International Nuclear Information System (INIS)
Lagunas-Solar, M.C.; Thibeau, H.L.; Goodart, C.E.; Little, F.E.; Navarro, N.J.; Hartnett, D.E.
1985-01-01
An integrally shielded 123 Xe → 123 I generator system has been designed and tested under production conditions for its suitability as a multicurie handling device from which to produce radiopharmaceutical-quality high-purity no-carrier-added (NCA) 123 I. The 123 Xe → 123 I generator system is expected to provide an alternative to current techniques and to increase the availability and reliability of high-purity 123 I made via the 127 I(p,5n) 123 Xe → 123 I nuclear reaction. The generator system is based on the Crocker Nuclear Laboratory's continuous-flow production system which has been operating since 1974 for the multicurie production of 123 I. The generator system, which consists of an integrally shielded xenon trap and separate loading and processing apparatuses, is simple and reliable to operate, can be adapted to computerized control, and provides a safe working environment for the repeated handling of multicurie amounts of Xe-I radioactivities
40 CFR 123.3 - Coordination with other programs.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination with other programs. 123.3 Section 123.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS STATE PROGRAM REQUIREMENTS General § 123.3 Coordination with other programs. Issuance of State permits...
The application of 10CFR830. 120 in a basic research environment
Energy Technology Data Exchange (ETDEWEB)
Bodnarczuk, M.
1991-04-01
In this paper, I describe the process of applying the 10 basic criteria of the proposed 10CFR830.120 to a basic research environment like Fermilab and discuss some of the issues associated with the implementation of such a program. I will also discuss some of the differences and similarities between the 18 basic elements of NQA-1 and the 10 criteria of 10CFR830.120 along with the more philosophical'' issues associated with performance versus process- based approach to quality in basic research.
40 CFR 123.61 - Approval process.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Approval process. 123.61 Section 123... REQUIREMENTS Program Approval, Revision, and Withdrawal § 123.61 Approval process. (a) After determining that a...; and (6) Briefly outline the fundamental aspects of the State's proposed program, and the process for...
RNEDE: Resilient Network Design Environment
Energy Technology Data Exchange (ETDEWEB)
Venkat Venkatasubramanian, Tanu Malik, Arun Giridh; Craig Rieger; Keith Daum; Miles McQueen
2010-08-01
Modern living is more and more dependent on the intricate web of critical infrastructure systems. The failure or damage of such systems can cause huge disruptions. Traditional design of this web of critical infrastructure systems was based on the principles of functionality and reliability. However, it is increasingly being realized that such design objectives are not sufficient. Threats, disruptions and faults often compromise the network, taking away the benefits of an efficient and reliable design. Thus, traditional network design parameters must be combined with self-healing mechanisms to obtain a resilient design of the network. In this paper, we present RNEDEa resilient network design environment that that not only optimizes the network for performance but tolerates fluctuations in its structure that result from external threats and disruptions. The environment evaluates a set of remedial actions to bring a compromised network to an optimal level of functionality. The environment includes a visualizer that enables the network administrator to be aware of the current state of the network and the suggested remedial actions at all times.
23 CFR 771.123 - Draft environmental impact statements.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Draft environmental impact statements. 771.123 Section... ENVIRONMENT ENVIRONMENTAL IMPACT AND RELATED PROCEDURES § 771.123 Draft environmental impact statements. (a) A... significant impacts on the environment. When the applicant, after consultation with any project sponsor that...
Lifetimes in 121,123Cs and the question of core stiffness
International Nuclear Information System (INIS)
Droste, Ch.; Morek, T.; Rohozinski, S.G.
1992-01-01
Lifetimes of low-lying states in 121,123 Cs and 120,122 Xe are measured using the recoil-distance Doppler-shift method. The investigated nuclei were produced by the 107 Ag + 18 O and 109 Ag + 18 O reactions. The negative-parity states in 121,123 Cs are described in the framework of the core-quasiparticle coupling model with γ-soft (the extended Wilets-Jean model) and rigid (the Davydov-Filippov model) cores. (Author)
40 CFR 96.123 - CAIR permit contents and term.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 96.123 Section 96.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... necessary to facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal...
40 CFR 97.123 - CAIR permit contents and term.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.123 Section 97.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal of the CAIR NOX...
Computer network environment planning and analysis
Dalphin, John F.
1989-01-01
The GSFC Computer Network Environment provides a broadband RF cable between campus buildings and ethernet spines in buildings for the interlinking of Local Area Networks (LANs). This system provides terminal and computer linkage among host and user systems thereby providing E-mail services, file exchange capability, and certain distributed computing opportunities. The Environment is designed to be transparent and supports multiple protocols. Networking at Goddard has a short history and has been under coordinated control of a Network Steering Committee for slightly more than two years; network growth has been rapid with more than 1500 nodes currently addressed and greater expansion expected. A new RF cable system with a different topology is being installed during summer 1989; consideration of a fiber optics system for the future will begin soon. Summmer study was directed toward Network Steering Committee operation and planning plus consideration of Center Network Environment analysis and modeling. Biweekly Steering Committee meetings were attended to learn the background of the network and the concerns of those managing it. Suggestions for historical data gathering have been made to support future planning and modeling. Data Systems Dynamic Simulator, a simulation package developed at NASA and maintained at GSFC was studied as a possible modeling tool for the network environment. A modeling concept based on a hierarchical model was hypothesized for further development. Such a model would allow input of newly updated parameters and would provide an estimation of the behavior of the network.
The Integration of Personal Learning Environments & Open Network Learning Environments
Tu, Chih-Hsiung; Sujo-Montes, Laura; Yen, Cherng-Jyh; Chan, Junn-Yih; Blocher, Michael
2012-01-01
Learning management systems traditionally provide structures to guide online learners to achieve their learning goals. Web 2.0 technology empowers learners to create, share, and organize their personal learning environments in open network environments; and allows learners to engage in social networking and collaborating activities. Advanced…
Social Networks and the Environment
Julio Videras
2013-01-01
This review discusses empirical research on social networks and the environment; it summarizes findings from representative studies and the conceptual frameworks social scientists use to examine the role of social networks. The article presents basic concepts in social network analysis, summarizes common challenges of empirical research on social networks, and outlines areas for future research. Finally, the article discusses the normative and positive meanings of social networks.
40 CFR 123.46 - Individual control strategies.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Individual control strategies. 123.46... PROGRAM REQUIREMENTS Transfer of Information and Permit Review § 123.46 Individual control strategies. (a..., approval, and implementation an individual control strategy for each point source identified by the State...
40 CFR 123.23 - Attorney General's statement.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Attorney General's statement. 123.23... PROGRAM REQUIREMENTS State Program Submissions § 123.23 Attorney General's statement. (a) Any State that seeks to administer a program under this part shall submit a statement from the State Attorney General...
40 CFR 90.123 - Denial, revocation of certificate of conformity.
2010-07-01
... conformity. 90.123 Section 90.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Emission Standards and Certification Provisions § 90.123 Denial, revocation of certificate of conformity... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...
40 CFR 91.123 - Denial, revocation of certificate of conformity.
2010-07-01
... conformity. 91.123 Section 91.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Certification Provisions § 91.123 Denial, revocation of certificate of conformity. (a) If, after review of the... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...
40 CFR 81.123 - Southeastern Oklahoma Intrastate Air Quality Control Region.
2010-07-01
... Quality Control Region. 81.123 Section 81.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.123 Southeastern Oklahoma Intrastate Air Quality Control Region. The Southeastern Oklahoma Intrastate Air Quality Control Region consists of the territorial area encompassed by the...
Cerebral kinetics of the dopamine D{sub 2} receptor ligand [{sup 123}I]IBZM in mice
Energy Technology Data Exchange (ETDEWEB)
Meyer, Philipp T. [Department of Neurology, University Hospital Aachen, 52074 Aachen (Germany); Department of Nuclear Medicine, University Hospital Aachen, 52074 Aachen (Germany)], E-mail: pmeyer@ukaachen.de; Salber, Dagmar [C. and O. Vogt Institute of Brain Research, University Hospital Duesseldorf, 40225 Duesseldorf (Germany); Schiefer, Johannes [Department of Neurology, University Hospital Aachen, 52074 Aachen (Germany); Cremer, Markus [Institute of Neurosciences and Biophysics, Research Center Juelich, 52425 Juelich (Germany); Schaefer, Wolfgang M. [Department of Nuclear Medicine, University Hospital Aachen, 52074 Aachen (Germany); Kosinski, Christoph M. [Department of Neurology, University Hospital Aachen, 52074 Aachen (Germany); Langen, Karl-Josef [Institute of Neurosciences and Biophysics, Research Center Juelich, 52425 Juelich (Germany)
2008-05-15
Introduction: In vivo small animal imaging of the dopaminergic system is of great interest for basic and applied neurosciences, especially in transgenic mice. Small animal SPECT is particularly attractive because of its superior spatial resolution and tracer availability. We investigated the kinetics of the commercial dopamine D{sub 2} receptor (DZR) ligand [{sup 123}I]IBZM in mice as a prerequisite for an appropriate design of translational SPECT imaging between mice and humans. Methods: Cerebral kinetics of [{sup 123}I]IBZM under isoflurane anaesthesia were assessed by autoradiography in mice sacrificed at 30, 60, 120 and 200 min after iv injection. To explore the possible effects of isoflurane anaesthesia, an additional mice group was only anaesthetized for 20 min before being sacrificed at 140 min (putative time of single-scan SPECT analysis). Results: Maximum [{sup 123}I]IBZM uptake in the striatum (D{sub 2}R-rich; 10.5{+-}2.7 %ID/g) and cerebellum (D{sub 2}R-devoid; 2.4{+-}0.7 %ID/g) was observed at 30 min after injection. Thereafter, [{sup 123}I]IBZM uptake decreased slowly in striatum and rapidly in the cerebellum (200 min: 5.3{+-}1.9 and 0.4{+-}0.2 %ID/g, respectively). The striatum-to-cerebellum (S/C) [{sup 123}I]IBZM uptake ratio increased from 4.6{+-}1.2 at 30 min to 11.6{+-}2.6 at 120 min. The S/C ratio at 200 min was highly variable (17.8{+-}10.1), possibly indicating pseudo-equilibration in some animals. In mice, which were only anaesthetized between 120 and 140 min, a higher S/C ratio of 17.0{+-}5.1 was observed. Conclusions: The present study suggests that [{sup 123}I]IBZM is a suitable ligand for D{sub 2}R-SPECT in mice. Although a single-scan analysis may be a pragmatic semi-quantitative approach, tracer kinetic analyses on dynamic SPECT data should be pursued. The interfering effects of isoflurane anaesthesia need to be considered.
40 CFR 158.120 - Determining data requirements.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Determining data requirements. 158.120 Section 158.120 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS... requirements for biochemical and microbial pest control agents are contained and are described separately...
Learning Networks Distributed Environment
Martens, Harrie; Vogten, Hubert; Koper, Rob; Tattersall, Colin; Van Rosmalen, Peter; Sloep, Peter; Van Bruggen, Jan; Spoelstra, Howard
2005-01-01
Learning Networks Distributed Environment is a prototype of an architecture that allows the sharing and modification of learning materials through a number of transport protocols. The prototype implements a p2p protcol using JXTA.
Software/hardware distributed processing network supporting the Ada environment
Wood, Richard J.; Pryk, Zen
1993-09-01
A high-performance, fault-tolerant, distributed network has been developed, tested, and demonstrated. The network is based on the MIPS Computer Systems, Inc. R3000 Risc for processing, VHSIC ASICs for high speed, reliable, inter-node communications and compatible commercial memory and I/O boards. The network is an evolution of the Advanced Onboard Signal Processor (AOSP) architecture. It supports Ada application software with an Ada- implemented operating system. A six-node implementation (capable of expansion up to 256 nodes) of the RISC multiprocessor architecture provides 120 MIPS of scalar throughput, 96 Mbytes of RAM and 24 Mbytes of non-volatile memory. The network provides for all ground processing applications, has merit for space-qualified RISC-based network, and interfaces to advanced Computer Aided Software Engineering (CASE) tools for application software development.
Social network analysis of study environment
Directory of Open Access Journals (Sweden)
Blaženka Divjak
2010-06-01
Full Text Available Student working environment influences student learning and achievement level. In this respect social aspects of students’ formal and non-formal learning play special role in learning environment. The main research problem of this paper is to find out if students' academic performance influences their position in different students' social networks. Further, there is a need to identify other predictors of this position. In the process of problem solving we use the Social Network Analysis (SNA that is based on the data we collected from the students at the Faculty of Organization and Informatics, University of Zagreb. There are two data samples: in the basic sample N=27 and in the extended sample N=52. We collected data on social-demographic position, academic performance, learning and motivation styles, student status (full-time/part-time, attitudes towards individual and teamwork as well as informal cooperation. Afterwards five different networks (exchange of learning materials, teamwork, informal communication, basic and aggregated social network were constructed. These networks were analyzed with different metrics and the most important were betweenness, closeness and degree centrality. The main result is, firstly, that the position in a social network cannot be forecast only by academic success and, secondly, that part-time students tend to form separate groups that are poorly connected with full-time students. In general, position of a student in social networks in study environment can influence student learning as well as her/his future employability and therefore it is worthwhile to be investigated.
National network of radioactivity measurement in environment
International Nuclear Information System (INIS)
2006-01-01
This document constitutes the report of management for the year 2006 of the national network of measurement of radioactivity in environment, instituted by the article R.1333-11 of the Public Health code. According to the 5. of the decree of 27. june 2005, the Institute of radiation protection and nuclear safety (I.R.S.N.) has for mission to write every year a report of management of the national network of radioactivity measurement in environment. This report has for principal objectives: to do an evaluation on organisation and functioning of the piloting committee; to realize a synthesis on the different tasks lead by the working groups; as well as on the human and financial resources devoted to this project; to debrief on the development project of the national network information system. This report must allow to the network actors, as to the professional people and the public, to understand the functioning of the national network and the process implemented for the development of centralization, management and public diffusion tools, of the radioactivity data in environment. The year 2006 was marked by the opening of an Internet gate of the national network. (N.C.)
Conditions for Productive Learning in Network Learning Environments
DEFF Research Database (Denmark)
Ponti, M.; Dirckinck-Holmfeld, Lone; Lindström, B.
2004-01-01
are designed without a deep understanding of the pedagogical, communicative and collaborative conditions embedded in networked learning. Despite the existence of good theoretical views pointing to a social understanding of learning, rather than a traditional individualistic and information processing approach......The Kaleidoscope1 Jointly Executed Integrating Research Project (JEIRP) on Conditions for Productive Networked Learning Environments is developing and elaborating conceptual understandings of Computer Supported Collaborative Learning (CSCL) emphasizing the use of cross-cultural comparative......: Pedagogical design and the dialectics of the digital artefacts, the concept of collaboration, ethics/trust, identity and the role of scaffolding of networked learning environments. The JEIRP is motivated by the fact that many networked learning environments in various European educational settings...
Heterogeneous networking in the home environment
Bolla, Raffaele; Davoli, Franco; Repetto, Matteo; Fragopoulos, Tasos; Serpanos, D.; Chessa, Stefano; Ferro, Erina
2006-01-01
The management and control at multiple protocol layers of a heterogeneous networking structure, to support multimedia applications in the home environment, is considered. The paper examines possible scenarios, and corresponding architectural solutions, also in the light of existing wireless and sensor networks technologies.
NNETS - NEURAL NETWORK ENVIRONMENT ON A TRANSPUTER SYSTEM
Villarreal, J.
1994-01-01
The primary purpose of NNETS (Neural Network Environment on a Transputer System) is to provide users a high degree of flexibility in creating and manipulating a wide variety of neural network topologies at processing speeds not found in conventional computing environments. To accomplish this purpose, NNETS supports back propagation and back propagation related algorithms. The back propagation algorithm used is an implementation of Rumelhart's Generalized Delta Rule. NNETS was developed on the INMOS Transputer. NNETS predefines a Back Propagation Network, a Jordan Network, and a Reinforcement Network to assist users in learning and defining their own networks. The program also allows users to configure other neural network paradigms from the NNETS basic architecture. The Jordan network is basically a feed forward network that has the outputs connected to a pseudo input layer. The state of the network is dependent on the inputs from the environment plus the state of the network. The Reinforcement network learns via a scalar feedback signal called reinforcement. The network propagates forward randomly. The environment looks at the outputs of the network to produce a reinforcement signal that is fed back to the network. NNETS was written for the INMOS C compiler D711B version 1.3 or later (MS-DOS version). A small portion of the software was written in the OCCAM language to perform the communications routing between processors. NNETS is configured to operate on a 4 X 10 array of Transputers in sequence with a Transputer based graphics processor controlled by a master IBM PC 286 (or better) Transputer. A RGB monitor is required which must be capable of 512 X 512 resolution. It must be able to receive red, green, and blue signals via BNC connectors. NNETS is meant for experienced Transputer users only. The program is distributed on 5.25 inch 1.2Mb MS-DOS format diskettes. NNETS was developed in 1991. Transputer and OCCAM are registered trademarks of Inmos Corporation. MS
Microautoradiography of [123I]ADAM in mice treated with fluoxetine and serotonin reuptake inhibitors
International Nuclear Information System (INIS)
Ye, X.-X.; Chen, J.-C.; Liu, R.-S.; Wey, S.-P.; Lee, J.-S.; Chen, C.-C.; Fu, Y.-K.; Ting, Gann; Hwang, J.-J.
