and empirically evaluating an SDN enabled Media Adaptation Network Entity (MANE) we provide a valuable empirical insight into the benefits and limitations of SDN enabled video adaptation for real time video applications. The SDN-MANE is the video adaptation component of our Video Quality Assurance Manager (VQAM) SDN control plane application, which also includes an SDN monitoring component to acquire network metrics and a decision making engine using algorithms to determine the optimum adaptation strategy for any real time video application flow given the current network conditions. Our proposed VQAM application has been implemented and
ATM Tactical Network - a challenge for the military networks
Waveren, C.J. van; Luiijf, H.A.M.; Burakowski, W.; Kopertowski, Z.
1997-01-01
The next generation of tactical networks will be based on the ATM technology. The POST-2000 tactical network is just in the designing phase. The objective of this paper is to point out the main problems which should be solved to adopt ATM technology into the tactical network environment. The
Spectral Analysis of Rich Network Topology in Social Networks
Wu, Leting
2013-01-01
Social networks have received much attention these days. Researchers have developed different methods to study the structure and characteristics of the network topology. Our focus is on spectral analysis of the adjacency matrix of the underlying network. Recent work showed good properties in the adjacency spectral space but there are few…
Promoting Social Network Awareness: A Social Network Monitoring System
Cadima, Rita; Ferreira, Carlos; Monguet, Josep; Ojeda, Jordi; Fernandez, Joaquin
2010-01-01
To increase communication and collaboration opportunities, members of a community must be aware of the social networks that exist within that community. This paper describes a social network monitoring system--the KIWI system--that enables users to register their interactions and visualize their social networks. The system was implemented in a…
Knowledge, attitudes and practices of local inhabitants about ...
African Journals Online (AJOL)
Objective: The present study was conducted to assess the knowledge, attitudes and practices of local residents about insecticide treated nets (ITNs) for malaria control in an endemic area of Ethiopia Methods: A descriptive cross-survey was conducted from July 2008 to September 2008. A structured questionnaire collecting ...
ter Kuile, Feiko O.; Terlouw, Dianne J.; Kariuki, Simon K.; Phillips-Howard, Penelope A.; Mirel, Lisa B.; Hawley, William A.; Friedman, Jennifer F.; Shi, Ya Ping; Kolczak, Margarette S.; Lal, Altaf A.; Vulule, John M.; Nahlen, Bernard L.
2003-01-01
As part of a community-based, group-randomized, controlled trial of insecticide-treated bed nets (ITNs) in an area with intense malaria transmission in western Kenya, a birth cohort (n = 833) was followed monthly until the age of 24 months to determine the potential beneficial and adverse effects of
Optimal Network-Topology Design
Li, Victor O. K.; Yuen, Joseph H.; Hou, Ting-Chao; Lam, Yuen Fung
1987-01-01
Candidate network designs tested for acceptability and cost. Optimal Network Topology Design computer program developed as part of study on topology design and analysis of performance of Space Station Information System (SSIS) network. Uses efficient algorithm to generate candidate network designs consisting of subsets of set of all network components, in increasing order of total costs and checks each design to see whether it forms acceptable network. Technique gives true cost-optimal network and particularly useful when network has many constraints and not too many components. Program written in PASCAL.
Integrating Networking into ATLAS
Mc Kee, Shawn Patrick; The ATLAS collaboration
2018-01-01
Networking is foundational to the ATLAS distributed infrastructure and there are many ongoing activities related to networking both within and outside of ATLAS. We will report on the progress in a number of areas exploring ATLAS's use of networking and our ability to monitor the network, analyze metrics from the network, and tune and optimize application and end-host parameters to make the most effective use of the network. Specific topics will include work on Open vSwitch for production systems, network analytics, FTS testing and tuning, and network problem alerting and alarming.
Autonomous vision networking: miniature wireless sensor networks with imaging technology
Messinger, Gioia; Goldberg, Giora
2006-09-01
The recent emergence of integrated PicoRadio technology, the rise of low power, low cost, System-On-Chip (SOC) CMOS imagers, coupled with the fast evolution of networking protocols and digital signal processing (DSP), created a unique opportunity to achieve the goal of deploying large-scale, low cost, intelligent, ultra-low power distributed wireless sensor networks for the visualization of the environment. Of all sensors, vision is the most desired, but its applications in distributed sensor networks have been elusive so far. Not any more. The practicality and viability of ultra-low power vision networking has been proven and its applications are countless, from security, and chemical analysis to industrial monitoring, asset tracking and visual recognition, vision networking represents a truly disruptive technology applicable to many industries. The presentation discusses some of the critical components and technologies necessary to make these networks and products affordable and ubiquitous - specifically PicoRadios, CMOS imagers, imaging DSP, networking and overall wireless sensor network (WSN) system concepts. The paradigm shift, from large, centralized and expensive sensor platforms, to small, low cost, distributed, sensor networks, is possible due to the emergence and convergence of a few innovative technologies. Avaak has developed a vision network that is aided by other sensors such as motion, acoustic and magnetic, and plans to deploy it for use in military and commercial applications. In comparison to other sensors, imagers produce large data files that require pre-processing and a certain level of compression before these are transmitted to a network server, in order to minimize the load on the network. Some of the most innovative chemical detectors currently in development are based on sensors that change color or pattern in the presence of the desired analytes. These changes are easily recorded and analyzed by a CMOS imager and an on-board DSP processor
Network Transformations in Economy
Directory of Open Access Journals (Sweden)
Bolychev O.
2014-09-01
Full Text Available In the context of ever-increasing market competition, networked interactions play a special role in the economy. The network form of entrepreneurship is increasingly viewed as an effective organizational structure to create a market value embedded in innovative business solutions. The authors study the characteristics of a network as an economic category and emphasize certain similarities between Rus sian and international approaches to identifying interactions of economic systems based on the network principle. The paper focuses on the types of networks widely used in the economy. The authors analyze the transformation of business networks along two lines: from an intra- to an inter-firm network and from an inter-firm to an inter-organizational network. The possible forms of network formation are described depending on the strength of connections and the type of integration. The drivers and reasons behind process of transition from a hierarchical model of the organizational structure to a network type are identified. The authors analyze the advantages of creating inter-firm networks and discuss the features of inter-organizational networks as compares to inter-firm ones. The article summarizes the reasons for and advantages of participation in inter-rganizational networks and identifies the main barriers to the formation of inter-organizational network.