2004-01-01
A radiopharmaceutical, 123 I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine ([ 123 I]ADAM), has been developed recently for evaluation of how serotonin transporters (SERT) function in the brain. However, the detailed biodistribution and specific binding in certain brain areas are not well investigated. In this study, both phosphor plate imaging and microautoradiography were applied to explore the binding characteristics of [ 123 I]ADAM in SERT neurons. The effect of two psychotropics and one narcotic on the binding of [ 123 I]ADAM to SERT was also studied. Fluoxetine and desipramine, both are psychotropics and specific SERT ligands and decreased the affinity of [ 123 I]ADAM, while p-chloroamphetamine (PCA), a narcotic, destroyed most of serotonergic neurons, as well as reducing the concentration of serotonin and the number of SERT in the brain as shown by the biodistribution of [ 123 I]ADAM. Significant and selective accumulation of [ 123 I]ADAM in the areas from midbrain to brain stem in normal mice with maximum target-to-background ratio was found at 90 minutes postinjection. A rapid clearance of [ 131 I]ADAM at 120 minutes postinjection was found in the CA1, CA3 and ThN brain areas. In addition, the inhibition effect on binding ability of [ 123 I]ADAM to SERT by the psychotropics and the narcotic was found to have the order of: PCA > fluoxetine > desipramine
Fragmented network subsystem with traffic filtering for microkernel environment
Directory of Open Access Journals (Sweden)
Anna Urievna Budkina
2016-06-01
Full Text Available The TCP/IP stack in a microkernel operating system executed in a user space, which requires the development of a distributed network infrastructure within a single software environment. Its functions are the organization of interaction between the components of the stack with different processes, as well as the organization of filtering mechanisms and routing of internal network traffic. Use of architectural approaches applicable in monolithic-modular systems is impossible, because the network stack is not a shareable component of the system. As a consequence, the microkernel environment requires development of special network subsystem. In this work we provide overview of major conceptions of network architectures in microkernel environments. Also, we provide own architecture which supports filtering of internal network traffic. We evaluate the architecture by development of high-performance "key-value" store.
Report on Asian Environment Information Network; 'Asia kankyo joho network' ni kansuru hokokusho
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
The goal is the construction of Asian Environment Information Network (AEInet) in accordance with a contract signed between Indonesia's LIPI (Indonesian Institute of Science) and NEDO under NEDO's Research Cooperation Project Concerning the Development of Environment Measuring Laser Radar (LR). The network is so designed and constituted as to operate on a private line between Indonesia and Japan via IP (Internet protocol) and to enable the exchange on the Internet network of the data collected/analyzed by the Indonesian LR system and of articles of e-mail between scientists of the two countries. The AEInet will be utilized for the collection/analysis of LR-collected data; exchange of observed data and the result of processing; provision of support to environment information scientists in exchanging e-mail and information; and the search of databases for the implementation of the project. In this paper, the outline and functions of the system, network system design, WWW server construction, network operating status, joint researches with Indonesia, etc., are described. (NEDO)
Massivizing Networked Virtual Environments on Clouds
Shen, S.
2015-01-01
Networked Virtual Environments (NVEs) are virtual environments where physically distributed, Internet-connected users can interact and socialize with others. The most popular NVEs are online games, which have hundreds of millions of users and a global market of tens of billions Euros per year.
Multimedia didactic courseware of imaging anatomy for network environment
International Nuclear Information System (INIS)
Jin Jiyang; Teng Gaojun; Yang Xiaoqing; Zhu Haihua; Kong Weiwei; Zhu Jiaming; Li Guozhao
2004-01-01
Objective: To design and program the multimedia didactic courseware of imaging anatomy for network environment. Methods: By collecting the teaching material and images of 'imaging anatomy', the images were obtained with digital cameras and scanners, and processed with graphic software, and then the multimedia didactic courseware was archived with Dreamweaver MX. Results: Multimedia didactic courseware of imaging anatomy with friendly interface for network environment had been completed. Reliable, stable, and flexible operation in campus network and Internet environment was achieved. Conclusion: Being not conditioned by time and space factor, multimedia didactic courseware for network environment with an abundance of information and more freedom in teaching and studying, which saves manpower and material resources and makes an effective disposal of educational resources, will have broad prospects to develop. (authors)
Iodogen-mediated radiolabeling of Bevacizumab with I-123 for clinical applications
International Nuclear Information System (INIS)
Lemps, R. de; Desruet, M.; Bacot, S.; Ahmadi, M.; Ghezzi, C.; Desruet, M.; Fagret, D.; Berger, F.
2014-01-01
Bevacizumab is a monoclonal antibody, directed against vascular endothelial growth factor (VEGF), and is currently used in various types of cancers (breast, lung, colorectal). In order to administer to humans glioblastomas, we developed its iodine 123 radiolabeling for in vitro and in vivo studies subsequent. The aim of the study is to choose the best radioiodination conditions based on feasibility in a hospital radiopharmacy: Quick one step method under mild condition, reproducible, using materials for pharmaceutical use and in a closed-system. Method Bevacizumab was radiolabeled with "1"2"3I using Iodogen, the most widely used oxidants in direct labelling techniques for tyrosyl residues-containing compounds. We have been explored two crucial parameters for clinical transfer: the amount of oxidant required (50μg and 100μg) and the choice of the purification column (size exclusion column or anion exchange resin), respectively. Quality control was performed before and after purification of each condition in order to evaluate the radiochemical purity (RCP) and purification efficiency. The stability of the radiolabeled molecule is evaluated over time and also when the solution is diluted with unlabeled bevacizumab. Moreover, the in vitro stability of "1"2"3I-bevacizumab was determined in presence of human blood at 15, 30, 60 and 120 min. Labeling yield before purification was 96.5% for the first condition (50μg Iodogen) and 95.5% for the second one (100μg Iodogen). The radiochemical purity was 99.5% after purification on a size exclusion column and 99% after purification on anion exchange resin. The purification yield with size exclusion column is 75%, compared with 81% of the anionic exchange resin. The stability in the labeling medium of "1"2"3I-bevacizumab at 3, 6, 24 and 30 h after labeling showed a RCP at 100%, 93%, 99.8% and 99.8% for condition 1 so that it was found to be 99.2%, 100%, 99.3%, 99.5% for condition 2, respectively. In vitro incubation with
40 CFR 89.123 - Amending the application and certificate of conformity.
2010-07-01
... certificate of conformity. 89.123 Section 89.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... of conformity. (a) The manufacturer of nonroad compression-ignition engines must notify the... be made to a product line covered by a certificate of conformity. This notification must include a...
A Mobile Sensor Network System for Monitoring of Unfriendly Environments.
Song, Guangming; Zhou, Yaoxin; Ding, Fei; Song, Aiguo
2008-11-14
Observing microclimate changes is one of the most popular applications of wireless sensor networks. However, some target environments are often too dangerous or inaccessible to humans or large robots and there are many challenges for deploying and maintaining wireless sensor networks in those unfriendly environments. This paper presents a mobile sensor network system for solving this problem. The system architecture, the mobile node design, the basic behaviors and advanced network capabilities have been investigated respectively. A wheel-based robotic node architecture is proposed here that can add controlled mobility to wireless sensor networks. A testbed including some prototype nodes has also been created for validating the basic functions of the proposed mobile sensor network system. Motion performance tests have been done to get the positioning errors and power consumption model of the mobile nodes. Results of the autonomous deployment experiment show that the mobile nodes can be distributed evenly into the previously unknown environments. It provides powerful support for network deployment and maintenance and can ensure that the sensor network will work properly in unfriendly environments.
40 CFR 68.120 - Petition process.
2010-07-01
...) CHEMICAL ACCIDENT PREVENTION PROVISIONS Regulated Substances for Accidental Release Prevention § 68.120 Petition process. (a) Any person may petition the Administrator to modify, by addition or deletion, the... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Petition process. 68.120 Section 68...
Intelligent Multi-Agent Middleware for Ubiquitous Home Networking Environments
Minwoo Son; Seung-Hun Lee; Dongkyoo Shin; Dongil Shin
2008-01-01
The next stage of the home networking environment is supposed to be ubiquitous, where each piece of material is equipped with an RFID (Radio Frequency Identification) tag. To fully support the ubiquitous environment, home networking middleware should be able to recommend home services based on a user-s interests and efficiently manage information on service usage profiles for the users. Therefore, USN (Ubiquitous Sensor Network) technology, which recognizes and manages a ...
HeNCE: A Heterogeneous Network Computing Environment
Directory of Open Access Journals (Sweden)
Adam Beguelin
1994-01-01
Full Text Available Network computing seeks to utilize the aggregate resources of many networked computers to solve a single problem. In so doing it is often possible to obtain supercomputer performance from an inexpensive local area network. The drawback is that network computing is complicated and error prone when done by hand, especially if the computers have different operating systems and data formats and are thus heterogeneous. The heterogeneous network computing environment (HeNCE is an integrated graphical environment for creating and running parallel programs over a heterogeneous collection of computers. It is built on a lower level package called parallel virtual machine (PVM. The HeNCE philosophy of parallel programming is to have the programmer graphically specify the parallelism of a computation and to automate, as much as possible, the tasks of writing, compiling, executing, debugging, and tracing the network computation. Key to HeNCE is a graphical language based on directed graphs that describe the parallelism and data dependencies of an application. Nodes in the graphs represent conventional Fortran or C subroutines and the arcs represent data and control flow. This article describes the present state of HeNCE, its capabilities, limitations, and areas of future research.
Integrated Analysis of Environment-driven Operational Effects in Sensor Networks
Energy Technology Data Exchange (ETDEWEB)
Park, Alfred J [ORNL; Perumalla, Kalyan S [ORNL
2007-07-01
There is a rapidly growing need to evaluate sensor network functionality and performance in the context of the larger environment of infrastructure and applications in which the sensor network is organically embedded. This need, which is motivated by complex applications related to national security operations, leads to a paradigm fundamentally different from that of traditional data networks. In the sensor networks of interest to us, the network dynamics depend strongly on sensor activity, which in turn is triggered by events in the environment. Because the behavior of sensor networks is sensitive to these driving phenomena, the integrity of the sensed observations, measurements and resource usage by the network can widely vary. It is therefore imperative to accurately capture the environmental phenomena, and drive the simulation of the sensor network operation by accounting fully for the environment effects. In this paper, we illustrate the strong, intimate coupling between the sensor network operation and the driving phenomena in their applications with an example sensor network designed to detect and track gaseous plumes.
Characterisation of Network Objects in Natural and Anthropic Environments
Harris, B.; McDougall, K.; Barry, M.
2014-11-01
Networks are structures that organise component objects, and they are extensive and recognisable across a range of environments. Estimating lengths of networks objects and their relationships to areas contiguous to them could assist provide owners with additional knowledge of their assets. There is currently some understanding of the way in which networks (such as waterways) relate and respond to their natural and anthropogenic environments. Despite this knowledge, there is no straight forward formula, method or model that can be applied to assess these relationships to a sufficient level of detail. Whilst waterway networks and their structures are well understood from the work of Horton and Strahler, relatively little attention has been paid to how (or if) these properties and behaviours can inform the understanding of other, unrelated, networks. Analysis of existing natural and built network objects exhibited how relationships derived from waterway networks can be applied in new areas of interest. We create a predictive approach to associate dissimilar objects such as pipe networks to assess if using the model established for waterway networks and their relationships can be functional in other areas. Using diversity of inputs we create data to assist with the creation of a predictive model. This work provides a clean theoretical connection between a formula applied to evaluate waterways and their environments, and other natural and anthropogenic network objects. It fills a key knowledge gap in the assessment and application of approaches used to measure natural and built networks.
Energy Technology Data Exchange (ETDEWEB)
Ye, X.-X.; Chen, J.-C.; Liu, R.-S.; Wey, S.-P.; Lee, J.-S.; Chen, C.-C.; Fu, Y.-K.; Ting, Gann; Hwang, J.-J. E-mail: jjhwang@ym.edu.tw
2004-07-01
A radiopharmaceutical, {sup 123}I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine ([{sup 123}I]ADAM), has been developed recently for evaluation of how serotonin transporters (SERT) function in the brain. However, the detailed biodistribution and specific binding in certain brain areas are not well investigated. In this study, both phosphor plate imaging and microautoradiography were applied to explore the binding characteristics of [{sup 123}I]ADAM in SERT neurons. The effect of two psychotropics and one narcotic on the binding of [{sup 123}I]ADAM to SERT was also studied. Fluoxetine and desipramine, both are psychotropics and specific SERT ligands and decreased the affinity of [{sup 123}I]ADAM, while p-chloroamphetamine (PCA), a narcotic, destroyed most of serotonergic neurons, as well as reducing the concentration of serotonin and the number of SERT in the brain as shown by the biodistribution of [{sup 123}I]ADAM. Significant and selective accumulation of [{sup 123}I]ADAM in the areas from midbrain to brain stem in normal mice with maximum target-to-background ratio was found at 90 minutes postinjection. A rapid clearance of [{sup 131}I]ADAM at 120 minutes postinjection was found in the CA1, CA3 and ThN brain areas. In addition, the inhibition effect on binding ability of [{sup 123}I]ADAM to SERT by the psychotropics and the narcotic was found to have the order of: PCA > fluoxetine > desipramine.
International Nuclear Information System (INIS)
Qaim, S.M.; Stoecklin, G.; Weinreich, R.
1976-08-01
The major object of this panel was to obtain information on the state of art of Iodine-123 production in Western Europe. Technical, medical and organizational problems were discussed extensively during the one-day meeting and a stimulating exchange of information between the various 123 I-producers and users has been initiated. Some specific examples of medical application were also included in order to get a feeling of the degree of acceptance by the medical community and the demand for this isotope. The meeting clearly demonstrated the great demand for this isotope but it also showed that the present rate of production is well below the demand. In order to fill this gap, not only further technical development is needed but also the organizational question of distribution has to be solved, perhaps within a network of collaborating cyclotrons, a task which is considerably more difficult in Western Europe than in the USA. (orig./HP) [de
An Intelligent Pinger Network for Solid Glacier Environments
Schönitz, S.; Reuter, S.; Henke, C.; Jeschke, S.; Ewert, D.; Eliseev, D.; Heinen, D.; Linder, P.; Scholz, F.; Weinstock, L.; Wickmann, S.; Wiebusch, C.; Zierke, S.
2016-12-01
This talk presents a novel approach for an intelligent, agent-based pinger network in an extraterrestrial glacier environment. Because of recent findings of the Cassini spacecraft, a mission to Saturn's moon Enceladus is planned in order search for extraterrestrial life within the ocean beneath Enceladus' ice crust. Therefore, a maneuverable melting probe, the EnEx probe, was developed to melt into Enceladus' ice and take liquid samples from water-filled crevasses. Hence, the probe collecting the samples has to be able to navigate in ice which is a hard problem, because neither visual nor gravitational methods can be used. To enhance the navigability of the probe, a network of autonomous pinger units (APU) is in development that is able to extract a map of the ice environment via ultrasonic soundwaves. A network of these APUs will be deployed on the surface of Enceladus, melt into the ice and form a network to help guide the probe safely to its destination. The APU network is able to form itself fully autonomously and to compensate system failures of individual APUs. The agents controlling the single APU are realized by rule-based expert systems implemented in CLIPS. The rule-based expert system evaluates available information of the environment, decides for actions to take to achieve the desired goal (e.g. a specific network topology), and executes and monitors such actions. In general, it encodes certain situations that are evaluated whenever an APU is currently idle, and then decides for a next action to take. It bases this decision on its internal world model that is shared with the other APUs. The optimal network topology that defines each agents position is iteratively determined by mixed-integer nonlinear programming. Extensive simulations studies show that the proposed agent design enables the APUs to form a robust network topology that is suited to create a reliable 3D map of the ice environment.
The Political Activity in the Network Environment
Directory of Open Access Journals (Sweden)
Марианна Юрьевна Павлютенкова
2015-12-01
Full Text Available The rapid development and deep penetration into all areas of modern society of information and communication technologies significantly increase the role of network interactions. Network structures represented primarily social networks, embedded in the public policy process and became one of the key political actors. Online communities take the form of public policy, where the formation of public opinion and political decision-making plays the main role. Networking environment opens up new opportunities for the opposition and protest movements, civic participation, and control of public policy in general. The article gives an insight on the political aspects of social networking, concludes on the trend formation and network's strengthening of the political activity in a wide distribution of e-networking and e-communications.
A Cluster- Based Secure Active Network Environment
Institute of Scientific and Technical Information of China (English)
CHEN Xiao-lin; ZHOU Jing-yang; DAI Han; LU Sang-lu; CHEN Gui-hai
2005-01-01
We introduce a cluster-based secure active network environment (CSANE) which separates the processing of IP packets from that of active packets in active routers. In this environment, the active code authorized or trusted by privileged users is executed in the secure execution environment (EE) of the active router, while others are executed in the secure EE of the nodes in the distributed shared memory (DSM) cluster. With the supports of a multi-process Java virtual machine and KeyNote, untrusted active packets are controlled to securely consume resource. The DSM consistency management makes that active packets can be parallelly processed in the DSM cluster as if they were processed one by one in ANTS (Active Network Transport System). We demonstrate that CSANE has good security and scalability, but imposing little changes on traditional routers.
Evaluation of QoS supported in Network Mobility NEMO environments
International Nuclear Information System (INIS)
Hussien, L F; Abdalla, A H; Habaebi, M H; Khalifa, O O; Hassan, W H
2013-01-01
Network mobility basic support (NEMO BS) protocol is an entire network, roaming as a unit which changes its point of attachment to the Internet and consequently its reachability in the network topology. NEMO BS doesn't provide QoS guarantees to its users same as traditional Internet IP and Mobile IPv6 as well. Typically, all the users will have same level of services without considering about their application requirements. This poses a problem to real-time applications that required QoS guarantees. To gain more effective control of the network, incorporated QoS is needed. Within QoS-enabled network the traffic flow can be distributed to various priorities. Also, the network bandwidth and resources can be allocated to different applications and users. Internet Engineering Task Force (IETF) working group has proposed several QoS solutions for static network such as IntServ, DiffServ and MPLS. These QoS solutions are designed in the context of a static environment (i.e. fixed hosts and networks). However, they are not fully adapted to mobile environments. They essentially demands to be extended and adjusted to meet up various challenges involved in mobile environments. With existing QoS mechanisms many proposals have been developed to provide QoS for individual mobile nodes (i.e. host mobility). In contrary, research based on the movement of the whole mobile network in IPv6 is still undertaking by the IETF working groups (i.e. network mobility). Few researches have been done in the area of providing QoS for roaming networks. Therefore, this paper aims to review and investigate (previous /and current) related works that have been developed to provide QoS in mobile network. Consequently, a new proposed scheme will be introduced to enhance QoS within NEMO environment, achieving by which seamless mobility to users of mobile network node (MNN)
Amigo - Ambient Intelligence for the networked home environment
Janse, M.D.