Reliable Communication in Wireless Meshed Networks using Network Coding
DEFF Research Database (Denmark)
Pahlevani, Peyman; Paramanathan, Achuthan; Hundebøll, Martin
2012-01-01
The advantages of network coding have been extensively studied in the field of wireless networks. Integrating network coding with existing IEEE 802.11 MAC layer is a challenging problem. The IEEE 802.11 MAC does not provide any reliability mechanisms for overheard packets. This paper addresses...... this problem and suggests different mechanisms to support reliability as part of the MAC protocol. Analytical expressions to this problem are given to qualify the performance of the modified network coding. These expressions are confirmed by numerical result. While the suggested reliability mechanisms...
Group Centric Networking: Large Scale Over the Air Testing of Group Centric Networking
2016-11-01
Large Scale Over-the-Air Testing of Group Centric Networking Logan Mercer, Greg Kuperman, Andrew Hunter, Brian Proulx MIT Lincoln Laboratory...performance of Group Centric Networking (GCN), a networking protocol developed for robust and scalable communications in lossy networks where users are...devices, and the ad-hoc nature of the network . Group Centric Networking (GCN) is a proposed networking protocol that addresses challenges specific to
A Collaborative Learning Network Approach to Improvement: The CUSP Learning Network.
Weaver, Sallie J; Lofthus, Jennifer; Sawyer, Melinda; Greer, Lee; Opett, Kristin; Reynolds, Catherine; Wyskiel, Rhonda; Peditto, Stephanie; Pronovost, Peter J
2015-04-01
Collaborative improvement networks draw on the science of collaborative organizational learning and communities of practice to facilitate peer-to-peer learning, coaching, and local adaption. Although significant improvements in patient safety and quality have been achieved through collaborative methods, insight regarding how collaborative networks are used by members is needed. Improvement Strategy: The Comprehensive Unit-based Safety Program (CUSP) Learning Network is a multi-institutional collaborative network that is designed to facilitate peer-to-peer learning and coaching specifically related to CUSP. Member organizations implement all or part of the CUSP methodology to improve organizational safety culture, patient safety, and care quality. Qualitative case studies developed by participating members examine the impact of network participation across three levels of analysis (unit, hospital, health system). In addition, results of a satisfaction survey designed to evaluate member experiences were collected to inform network development. Common themes across case studies suggest that members found value in collaborative learning and sharing strategies across organizational boundaries related to a specific improvement strategy. The CUSP Learning Network is an example of network-based collaborative learning in action. Although this learning network focuses on a particular improvement methodology-CUSP-there is clear potential for member-driven learning networks to grow around other methods or topic areas. Such collaborative learning networks may offer a way to develop an infrastructure for longer-term support of improvement efforts and to more quickly diffuse creative sustainment strategies.
Li, Huajiao; An, Haizhong; Wang, Yue; Huang, Jiachen; Gao, Xiangyun
2016-05-01
Keeping abreast of trends in the articles and rapidly grasping a body of article's key points and relationship from a holistic perspective is a new challenge in both literature research and text mining. As the important component, keywords can present the core idea of the academic article. Usually, articles on a single theme or area could share one or some same keywords, and we can analyze topological features and evolution of the articles co-keyword networks and keywords co-occurrence networks to realize the in-depth analysis of the articles. This paper seeks to integrate statistics, text mining, complex networks and visualization to analyze all of the academic articles on one given theme, complex network(s). All 5944 ;complex networks; articles that were published between 1990 and 2013 and are available on the Web of Science are extracted. Based on the two-mode affiliation network theory, a new frontier of complex networks, we constructed two different networks, one taking the articles as nodes, the co-keyword relationships as edges and the quantity of co-keywords as the weight to construct articles co-keyword network, and another taking the articles' keywords as nodes, the co-occurrence relationships as edges and the quantity of simultaneous co-occurrences as the weight to construct keyword co-occurrence network. An integrated method for analyzing the topological features and evolution of the articles co-keyword network and keywords co-occurrence networks is proposed, and we also defined a new function to measure the innovation coefficient of the articles in annual level. This paper provides a useful tool and process for successfully achieving in-depth analysis and rapid understanding of the trends and relationships of articles in a holistic perspective.
Energy Technology Data Exchange (ETDEWEB)
Kalb, Jeffrey L.; Lee, David S.
2008-01-01
Emerging high-bandwidth, low-latency network technology has made network-based architectures both feasible and potentially desirable for use in satellite payload architectures. The selection of network topology is a critical component when developing these multi-node or multi-point architectures. This study examines network topologies and their effect on overall network performance. Numerous topologies were reviewed against a number of performance, reliability, and cost metrics. This document identifies a handful of good network topologies for satellite applications and the metrics used to justify them as such. Since often multiple topologies will meet the requirements of the satellite payload architecture under development, the choice of network topology is not easy, and in the end the choice of topology is influenced by both the design characteristics and requirements of the overall system and the experience of the developer.
Dissemination Patterns and Associated Network Effects of Sentiments in Social Networks
DEFF Research Database (Denmark)
Hillmann, Robert; Trier, Matthias
2012-01-01
. The dissemination patterns analyzed in this study consist of network motifs based on triples of actors and the ties among them. These motifs are associated with common social network effects to derive meaningful insights about dissemination activities. The data basis includes several thousand social networks...... with textual messages classified according to embedded positive and negative sentiments. Based on this data, sub-networks are extracted and analyzed with a dynamic network motif analysis to determine dissemination patterns and associated network effects. Results indicate that the emergence of digital social...... networks exhibits a strong tendency towards reciprocity, followed by the dominance of hierarchy as an intermediate step leading to social clustering with hubs and transitivity effects for both positive and negative sentiments to the same extend. Sentiments embedded in exchanged textual messages do only...