2008-01-01
The Amigo project develops open, standardized, interoperable middleware and attractive user services for the networked home environment. Fifteen of Europe's leading companies and research organizations in mobile and home networking, software development, consumer electronics and domestic appliances
International Nuclear Information System (INIS)
Cordes, M.; Henkes, H.; Hierholzer, J.; Eichstaedt, H.; Felix, R.; Laudahn, D.; Braeu, H.; Girke, W.; Kramp, W.
1991-01-01
[ 123 I]IBZM is a new radioactive labelled ligand which has a high affinity and specificity to D2-dopamine receptors. The in vivo kinetics of [ 123 I]IBZM were studied in patients with unilateral and bilateral accentuated idiopathic Parkinson's disease. The uptake in the basal ganglias and the imaging properties of this D2 receptor antagonist as a radiopharmaceutical for SPECT examinations had to be investigated. 5 patients, aged 42-66 years, (2m/3f) were examined. Each patient received 185 MBq [ 123 I]IBZM intravenously. Blood samples were taken 0-120 min post injection (p.i.) and time activity curves were plotted. Three SPECT examinations were performed (I: 30-50 min; II: 50-70 min; and III: 70-90 min p.i.). The count rates (counts/pixel) in the basal ganglias and the cerebellum were measured for each SPECT series on transverse slices using the region-of-interest technique. The time-activity curve of [ 123 I]IBZM shows a rapid decline in plasma during the first 10 min followed by a plateau until 120 min after injection. The SPECT examinations demonstrate the highest count rate in the basal ganglia during SPECT series III (i.e., 70-90 min p.i.). The side-to-side difference of the count rates were in the range of 3 percent in four patients, and 10 percent in one patient. The biokinetic data of [ 123 I]IBZM make this substance capable as a radiopharmaceutical for SPECT examinations. The basal ganglia are best visualized 70-90 min p.i., thus [ 123 I]IBZM seems to be a promising imaging agent for diseases of the D2-dopaminergic receptor system. (author). 7 refs.; 4 figs.; 4 tabs
Iodine-123 (123I) is promising radiopharmaceutical in the radionuclide diagnostics
International Nuclear Information System (INIS)
Tazhedinov, I.T.
2003-01-01
In the paper some advantages of the radiopharmaceuticals with 123 I against 99m Tc preparations are shown. It is noted that the 123 I is the most favourable among cyclotron radionuclides for radionuclide diagnostics by it nuclear-physical characteristics. With application of 123 I it is possible to attain a significant progress in the thyroid examination. 123 I labelled preparations should have a high bond strength providing the high information valuation of examinations
Optimal network structure in an open market environment
International Nuclear Information System (INIS)
2002-01-01
The focus of this report is on network planning in the new environment of a liberalized electricity market. The development of the network is viewed from different stakeholders objectives. The stakeholders in the transmission network are groups or individuals who have a stake in, or an expectation of the development and performance of the network. An open network exists when all market players meet equal admission rights and obligations. This required that the grid be administered through a transparent set of rules such as a grid code. (author)
Public Agility and Change in a Network Environment
Directory of Open Access Journals (Sweden)
Tom van Engers
2011-03-01
Full Text Available Preparing for change is increasingly core business for governmental organizations. The networked society and the increasing connectedness of governmental organizations have as much impact on the complexity of the change process as the complexities of the corpus of law. Change is not only driven by changes in the law; changes in the organization’s environment often create a need to redesign business processes, reallocate roles and responsibilities, and reorder tasks. Moreover, preparations for change are not limited to the internal processes and systems of these organizations. Propagation of changes to network partners and redesign of network arrangements can be an enormous challenge. In the AGILE project, we develop a design method, distributed service architecture, and supporting tools that enable organizations - administrative and otherwise - to orchestrate their law-based services in a networked environment. This paper explains the Agile approach and describes some of its key principles.
Report on Asian Environment Information Network; 'Asia kankyo joho network' ni kansuru hokokusho
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
The goal is the construction of Asian Environment Information Network (AEInet) in accordance with a contract signed between Indonesia's LIPI (Indonesian Institute of Science) and NEDO under NEDO's Research Cooperation Project Concerning the Development of Environment Measuring Laser Radar (LR). The network is so designed and constituted as to operate on a private line between Indonesia and Japan via IP (Internet protocol) and to enable the exchange on the Internet network of the data collected/analyzed by the Indonesian LR system and of articles of e-mail between scientists of the two countries. The AEInet will be utilized for the collection/analysis of LR-collected data; exchange of observed data and the result of processing; provision of support to environment information scientists in exchanging e-mail and information; and the search of databases for the implementation of the project. In this paper, the outline and functions of the system, network system design, WWW server construction, network operating status, joint researches with Indonesia, etc., are described. (NEDO)
International Nuclear Information System (INIS)
Britto, J.L.Q. de; Silva, A.G. da; Teixeira, F.C.M.; Costa e Silva, A.; Souza, A.S.F. de
1981-01-01
The 12 I is prepared by 122 Te( 3 He, 2n) 123 Xe sup(β+) → 123 I reaction. The remotization of the Xe diffusion and capture system and the retired of the 123 I produced by the 123 Xe precursory decaying. (E.G.) [pt
Network printing in a heterogenous environment
International Nuclear Information System (INIS)
Beyer, C.; Schroth, G.
2001-01-01
Mail and printing are often said to be the most visible services for the user in the network. Though many people talked about the paperless bureau a few years ago it seems that the more digital data is accessible, the more it gets printed. Print management in a heterogenous network environments is typically crossing all operating systems. Each of those brings its own requirements and different printing system implementations with individual user interfaces. The scope is to give the user the advantage and features of the native interface of their operating system while making administration tasks as easy as possible by following the general ideas of a centralised network service on the server side
Amigo - Ambient Intelligence for the networked home environment
Janse, M.D.
2008-01-01
The Amigo project develops open, standardized, interoperable middleware and attractive user services for the networked home environment. Fifteen of Europe's leading companies and research organizations in mobile and home networking, software development, consumer electronics and domestic appliances have joined together in the Amigo project to develop an integrated interoperable home networking framework. Amigo is an IST-funded IP project. This report is the final report providing an overview ...
Energy Technology Data Exchange (ETDEWEB)
Acton, P.D.; Kung Mei-Ping; Mu Mu; Ploessl, K.; Hou, C.; Siciliano, M.; Oya Shunichi (Department of Radiology, University of Pennsylvania, Philadelphia, PA (United States)); Kung, H.F. (Department of Radiology, University of Pennsylvania, Philadelphia, PA (United States) Department of Pharmacology, University of Pennsylvania, Philadelphia (United States))
1999-08-01
A new radioligand, 5-iodo-2-[[2-2-[(dimethylamino)methyl]phenyl]thio]benzyl alcohol ([[sup 123]I]IDAM), has been developed for selective single-photon emission tomography (SPET) imaging of SERT. In vitro binding studies suggest a high selectivity of IDAM for SERT (K[sub i]=0.097 nM), with considerably lower affinities for norepinephrine and dopamine transporters (NET K[sub i]= 234 nM and DAT K[sub i]>10 [mu]M, respectively). In this study the biodistribution of SERT in the baboon brain was investigated in vivo using [[sup 123]I]IDAM and SPET imaging. Dynamic sequences of SPET scans were performed on three female baboons (Papio anubis) after injection of 555 MBq of [[sup 123]I]IDAM. Displacing doses (1 mg/kg) of the selective SERT ligand (+)McN5652 were administered 90-120 min after injection of [[sup 123]I]IDAM. Similar studies were performed using a NET inhibitor, nisoxetine, and a DAT blocker, methylphenidate. After 60-120 min, the regional distribution of tracer within the brain reflected the characteristic distribution of SERT, with the highest uptake in the midbrain area (hypothalamus, raphe nucleus, substantia nigra), and the lowest uptake in the cerebellum (an area presumed free of SERT). Peak specific binding in the midbrain occurred at 120 min, with a ratio to the cerebellum of 1.80[+-]0.13. At 30 min, 85% of the radioactivity in the blood was metabolite. Following injection of a competing SERT ligand, (+)McN5652, the tracer exhibited rapid washout from areas with high concentrations of SERT (dissociation rate constant in the midbrain, averaged over three baboons, k[sub off]=0.025[+-]0.002 min[sup -1]), while the cerebellar activity distribution was undisturbed (washout rate 0.0059[+-] 0.0003 min[sup -1]). Calculation of tracer washout rate pixel-by-pixel enabled the generation of parametric images of the dissociation rate constant. Similar studies using nisoxetine and methylphenidate had no effect on the distribution of [[sup 123]I]IDAM in the brain
Energy Technology Data Exchange (ETDEWEB)
Lee, J. H.; Ji, D. Y. [Inha University, Incheon (Korea, Republic of); Moon, B. S.; Lee, T. S.; Lee, D. H.; Lee, K. C.; Ahn, G. I.; Yang, S. D.; Choi, C. W.; Jun, K. S. [KIRAMS, Seoul (Korea, Republic of)
2005-07-01
Photofrin has currently been approved for general use by licensing authorities to treatment for solid tumor and cancer using photodynamic therapy (PDT) that treat to photochemical effect induced by light. Recently, meso-tetra(3-hydroxyphenyl)porphyrin has been developed as one of best tumor localizer and also shown a favorable tissue distribution. We have studied to develop I-123 labeled meso-tetra(3-methoxyphenyl)porphyrins for tumor imaging. We have studied to develop iodine-123 labeled meso-tetra(3-carboxymethoxy phenyl)porphyrin for tumor imaging agent. The radioiodinated porphyrin compound was obtained by the iodination reaction of tin precursor (50 ig) of porphyrin with Na-123I (200 {mu}L, 100-200 mCi), in the presence of peracetic acid (40 {mu}L) in ethanol. Iodine-123 labeled porphyrin derivative was obtained in 20-30% radiochemical yield and purified by HPLC at 2 mL/min using EtOH/water gradient condition and the fraction at 24-26 min was collected and characterized to desired compound by co injection with cold porphyrin analogue. Total time was around 120 min. The in vitro and in vivo of I-123 labeled porphyrin derivative is under studying.
International Nuclear Information System (INIS)
Lee, J. H.; Ji, D. Y.; Moon, B. S.; Lee, T. S.; Lee, D. H.; Lee, K. C.; Ahn, G. I.; Yang, S. D.; Choi, C. W.; Jun, K. S.
2005-01-01
Photofrin has currently been approved for general use by licensing authorities to treatment for solid tumor and cancer using photodynamic therapy (PDT) that treat to photochemical effect induced by light. Recently, meso-tetra(3-hydroxyphenyl)porphyrin has been developed as one of best tumor localizer and also shown a favorable tissue distribution. We have studied to develop I-123 labeled meso-tetra(3-methoxyphenyl)porphyrins for tumor imaging. We have studied to develop iodine-123 labeled meso-tetra(3-carboxymethoxy phenyl)porphyrin for tumor imaging agent. The radioiodinated porphyrin compound was obtained by the iodination reaction of tin precursor (50 ig) of porphyrin with Na-123I (200 μL, 100-200 mCi), in the presence of peracetic acid (40 μL) in ethanol. Iodine-123 labeled porphyrin derivative was obtained in 20-30% radiochemical yield and purified by HPLC at 2 mL/min using EtOH/water gradient condition and the fraction at 24-26 min was collected and characterized to desired compound by co injection with cold porphyrin analogue. Total time was around 120 min. The in vitro and in vivo of I-123 labeled porphyrin derivative is under studying
National network of environment radioactivity measurements. Press kit
International Nuclear Information System (INIS)
2010-01-01
This document first presents the objectives, challenges, context, operation and actors of the French national network of environment radioactivity measurements. It discusses the reasons for these measurements, the way they are performed, who perform them and how they are transmitted to the national network. It describes the quality policy for these measurements, and how this network is at the service of authorities, experts and population. It outlines the originality of the French approach within the European Union, and how this network takes the population expectations and their evolution into account
Prediction of the Secondary Structure of HIV-1 gp120
DEFF Research Database (Denmark)
Hansen, Jan; Lund, Ole; Nielsen, Jens O.
1996-01-01
Fourier transform infrared spectroscopy. The predicted secondary structure of gp120 compared well with data from NMR analysis of synthetic peptides from the V3 loop and the C4 region. As a first step towards modeling the tertiary structure of gp120, the predicted secondary structure may guide the design......The secondary structure of HIV-1 gp120 was predicted using multiple alignment and a combination of two independent methods based on neural network and nearest-neighbor algorithms. The methods agreed on the secondary structure for 80% of the residues in BH10 gp120. Six helices were predicted in HIV...
International Nuclear Information System (INIS)
Lagunas-Solar, M.C.
1985-01-01
The use of iodine-123 in nuclear medicine procedures is well documented in the scientific literature. Also, several methods for its production based on accelerator techniques have been described. Indirectly made 123 I via the 127 I(p,5n) 123 Xe → 123 I reaction produces 123 I of > 99.9% radionuclidic purity, with only 125 I ( 123 I production were developed at the University of California at Davis, where since 1974 the 76-in. isochronous cyclotron of the Crocker Nuclear Laboratory has been used for routine biweekly production of high-purity no-carrier-added 123 I
40 CFR 81.120 - Middle Tennessee Intrastate Air Quality Control Region.
2010-07-01
... Quality Control Region. 81.120 Section 81.120 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.120 Middle Tennessee Intrastate Air Quality Control Region. The Middle Tennessee Intrastate Air Quality Control Region consists of the territorial area encompassed by...
40 CFR 405.120 - Applicability; description of the dry whey subcategory.
2010-07-01
... whey subcategory. 405.120 Section 405.120 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS DAIRY PRODUCTS PROCESSING POINT SOURCE CATEGORY Dry Whey Subcategory § 405.120 Applicability; description of the dry whey subcategory. The provisions of this subpart...
Wireless sensor network and monitoring for environment
Han, Liang
2011-01-01
In recent years, wireless sensor network technology is developing at a surprisingly high speed. More and more fields have started to use the wireless sensor network technology and find the advantages of WSN, such as military applications, environmental observing and forecasting system, medical care, smart home, structure monitoring. The world Environmental Summit in Copenhagen on 2010 has just concluded that environment has become the world’s main concern. But regrettably the summit did no...
Striatal [123I]β-CIT SPECT and prefrontal cognitive functions in Parkinson's disease
International Nuclear Information System (INIS)
Mueller, U.; Waechter, T.; Barthel, H.; Reuter, M.; Cramon, D.Y. von
2000-01-01
Twenty non-demented patients with idiopathic Parkinson's disease (PD) underwent single photon emission computed tomography (SPECT) with [ 123 I]β-CIT to further investigate the contribution of nigrostriatal dysfunction to cognitive and motor deficits. Compared to matched controls PD patients showed normal verbal intelligence, short-term memory and phasic alertness. There were significant (p 123 I]β-CIT SPECT. These results support the view that the striatum is part of a neuronal network that is mediating prefrontal cognitive functions. (author)
An Adaptive Learning Based Network Selection Approach for 5G Dynamic Environments
Directory of Open Access Journals (Sweden)
Xiaohong Li
2018-03-01
Full Text Available Networks will continue to become increasingly heterogeneous as we move toward 5G. Meanwhile, the intelligent programming of the core network makes the available radio resource be more changeable rather than static. In such a dynamic and heterogeneous network environment, how to help terminal users select optimal networks to access is challenging. Prior implementations of network selection are usually applicable for the environment with static radio resources, while they cannot handle the unpredictable dynamics in 5G network environments. To this end, this paper considers both the fluctuation of radio resources and the variation of user demand. We model the access network selection scenario as a multiagent coordination problem, in which a bunch of rationally terminal users compete to maximize their benefits with incomplete information about the environment (no prior knowledge of network resource and other users’ choices. Then, an adaptive learning based strategy is proposed, which enables users to adaptively adjust their selections in response to the gradually or abruptly changing environment. The system is experimentally shown to converge to Nash equilibrium, which also turns out to be both Pareto optimal and socially optimal. Extensive simulation results show that our approach achieves significantly better performance compared with two learning and non-learning based approaches in terms of load balancing, user payoff and the overall bandwidth utilization efficiency. In addition, the system has a good robustness performance under the condition with non-compliant terminal users.
Mobility management for SIP sessions in a heterogeneous network environment
Romijn, Willem A.; Plas, Dirk-Jaap; Bijwaard, D.; Meeuwissen, Erik; van Ooijen, Gijs
2004-01-01
The next generation of communication networks is expected to create a heterogeneous network environment encompassing an ever-increasing number of different access networks and end-user terminals that will enable the introduction of and provide access to numerous feature-rich end-user services. It is
Liner shipping hub network design in a competitive environment
DEFF Research Database (Denmark)
Gelareh, Shahin; Nickel, Stefan; Pisinger, David
2010-01-01
A mixed integer programming formulation is proposed for hub-and-spoke network design in a competitive environment. It addresses the competition between a newcomer liner service provider and an existing dominating operator, both operating on hub-and-spoke networks. The newcomer company maximizes i...