Le Port, Agnès; Watier, Laurence; Cottrell, Gilles; Ouédraogo, Smaila; Dechavanne, Célia; Pierrat, Charlotte; Rachas, Antoine; Bouscaillou, Julie; Bouraima, Aziz; Massougbodji, Achille; Fayomi, Benjamin; Thiébaut, Anne; Chandre, Fabrice; Migot-Nabias, Florence; Martin-Prevel, Yves; Garcia, André; Cot, Michel
2011-01-01
The association between placental malaria (PM) and first peripheral parasitaemias in early infancy was assessed in Tori Bossito, a rural area of Benin with a careful attention on transmission factors at an individual level. Statistical analysis was performed on 550 infants followed weekly from birth to 12 months. Malaria transmission was assessed by anopheles human landing catches every 6 weeks in 36 sampling houses and season defined by rainfall. Each child was located by GPS and assigned to the closest anopheles sampling house. Data were analysed by survival Cox models, stratified on the possession of insecticide-treated mosquito nets (ITNs) at enrolment. Among infants sleeping in a house with an ITN, PM was found to be highly associated to first malaria infections, after adjusting on season, number of anopheles, antenatal care (ANC) visits and maternal severe anaemia. Infants born from a malaria infected placenta had a 2.13 fold increased risk to present a first malaria infection than those born from a non infected placenta ([1.24-3.67], prisk to present a first malaria infection was increased by 3.2 to 6.5, according to the level of anopheles exposure (moderate or high levels, compared to the absence of anopheles). First malaria infections in early childhood can be attributed simultaneously to both PM and high levels of exposure to infected anopheles. Protective measures as Intermittent Preventive Treatment during pregnancy (IPTp) and ITNs, targeted on both mothers and infants should be reinforced, as well as the research on new drugs and insecticides. In parallel, investigations on placental malaria have to be strengthened to better understand the mechanisms involved, and thus to protect adequately the infants high risk group.
Zheng, Jun; Ansari, Nirwan
2005-01-01
Call for Papers: Optical Access Networks Guest Editors Jun Zheng, University of Ottawa Nirwan Ansari, New Jersey Institute of Technology Submission Deadline: 1 June 2005 Background With the wide deployment of fiber-optic technology over the past two decades, we have witnessed a tremendous growth of bandwidth capacity in the backbone networks of today's telecommunications infrastructure. However, access networks, which cover the "last-mile" areas and serve numerous residential and small business users, have not been scaled up commensurately. The local subscriber lines for telephone and cable television are still using twisted pairs and coaxial cables. Most residential connections to the Internet are still through dial-up modems operating at a low speed on twisted pairs. As the demand for access bandwidth increases with emerging high-bandwidth applications, such as distance learning, high-definition television (HDTV), and video on demand (VoD), the last-mile access networks have become a bandwidth bottleneck in today's telecommunications infrastructure. To ease this bottleneck, it is imperative to provide sufficient bandwidth capacity in the access networks to open the bottleneck and thus present more opportunities for the provisioning of multiservices. Optical access solutions promise huge bandwidth to service providers and low-cost high-bandwidth services to end users and are therefore widely considered the technology of choice for next-generation access networks. To realize the vision of optical access networks, however, many key issues still need to be addressed, such as network architectures, signaling protocols, and implementation standards. The major challenges lie in the fact that an optical solution must be not only robust, scalable, and flexible, but also implemented at a low cost comparable to that of existing access solutions in order to increase the economic viability of many potential high-bandwidth applications. In recent years, optical access networks
McKee, Shawn; ATLAS Collaboration
2017-10-01
Networks have played a critical role in high-energy physics (HEP), enabling us to access and effectively utilize globally distributed resources to meet the needs of our physicists. Because of their importance in enabling our grid computing infrastructure many physicists have taken leading roles in research and education (R&E) networking, participating in, and even convening, network related meetings and research programs with the broader networking community worldwide. This has led to HEP benefiting from excellent global networking capabilities for little to no direct cost. However, as other science domains ramp-up their need for similar networking it becomes less clear that this situation will continue unchanged. What this means for ATLAS in particular needs to be understood. ATLAS has evolved its computing model since the LHC started based upon its experience with using globally distributed resources. The most significant theme of those changes has been increased reliance upon, and use of, its networks. We will report on a number of networking initiatives in ATLAS including participation in the global perfSONAR network monitoring and measuring efforts of WLCG and OSG, the collaboration with the LHCOPN/LHCONE effort, the integration of network awareness into PanDA, the use of the evolving ATLAS analytics framework to better understand our networks and the changes in our DDM system to allow remote access to data. We will also discuss new efforts underway that are exploring the inclusion and use of software defined networks (SDN) and how ATLAS might benefit from: • Orchestration and optimization of distributed data access and data movement. • Better control of workflows, end to end. • Enabling prioritization of time-critical vs normal tasks • Improvements in the efficiency of resource usage
Identity and Professional Networking.
Raj, Medha; Fast, Nathanael J; Fisher, Oliver
2017-06-01
Despite evidence that large professional networks afford a host of financial and professional benefits, people vary in how motivated they are to build such networks. To help explain this variance, the present article moves beyond a rational self-interest account to examine the possibility that identity shapes individuals' intentions to network. Study 1 established a positive association between viewing professional networking as identity-congruent and the tendency to prioritize strengthening and expanding one's professional network. Study 2 revealed that manipulating the salience of the self affects networking intentions, but only among those high in networking identity-congruence. Study 3 further established causality by experimentally manipulating identity-congruence to increase networking intentions. Study 4 examined whether identity or self-interest is a better predictor of networking intentions, providing support for the former. These findings indicate that identity influences the networks people develop. Implications for research on the self, identity-based motivation, and professional networking are discussed.
Plaßmann, Wilfried
Zweitore (nach DIN 4899; alte Bezeichnung "Vierpole") sind Funktionseinheiten mit zwei Toren, wobei zu jedem Tor ein Klemmenpaar gehört. An eines der Tore wird das Eingangssignal angeschlossen, die zugehörigen Anschlüsse werden mit Eingangsklemmen bezeichnet. Entsprechend wird an den zwei Ausgangsklemmen das Ausgangssignal abgegriffen. Eventuell erforderliche Anschlüsse für eine Stromversorgung werden nicht mitgezählt. Der interne Aufbau besteht aus einer beliebigen Zusammenschaltung von Widerständen, Kondensatoren, Spulen, Transformatoren, Dioden, Transistoren usw. Es wird vorausgesetzt, dass die Zweitore zeitinvariant sind, d. h. die Eigenschaften hängen nicht von der Zeit ab.
Hydrogen mobility is moving forward; Wasserstoff-Mobilitaet kommt voran
Energy Technology Data Exchange (ETDEWEB)
Fernandez Duran, Andres [Air Liquide Deutschland GmbH, Duesseldorf (Germany)
2013-06-15
The European Union (EU) declared aim is to cover at least 20 percent of energy needs from alternative sources until 2020. EU as well as federal and state governments promote various projects, to establish hydrogen as an energy carrier. Air Liquide participates by setting up a hydrogen infrastructure in this future project. [German] Erklaertes Ziel der Europaeischen Union (EU) ist es, bis 2020 mindestens 20 Prozent des Energiebedarfs aus alternativen Quellen zu decken. Dazu foerdern EU sowie Bund und Laender verschiedene Projekte, die Wasserstoff als Energietraeger etablieren sollen. Air Liquide beteiligt sich durch Mitarbeit am Aufbau einer Wasserstoff-Infrastruktur an diesem Zukunftsvorhaben.