Network monitoring module of BES III system environment
International Nuclear Information System (INIS)
Song Liwen; Zhao Jingwei; Zhang Bingyun
2002-01-01
In order to meet the needs of the complicated network architecture of BES III (Beijing Spectrometer III) and make sure normal online running in the future, it is necessary to develop a multi-platforms Network Monitoring Tool which can help system administrator monitor and manage BES III network. The author provides a module that can monitor not only the traffic of switch-router's ports but also the performance status of key devices in the network environment, meanwhile it can also give warning to manager and submit the related reports. the great sense, the theory basis, the implementing method and the graph in formation of this tool will be discussed
International Nuclear Information System (INIS)
Castro, D.J.; Saxton, R.E.; Markley, J.; Foote, C.S.; Fetterman, H.R.; Castro, D.J.; Ward, P.H.
1990-01-01
Recent studies demonstrated that the cationic, mitochondrial-specific dye Rhodamine-123 (Rh-123), is an efficient tumor photosensitizer for Argon laser treatment of human cancer cells both in vitro and in tumors grown as xenografts in athymic mice. To demonstrate the photodynamic mechanism of action of this reaction, the intracellular role of oxygen and temperature changes in treated cells have to be defined. In the current study, a large panel of human tumor cell lines of diverse histologic origin were tested for in vitro sensitivity to Rh-123 and the Argon laser (514.5 nm) in oxygen, deuterium oxide (D2O), and nitrogen (N2) environment. Tumor cells in suspension were first sensitized to Rh-123 (1 or 20 micrograms/ml for 1 hour), cooled on ice to 4 degrees C, and then exposed to the Argon laser (delta T = 14 +/- 1 degree C). Cell proliferation measured by [3H]-thymidine uptake 24 hours after sensitization with Rh-123 and laser treatment was significantly decreased in tumor cells kept in oxygen and D2O atmospheres. No decrease in DNA synthesis was seen in Rh-123 and laser treated cells kept in an N2 environment. Control tumor cells treated with Rh-123 or the Argon laser separately did not show any decreased [3H]-thymidine uptake in oxygen, D2O or N2 environment. These results provide evidence of a photodynamic process since Rh-123 sensitization and Argon laser activation occur at nonthermal levels of energy and are oxygen dependent. The high effectiveness of this technique of photodynamic therapy with the Argon laser, and low toxicity of Rh-123 could make its clinical use very attractive for the treatment of superficial malignancies
MUPBED - interworking challenges in a multi-domain and multi-technology network environment
DEFF Research Database (Denmark)
Foisel, Hans-Martin; Spaeth, Jan; Cavazzoni, Carlo
2007-01-01
Todays data transport networks are evolving continuously towards customer oriented and application aware networks. This evolution happens in Europe in a highly diverse network environment, covering multiple network domains, layers, technologies, control and management approaches. In this paper...
A Neural Network Model to Learn Multiple Tasks under Dynamic Environments
Tsumori, Kenji; Ozawa, Seiichi
When environments are dynamically changed for agents, the knowledge acquired in an environment might be useless in future. In such dynamic environments, agents should be able to not only acquire new knowledge but also modify old knowledge in learning. However, modifying all knowledge acquired before is not efficient because the knowledge once acquired may be useful again when similar environment reappears and some knowledge can be shared among different environments. To learn efficiently in such environments, we propose a neural network model that consists of the following modules: resource allocating network, long-term & short-term memory, and environment change detector. We evaluate the model under a class of dynamic environments where multiple function approximation tasks are sequentially given. The experimental results demonstrate that the proposed model possesses stable incremental learning, accurate environmental change detection, proper association and recall of old knowledge, and efficient knowledge transfer.
Applications of Wireless Sensor Networks in Marine Environment Monitoring: A Survey
Xu, Guobao; Shen, Weiming; Wang, Xianbin
2014-01-01
With the rapid development of society and the economy, an increasing number of human activities have gradually destroyed the marine environment. Marine environment monitoring is a vital problem and has increasingly attracted a great deal of research and development attention. During the past decade, various marine environment monitoring systems have been developed. The traditional marine environment monitoring system using an oceanographic research vessel is expensive and time-consuming and has a low resolution both in time and space. Wireless Sensor Networks (WSNs) have recently been considered as potentially promising alternatives for monitoring marine environments since they have a number of advantages such as unmanned operation, easy deployment, real-time monitoring, and relatively low cost. This paper provides a comprehensive review of the state-of-the-art technologies in the field of marine environment monitoring using wireless sensor networks. It first describes application areas, a common architecture of WSN-based oceanographic monitoring systems, a general architecture of an oceanographic sensor node, sensing parameters and sensors, and wireless communication technologies. Then, it presents a detailed review of some related projects, systems, techniques, approaches and algorithms. It also discusses challenges and opportunities in the research, development, and deployment of wireless sensor networks for marine environment monitoring. PMID:25215942
Clinical uses of I-123 produced by 127I(p, 5n)123Xe to 123I reaction in NIRS
International Nuclear Information System (INIS)
Saegusa, Kenji; Arimizu, Noboru; Uchiyama, Guio; Tateno, Yukio; Rikitake, Tomoyuki.
1978-01-01
123 I capsules produced by NIRS which are believed to be uncontaminated by radioactive impurities other than 125 I were compared with commercial 123 I capsules regarding gamma-ray spectra, thyroid phantoms and clinical scintigrams. Absorbed radiation doses of 123 I contaminated with nuclides other than 123 I to thyroid and whole body were also estimated. Regarding gamma-ray spectra, any nuclides other than 125 I(0.53%) did not contaminate in 123 I produced by NIRS, and it was superior to commercial capsules. Regarding phantoms and clinical scintigrams, background counts around the thyroid gland seemed to be slightly higher in commercial capsules than that produced by NIRS because of contamination with other nuclides. Exposed doses in thyroid and whole body were counted. Ratios in thyroid and whole body were increased by 30% and 9%, respectively in 123 I produced by NIRS because of contamination with 0.53% of 125 I in the event that the intake ratio of thyroid was determined as 25%. In commercial capsules the doses in thyroid and whole body were increased by 500% and 150%, respectively. Doses of commercial capsules and NIRS capsules were 7.87 rad and 1.72 rad, respectively per 100 μCi in thyroid. The ratio of NIRS capsules to commercial capsules in thyroid was 1/4.6, and that in the whole body was less than 1/2. (Ichikawa, K.)
Mobile Sensor Networks for Inspection Tasks in Harsh Industrial Environments
Mulder, Jacob; Wang, Xinyu; Ferwerda, Franke; Cao, Ming
Recent advances in sensor technology have enabled the fast development of mobile sensor networks operating in various unknown and sometimes hazardous environments. In this paper, we introduce one integrative approach to design, analyze and test distributed control algorithms to coordinate a network
Evolution of regulatory networks towards adaptability and stability in a changing environment
Lee, Deok-Sun
2014-11-01
Diverse biological networks exhibit universal features distinguished from those of random networks, calling much attention to their origins and implications. Here we propose a minimal evolution model of Boolean regulatory networks, which evolve by selectively rewiring links towards enhancing adaptability to a changing environment and stability against dynamical perturbations. We find that sparse and heterogeneous connectivity patterns emerge, which show qualitative agreement with real transcriptional regulatory networks and metabolic networks. The characteristic scaling behavior of stability reflects the balance between robustness and flexibility. The scaling of fluctuation in the perturbation spread shows a dynamic crossover, which is analyzed by investigating separately the stochasticity of internal dynamics and the network structure differences depending on the evolution pathways. Our study delineates how the ambivalent pressure of evolution shapes biological networks, which can be helpful for studying general complex systems interacting with environments.
Directory of Open Access Journals (Sweden)
Dongkyun Kim
2017-12-01
Full Text Available Recent development of distributed cloud environments requires advanced network infrastructure in order to facilitate network automation, virtualization, high performance data transfer, and secured access of end-to-end resources across regional boundaries. In order to meet these innovative cloud networking requirements, software-defined wide area network (SD-WAN is primarily demanded to converge distributed cloud resources (e.g., virtual machines (VMs in a programmable and intelligent manner over distant networks. Therefore, this paper proposes a logically isolated networking scheme designed to integrate distributed cloud resources to dynamic and on-demand virtual networking over SD-WAN. The performance evaluation and experimental results of the proposed scheme indicate that virtual network convergence time is minimized in two different network models such as: (1 an operating OpenFlow-oriented SD-WAN infrastructure (KREONET-S which is deployed on the advanced national research network in Korea, and (2 Mininet-based experimental and emulated networks.
Conducting network penetration and espionage in a global environment
Middleton, Bruce
2014-01-01
When it's all said and done, penetration testing remains the most effective way to identify security vulnerabilities in computer networks. Conducting Network Penetration and Espionage in a Global Environment provides detailed guidance on how to perform effective penetration testing of computer networks-using free, open source, and commercially available tools, including Backtrack, Metasploit, Wireshark, Nmap, Netcat, and Nessus. It also considers exploits and other programs using Python, PERL, BASH, PHP, Ruby, and Windows PowerShell.The book taps into Bruce Middleton's decades of experience wi
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false State. 1280.123 Section 1280.123 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Definitions § 1280.123 State. State means each of the 50 States and the District of Columbia. ...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1260.123 Section 1260.123 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Definitions § 1260.123 Research. Research means studies relative to the...
International Nuclear Information System (INIS)
Rellas, J.S.; Corbett, J.R.; Kulkarni, P.
1983-01-01
The ability of an iodinated fatty acid, iodine-123 phenylpentadecanoic acid (1-123 PPA), and single-photon emission computed tomography (SPECT) to detect myocardium injured by temporary or permanent coronary arterial occlusion was evaluated. In 5 control dogs, 11 dogs that underwent 90 to 120 minutes of fixed left anterior descending coronary artery (LAD) occlusion, and 8 dogs that underwent 90 minutes of temporary LAD occlusion and up to 90 minutes of reflow, 2 to 6 mCi of I-123 PPA were injected and the dogs were imaged with SPECT. Control dogs showed relatively uniform uptake and clearance of I-123 PPA in similar left ventricular (LV) regions. Dogs with permanent LAD occlusion were identified by computer algorithm as having regions of decreased I-123 PPA uptake in the infarct-related area and a reduced rate of I-123 PPA clearance (-9.4% in infarct sectors [washin], +3.7% in sectors adjacent to the area of infarction, and +15.4% in control LV sectors [p less than 0.01]). Dogs with temporary LAD occlusion and reperfusion had decreased clearance of I-123 PPA from the regions with infarction; I-123 PPA clearance was -5.2 +/- 16.4% in infarct sectors, 12.7 +/- 7.4% in periinfarct zones, and 30.4 +/- 12% in control LV regions. These data demonstrate that tomographic analysis of I-123 PPA uptake and clearance permits the relatively noninvasive detection of LV myocardium injured by permanent or temporary LAD occlusion and reperfusion
40 CFR 429.120 - Applicability; description of the sawmills and planing mills subcategory.
2010-07-01
... sawmills and planing mills subcategory. 429.120 Section 429.120 Protection of Environment ENVIRONMENTAL... CATEGORY Sawmills and Planing Mills Subcategory § 429.120 Applicability; description of the sawmills and planing mills subcategory. This subpart applies to discharges to waters of the United States and to the...
Liner Shipping Hub Network Design in a Competitive Environment
DEFF Research Database (Denmark)
Gelareh, Shahin; Nickel, Stefan; Pisinger, David
A new mixed integer programming formulation is proposed for hub-and-spoke network design in a competitive environment. It addresses competition between a newcomer liner service provider and an alliance, both operating on hub-and-spoke networks. The newcomer company maximizes its market share...... — proportional to service time and transportation cost —by locating a predefined number of hubs at candidate ports and designing its network. While general-purpose solvers do not solve instances of even small size, an accelerated lagrangian method coupled with a primal heuristic obtains very good bounds. Our...
Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism
Energy Technology Data Exchange (ETDEWEB)
Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro [Kagoshima Univ. (Japan). Faculty of Medicine
1999-12-01
Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method ({mu}=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)
Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism
International Nuclear Information System (INIS)
Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro
1999-01-01
Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method (μ=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)
The challenge of social networking in the field of environment and health.
van den Hazel, Peter; Keune, Hans; Randall, Scott; Yang, Aileen; Ludlow, David; Bartonova, Alena
2012-06-28
The fields of environment and health are both interdisciplinary and trans-disciplinary, and until recently had little engagement in social networking designed to cross disciplinary boundaries. The EU FP6 project HENVINET aimed to establish integrated social network and networking facilities for multiple stakeholders in environment and health. The underlying assumption is that increased social networking across disciplines and sectors will enhance the quality of both problem knowledge and problem solving, by facilitating interactions. Inter- and trans-disciplinary networks are considered useful for this purpose. This does not mean that such networks are easily organized, as openness to such cooperation and exchange is often difficult to ascertain. Different methods may enhance network building. Using a mixed method approach, a diversity of actions were used in order to investigate the main research question: which kind of social networking activities and structures can best support the objective of enhanced inter- and trans-disciplinary cooperation and exchange in the fields of environment and health. HENVINET applied interviews, a role playing session, a personal response system, a stakeholder workshop and a social networking portal as part of the process of building an interdisciplinary and trans-disciplinary network. The interviews provided support for the specification of requirements for an interdisciplinary and trans-disciplinary network. The role playing session, the personal response system and the stakeholder workshop were assessed as useful tools in forming such network, by increasing the awareness by different disciplines of other's positions. The social networking portal was particularly useful in delivering knowledge, but the role of the scientist in social networking is not yet clear. The main challenge in the field of environment and health is not so much a lack of scientific problem knowledge, but rather the ability to effectively communicate, share
Uranium mining and metallurgy library information service under the network environment
International Nuclear Information System (INIS)
Tang Lilei
2012-01-01
This paper analyzes the effect of the network environment on the uranium mining and metallurgy of the information service. Introduces some measures such as strengthening professional characteristic literature resources construction, changing the service mode, building up information navigation, deepening service, meet the individual needs of users, raising librarian's quality, promoting the co-construction and sharing of library information resources, and puts forward the development idea of uranium mining and metallurgy library information service under the network environment. (author)
Directory of Open Access Journals (Sweden)
Shawq Malik Mehibs
2017-12-01
Full Text Available Cloud computing is distributed architecture, providing computing facilities and storage resource as a service over the internet. This low-cost service fulfills the basic requirements of users. Because of the open nature and services introduced by cloud computing intruders impersonate legitimate users and misuse cloud resource and services. To detect intruders and suspicious activities in and around the cloud computing environment, intrusion detection system used to discover the illegitimate users and suspicious action by monitors different user activities on the network .this work proposed based back propagation artificial neural network to construct t network intrusion detection in the cloud environment. The proposed module evaluated with kdd99 dataset the experimental results shows promising approach to detect attack with high detection rate and low false alarm rate
Lin, Jian-Wei; Huang, Hsieh-Hong; Chuang, Yuh-Shy
2015-01-01
An e-learning environment that supports social network awareness (SNA) is a highly effective means of increasing peer interaction and assisting student learning by raising awareness of social and learning contexts of peers. Network centrality profoundly impacts student learning in an SNA-related e-learning environment. Additionally,…
Dynamic Optical Networks for Future Internet Environments
Matera, Francesco
2014-05-01
This article reports an overview on the evolution of the optical network scenario taking into account the exponential growth of connected devices, big data, and cloud computing that is driving a concrete transformation impacting the information and communication technology world. This hyper-connected scenario is deeply affecting relationships between individuals, enterprises, citizens, and public administrations, fostering innovative use cases in practically any environment and market, and introducing new opportunities and new challenges. The successful realization of this hyper-connected scenario depends on different elements of the ecosystem. In particular, it builds on connectivity and functionalities allowed by converged next-generation networks and their capacity to support and integrate with the Internet of Things, machine-to-machine, and cloud computing. This article aims at providing some hints of this scenario to contribute to analyze impacts on optical system and network issues and requirements. In particular, the role of the software-defined network is investigated by taking into account all scenarios regarding data centers, cloud computing, and machine-to-machine and trying to illustrate all the advantages that could be introduced by advanced optical communications.
Nakagawa, M.; Akano, K.; Kobayashi, T.; Sekiguchi, Y.
2017-09-01
Image-based virtual reality (VR) is a virtual space generated with panoramic images projected onto a primitive model. In imagebased VR, realistic VR scenes can be generated with lower rendering cost, and network data can be described as relationships among VR scenes. The camera network data are generated manually or by an automated procedure using camera position and rotation data. When panoramic images are acquired in indoor environments, network data should be generated without Global Navigation Satellite Systems (GNSS) positioning data. Thus, we focused on image-based VR generation using a panoramic camera in indoor environments. We propose a methodology to automate network data generation using panoramic images for an image-based VR space. We verified and evaluated our methodology through five experiments in indoor environments, including a corridor, elevator hall, room, and stairs. We confirmed that our methodology can automatically reconstruct network data using panoramic images for image-based VR in indoor environments without GNSS position data.
Directory of Open Access Journals (Sweden)
M. Nakagawa
2017-09-01
Full Text Available Image-based virtual reality (VR is a virtual space generated with panoramic images projected onto a primitive model. In imagebased VR, realistic VR scenes can be generated with lower rendering cost, and network data can be described as relationships among VR scenes. The camera network data are generated manually or by an automated procedure using camera position and rotation data. When panoramic images are acquired in indoor environments, network data should be generated without Global Navigation Satellite Systems (GNSS positioning data. Thus, we focused on image-based VR generation using a panoramic camera in indoor environments. We propose a methodology to automate network data generation using panoramic images for an image-based VR space. We verified and evaluated our methodology through five experiments in indoor environments, including a corridor, elevator hall, room, and stairs. We confirmed that our methodology can automatically reconstruct network data using panoramic images for image-based VR in indoor environments without GNSS position data.