Moderne mathematische Methoden der Physik
Goldhorn, Karl-Heinz; Kraus, Margarita
2010-01-01
Der große Vorzug dieses Lehrbuchs liegt in seiner kompromisslosen Konzentration auf begriffliche Klarheit bei bewusstem Verzicht auf für Physiker irrelevante Details. Es richtet sich u.a. an Studierende von Master-, Aufbau-, Graduierten- und Promotionsstudiengängen im Bereich der theoretischen und mathematischen Physik. Die Auswahl des Stoffes deckt ein breites Spektrum mathematischer Konzepte und Methoden ab, die für die heutige Physik relevant sind. Dieser zweite Band konzentriert sich dabei auf mathematische Grundlagen der Quantenmechanik: Unbeschränkte Operatoren im Hilbertraum, Spektraltheorie sowie Symmetriegruppen und ihre Darstellungen mit besonderem Augenmerk auf Rotations- und Lorentzgruppe.
Energy Technology Data Exchange (ETDEWEB)
Boettcher, R.; Hugo, K.H.; Kuhn, M.; Strauch, T. [comps.
1999-07-01
After outlining developmental trends in the various mining sectors as well as the structure and tasks of the State Mines Inspectorate, the annual report describes the activities in the fields of health and industrial safety, mining engineering and safety, and the environmental effects of mining activities, as well as special accidents and incidents. (HS) [German] Nach einem Ueberblick ueber die bergwirtschaftliche Entwicklung in den einzelnen Bergbauzweigen sowie ueber den Aufbau und die Zustaendigkeit der Bergbehoerde werden die Aktivitaeten in den Bereichen Arbeits- und Gesundheitsschutz, Bergtechnik und Sicherheit, Bergbau und Umwelt sowie bemerkenswerte Unfaelle und Vorkommnisse beschrieben. (HS)
DEFF Research Database (Denmark)
Sindbæk, Søren Michael
2015-01-01
preserve patterns of thisinteraction. Formal network analysis and modelling holds the potential to identify anddemonstrate such patterns, where traditional methods often prove inadequate. Thearchaeological study of communication networks in the past, however, calls for radically different analytical...... this is not a problem of network analysis, but network synthesis: theclassic problem of cracking codes or reconstructing black-box circuits. It is proposedthat archaeological approaches to network synthesis must involve a contextualreading of network data: observations arising from individual contexts, morphologies...
Social networks in primates: smart and tolerant species have more efficient networks.
Pasquaretta, Cristian; Levé, Marine; Claidière, Nicolas; van de Waal, Erica; Whiten, Andrew; MacIntosh, Andrew J J; Pelé, Marie; Bergstrom, Mackenzie L; Borgeaud, Christèle; Brosnan, Sarah F; Crofoot, Margaret C; Fedigan, Linda M; Fichtel, Claudia; Hopper, Lydia M; Mareno, Mary Catherine; Petit, Odile; Schnoell, Anna Viktoria; di Sorrentino, Eugenia Polizzi; Thierry, Bernard; Tiddi, Barbara; Sueur, Cédric
2014-12-23
Network optimality has been described in genes, proteins and human communicative networks. In the latter, optimality leads to the efficient transmission of information with a minimum number of connections. Whilst studies show that differences in centrality exist in animal networks with central individuals having higher fitness, network efficiency has never been studied in animal groups. Here we studied 78 groups of primates (24 species). We found that group size and neocortex ratio were correlated with network efficiency. Centralisation (whether several individuals are central in the group) and modularity (how a group is clustered) had opposing effects on network efficiency, showing that tolerant species have more efficient networks. Such network properties affecting individual fitness could be shaped by natural selection. Our results are in accordance with the social brain and cultural intelligence hypotheses, which suggest that the importance of network efficiency and information flow through social learning relates to cognitive abilities.
Epidemic Network Failures in Optical Transport Networks
DEFF Research Database (Denmark)
Ruepp, Sarah Renée; Katsikas, Dimitrios; Fagertun, Anna Manolova
2013-01-01
This paper presents a failure propagation model for transport networks which are affected by epidemic failures. The network is controlled using the GMPLS protocol suite. The Susceptible Infected Disabled (SID) epidemic model is investigated and new signaling functionality of GMPLS to support...
Network on Target: Remotely Configured Adaptive Tactical Networks
National Research Council Canada - National Science Library
Bordetsky, Alex; Bourakov, Eugene
2006-01-01
.... The node mobility as well as ad hoc network topology reconfiguration becomes a powerful control option, which network operators or intelligent management agents could apply to provide for self...
Analysis of Network Parameters Influencing Performance of Hybrid Multimedia Networks
Directory of Open Access Journals (Sweden)
Dominik Kovac
2013-10-01
Full Text Available Multimedia networks is an emerging subject that currently attracts the attention of research and industrial communities. This environment provides new entertainment services and business opportunities merged with all well-known network services like VoIP calls or file transfers. Such a heterogeneous system has to be able satisfy all network and end-user requirements which are increasing constantly. Therefore the simulation tools enabling deep analysis in order to find the key performance indicators and factors which influence the overall quality for specific network service the most are highly needed. This paper provides a study on the network parameters like communication technology, routing protocol, QoS mechanism, etc. and their effect on the performance of hybrid multimedia network. The analysis was performed in OPNET Modeler environment and the most interesting results are discussed at the end of this paper
CSIR Research Space (South Africa)
Modieginyane, KM
2017-03-01
Full Text Available Wireless Sensor Networks (WSNs) are commonly used information technologies of modern networking and computing platforms. Today's network computing applications are faced with a high demand of powerful network functionalities. Functional network...
Baker-Doyle, Kira J.
2015-01-01
Social network research on teachers and schools has risen exponentially in recent years as an innovative method to reveal the role of social networks in education. However, scholars are still exploring ways to incorporate traditional quantitative methods of Social Network Analysis (SNA) with qualitative approaches to social network research. This…
Developing cyber security architecture for military networks using cognitive networking
Kärkkäinen, Anssi
2015-01-01
In recent years, the importance of cyber security has increased. Cyber security has not become a critical issue only for governmental or business actors, but also for armed forces that nowadays rely on national or even global networks in their daily activities. The Network Centric Warfare (NCW) paradigm has increased the significance of networking during last decades as it enables information superiority in which military combat power increased by networking the battlefield actors from perspe...
Game theory in communication networks cooperative resolution of interactive networking scenarios
Antoniou, Josephina
2012-01-01
A mathematical tool for scientists and researchers who work with computer and communication networks, Game Theory in Communication Networks: Cooperative Resolution of Interactive Networking Scenarios addresses the question of how to promote cooperative behavior in interactive situations between heterogeneous entities in communication networking scenarios. It explores network design and management from a theoretical perspective, using game theory and graph theory to analyze strategic situations and demonstrate profitable behaviors of the cooperative entities. The book promotes the use of Game T
Advanced network programming principles and techniques : network application programming with Java
Ciubotaru, Bogdan
2013-01-01
Answering the need for an accessible overview of the field, this text/reference presents a manageable introduction to both the theoretical and practical aspects of computer networks and network programming. Clearly structured and easy to follow, the book describes cutting-edge developments in network architectures, communication protocols, and programming techniques and models, supported by code examples for hands-on practice with creating network-based applications. Features: presents detailed coverage of network architectures; gently introduces the reader to the basic ideas underpinning comp
An Inter-Networking Mechanism with Stepwise Synchronization for Wireless Sensor Networks
Directory of Open Access Journals (Sweden)
Masayuki Murata
2011-08-01
Full Text Available To realize the ambient information society, multiple wireless networks deployed in the region and devices carried by users are required to cooperate with each other. Since duty cycles and operational frequencies are different among networks, we need a mechanism to allow networks to efficiently exchange messages. For this purpose, we propose a novel inter-networking mechanism where two networks are synchronized with each other in a moderate manner, which we call stepwise synchronization. With our proposal, to bridge the gap between intrinsic operational frequencies, nodes near the border of networks adjust their operational frequencies in a stepwise fashion based on the pulse-coupled oscillator model as a fundamental theory of synchronization. Through simulation experiments, we show that the communication delay and the energy consumption of border nodes are reduced, which enables wireless sensor networks to communicate longer with each other.
The Analysis of SARDANA HPON Networks Using the HPON Network Configurator
Directory of Open Access Journals (Sweden)
Rastislav Roka
2013-01-01
Full Text Available NG-PON systems present optical access infrastructures to support various applications of the many service providers. In the near future, we can expect NG-PON technologies with different motivations for developing of HPON networks. The HPON is a hybrid passive optical network in a way that utilizes on a physical layer both TDM and WDM multiplexing principles together. The HPON network utilizes similar or soft revised topologies as TDM-PON architectures. In this second paper, requirements for the SARDANA HPON networks are introduced. A main part of the paper is dedicated to presentation of the HPON network configurator that allows configurating and analyzing the SARDANA HPON characteristics from a viewpoint of various specific network parameters. Finally, a short introduction to the comparison of the SARDANA and SUCCESS HPON networks based on simulation results is presented.
The Analysis of SUCCESS HPON Networks Using the HPON Network Configurator
Directory of Open Access Journals (Sweden)
Rastislav Roka
2013-01-01
Full Text Available NG-PON systems present optical access infrastructures to support various applications of the many service providers. In the near future, we can expect NG-PON technologies with different motivations for developing of HPON networks. The HPON is a hybrid passive optical network in a way that utilizes on a physical layer both TDM and WDM multiplexing principles together. The HPON network utilizes similar or soft revised topologies as TDM-PON architectures. In this first paper, design requirements for SUCCESS HPON networks are introduced. A main part of the paper is dedicated to presentation of the HPON network configurator that allows configurating and analyzing the SUCCESS HPON characteristics from a viewpoint of various specific network parameters. Finally, a short introduction to the comparison of the SUCCESS and SARDANA HPON networks based on simulation results is presented.
International Nuclear Information System (INIS)
Smith, Patrick I.
2003-01-01
Physicists use large detectors to measure particles created in high-energy collisions at particle accelerators. These detectors typically produce signals indicating either where ionization occurs along the path of the particle, or where energy is deposited by the particle. The data produced by these signals is fed into pattern recognition programs to try to identify what particles were produced, and to measure the energy and direction of these particles. Ideally, there are many techniques used in this pattern recognition software. One technique, neural networks, is particularly suitable for identifying what type of particle caused by a set of energy deposits. Neural networks can derive meaning from complicated or imprecise data, extract patterns, and detect trends that are too complex to be noticed by either humans or other computer related processes. To assist in the advancement of this technology, Physicists use a tool kit to experiment with several neural network techniques. The goal of this research is interface a neural network tool kit into Java Analysis Studio (JAS3), an application that allows data to be analyzed from any experiment. As the final result, a physicist will have the ability to train, test, and implement a neural network with the desired output while using JAS3 to analyze the results or output. Before an implementation of a neural network can take place, a firm understanding of what a neural network is and how it works is beneficial. A neural network is an artificial representation of the human brain that tries to simulate the learning process [5]. It is also important to think of the word artificial in that definition as computer programs that use calculations during the learning process. In short, a neural network learns by representative examples. Perhaps the easiest way to describe the way neural networks learn is to explain how the human brain functions. The human brain contains billions of neural cells that are responsible for processing
Default network modulation and large-scale network interactivity in healthy young and old adults.
Spreng, R Nathan; Schacter, Daniel L
2012-11-01
We investigated age-related changes in default, attention, and control network activity and their interactions in young and old adults. Brain activity during autobiographical and visuospatial planning was assessed using multivariate analysis and with intrinsic connectivity networks as regions of interest. In both groups, autobiographical planning engaged the default network while visuospatial planning engaged the attention network, consistent with a competition between the domains of internalized and externalized cognition. The control network was engaged for both planning tasks. In young subjects, the control network coupled with the default network during autobiographical planning and with the attention network during visuospatial planning. In old subjects, default-to-control network coupling was observed during both planning tasks, and old adults failed to deactivate the default network during visuospatial planning. This failure is not indicative of default network dysfunction per se, evidenced by default network engagement during autobiographical planning. Rather, a failure to modulate the default network in old adults is indicative of a lower degree of flexible network interactivity and reduced dynamic range of network modulation to changing task demands.