AGENT-BASED NEGOTIATION PLATFORM IN COLLABORATIVE NETWORKED ENVIRONMENT
Directory of Open Access Journals (Sweden)
Adina-Georgeta CREȚAN
2014-05-01
Full Text Available This paper proposes an agent-based platform to model and support parallel and concurrent negotiations among organizations acting in the same industrial market. The underlying complexity is to model the dynamic environment where multi-attribute and multi-participant negotiations are racing over a set of heterogeneous resources. The metaphor Interaction Abstract Machines (IAMs is used to model the parallelism and the non-deterministic aspects of the negotiation processes that occur in Collaborative Networked Environment.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is so...
Lightweight context aware routing in wireless sensor networks for environments
International Nuclear Information System (INIS)
Aijaz, S.
2015-01-01
Design and implementation of a WSN (Wireless Sensor Network) that can efficiently work for a longer time period must include identification of the deployment environment context and to conform to the behavior of the sensor nodes. The context information when treated with evaluation factor becomes a process of context awareness and the evaluation factor is called the context attribute. In this paper, we consider the context factor of energy. The paper identifies analyses and evaluates efficiency of two when used in a context aware environment. Furthermore, the study also highlights the strengths and weaknesses of sensor SPIN (Sensor Protocol for Information via Negotiation) and LEACH (Low Energy Adaptive Clustering Hierarchy) protocols with respect to the support for WSN with heavy network traffic conditions. The performance has been evaluated in terms of energy efficiency, data packet transmission, network status, data management, reliability, etc. (author)
Developing a virtualised testbed environment in preparation for testing of network based attacks
CSIR Research Space (South Africa)
Van Heerden, RP
2013-11-01
Full Text Available Computer network attacks are difficult to simulate due to the damage they may cause to live networks and the complexity required simulating a useful network. We constructed a virtualised network within a vSphere ESXi environment which is able...
On library information resources construction under network environment
International Nuclear Information System (INIS)
Guo Huifang; Wang Jingjing
2014-01-01
Information resources construction is the primary task and critical measures for libraries. In the 2lst century, the knowledge economy era, with the continuous development of computer network technology, information resources have become an important part of libraries which have been a significant indicator of its capacity construction. The development of socialized Information, digitalization and internalization has put forward new requirements for library information resources construction. This paper describes the impact of network environment on construction of library information resources and proposes the measures of library information resources. (authors)
Metabolism of 123I-FP-CIT in humans
International Nuclear Information System (INIS)
Tanaka, Akihiro; Okano, Kyoko; Tamagami, Hiroshi
1999-01-01
The metabolism of N-(3-fluoropropyl)-2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-FP-CIT) in healthy humans was studied. Plasma and urine samples, obtained after i.v. administration of 123 I-FP-CIT, were analyzed using the two-dimensional thin-layer chromatography technique. Eleven radiochemical components were detected in both plasma and urine, and four of them were the parent 123 I-FP-CIT and its metabolites, N-(3-fluoropropyl)-2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-acid), 2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-acid) and 2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-CIT). These four identified radiochemical components occupied about 80% or more in ratio of the radiochemical components in the plasma and urine. In the metabolites of 123 I-FP-CIT, the high polar metabolites- 123 I-acid and 123 I-nor-acid-were found to be the major components, while lipophilic 123 I-nor-CIT was a minor component. Free iodide ( 123 I - ) was not found in the plasma or urine. Thus, the main metabolic reactions which 123 I-FP-CIT undergoes in humans seem to be hydrolysis of the ester bond and N-dealkylation. In vivo deiodination of 123 I-FP-CIT was found to be minimum. Current results suggest that the metabolites of 123 I-FP-CIT hardly influence evaluation of the dopamine transporter in the human brain. (author)
Networked Mobilities and Performative Urban Environments
DEFF Research Database (Denmark)
Jensen, Ole B.
, an increasing number of such mobile practices are mediated by technologies of tangible and less tangible sorts. Thus by focusing on the complex relationship between material and virtual technologies within the sphere of mobility it is shown that we need to move beyond dichotomies of; global or local, nomad...... or sedentary, digital or material. The paper investigates the meaning of mobility and the potential in mediation and technologies to enhance the experiences and interaction in relation to urban transit spaces. In understanding the importance of mediation, global-local interactions, networks....... By studying embedded technologies and ‘ambient environments' we increase our knowledge about the over layering of the material environment with digital technologies. The presences of GPS, mediated surfaces, mobile agents (robots), RFID and other technologies that all relate to contemporary mobility practices...
[A Phase 1 study of beta-methyl-p-(123I)-iodophenyl-pentadecanoic acid (123I-BMIPP)].
Torizuka, K; Yonekura, Y; Nishimura, T; Tamaki, N; Uehara, T; Ikekubo, K; Hino, M
1991-07-01
Phase 1 study of beta-methyl-p-(123I)-iodophenylpentadecanoic acid (123I-BMIPP), a new radiopharmaceutical developed for the evaluation of myocardial fatty acid metabolism, was performed in six normal volunteers to evaluate its biodistribution and safety. After intravenous injection of 111 MBq of 123I-BMIPP, the agent accumulated to the myocardium rapidly (5.4 +/- 0.6% at 1.5 hr after injection) and was washed-out slowly (5.1 +/- 0.4% at 3.0hr). 123I-BMIPP demonstrated no significant accumulation to any specific organs other than myocardium, liver and muscle. Myocardium was clearly visualized in the planar and SPECT images obtained 30 min and 3 hrs after injection. The absorption doses from 123I-BMIPP estimated by MIRD method were lower than those from 201Tl in all organs. Neither adverse reactions nor abnormal clinical laboratory findings were found in the safety evaluation. These results suggest 123I-BMIPP is a promising agent for evaluating myocardial fatty acid metabolism.
Performance Analysis of Routing Protocols in Ad-hoc and Sensor Networking Environments
Directory of Open Access Journals (Sweden)
L. Gavrilovska
2009-06-01
Full Text Available Ad-hoc and sensor networks are becoming an increasingly popular wireless networking concepts lately. This paper analyzes and compares prominent routing schemes in these networking environments. The knowledge obtained can serve users to better understand short range wireless network solutions thus leading to options for implementation in various scenarios. In addition, it should aid researchers develop protocol improvements reliable for the technologies of interest.
Application of local area network technology in an engineering environment
International Nuclear Information System (INIS)
Powell, A.D.; Sokolowski, M.A.
1990-01-01
This paper reports on the application of local area network technology in an engineering environment. Mobil Research and Development Corporation Engineering, Dallas, texas has installed a local area network (LAN) linking over 85 microcomputers. This network, which has been in existence for more than three years, provides common access by all engineers to quality output devices such as laser printers and multi-color pen plotters; IBM mainframe connections; electronic mail and file transfer; and common engineering program. The network has been expanded via a wide area ethernet network to link the Dallas location with a functionally equivalent LAN of over 400 microcomputers in Princeton, N.J. Additionally, engineers on assignment at remote areas in Europe, U.S., Africa and project task forces have dial-in access to the network via telephone lines
A Neural Network Approach to Fluid Quantity Measurement in Dynamic Environments
Terzic, Edin; Nagarajah, Romesh; Alamgir, Muhammad
2012-01-01
Sloshing causes liquid to fluctuate, making accurate level readings difficult to obtain in dynamic environments. The measurement system described uses a single-tube capacitive sensor to obtain an instantaneous level reading of the fluid surface, thereby accurately determining the fluid quantity in the presence of slosh. A neural network based classification technique has been applied to predict the actual quantity of the fluid contained in a tank under sloshing conditions. In A neural network approach to fluid quantity measurement in dynamic environments, effects of temperature variations and contamination on the capacitive sensor are discussed, and the authors propose that these effects can also be eliminated with the proposed neural network based classification system. To examine the performance of the classification system, many field trials were carried out on a running vehicle at various tank volume levels that range from 5 L to 50 L. The effectiveness of signal enhancement on the neural network base...
40 CFR 122.25 - Aquaculture projects (applicable to State NPDES programs, see § 123.25).
2010-07-01
... DISCHARGE ELIMINATION SYSTEM Permit Application and Special NPDES Program Requirements § 122.25 Aquaculture... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Aquaculture projects (applicable to State NPDES programs, see § 123.25). 122.25 Section 122.25 Protection of Environment ENVIRONMENTAL...
40 CFR 122.27 - Silvicultural activities (applicable to State NPDES programs, see § 123.25).
2010-07-01
... POLLUTANT DISCHARGE ELIMINATION SYSTEM Permit Application and Special NPDES Program Requirements § 122.27... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Silvicultural activities (applicable to State NPDES programs, see § 123.25). 122.27 Section 122.27 Protection of Environment...
Social networks and online environments: when science and practice co-evolve
Rosen, Devan; Barnett, George A.; Kim, Jang Hyun
2011-01-01
The science of social network analysis has co-evolved with the development of online environments and computer-mediated communication. Unique and precise data available from computer and information systems have allowed network scientists to explore novel social phenomena and develop new methods. Additionally, advances in the structural analysis and visualization of computer-mediated social networks have informed developers and shaped the design of social media tools. This article reviews som...
A Pseudomonas putida strain genetically engineered for 1,2,3-trichloropropane bioremediation
Samin, Ghufrana; Pavlova, Martina; Arif, Muhammad; Postema, Christiaan P; Damborsky, Jiri; Janssen, Dick B
1,2,3-Trichloropropane (TCP) is a toxic compound that is recalcitrant to biodegradation in the environment. Attempts to isolate TCP-degrading organisms using enrichment cultivation have failed. A potential biodegradation pathway starts with hydrolytic dehalogenation to 2,3-dichloro-1-propanol (DCP),
Energy Technology Data Exchange (ETDEWEB)
Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko (Toho Univ., Tokyo (Japan). School of Medicine)
1992-09-01
We studied the clinical usefulness of I[sup 123]-IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I[sup 123]-IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p<0.01). In all groups except the migraine, we could find abnormal findings in more than 90% of the patients. Out of 28 patients without focal findings on the initial CT scanning. I[sup 123]-IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I[sup 123]-IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I[sup 123]-IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I[sup 123]-IMP SPECT showed larger abnormalities in CT scanning. By using I[sup 123]-IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I[sup 123]-IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I[sup 123]-IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I[sup 123]-IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author).
King, Sharla; Greidanus, Elaine; Carbonaro, Michael; Drummond, Jane; Patterson, Steven
2009-04-28
This study describes the redesign of an interprofessional team development course for health science students. A theoretical model is hypothesized as a framework for the redesign process, consisting of two themes: 1) the increasing trend among post-secondary students to participate in social networking (e.g., Facebook, Second Life) and 2) the need for healthcare educators to provide interprofessional training that results in effective communities of practice and better patient care. The redesign focused on increasing the relevance of the course through the integration of custom-designed technology to facilitate social networking during their interprofessional education. Results suggest that students in an educationally structured social networking environment can be guided to join learning communities quickly and access course materials. More research and implementation work is required to effectively develop interprofessional health sciences communities in a combined face-to-face and on-line social networking context.
Client-Server and Peer-to-Peer Ad-hoc Network for a Flexible Learning Environment
Directory of Open Access Journals (Sweden)
Ferial Khaddage
2011-01-01
Full Text Available Peer-to-Peer (P2P networking in a mobile learning environment has become a popular topic of research. One of the new emerging research ideas is on the ability to combine P2P network with server-based network to form a strong efficient portable and compatible network infrastructure. This paper describes a unique mobile network architecture, which reflects the on-campus students’ need for a mobile learning environment. This can be achieved by combining two different networks, client-server and peer-to-peer ad-hoc to form a sold and secure network. This is accomplished by employing one peer within the ad-hoc network to act as an agent-peer to facilitate communication and information sharing between the two networks. It can be implemented without any major changes to the current network technologies, and can combine any wireless protocols such as GPRS, Wi-Fi, Bluetooth, and 3G.
SPECT 123-I-[FP-CIT] diagnostic in the presynaptic parkinsonism
International Nuclear Information System (INIS)
Piperkova, E.; Georgiev, R.; Dimitrova, M.; Daskalov, M.; Orosova, M.; Milanova, M.; Danon, S.
2005-01-01
Detection of loss off functional dopaminergic neurone terminals in the striatum of patients with clinically uncertain Parkinsonian Syndromes will help to differentiate the Essential Tremor (ET) from the Parkinson Syndromes related to idiopathic Parkinson's Disease (PD), Multiple System Atrophy (MSA) or Progressive Supranuclear Palsy (PSP). In these cases dopaminic medication should be avoided for patients not suffering from true parkinsonism.Objective of the study is to determine the utility of [ 123 I] FP-CIT SPECT in clinically uncertain Parkinsonian syndromes and their differentiation from ET. Materials and Methods: This prospective study involved 9 patients (4 males and 5 females, aged between 38 - 81 years) with clinically uncertain Parkinsonism. The main symptoms were tremor (n=8), gait alteration (n=6), bradykinesia (n=3) and Negro phenomena positive (n=2), or a combination of these symptoms (n=9), with subsequent follow-up of 7-8 months. Dopamine agonists and antagonists acting on the postsynaptic dopamine receptors were not accepted to interfere with 123 I-Ioflupane. All patients underwent appropriate thyroid blocking by oral administration of 120 mg potassium iodide before and after [ 123 ] I FP-CIT application. All patents underwent SPECT scans 3-4 hours after i.v. injection of 185 MBq [ 123 ] FP-CIT (DaTSCAN - Amersham) on a Diacam Gamma-Camera System (Siemens). To estimate [ 123 ] FP-CIT biodistribution whole-body scans were performed, 15 minutes and 2-3 hrs after the i.v. application of the tracer. The SPECT results were evaluated visually and semi quantitatively. The [ 123 ] FP-CIT uptake of the striatum (nucleus caudatus and putamen) was referenced to the occipital cortex and to the symmetrical ROI. The scanning procedure was completed according to strict conditions for symmetry and geometry. The filtering and reconstructing procedures if the images were performed individually for each patient to avoid artifacts and errors. In all patients CT scans
Production and application of 123I-labeled M-iodobenzylguanidine (123I-MIBG)
International Nuclear Information System (INIS)
Washburn, L.C.; Khosla, R.C.; Williams, C.C.; Gelfand, M.J.; Maxon, H.R.
1993-01-01
For the past two years the authors have been producing 123 I-MIBG for diagnosis and evaluation of neural crest tumors in both pediatric and adult patients. The method of Mock and Weiner (Appl. Radiat. Isot. 39:939-942, 1988) was used. Out of 89 attempted runs, 87 were successful in meeting the 90% radiochemical purity required for patient administration; both failures occurred during the first six months of the project. The 87 runs provided 144 pediatric doses and 48 adult doses. The radiochemical yield, not corrected for decay, was 67.7 ± 10.3% (mean ± S.D.). The radiochemical purity of the successful runs was 99.3 ± 1.3%, with 71 of the 87 runs giving a radiochemical purity of >99%. The radionuclidic purity of the I-123, obtained as sodium [ 123 I]iodide from Nordion International, was 99.985 ± 0.008%. Bacterial endotoxins, determined by the Limulus amebocyte lysate technique, were below the detectable level of 0.31 EU/mL for all batches of 123 I-MIBG. Sterility tests using both trypticase soy broth and fluid thioglycollate medium were negative for all batches except two, which showed growth of nonpathogenic microorganisms probably introduced during inoculation of the culture medium. 123 I-MIBG has thus been reliably prepared in high yield and excellent purity, and it has proved to be a valuable agent for diagnosis and evaluation of neural crest tumors in both children and adults
Renovascular hypertension screening with iodine-123 orthoiodohippurate
International Nuclear Information System (INIS)
Oppenheim, B.E.; Appledorn, C.R.; Mock, B.H.; Yune, H.Y.; Grim, C.E.
1985-01-01
Screening of 123 hypertensive patients for renovascular disease was carried out through renal studies, performed with iodine-123 ortho-iodohippurate (OIH), consisting of 214 studies performed with high-purity 123 I-OIH and 10 studies performed with 123 I-OIH contaminated with 124 I. Standard dynamic renal images and renogram curves were supplemented by functional renal images generated by computer. For the same radiation dose to the bladder, the number of detected photons with contaminated 123 I-OIH is only about one-third of that for high-purity 123 I-OIH so that for comparable studies one must use at least twice the dose with the former agent as compared with the latter. The study was hampered by erratic delivery of 123 I-OIH, which demonstrated the need for a reliable source
40 CFR 122.28 - General permits (applicable to State NPDES programs, see § 123.25).
2010-07-01
... ELIMINATION SYSTEM Permit Application and Special NPDES Program Requirements § 122.28 General permits... 40 Protection of Environment 21 2010-07-01 2010-07-01 false General permits (applicable to State NPDES programs, see § 123.25). 122.28 Section 122.28 Protection of Environment ENVIRONMENTAL PROTECTION...
Lessons learned on solar powered wireless sensor network deployments in urban, desert environments
Dehwah, Ahmad H.
2015-05-01
The successful deployment of a large scale solar powered wireless sensor network in an urban, desert environment is a very complex task. Specific cities of such environments cause a variety of operational problems, ranging from hardware faults to operational challenges, for instance due to the high variability of solar energy availability. Even a seemingly functional sensor network created in the lab does not guarantee reliable long term operation, which is absolutely necessary given the cost and difficulty of accessing sensor nodes in urban environments. As part of a larger traffic flow wireless sensor network project, we conducted several deployments in the last two years to evaluate the long-term performance of solar-powered urban wireless sensor networks in a desert area. In this article, we share our experiences in all domains of sensor network operations, from the conception of hardware to post-deployment analysis, including operational constraints that directly impact the software that can be run. We illustrate these experiences using numerous experimental results, and present multiple unexpected operational problems as well as some possible solutions to address them. We also show that current technology is far from meeting all operational constraints for these demanding applications, in which sensor networks are to operate for years to become economically appealing.