Social networks in primates: smart and tolerant species have more efficient networks
Pasquaretta, Cristian; Levé, Marine; Claidière, Nicolas; van de Waal, Erica; Whiten, Andrew; MacIntosh, Andrew J. J.; Pelé, Marie; Bergstrom, Mackenzie L.; Borgeaud, Christèle; Brosnan, Sarah F.; Crofoot, Margaret C.; Fedigan, Linda M.; Fichtel, Claudia; Hopper, Lydia M.; Mareno, Mary Catherine; Petit, Odile; Schnoell, Anna Viktoria; di Sorrentino, Eugenia Polizzi; Thierry, Bernard; Tiddi, Barbara; Sueur, Cédric
2014-01-01
Network optimality has been described in genes, proteins and human communicative networks. In the latter, optimality leads to the efficient transmission of information with a minimum number of connections. Whilst studies show that differences in centrality exist in animal networks with central individuals having higher fitness, network efficiency has never been studied in animal groups. Here we studied 78 groups of primates (24 species). We found that group size and neocortex ratio were correlated with network efficiency. Centralisation (whether several individuals are central in the group) and modularity (how a group is clustered) had opposing effects on network efficiency, showing that tolerant species have more efficient networks. Such network properties affecting individual fitness could be shaped by natural selection. Our results are in accordance with the social brain and cultural intelligence hypotheses, which suggest that the importance of network efficiency and information flow through social learning relates to cognitive abilities. PMID:25534964
McMillan, Troy
2011-01-01
An engaging approach for anyone beginning a career in networking As the world leader of networking products and services, Cisco products are constantly growing in demand. Yet, few books are aimed at those who are beginning a career in IT--until now. Cisco Networking Essentials provides a solid foundation on the Cisco networking products and services with thorough coverage of fundamental networking concepts. Author Troy McMillan applies his years of classroom instruction to effectively present high-level topics in easy-to-understand terms for beginners. With this indispensable full-color resour
Computer-communication networks
Meditch, James S
1983-01-01
Computer- Communication Networks presents a collection of articles the focus of which is on the field of modeling, analysis, design, and performance optimization. It discusses the problem of modeling the performance of local area networks under file transfer. It addresses the design of multi-hop, mobile-user radio networks. Some of the topics covered in the book are the distributed packet switching queuing network design, some investigations on communication switching techniques in computer networks and the minimum hop flow assignment and routing subject to an average message delay constraint
Epidemics on interconnected networks
Dickison, Mark; Havlin, S.; Stanley, H. E.
2012-06-01
Populations are seldom completely isolated from their environment. Individuals in a particular geographic or social region may be considered a distinct network due to strong local ties but will also interact with individuals in other networks. We study the susceptible-infected-recovered process on interconnected network systems and find two distinct regimes. In strongly coupled network systems, epidemics occur simultaneously across the entire system at a critical infection strength βc, below which the disease does not spread. In contrast, in weakly coupled network systems, a mixed phase exists below βc of the coupled network system, where an epidemic occurs in one network but does not spread to the coupled network. We derive an expression for the network and disease parameters that allow this mixed phase and verify it numerically. Public health implications of communities comprising these two classes of network systems are also mentioned.
DEFF Research Database (Denmark)
Landex, Alex
2012-01-01
Railway operation is often affected by network effects as a change in one part of the network can influence other parts of the network. Network effects occur because the train runs may be quite long and since the railway system has a high degree of interdependencies as trains cannot cross....../overtake each other everywhere in the network. First this paper describes network effects in general (section 1). In section 2 the network effects for trains and how they can be measured by scheduled waiting time is described. When the trains are affected by network effects the passengers are also affected....... Therefore, sections 3 and 4 describe the network effects for passengers and how they can be measured using passenger delay models. Before the concluding remarks in section 6, section 5 discusses how the operation can be improved by examining network effects in the planning process. © 2012 WIT Press....
Buchanan, Mark; Caldarelli, Guido; De Los Rios, Paolo; Rao, Francesco; Vendruscolo, Michele
2010-05-01
Introduction; 1. Network views of the cell Paolo De Los Rios and Michele Vendruscolo; 2. Transcriptional regulatory networks Sarath Chandra Janga and M. Madan Babu; 3. Transcription factors and gene regulatory networks Matteo Brilli, Elissa Calistri and Pietro Lió; 4. Experimental methods for protein interaction identification Peter Uetz, Björn Titz, Seesandra V. Rajagopala and Gerard Cagney; 5. Modeling protein interaction networks Francesco Rao; 6. Dynamics and evolution of metabolic networks Daniel Segré; 7. Hierarchical modularity in biological networks: the case of metabolic networks Erzsébet Ravasz Regan; 8. Signalling networks Gian Paolo Rossini; Appendix 1. Complex networks: from local to global properties D. Garlaschelli and G. Caldarelli; Appendix 2. Modelling the local structure of networks D. Garlaschelli and G. Caldarelli; Appendix 3. Higher-order topological properties S. Ahnert, T. Fink and G. Caldarelli; Appendix 4. Elementary mathematical concepts A. Gabrielli and G. Caldarelli; References.
An Optical Multicast Routing with Minimal Network Coding Operations in WDM Networks
Directory of Open Access Journals (Sweden)
Huanlin Liu
2014-01-01
Full Text Available Network coding can improve the optical multicast routing performance in terms of network throughput, bandwidth utilization, and traffic load balance. But network coding needs high encoding operations costs in all-optical WDM networks due to shortage of optical RAM. In the paper, the network coding operation is defined to evaluate the number of network coding operation cost in the paper. An optical multicast routing algorithm based on minimal number of network coding operations is proposed to improve the multicast capacity. Two heuristic criteria are designed to establish the multicast routing with low network coding cost and high multicast capacity. One is to select one path from the former K shortest paths with the least probability of dropping the multicast maximal capacity. The other is to select the path with lowest potential coding operations with the highest link shared degree among the multiple wavelength disjoint paths cluster from source to each destination. Comparing with the other multicast routing based on network coding, simulation results show that the proposed multicast routing algorithm can effectively reduce the times of network coding operations, can improve the probability of reaching multicast maximal capacity, and can keep the less multicast routing link cost for optical WDM networks.
Network Bandwidth Utilization Forecast Model on High Bandwidth Network
Energy Technology Data Exchange (ETDEWEB)
Yoo, Wucherl; Sim, Alex
2014-07-07
With the increasing number of geographically distributed scientific collaborations and the scale of the data size growth, it has become more challenging for users to achieve the best possible network performance on a shared network. We have developed a forecast model to predict expected bandwidth utilization for high-bandwidth wide area network. The forecast model can improve the efficiency of resource utilization and scheduling data movements on high-bandwidth network to accommodate ever increasing data volume for large-scale scientific data applications. Univariate model is developed with STL and ARIMA on SNMP path utilization data. Compared with traditional approach such as Box-Jenkins methodology, our forecast model reduces computation time by 83.2percent. It also shows resilience against abrupt network usage change. The accuracy of the forecast model is within the standard deviation of the monitored measurements.