Energy Technology Data Exchange (ETDEWEB)
Gonzalez-Barrios, P.; Castro, M.; Pérez, O.; Vilaró, D.; Gutiérrez, L.
2017-07-01
Modeling genotype by environment interaction (GEI) is one of the most challenging aspects of plant breeding programs. The use of efficient trial networks is an effective way to evaluate GEI to define selection strategies. Furthermore, the experimental design and the number of locations, replications, and years are crucial aspects of multi-environment trial (MET) network optimization. The objective of this study was to evaluate the efficiency and performance of a MET network of sunflower (Helianthus annuus L.). Specifically, we evaluated GEI in the network by delineating mega-environments, estimating genotypic stability and identifying relevant environmental covariates. Additionally, we optimized the network by comparing experimental design efficiencies. We used the National Evaluation Network of Sunflower Cultivars of Uruguay (NENSU) in a period of 20 years. MET plot yield and flowering time information was used to evaluate GEI. Additionally, meteorological information was studied for each sunflower physiological stage. An optimal network under these conditions should have three replications, two years of evaluation and at least three locations. The use of incomplete randomized block experimental design showed reasonable performance. Three mega-environments were defined, explained mainly by different management of sowing dates. Late sowings dates had the worst performance in grain yield and oil production, associated with higher temperatures before anthesis and fewer days allocated to grain filling. The optimization of MET networks through the analysis of the experimental design efficiency, the presence of GEI, and appropriate management strategies have a positive impact on the expression of yield potential and selection of superior cultivars.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 71.123 Section 71.123 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PACKAGING AND TRANSPORTATION OF RADIOACTIVE MATERIAL Quality Assurance § 71.123 Test control. The licensee, certificate holder, and applicant for a CoC shall establish a test...
International Nuclear Information System (INIS)
Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko
1992-01-01
We studied the clinical usefulness of I 123 -IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I 123 -IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p 123 -IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I 123 -IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I 123 -IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I 123 -IMP SPECT showed larger abnormalities in CT scanning. By using I 123 -IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I 123 -IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I 123 -IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I 123 -IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author)
Autoradiolytic decomposition and reductant-free sodium sup 124 I- and sup 123 I-iodide
Energy Technology Data Exchange (ETDEWEB)
Sajjad, M.; Lambrecht, R.M.; Bakr, S.A. (King Faisal Specialist Hospital and Research Centre, Riyadh (Saudi Arabia). Radionuclide and Cyclotron Operations)
1990-01-01
The presence of salts and metal cations in {sup 124}I- and {sup 123}I-sodium iodide solutions separated from {sup 124}Te targets promots autoradiolytic decomposition of iodide to several different iodine species dependent upon the chemical environment. The stabilization of the radioiodine as iodide by removal of trace salts and trace metal cations and in the absence of reducing agents is described. The high specific activity {sup 123}I- and {sup 124}I-iodide is suitable for labeling antibodies, proteins and radiopharmaceuticals. (orig.).
Renal function study using I-123-OIH
International Nuclear Information System (INIS)
Yamashita, Masato; Osaka, Yosio; Aikawa, Ichiro
1989-01-01
Twenty-eight renal function studies were performed in 24 patients with renal diseases with I-123 orthoiodohippurate (I-123 OIH). Neither side effects nor abnormal laboratory values were attributable to I-123 OIH. Imaging with Tc-99m diethylene triaminepentaacetic acid (DTPA) was also performed in 20 patients within one week after I-123 imaging. Findings with I-123 OIH and Tc-99m DTPA were similar in all except for two patients. The two patients had received cadaveric renal transplantation. One patient presented with acute tubular necrosis and the other with chronic renal rejection. In these patients, I-123 imaging showed vascular stricture and Tc-99m imaging showed a decreased glomerular function. Because I-123 OIH and Tc-99m DTPA had different pharmacodynamics, combined use of the two imaging agents may be useful in evaluating renal rejection or acute tubular necrosis. (N.K.)
The Global Environment Radiation Monitoring Network (GERMON)
International Nuclear Information System (INIS)
Zakheim, B.J.; Goellner, D.A.
1994-01-01
Following the Chernobyl accident in 1986, a group of experts from the World Health Organization (WHO) and the United Nations Environment Program (UNEP) met in France to discuss and develop the basic principles of a global environmental radiation monitoring network (GERMON). The basic functions of this network were to provide regular reports on environmental radiation levels and to be in a position to provide reliable and accurate radiation measurements on a quick and accurate radiation measurements on a quick turnaround basis in the event of a major radiation release. By 1992, although 58 countries had indicated an interest in becoming a part of the GERMON system, only 16 were providing data on a regular basis. This paper traces the history of GERMON from its inception in 1987 through its activities during 1993-4. It details the objectives of the network, describes functions, lists its participants, and presents obstacles in the current network. The paper examines the data requirements for radiological emergency preparedness and offers suggestions for the current system. The paper also describes the growing need for such a network. To add a domestic perspective, the authors present a summary of the environmental monitoring information system that was used by the NRC in 1986 in its analyses of the Chernobyl incident. Then we will use this 1986 experience to propose a method for the use of GERMON should a similar occasion arise in the future
Striatal uptake of I-123-β-CIT and I-123-IBZM in patients with extrapyramidal symptoms
International Nuclear Information System (INIS)
Bettin, S.; Kaempfer, I.; Seese, A.; Schaefer, A.; Reuter, M.; Loessner, J.; Dietrich, J.; Wagner, A.; Knapp, W.H.
1997-01-01
Aim: This pilot study deals with the question whether characteristic changes in local cerebral dopamine transporter function and D 2 -receptor binding capacity can be shown with SPET, in idiopathic Parkinson syndrome (IPS) and secondary Parkinson syndrome (SPS). Methods: In 16 patients (6 with IPS, 6 with SPS except Wilsons's disease, and 4 with Wilson's disease) SPET studies were performed using I-123-β-CIT and I-123-IBZM and a dual-head gamma camera. Images were obtained 20-24 h and 2 h post injection, respectively. For semiquantitative analysis count density ratios of basal ganglia (BG) and cerebellum (CER) were determined for I-123-β-CIT and ratios between BG and medial frontal cortex (MFC) for I-123-IBZM. Results: The BG/CER ratio in the I-123-β-CIT studies averaged 3.04±0.83 in IPS and 7.73±3.28 in SPS (p [de
Li, Fu; Sutherland, May Kung; Yu, Changpu; Walter, Roland B; Westendorf, Lori; Valliere-Douglass, John; Pan, Lucy; Cronkite, Ashley; Sussman, Django; Klussman, Kerry; Ulrich, Michelle; Anderson, Martha E; Stone, Ivan J; Zeng, Weiping; Jonas, Mechthild; Lewis, Timothy S; Goswami, Maitrayee; Wang, Sa A; Senter, Peter D; Law, Che-Leung; Feldman, Eric J; Benjamin, Dennis R
2018-02-01
Treatment choices for acute myelogenous leukemia (AML) patients resistant to conventional chemotherapies are limited and novel therapeutic agents are needed. IL3 receptor alpha (IL3Rα, or CD123) is expressed on the majority of AML blasts, and there is evidence that its expression is increased on leukemic relative to normal hematopoietic stem cells, which makes it an attractive target for antibody-based therapy. Here, we report the generation and preclinical characterization of SGN-CD123A, an antibody-drug conjugate using the pyrrolobenzodiazepine dimer (PBD) linker and a humanized CD123 antibody with engineered cysteines for site-specific conjugation. Mechanistically, SGN-CD123A induces activation of DNA damage response pathways, cell-cycle changes, and apoptosis in AML cells. In vitro , SGN-CD123A-mediated potent cytotoxicity of 11/12 CD123 + AML cell lines and 20/23 primary samples from AML patients, including those with unfavorable cytogenetic profiles or FLT3 mutations. In vivo , SGN-CD123A treatment led to AML eradication in a disseminated disease model, remission in a subcutaneous xenograft model, and significant growth delay in a multidrug resistance xenograft model. Moreover, SGN-CD123A also resulted in durable complete remission of a patient-derived xenograft AML model. When combined with a FLT3 inhibitor quizartinib, SGN-CD123A enhanced the activity of quizartinib against two FLT3-mutated xenograft models. Overall, these data demonstrate that SGN-CD123A is a potent antileukemic agent, supporting an ongoing trial to evaluate its safety and efficacy in AML patients (NCT02848248). Mol Cancer Ther; 17(2); 554-64. ©2017 AACR . ©2017 American Association for Cancer Research.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false PA fees. 701.123 Section 701.123 National... OFFICIAL RECORDS AVAILABILITY OF DEPARTMENT OF THE NAVY RECORDS AND PUBLICATION OF DEPARTMENT OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.123 PA fees. The PA fee schedule is only applicable...
Integración del brazo robot IRB120 en entorno ROS-MATLAB
Gómez Cuadrado, José Manuel
2017-01-01
Este proyecto usa el entorno ROS (Robot Operating System) para desarrollar el control del brazo robot IRB 120 y su implementación en el entorno de trabajo MATLAB. Se explicará la creación del modelo del robot, la planificación de trayectorias y la comunicación con dicho robot. This project uses the ROS (Robot Operating System) environment for developing the control of the IRB 120 robotic arm and its implementation in the MATLAB working environment. It will explain the creation of the...
On the Relevance of Using OpenWireless Sensor Networks in Environment Monitoring
Directory of Open Access Journals (Sweden)
Antoine B. Bagula
2009-06-01
Full Text Available This paper revisits the problem of the readiness for field deployments of wireless- sensor networks by assessing the relevance of using Open Hardware and Software motes for environment monitoring. We propose a new prototype wireless sensor network that finetunes SquidBee motes to improve the life-time and sensing performance of an environment monitoring system that measures temperature, humidity and luminosity. Building upon two outdoor sensing scenarios, we evaluate the performance of the newly proposed energy-aware prototype solution in terms of link quality when expressed by the Received Signal Strength, Packet Loss and the battery lifetime. The experimental results reveal the relevance of using the Open Hardware and Software motes when setting up outdoor wireless sensor networks.
Lightweight Context Aware Routing in Wireless Sensor Networks for Real Environments
Directory of Open Access Journals (Sweden)
Samia Aijaz
2015-07-01
Full Text Available Design and implementation of a WSN (Wireless Sensor Network that can efficiently work for a longer time period must include identification of the deployment environment context and to conform to the behavior of the sensor nodes. The context information when treated with evaluation factor becomes a process of context awareness and the evaluation factor is called the context attribute. In this paper, we consider the context factor of energy. The paper identifies analyses and evaluates efficiency of two when used in a context aware environment. Furthermore, the study also highlights the strengths and weaknesses of sensor SPIN (Sensor Protocol for Information via Negotiation and LEACH (Low Energy Adaptive Clustering Hierarchy protocols with respect to the support for WSN with heavy network traffic conditions. The performance has been evaluated in terms of energy efficiency, data packet transmission, network status, data management, reliability, etc.
Dosimetry of iodine-123 for newborn and infant
International Nuclear Information System (INIS)
Guilhem, M.T.; Therain, F.
1987-01-01
Iodine-123 ( 123 I) is a radionuclide of choice of neonatal hypothyroidism diagnosis. It is important to know infant main organs adsorbed doses during a thyroid scan with 123 I. Absorbed doses are already available for adults: for infants, they must be transformed taking account of organs sizes and inter-organs distances. Calculations are done for commercially available 123 I(p,2n) and 123 I(p,5n). Important contamination of 124 I in 123 I(p,2n) increases considerably the absorbed-dose during thyroid scan of a newborn (the ratio 124 I/ 123 I doubles every 15h). For routinely used activities, thyroid absorbed dose, 24 h after end of production, is fifteen times higher with 123 I(p,5n) than with 99m Tc: for one month old child; total body absorbed dose is of the same order of magnitude [fr
Gauging in volumetric activity of the L.B.123 in order to study release dispersion in 85Kr
International Nuclear Information System (INIS)
Label, D.
2001-01-01
The L.B.123 is a krypton detector. The calculations of the different beta and gamma yields have allowed to confirm that the LB123 is low sensitive to gamma radiations and in the case of krypton 85 the only beta contribution is to be considered. This detector can be used to study the dispersion modes of gaseous releases in the environment of La Hague. (N.C.)
Industrial system for producing iodine-123
International Nuclear Information System (INIS)
Brantley, J.C.
1985-01-01
An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments
40 CFR 123.30 - Judicial review of approval or denial of permits.
2010-07-01
... permitting process. A State will meet this standard if State law allows an opportunity for judicial review... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Judicial review of approval or denial... (CONTINUED) WATER PROGRAMS STATE PROGRAM REQUIREMENTS State Program Submissions § 123.30 Judicial review of...
Effects Of Social Networking Sites (SNSs) On Hyper Media Computer Mediated Environments (HCMEs)
Yoon C. Cho
2011-01-01
Social Networking Sites (SNSs) are known as tools to interact and build relationships between users/customers in Hyper Media Computer Mediated Environments (HCMEs). This study explored how social networking sites play a significant role in communication between users. While numerous researchers examined the effectiveness of social networking websites, few studies investigated which factors affected customers attitudes and behavior toward social networking sites. In this paper, the authors inv...
Construct mine environment monitoring system based on wireless mesh network
Chen, Xin; Ge, Gengyu; Liu, Yinmei; Cheng, Aimin; Wu, Jun; Fu, Jun
2018-04-01
The system uses wireless Mesh network as a network transmission medium, and strive to establish an effective and reliable underground environment monitoring system. The system combines wireless network technology and embedded technology to monitor the internal data collected in the mine and send it to the processing center for analysis and environmental assessment. The system can be divided into two parts: the main control network module and the data acquisition terminal, and the SPI bus technology is used for mutual communication between them. Multi-channel acquisition and control interface design Data acquisition and control terminal in the analog signal acquisition module, digital signal acquisition module, and digital signal output module. The main control network module running Linux operating system, in which the transplant SPI driver, USB card driver and AODV routing protocol. As a result, the internal data collection and reporting of the mine are realized.
Networking for the Environment
DEFF Research Database (Denmark)
Dickel, Petra; Hörisch, Jacob; Ritter, Thomas
2018-01-01
Although the public debate on the environmental orientation of firms has intensified, there is a lack of understanding about the consequences of that orientation, especially in terms of its impact on firms' networking behavior. In order to fill this gap, this paper analyzes the impact of external...... and internal environmental orientation on start-ups’ network characteristics, because networks are both vital for the success of start-ups and resource demanding. More specifically, the effects of environmental orientation on networking frequency and network size among start-ups are analyzed. Empirical data...... from 248 technology-based start-ups shows that those firms with a strong external environmental orientation have significantly higher networking frequencies and build larger networks. Conversely, a strong internal environmental orientation is linked to smaller networks. Thus, the results highlight...
Automated Construction of Node Software Using Attributes in a Ubiquitous Sensor Network Environment
Lee, Woojin; Kim, Juil; Kang, JangMook
2010-01-01
In sensor networks, nodes must often operate in a demanding environment facing restrictions such as restricted computing resources, unreliable wireless communication and power shortages. Such factors make the development of ubiquitous sensor network (USN) applications challenging. To help developers construct a large amount of node software for sensor network applications easily and rapidly, this paper proposes an approach to the automated construction of node software for USN applications using attributes. In the proposed technique, application construction proceeds by first developing a model for the sensor network and then designing node software by setting the values of the predefined attributes. After that, the sensor network model and the design of node software are verified. The final source codes of the node software are automatically generated from the sensor network model. We illustrate the efficiency of the proposed technique by using a gas/light monitoring application through a case study of a Gas and Light Monitoring System based on the Nano-Qplus operating system. We evaluate the technique using a quantitative metric—the memory size of execution code for node software. Using the proposed approach, developers are able to easily construct sensor network applications and rapidly generate a large number of node softwares at a time in a ubiquitous sensor network environment. PMID:22163678
Automated Construction of Node Software Using Attributes in a Ubiquitous Sensor Network Environment
Directory of Open Access Journals (Sweden)
JangMook Kang
2010-09-01
Full Text Available In sensor networks, nodes must often operate in a demanding environment facing restrictions such as restricted computing resources, unreliable wireless communication and power shortages. Such factors make the development of ubiquitous sensor network (USN applications challenging. To help developers construct a large amount of node software for sensor network applications easily and rapidly, this paper proposes an approach to the automated construction of node software for USN applications using attributes. In the proposed technique, application construction proceeds by first developing a model for the sensor network and then designing node software by setting the values of the predefined attributes. After that, the sensor network model and the design of node software are verified. The final source codes of the node software are automatically generated from the sensor network model. We illustrate the efficiency of the proposed technique by using a gas/light monitoring application through a case study of a Gas and Light Monitoring System based on the Nano-Qplus operating system. We evaluate the technique using a quantitative metric—the memory size of execution code for node software. Using the proposed approach, developers are able to easily construct sensor network applications and rapidly generate a large number of node softwares at a time in a ubiquitous sensor network environment.
Automated construction of node software using attributes in a ubiquitous sensor network environment.
Lee, Woojin; Kim, Juil; Kang, JangMook
2010-01-01
In sensor networks, nodes must often operate in a demanding environment facing restrictions such as restricted computing resources, unreliable wireless communication and power shortages. Such factors make the development of ubiquitous sensor network (USN) applications challenging. To help developers construct a large amount of node software for sensor network applications easily and rapidly, this paper proposes an approach to the automated construction of node software for USN applications using attributes. In the proposed technique, application construction proceeds by first developing a model for the sensor network and then designing node software by setting the values of the predefined attributes. After that, the sensor network model and the design of node software are verified. The final source codes of the node software are automatically generated from the sensor network model. We illustrate the efficiency of the proposed technique by using a gas/light monitoring application through a case study of a Gas and Light Monitoring System based on the Nano-Qplus operating system. We evaluate the technique using a quantitative metric-the memory size of execution code for node software. Using the proposed approach, developers are able to easily construct sensor network applications and rapidly generate a large number of node softwares at a time in a ubiquitous sensor network environment.
Implementation and validation of UPnP for embedded systems in a home networking environment
Tran, T.M.; Feijs, L.M.G.; Lukkien, J.J.; Hamza, M.H.
2002-01-01
Devices in a home environment are often equipped with general purpose network connections. There is an increasingly strong requirement that these devices cooperate in an autonomous fashion by using the functionality they find on the network. In the context of home networking, several standard
Collective properties of the odd-mass I nuclei: 123,125,127I
Shroy, R. E.; Gordon, D. M.; Gai, M.; Fossan, D. B.; Gaigalas, A. K.
1982-09-01
The high-spin states of 123,125,127I have been investigated via the ASn(6Li, 3n)A+3I reactions to study the collective properties of the odd-mass I isotopes. In-beam measurements of γ-ray excitations, γ-γ coincidences, γ-ray angular distributions, and pulsed beam-γ timing were performed with Ge detectors to determine level energies, decay schemes, γ-ray multipolarities, Jπ assignments, and lifetime information. A similar study of the 117,119,121I isotopes is reported in the following paper. Two collective features have been identified in these odd-mass I nuclei. Systematic ΔJ=1 bands built on low-lying 92+ proton-hole (4p-1h) states were observed. The 92+ bandheads, that involve the excitation of a 1g92 proton across the Z=50 shell, drop to very low energies near the middle of the neutron shell. The properties of the 92+ proton-hole states for all of the odd-mass I isotopes are presented and related to the systematic information for the proton-hole states in the entire Z>50 transition region. Systematic ΔJ=2 bands built on 112- (1h112 quasiproton) states, on 72+ (1g72 quasiproton) states, and on 52+ (2d52 quasiproton) states were also observed. The ΔJ=2 band spacings generally follow the spacings of the Te-core ground-state bands with the exception of the 112- ΔJ=2 bands, for which the spacings decrease significantly relative to those for the Te cores as A decreases. These systematic properties are discussed in terms of several theoretical approaches to the onset of collectivity in transitional nuclei. An isomer at 2660 keV in 123I was observed to have a mean lifetime τ=38+/-3 ns. NUCLEAR REACTIONS 120-124Sn(6Li, 3n)123-127I measured γ-γ coincidences, γ(E, θ, t) deduced level schemes in odd-mass 123-127I, γ multipolarities, Jπ, T12. Enriched targets, Ge(Li) detectors.
Biodistribution study of [I-123] ADAM in mice brain using quantitative autoradiography
International Nuclear Information System (INIS)
Lin, K.J.; Yen, T.C.; Tzen, K.Y.; Ye, X.X.; Hwang, J.J.; Wey, S.P.; Ting, G.
2002-01-01
Aim: Autoradiography with radioluminography is a delicate method to characterize newly developed radiotracers and to apply them to pharmacological studies. Herein, we reported a biodistribution result of [I-123] ADAM (2-((2-((dimethylamino)methyl)phenyl)thio)-5- iodophenylamine) in mice brain quantitatively using imaging plates. Materials and Methods: 1mCi [I-123] ADAM was injected into male ICR mice through tail veins. Brains were removed at sequential time points ranging from 0.5hr to 4hr after injection. The whole brain was cut into 14mm thick coronal sections using a cyrotome. The sections were thaw-mounted on glass plate and apposed placed on an imaging plate with filter paper standards for 24 hours. Imaging reading was done by a Fuji FLA5000 device. Regions of interest were placed on the globus pallidus, hypothalamus, substantia nigra, raphe nuclei and cerebellum corresponding to the sterotaxic atlas, and the PSL/mm 2 values were measured. The specific binding was expressed as the ratios of (targets - cerebellum) to cerebellum. Results: Autoradiography study of brain showed that the [I-123] ADAM was accumulated at serotonin transporter rich sites, including the olfactory tubercle, globus pallidus, thalamus nuclei, hypothalamus, substantia nigra, interpeduncular nucleus, amygdala and raphe nuclei. Biodistribution of [I-123] ADAM in mice brain using quantitative autoradiography method showed a high specific binding in the substantia nigra and hypothalamus and the time-activity curve peaked at 120 min post-injection. Compatible specific binding result was achieved in the region of hypothalamus as compared with previous study by other group using conventional tissue micro-dissection method (Synapse 38:403-412, 2000). However, higher specific binding was observed in certain small brain regions including substantia nigra, raphe nuclei due to improved spatial resolution of the quantitative autoradiography technique. Conclusion: Our result showed that the
Brain receptor single-photon emission computer tomography with 123I Datscan in Parkinson's disease
International Nuclear Information System (INIS)
Minchev, D.; Peshev, N.; Kostadinova, I.; Grigorova, O.; Trindev, P.; Shotekov, P.
2005-01-01
Clinical aspects of Parkinson's disease are not enough for the early diagnosis of the disease. Positron emission tomography and the receptor single - photon emission tomography can be used for imaging functional integrity of nigrostriatal dopaminergic structures. 24 patient (17 men and 7 women) were investigated. 20 of them are with Parkinson's disease and 4 are with essential tremor. The radiopharmaceutical - 123I-Datscan (ioflupane, bind with 123I) represent a cocaine analogue with selective affinity to dopamine transporters, located in the dopaminergic nigrostriatal terminals in the striatum. Single - photon emission computer tomography was performed with SPECT gamma camera (ADAC, SH Epic detector). The scintigraphic study was made 3 to 6 hours after intravenous injection of the radiopharmaceutical - 123I- Datscan in dose 185 MBq. 120 frames are registered with duration of each one 22 seconds and gamma camera rotation 360. After generation of transversal slices we generated two composites pictures. The first composite picture image the striatum, the second - the occipital region. Two ratios were calculated representing the uptake of the radiopharmaceutical in the left and right striatum. Qualitative and quantitative criteria were elaborated for evaluating the scintigraphic patterns. Decreased, nonhomogeneous and asymmetric uptake of the radiopharmaceutical coupled with low quantitative parameters in range from 1.44 to 2.87 represents the characteristic scintigraphic pattern for Parkinson's disease with clear clinical picture. Homogenous with high intensity and symmetric uptake of the radiopharmaceutical in the striatum coupled with his clear frontier and with quantitative parameters up to 4.40 represent the scintigraphic pattern in two patients with essential tremor. Receptor single - photon emission computer tomography with 123I - Datscan represents an accurate nuclear-medicine method for precise diagnosis of Parkinson's disease and for its differentiation from
Mason, Michael J; Schmidt, Christopher; Abraham, Anisha; Walker, Leslie; Tercyak, Kenneth
2009-12-01
The present study examined components of adolescents' social environment (social network, extracurricular activities, and family relationships) in association with depression. A total of 332 adolescents presenting for a routine medical check-up were self-assessed for social network risk (i.e., smoking habits of best male and female friends), extracurricular activity level (i.e., participation in organized sports teams, clubs, etc.), family relationship quality (i.e., cohesion and conflict), and symptoms of depression (i.e., minimal, mild, moderate/severe). Results of a forward linear regression modeling indicate that social environment components were associated with a significant proportion of the variance in adolescent depression (Adjusted R (2) = .177, p social network (beta = .107, p depression symptoms. Conversely, adolescents who engaged in more extracurricular activities (beta = -.118, p depressive symptoms. These findings highlight the important role that the social environment plays in adolescent depression, as well as yields new insights into socially-based intervention targets that may ameliorate adolescent depression. These intervention targets may be gender-specific, include positive social network skills training, increase adolescents' engagement in organized activities, and attend to the quality of their family relationships.
Research on Influence of Cloud Environment on Traditional Network Security
Ming, Xiaobo; Guo, Jinhua
2018-02-01
Cloud computing is a symbol of the progress of modern information network, cloud computing provides a lot of convenience to the Internet users, but it also brings a lot of risk to the Internet users. Second, one of the main reasons for Internet users to choose cloud computing is that the network security performance is great, it also is the cornerstone of cloud computing applications. This paper briefly explores the impact on cloud environment on traditional cybersecurity, and puts forward corresponding solutions.
18 CFR 284.123 - Rates and charges.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Rates and charges. 284.123 Section 284.123 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... AUTHORITIES Certain Transportation by Intrastate Pipelines § 284.123 Rates and charges. (a) General rule...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Restrooms. 38.123 Section 38.123 Transportation Office of the Secretary of Transportation AMERICANS WITH DISABILITIES ACT (ADA) ACCESSIBILITY... measured to the top of the toilet seat. Seats shall not be sprung to return to a lifted position. (3) A...
Lessons learned on solar powered wireless sensor network deployments in urban, desert environments
Dehwah, Ahmad H.; Mousa, Mustafa; Claudel, Christian G.
2015-01-01
The successful deployment of a large scale solar powered wireless sensor network in an urban, desert environment is a very complex task. Specific cities of such environments cause a variety of operational problems, ranging from hardware faults
19 CFR 123.31 - Merchandise in transit.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.31 Section 123.31... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.31 Merchandise in transit. (a) From one contiguous country to another. Merchandise may be transported in transit...
19 CFR 123.21 - Merchandise in transit.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.21 Section 123.21... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.21 Merchandise in transit. (a) Status. Merchandise may be transported from one port to another in the United...
29 CFR 780.123 - Raising of bees.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Raising of bees. 780.123 Section 780.123 Labor Regulations... Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.123 Raising of bees. The term “raising of * * * bees” refers to all of those activities customarily performed in connection with the...
Clinical utility of N-isopropyl-p-[123I] iodoamphetamine (123I-IMP) for SPECT in epileptic children
International Nuclear Information System (INIS)
Taki, Kuniyasu; Seto, Hikaru; Futatsuya, Ryusuke; Kakishita, Masao; Seki, Hiroyasu.
1989-01-01
A regional cerebral perfusion study was performed in epileptic children using single photon emission computed tomography (SPECT) and N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP). A total of 22 patients with epilepsy underwent both a 123 I-IMP brain perfusion study and X-ray CT. Eighteen had positive and four had negative perfusion study results. Of the eighteen patients with positive perfusion study results, two were positive on X-ray CT. In these two patients, the areas of perfusion defects were larger than those of low density on X-ray CT. In only four patients did the areas of perfusion defects correspond to the sites of abnormal EEG. In conclusion, 123 I-IMP perfusion study is of great clinical value in pediatric epileptic cases. (author)
International Nuclear Information System (INIS)
Palumbo, Barbara; Fravolini, Mario Luca; Nuvoli, Susanna; Spanu, Angela; Madeddu, Giuseppe; Paulus, Kai Stephan; Schillaci, Orazio
2010-01-01
To contribute to the differentiation of Parkinson's disease (PD) and essential tremor (ET), we compared two different artificial neural network classifiers using 123 I-FP-CIT SPECT data, a probabilistic neural network (PNN) and a classification tree (ClT). 123 I-FP-CIT brain SPECT with semiquantitative analysis was performed in 216 patients: 89 with ET, 64 with PD with a Hoehn and Yahr (H and Y) score of ≤2 (early PD), and 63 with PD with a H and Y score of ≥2.5 (advanced PD). For each of the 1,000 experiments carried out, 108 patients were randomly selected as the PNN training set, while the remaining 108 validated the trained PNN, and the percentage of the validation data correctly classified in the three groups of patients was computed. The expected performance of an ''average performance PNN'' was evaluated. In analogy, for ClT 1,000 classification trees with similar structures were generated. For PNN, the probability of correct classification in patients with early PD was 81.9±8.1% (mean±SD), in patients with advanced PD 78.9±8.1%, and in ET patients 96.6±2.6%. For ClT, the first decision rule gave a mean value for the putamen of 5.99, which resulted in a probability of correct classification of 93.5±3.4%. This means that patients with putamen values >5.99 were classified as having ET, while patients with putamen values <5.99 were classified as having PD. Furthermore, if the caudate nucleus value was higher than 6.97 patients were classified as having early PD (probability 69.8±5.3%), and if the value was <6.97 patients were classified as having advanced PD (probability 88.1%±8.8%). These results confirm that PNN achieved valid classification results. Furthermore, ClT provided reliable cut-off values able to differentiate ET and PD of different severities. (orig.)
Production of 123 I for medical diagnosis application
International Nuclear Information System (INIS)
Britto, J.L.Q. de.
1982-01-01
A method for production of carrier free 123 I with high radionuclidic purity in which the processing is done remotely was developed at Instituto de Engenharia Nuclear in Rio de Janeiro. The 123 I is produced in the decay of 123 Xe which is obtained through the reaction 122 Te ( 3 He, 2 n) 123 Xe with 30 MeV 3 He beams of IEN's variable energy cyclotron. The irradiated natural Te O 2 target is heated in a furnace at 675 0 C and the diffused out 123 Xe is adsorbed in a copper trap maintained at -196 0 C. The 123 Xe is allowed to decay during 6.3 hours and the 123 I produced washed out of the trap with a 0.1 N solution of NaOH. All the process is remotely controlled by using electric and pneumatic systems as well as manipulators and tongs. The quality control was achieved by atomic absorption and gamma-ray spectroscopy. (author)
Communication and cooperation in networked environments: an experimental analysis.
Galimberti, C; Ignazi, S; Vercesi, P; Riva, G
2001-02-01
Interpersonal communication and cooperation do not happen exclusively face to face. In work contexts, as in private life, there are more and more situations of mediated communication and cooperation in which new online tools are used. However, understanding how to use the Internet to support collaborative interaction presents a substantial challenge for the designers and users of this emerging technology. First, collaborative Internet environments are designed to serve a purpose, so must be designed with intended users' tasks and goals explicitly considered. Second, in cooperative activities the key content of communication is the interpretation of the situations in which actors are involved. So, the most effective way of clarifying the meaning of messages is to connect them to a shared context of meaning. However, this is more difficult in the Internet than in other computer-based activities. This paper tries to understand the characteristics of cooperative activities in networked environments--shared 3D virtual worlds--through two different studies. The first used the analysis of conversations to explore the characteristics of the interaction during the cooperative task; the second analyzed whether and how the level of immersion in the networked environments influenced the performance and the interactional process. The results are analyzed to identify the psychosocial roots used to support cooperation in a digital interactive communication.
Modification of GNPS environment radiation monitoring network system
International Nuclear Information System (INIS)
Jiang Lili; Cao Chunsheng
1999-01-01
GNPS Environment Radiation Continuous Monitoring System (KRS), the only real time on-line system of site radiation monitoring, was put into service in 1993 prior to the first loading the the plant. It is revealed through several years of operation that this system has some deficiencies such as inadequate real time monitoring means, no figure and diagram display function on the central computer, high failures, frequent failure warning signals, thus making the availability of the system at a low level. In recent years, with the rapid development of computer network technology and increasingly strict requirements on the NPP environment protection raised by the government and public, KRS modification had become necessary and urgent. In 1996, GNPS carried out modification work on the measuring geometry condition of γ radiation monitoring sub-station and lightening protection. To enhance the functions of real time monitoring and data auto-processing, further modification of the system was made in 1998, including the update of the software and hardware of KRS central processor, set-up of system computer local network and database. In this way, the system availability and monitoring quality are greatly improved and effective monitoring and analysis means are provided for gaseous release during normal operation and under accident condition
Donnemiller, E; Brenneis, C; Wissel, J; Scherfler, C; Poewe, W; Riccabona, G; Wenning, G K
2000-09-01
Structural imaging suggests that traumatic brain injury (TBI) may be associated with disruption of neuronal networks, including the nigrostriatal dopaminergic pathway. However, to date deficits in pre- and/or postsynaptic dopaminergic neurotransmission have not been demonstrated in TBI using functional imaging. We therefore assessed dopaminergic function in ten TBI patients using [123I]2-beta-carbomethoxy-3-beta-(4-iodophenyl)tropane (beta-CIT) and [123I]iodobenzamide (IBZM) single-photon emission tomography (SPET). Average Glasgow Coma Scale score (+/-SD) at the time of head trauma was 5.8+/-4.2. SPET was performed on average 141 days (SD +/-92) after TBI. The SPET images were compared with structural images using cranial computerised tomography (CCT) and magnetic resonance imaging (MRI). SPET was performed with an ADAC Vertex dual-head camera. The activity ratios of striatal to cerebellar uptake were used as a semiquantitative parameter of striatal dopamine transporter (DAT) and D2 receptor (D2R) binding. Compared with age-matched controls, patients with TBI had significantly lower striatal/cerebellar beta-CIT and IBZM binding ratios (PTBI despite relative structural preservation of the striatum. Further investigations of possible clinical correlates and efficacy of dopaminergic therapy in patients with TBI seem justified.
Field test of wireless sensor network in the nuclear environment
International Nuclear Information System (INIS)
Li, L.; Wang, Q.; Bari, A.; Deng, C.; Chen, D.; Jiang, J.; Alexander, Q.; Sur, B.
2014-01-01
Wireless sensor networks (WSNs) are appealing options for the health monitoring of nuclear power plants due to their low cost and flexibility. Before they can be used in highly regulated nuclear environments, their reliability in the nuclear environment and compatibility with existing devices have to be assessed. In situ electromagnetic interference tests, wireless signal propagation tests, and nuclear radiation hardness tests conducted on candidate WSN systems at AECL Chalk River Labs are presented. The results are favourable to WSN in nuclear applications. (author)
Field test of wireless sensor network in the nuclear environment
Energy Technology Data Exchange (ETDEWEB)
Li, L., E-mail: lil@aecl.ca [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada); Wang, Q.; Bari, A. [Univ. of Western Ontario, London, Ontario (Canada); Deng, C.; Chen, D. [Univ. of Electronic Science and Technology of China, Chengdu, Sichuan (China); Jiang, J. [Univ. of Western Ontario, London, Ontario (Canada); Alexander, Q.; Sur, B. [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada)
2014-06-15
Wireless sensor networks (WSNs) are appealing options for the health monitoring of nuclear power plants due to their low cost and flexibility. Before they can be used in highly regulated nuclear environments, their reliability in the nuclear environment and compatibility with existing devices have to be assessed. In situ electromagnetic interference tests, wireless signal propagation tests, and nuclear radiation hardness tests conducted on candidate WSN systems at AECL Chalk River Labs are presented. The results are favourable to WSN in nuclear applications. (author)
Resolving the clumpy circumstellar environment of the B[e] supergiant LHA 120-S 35
Torres, A. F.; Cidale, L. S.; Kraus, M.; Arias, M. L.; Barbá, R. H.; Maravelias, G.; Borges Fernandes, M.