Network bandwidth utilization forecast model on high bandwidth networks
Energy Technology Data Exchange (ETDEWEB)
Yoo, Wuchert (William) [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Sim, Alex [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-03-30
With the increasing number of geographically distributed scientific collaborations and the scale of the data size growth, it has become more challenging for users to achieve the best possible network performance on a shared network. We have developed a forecast model to predict expected bandwidth utilization for high-bandwidth wide area network. The forecast model can improve the efficiency of resource utilization and scheduling data movements on high-bandwidth network to accommodate ever increasing data volume for large-scale scientific data applications. Univariate model is developed with STL and ARIMA on SNMP path utilization data. Compared with traditional approach such as Box-Jenkins methodology, our forecast model reduces computation time by 83.2%. It also shows resilience against abrupt network usage change. The accuracy of the forecast model is within the standard deviation of the monitored measurements.
Directory of Open Access Journals (Sweden)
Samson S Kiware
Full Text Available Despite great achievements by insecticide-treated nets (ITNs and indoor residual spraying (IRS in reducing malaria transmission, it is unlikely these tools will be sufficient to eliminate malaria transmission on their own in many settings today. Fortunately, field experiments indicate that there are many promising vector control interventions that can be used to complement ITNs and/or IRS by targeting a wide range of biological and environmental mosquito resources. The majority of these experiments were performed to test a single vector control intervention in isolation; however, there is growing evidence and consensus that effective vector control with the goal of malaria elimination will require a combination of interventions.We have developed a model of mosquito population dynamic to describe the mosquito life and feeding cycles and to optimize the impact of vector control intervention combinations at suppressing mosquito populations. The model simulations were performed for the main three malaria vectors in sub-Saharan Africa, Anopheles gambiae s.s, An. arabiensis and An. funestus. We considered areas having low, moderate and high malaria transmission, corresponding to entomological inoculation rates of 10, 50 and 100 infective bites per person per year, respectively. In all settings, we considered baseline ITN coverage of 50% or 80% in addition to a range of other vector control tools to interrupt malaria transmission. The model was used to sweep through parameters space to select the best optimal intervention packages. Sample model simulations indicate that, starting with ITNs at a coverage of 50% (An. gambiae s.s. and An. funestus or 80% (An. arabiensis and adding interventions that do not require human participation (e.g. larviciding at 80% coverage, endectocide treated cattle at 50% coverage and attractive toxic sugar baits at 50% coverage may be sufficient to suppress all the three species to an extent required to achieve local malaria
Hoffman, Steven J; Guindon, G Emmanuel; Lavis, John N; Ndossi, Godwin D; Osei, Eric J A; Sidibe, Mintou Fall; Boupha, Boungnong
2011-12-13
Research evidence is not always being disseminated to healthcare providers who need it to inform their clinical practice. This can result in the provision of ineffective services and an inefficient use of resources, the implications of which might be felt particularly acutely in low- and middle-income countries. Malaria prevention is a particularly compelling domain to study evidence/practice gaps given the proven efficacy, cost-effectiveness and disappointing utilization of insecticide-treated nets (ITNs). This study compares what is known about ITNs to the related knowledge and practices of healthcare providers in four low- and middle-income countries. A new questionnaire was developed, pilot tested, translated and administered to 497 healthcare providers in Ghana (140), Laos (136), Senegal (100) and Tanzania (121). Ten questions tested participants' knowledge and clinical practice related to malaria prevention. Additional questions addressed their individual characteristics, working context and research-related activities. Ordinal logistic regressions with knowledge and practices as the dependent variable were conducted in addition to descriptive statistics. The survey achieved a 75% response rate (372/497) across Ghana (107/140), Laos (136/136), Senegal (51/100) and Tanzania (78/121). Few participating healthcare providers correctly answered all five knowledge questions about ITNs (13%) or self-reported performing all five clinical practices according to established evidence (2%). Statistically significant factors associated with higher knowledge within each country included: 1) training in acquiring systematic reviews through the Cochrane Library (OR 2.48, 95% CI 1.30-4.73); and 2) ability to read and write English well or very well (OR 1.69, 95% CI 1.05-2.70). Statistically significant factors associated with better clinical practices within each country include: 1) reading scientific journals from their own country (OR 1.67, 95% CI 1.10-2.54); 2) working
Costs and cost-effectiveness of malaria control interventions - a systematic review
Directory of Open Access Journals (Sweden)
White Michael T
2011-11-01
Full Text Available Abstract Background The control and elimination of malaria requires expanded coverage of and access to effective malaria control interventions such as insecticide-treated nets (ITNs, indoor residual spraying (IRS, intermittent preventive treatment (IPT, diagnostic testing and appropriate treatment. Decisions on how to scale up the coverage of these interventions need to be based on evidence of programme effectiveness, equity and cost-effectiveness. Methods A systematic review of the published literature on the costs and cost-effectiveness of malaria interventions was undertaken. All costs and cost-effectiveness ratios were inflated to 2009 USD to allow comparison of the costs and benefits of several different interventions through various delivery channels, across different geographical regions and from varying costing perspectives. Results Fifty-five studies of the costs and forty three studies of the cost-effectiveness of malaria interventions were identified, 78% of which were undertaken in sub-Saharan Africa, 18% in Asia and 4% in South America. The median financial cost of protecting one person for one year was $2.20 (range $0.88-$9.54 for ITNs, $6.70 (range $2.22-$12.85 for IRS, $0.60 (range $0.48-$1.08 for IPT in infants, $4.03 (range $1.25-$11.80 for IPT in children, and $2.06 (range $0.47-$3.36 for IPT in pregnant women. The median financial cost of diagnosing a case of malaria was $4.32 (range $0.34-$9.34. The median financial cost of treating an episode of uncomplicated malaria was $5.84 (range $2.36-$23.65 and the median financial cost of treating an episode of severe malaria was $30.26 (range $15.64-$137.87. Economies of scale were observed in the implementation of ITNs, IRS and IPT, with lower unit costs reported in studies with larger numbers of beneficiaries. From a provider perspective, the median incremental cost effectiveness ratio per disability adjusted life year averted was $27 (range $8.15-$110 for ITNs, $143 (range $135
Software-Defined Networks as a Stage of the Network Technology Evolution
Directory of Open Access Journals (Sweden)
A. A. Krasotin
2013-01-01
Full Text Available The authors of the article focus on the concept of a software defined network. In the beginning, the brief historical account is given concerning software defined networks as a scientific concept, its formation and technological and scientific meaning. The software defined network concept is treated in the article not as the final state-of-the-art in networking, but rather as a possible step and direction in the development of a networking paradigm. The article touches on pros and cons as well of the software defined networking and gives an account of possible stages of development of this technology in the context of other technologies, considering its hybrid with MPLS, as an example. OpenFlow protocol constitutes the main part of the article. The authors further discuss various kinds of existing libraries realizing programmable management routines for a software defined network using OpenFlow. All of these libraries provide API for building modular applications for software defined network management. Touching on practical side of implementation the results of comparative tests of throughput and latency, achieved with these libraries are shown.
Robertazzi, Thomas
2012-01-01
Springer Brief Basics of Computer Networking provides a non-mathematical introduction to the world of networks. This book covers both technology for wired and wireless networks. Coverage includes transmission media, local area networks, wide area networks, and network security. Written in a very accessible style for the interested layman by the author of a widely used textbook with many years of experience explaining concepts to the beginner.
de Moura, Alessandro P S
2006-01-01
A modified version of the Watts-Strogatz (WS) network model is proposed, in which the number of shortcuts scales with the network size N as Nalpha, with alpha infinity, whereas in the original WS model, this ratio is constant. We call such networks "thin Watts-Strogatz networks." We show that even though the fraction of shortcuts becomes vanishingly small for large networks, they still cause a kind of small-world effect, in the sense that the length L of the network increases sublinearly with the size. We develop a mean-field theory for these networks, which predicts that the length scales as N1-alpha ln N for large N. We also study how a search using only local information works in thin WS networks. We find that the search performance is enhanced compared to the regular network, and we predict that the search time tau scales as N1-alpha/2. These theoretical results are tested using numerical simulations. We comment on the possible relevance of thin WS networks for the design of high-performance low-cost communication networks.
"Homeless Networks: Testing Peer and Homed Networks Against Location Choice"
Shinichiro Iwata; Koji Karato
2007-01-01
This paper examines the location choices of homeless people in Osaka City, and finds them concentrated because of homeless networks. The paper also shows that different types of homeless networks operate in two different homeless groups: (1) peer networks that provide a social tie inside homeless communities are observed in groups that had not had work experience in the day labor market; (2) homed networks that provide a social tie outside homeless communities affect location choice in the ex...
Mc Kee, Shawn Patrick; The ATLAS collaboration
2016-01-01
Networks have played a critical role in high-energy physics (HEP), enabling us to access and effectively utilize globally distributed resources to meet the needs of our physicists. Because of their importance in enabling our grid computing infrastructure many physicists have taken leading roles in research and education (R&E) networking, participating in, and even convening, network related meetings and research programs with the broader networking community worldwide. This has led to HEP benefiting from excellent global networking capabilities for little to no direct cost. However, as other science domains ramp-up their need for similar networking it becomes less clear that this situation will continue unchanged. What this means for ATLAS in particular needs to be understood. ATLAS has evolved its computing model since the LHC started based upon its experience with using globally distributed resources. The most significant theme of those changes has been increased reliance upon, and use of, its networks....
AUTHOR|(INSPIRE)INSPIRE-00260714; The ATLAS collaboration
2017-01-01
Networks have played a critical role in high-energy physics (HEP), enabling us to access and effectively utilize globally distributed resources to meet the needs of our physicists. Because of their importance in enabling our grid computing infrastructure many physicists have taken leading roles in research and education (R&E) networking, participating in, and even convening, network related meetings and research programs with the broader networking community worldwide. This has led to HEP benefiting from excellent global networking capabilities for little to no direct cost. However, as other science domains ramp-up their need for similar networking it becomes less clear that this situation will continue unchanged. What this means for ATLAS in particular needs to be understood. ATLAS has evolved its computing model since the LHC started based upon its experience with using globally distributed resources. The most significant theme of those changes has been increased reliance upon, and use of, its networks....
Mobility Models for Next Generation Wireless Networks Ad Hoc, Vehicular and Mesh Networks
Santi, Paolo
2012-01-01
Mobility Models for Next Generation Wireless Networks: Ad Hoc, Vehicular and Mesh Networks provides the reader with an overview of mobility modelling, encompassing both theoretical and practical aspects related to the challenging mobility modelling task. It also: Provides up-to-date coverage of mobility models for next generation wireless networksOffers an in-depth discussion of the most representative mobility models for major next generation wireless network application scenarios, including WLAN/mesh networks, vehicular networks, wireless sensor networks, and
Development of a Spatial Decision Support System for Analyzing Changes in Hydro-meteorological Risk
van Westen, Cees
2013-04-01
In the framework of the EU FP7 Marie Curie ITN Network "CHANGES: Changing Hydro-meteorological Risks, as Analyzed by a New Generation of European Scientists (http://www.changes-itn.eu)", a spatial decision support system is under development with the aim to analyze the effect of risk reduction planning alternatives on reducing the risk now and in the future, and support decision makers in selecting the best alternatives. The SDSS is one of the main outputs of the CHANGES network, which will develop an advanced understanding of how global changes, related to environmental and climate change as well as socio-economical change, may affect the temporal and spatial patterns of hydro-meteorological hazards and associated risks in Europe; how these changes can be assessed, modeled, and incorporated in sustainable risk management strategies, focusing on spatial planning, emergency preparedness and risk communication. The CHANGES network consists of 11 full partners and 6 associate partners of which 5 private companies, representing 10 European countries. The CHANGES network has hired 12 Early Stage Researchers (ESRs) and is currently hiring 3-6 researchers more for the implementation of the SDSS. The Spatial Decision Support System will be composed of a number of integrated components. The Risk Assessment component allows to carry out spatial risk analysis, with different degrees of complexity, ranging from simple exposure (overlay of hazard and assets maps) to quantitative analysis (using different hazard types, temporal scenarios and vulnerability curves) resulting into risk curves. The platform does not include a component to calculate hazard maps, and existing hazard maps are used as input data for the risk component. The second component of the SDSS is a risk reduction planning component, which forms the core of the platform. This component includes the definition of risk reduction alternatives (related to disaster response planning, risk reduction measures and
Validity of language sample measures taken from structured elicitation procedures in Czech
Czech Academy of Sciences Publication Activity Database
Smolík, Filip; Seidlová Málková, G.
2011-01-01
Roč. 55, č. 5 (2011), s. 448-458 ISSN 0009-062X Grant - others:EU P7-PEOPLE-2007-1-1-ITN215961 Institutional research plan: CEZ:AV0Z70250504 Keywords : mean length of utterance * sentence complexity * language development Subject RIV: AN - Psychology Impact factor: 0.087, year: 2011