2018-05-01
Context. B[e] supergiants are massive post-main-sequence stars, surrounded by a complex circumstellar environment where molecules and dust can survive. The shape in which the material is distributed around these objects and its dynamics as well as the mechanisms that give rise to these structures are not well understood. Aims: The aim is to deepen our knowledge of the structure and kinematics of the circumstellar disc of the B[e] supergiant LHA 120-S 35. Methods: High-resolution optical spectra were obtained in three different years. Forbidden emission lines, that contribute to trace the disc at different distances from the star, are modelled in order to determine the kinematical properties of their line-forming regions, assuming Keplerian rotation. In addition, we used low-resolution near-infrared spectra to explore the variability of molecular emission. Results: LHA 120-S 35 displays an evident spectral variability in both optical and infrared regions. The P-Cygni line profiles of H I, as well as those of Fe II and O I, suggest the presence of a strong bipolar clumped wind. We distinguish density enhancements in the P-Cygni absorption component of the first Balmer lines, which show variations in both velocity and strength. The P-Cygni profile emission component is double-peaked, indicating the presence of a rotating circumstellar disc surrounding the star. We also observe line-profile variations in the permitted and forbidden features of Fe II and O I. In the infrared, we detect variations in the intensity of the H I emission lines as well as in the emission of the CO band-heads. Moreover, we find that the profiles of each [Ca II] and [O I] emission lines contain contributions from spatially different (complete or partial) rings. Globally, we find evidence of detached multi-ring structures, revealing density variations along the disc. We identify an inner ring, with sharp edge, where [Ca II] and [O I] lines share their forming region with the CO molecular bands
Pipeline network and environment
International Nuclear Information System (INIS)
Oliveira Nascimento, I.; Wagner, J.; Silveira, T.
2012-01-01
The Rio de Janeiro is one of 27 units of Brazil. It is located in the eastern portion of the Southeast and occupies an area of 43 696.054 km², being effectively the 3rd smallest state in Brazil. This state in recent years has suffered from erosion problems caused by the deployment of the network pipeline. The deployment pipeline is part of the activities related to the oil industry has caused a more intense conflict between the environment and economic activities, modifying the soil structure and distribution of surface and subsurface flows. This study aimed to analyze the erosion caused by the removal of soil for the deployment of pipeline transportation, with the consequences of the emergence of numerous gullies, landslides and silting of rivers. For the development of this study were performed bibliographic research, field work, mapping and digital preparation of the initial diagnosis of active processes and what the consequent environmental impacts. For these reasons, we conclude that the problems could be avoided or mitigated if there was a prior geological risk management. (author)
2010-07-01
... POLLUTANT DISCHARGE ELIMINATION SYSTEM Permit Application and Special NPDES Program Requirements § 122.22... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Signatories to permit applications and reports (applicable to State programs, see § 123.25). 122.22 Section 122.22 Protection of Environment...
New grid based test bed environment for carrying out ad-hoc networking experiments
CSIR Research Space (South Africa)
Johnson, D
2006-09-01
Full Text Available and the third is to do analysis on a real test bed network which has implemented the ad-hoc networking protocol. This paper concerns the third option. Most researchers who have done work on test bed environments have used either indoor Wifi inter-office links...
Energy Technology Data Exchange (ETDEWEB)
Meyer, Philipp T. [Department of Neurology, University Hospital Aachen, 52074 Aachen (Germany); Department of Nuclear Medicine, University Hospital Aachen, 52074 Aachen (Germany)], E-mail: pmeyer@ukaachen.de; Salber, Dagmar [C. and O. Vogt Institute of Brain Research, University Hospital Duesseldorf, 40225 Duesseldorf (Germany); Schiefer, Johannes [Department of Neurology, University Hospital Aachen, 52074 Aachen (Germany); Cremer, Markus [Institute of Neurosciences and Biophysics - Medicine, Research Center Juelich, 52425 Juelich (Germany); Schaefer, Wolfgang M. [Department of Nuclear Medicine, University Hospital Aachen, 52074 Aachen (Germany); Kosinski, Christoph M. [Department of Neurology, University Hospital Aachen, 52074 Aachen (Germany); Langen, Karl-Josef [Institute of Neurosciences and Biophysics - Medicine, Research Center Juelich, 52425 Juelich (Germany)
2008-07-15
Introduction: Intraperitoneal (IP) injection represents an attractive alternative route of radiotracer administration for small animal imaging, e.g., for longitudinal studies in transgenic mouse models. We explored the cerebral kinetics of the reversible dopamine D2 receptor ligand [{sup 123}I]IBZM after IP injection in mice. Methods: Cerebral [{sup 123}I]IBZM kinetics were assessed by ex vivo autoradiography in mice sacrificed between 30 and 200 min after IP or intravenous (IV) injection. The striatum-to-cerebellum (S/C) uptake ratio at 140 min was evaluated in wild-type mice and R6/2 transgenic mice (a Huntington's disease model) in comparison with in vitro autoradiography using [{sup 3}H]raclopride. Results: [{sup 123}I]IBZM uptake was slower and lower after IP injection [maximum uptake in striatum 5.6% injected dose per gram (ID/g) at 60 min] than IV injection (10.5%ID/g at 30 min). Between 60 and 120 min, striatal (cerebellar) uptake after IP injection reached 63% (91%) of the uptake after IV injection. The S/C uptake ratio increased to 15.5 at 200 min after IP injection, which corresponds to 87% of the IV injection value (17.8). Consistent with in vitro [{sup 3}H]raclopride autoradiography, the S/C ratio given by ex vivo [{sup 123}I]IBZM autoradiography (140 min after IP injection) was significantly reduced in R6/2 mice. Conclusions: Although IP injection resulted in slower kinetics, relevant measures of dopamine D2 receptor availability were comparable. Thus, IP injection represents a promising route of tracer administration for small animal [{sup 123}I]IBZM SPECT. This should considerably simplify the implementation of longitudinal small animal neuroimaging studies, e.g., in transgenic mouse models.
International Nuclear Information System (INIS)
Chaptal-Gradoz, N.; Chevreuil, M.; D'amico, D.; Debayle, Ch.; Leprieur, F.; Manificat, G.; Peres, J.M.; Pierrard, O.; Tournieux, D.; Veran-Viguie, M.P.; Renaud, Ph.; Roussel-Debet, S.; Masson, O.; Pourcelot, L.; Fayolle, C.; Loyen, J.; Robe, M.Ch.; Picolo, J.L.; Gallerand, M.O.
2009-01-01
While providing many maps, graphs and tables, this report presents and comments the very large amount of data acquired in 2008 within the frame of the control by the IRSN of radioactivity levels on the French national territory by means of its different surveillance networks. After a presentation of these networks (objectives, organization, sample collection, analysis, and preparation methodologies) and of the different radionuclides present in the French environment, results are presented by installation type (electricity production nuclear centres, nuclear fuel reprocessing centres, nuclear medicine centres, nuclear waste storage centres, research centres, nuclear naval bases, etc.) and environment component (air, water ways, rain waters, continental or coastal environment, biological media, etc.)
Energy Technology Data Exchange (ETDEWEB)
Tolendino, Lawrence F.; Hu, Tan Chang
2005-06-01
The Advanced Simulation and Computing (ASC) Distance Computing (DisCom) Wide Area Network (WAN) is a high performance, long distance network environment that is based on the ubiquitous TCP/IP protocol set. However, the Transmission Control Protocol (TCP) and the algorithms that govern its operation were defined almost two decades ago for a network environment vastly different from the DisCom WAN. In this paper we explore and evaluate possible modifications to TCP that purport to improve TCP performance in environments like the DisCom WAN. We also examine a much newer protocol, SCTP (Stream Control Transmission Protocol) that claims to provide reliable network transport while also implementing multi-streaming, multi-homing capabilities that are appealing in the DisCom high performance network environment. We provide performance comparisons and recommendations for continued development that will lead to network communications protocol implementations capable of supporting the coming ASC Petaflop computing environments.
The Effect of Social Interaction on Learning Engagement in a Social Networking Environment
Lu, Jie; Churchill, Daniel
2014-01-01
This study investigated the impact of social interactions among a class of undergraduate students on their learning engagement in a social networking environment. Thirteen undergraduate students enrolled in a course in a university in Hong Kong used an Elgg-based social networking platform throughout a semester to develop their digital portfolios…
International Nuclear Information System (INIS)
Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji
1997-01-01
123 I-Iomazenil ( 123 I-IMZ) and 123 I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On 123 I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on 123 I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower 123 I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of 123 I-IMZ, negative correlation (R 123 I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)
Plant-pollinator interactions over 120 years: loss of species, co-occurrence, and function.
Burkle, Laura A; Marlin, John C; Knight, Tiffany M
2013-03-29
Using historic data sets, we quantified the degree to which global change over 120 years disrupted plant-pollinator interactions in a temperate forest understory community in Illinois, USA. We found degradation of interaction network structure and function and extirpation of 50% of bee species. Network changes can be attributed to shifts in forb and bee phenologies resulting in temporal mismatches, nonrandom species extinctions, and loss of spatial co-occurrences between extant species in modified landscapes. Quantity and quality of pollination services have declined through time. The historic network showed flexibility in response to disturbance; however, our data suggest that networks will be less resilient to future changes.
Experience with PACS in an ATM/Ethernet switched network environment.
Pelikan, E; Ganser, A; Kotter, E; Schrader, U; Timmermann, U
1998-03-01
Legacy local area network (LAN) technologies based on shared media concepts are not adequate for the growth of a large-scale picture archiving and communication system (PACS) in a client-server architecture. First, an asymmetric network load, due to the requests of a large number of PACS clients for only a few main servers, should be compensated by communication links to the servers with a higher bandwidth compared to the clients. Secondly, as the number of PACS nodes increases, the network throughout should not measurably cut production. These requirements can easily be fulfilled using switching technologies. Here asynchronous transfer mode (ATM) is clearly one of the hottest topics in networking because the ATM architecture provides integrated support for a variety of communication services, and it supports virtual networking. On the other hand, most of the imaging modalities are not yet ready for integration into a native ATM network. For a lot of nodes already joining an Ethernet, a cost-effective and pragmatic way to benefit from the switching concept would be a combined ATM/Ethernet switching environment. This incorporates an incremental migration strategy with the immediate benefits of high-speed, high-capacity ATM (for servers and high-sophisticated display workstations), while preserving elements of the existing network technologies. In addition, Ethernet switching instead of shared media Ethernet improves the performance considerably. The LAN emulation (LANE) specification by the ATM forum defines mechanisms that allow ATM networks to coexist with legacy systems using any data networking protocol. This paper points out the suitability of this network architecture in accordance with an appropriate system design.
Labeling of indocyanine green with carrier-free iodine-123
International Nuclear Information System (INIS)
Ansari, A.N.; Lambrecht, R.M.; Redvanly, C.S.; Wolf, A.P.
1976-01-01
The method is described for labeling indocyanine green (ICG) with carrier-free iodine-123 by condensing xenon-123 on crystals of ICG followed by permitting decay of the 123 Xe a sufficient length of time to produce 123 I-electronically excited ions and atoms which subsequently label ICG. 4 claims, no drawings
Quantitative SPECT reconstruction of iodine-123 data
International Nuclear Information System (INIS)
Gilland, D.R.; Jaszczak, R.J.; Greer, K.L.; Coleman, R.E.
1991-01-01
Many clinical and research studies in nuclear medicine require quantitation of iodine-123 ( 123 I) distribution for the determination of kinetics or localization. The objective of this study was to implement several reconstruction methods designed for single-photon emission computed tomography (SPECT) using 123 I and to evaluate their performance in terms of quantitative accuracy, image artifacts, and noise. The methods consisted of four attenuation and scatter compensation schemes incorporated into both the filtered backprojection/Chang (FBP) and maximum likelihood-expectation maximization (ML-EM) reconstruction algorithms. The methods were evaluated on data acquired of a phantom containing a hot sphere of 123 I activity in a lower level background 123 I distribution and nonuniform density media. For both reconstruction algorithms, nonuniform attenuation compensation combined with either scatter subtraction or Metz filtering produced images that were quantitatively accurate to within 15% of the true value. The ML-EM algorithm demonstrated quantitative accuracy comparable to FBP and smaller relative noise magnitude for all compensation schemes
Partially blind instantly decodable network codes for lossy feedback environment
Sorour, Sameh
2014-09-01
In this paper, we study the multicast completion and decoding delay minimization problems for instantly decodable network coding (IDNC) in the case of lossy feedback. When feedback loss events occur, the sender falls into uncertainties about packet reception at the different receivers, which forces it to perform partially blind selections of packet combinations in subsequent transmissions. To determine efficient selection policies that reduce the completion and decoding delays of IDNC in such an environment, we first extend the perfect feedback formulation in our previous works to the lossy feedback environment, by incorporating the uncertainties resulting from unheard feedback events in these formulations. For the completion delay problem, we use this formulation to identify the maximum likelihood state of the network in events of unheard feedback and employ it to design a partially blind graph update extension to the multicast IDNC algorithm in our earlier work. For the decoding delay problem, we derive an expression for the expected decoding delay increment for any arbitrary transmission. This expression is then used to find the optimal policy that reduces the decoding delay in such lossy feedback environment. Results show that our proposed solutions both outperform previously proposed approaches and achieve tolerable degradation even at relatively high feedback loss rates.
Integrated Environment for Ubiquitous Healthcare and Mobile IPv6 Networks
Cagalaban, Giovanni; Kim, Seoksoo
The development of Internet technologies based on the IPv6 protocol will allow real-time monitoring of people with health deficiencies and improve the independence of elderly people. This paper proposed a ubiquitous healthcare system for the personalized healthcare services with the support of mobile IPv6 networks. Specifically, this paper discusses the integration of ubiquitous healthcare and wireless networks and its functional requirements. This allow an integrated environment where heterogeneous devices such a mobile devices and body sensors can continuously monitor patient status and communicate remotely with healthcare servers, physicians, and family members to effectively deliver healthcare services.
In vitro and in vivo evaluation of [123I]IBZM: a potential CNS D-2 dopamine receptor imaging agent
International Nuclear Information System (INIS)
Kung, H.F.; Pan, S.; Kung, M.P.; Billings, J.; Kasliwal, R.; Reilley, J.; Alavi, A.
1989-01-01
In vitro binding characteristics of a CNS dopamine D-2 receptor imaging agent, (S)-N-[(1-ethyl-2-pyrrolidinyl)] methyl-2-hydroxy-3-iodo-6-methoxybenzamide [( 125 I]IBZM), was carried out in rats. Also brain images, as well as organ biodistribution were determined in a monkey following the administration of 123 I-labeled compound. The S-(-)-I[ 125 I]IBZM showed high specific dopamine D-2 receptor binding in rat striatum (Kd = 0.426 +/- 0.082 nM, Bmax = 480 +/- 22 fmol/mg of protein). Competition of various ligands for the IBZM binding displayed the following rank order of potency: spiperone greater than S(-)IBZM much greater than R(+)IBZM greater than or equal to S(-)BZM greater than dopamine greater than ketanserin greater than SCH-23390 much greater than propranolol, norepinephrine, serotonin. In vivo planar images of a monkey injected with [ 123 I]IBZM demonstrated a high concentration in basal ganglia of brain. The ratios of activity in the basal ganglia to cerebellum and the cortex to cerebellum in monkey brain were 4.93 and 1.44, respectively, at 120 min postinjection. These preliminary results indicate that [ 123 I]IBZM is a potentially promising imaging agent for the investigation of dopamine D-2 receptors in humans
Government information collections in the networked environment new issues and models
Cheverie, Joan F
2013-01-01
This insightful book explores the challenging issues related to effective access to government information.Amidst all the chaos of today's dynamic information transition period, the only constants related to government information are change and inconsistency, yet with Government Information Collections in the Networked Environment: New Issues and Models, you will defeat the challenging issues and take advantage of the opportunities that networked government information collections have to offer. This valuable book gives you a fresh opportunity to rethink collecting activities and to
Ginkgo biloba extract alters the binding of the sodium [123I] iodide (Na123I) on blood constituents
International Nuclear Information System (INIS)
Aleixo, Luiz Cláudio Martins; Moreno, Silvana Ramos Farias; Freitas, Rosimeire de Souza; Thomaz, Hélio; Santos-Filho, Sebastião David
2012-01-01
We evaluated the in vitro effect of an aqueous extract of Ginkgo biloba (EGb) on the distribution in blood cells (BC) and plasma (P) and on the binding of Na 123 I to the blood constituents using precipitation with trichloroacetic acid. The radioactivity percentages insoluble (SF) and insoluble fraction (IF) of blood constituents were determined. The EGb interfered (p 123 I in the P (from 69.64 to 86.13) and BC (from 30.36 to 13.87) and altered the fixation of the Na 123 I in IF-P and in IF-BC. - Highlights: ► Interaction between the Ginkgo biloba and blood constituents radiolabeled. ► Modification of the binding of sodium iodide (Na 123 I) to the blood constituents. ► This alteration should have influence in a diagnosis of nuclear medicine.
Dudovitz, Rebecca N; Perez-Aguilar, Giselle; Kim, Grace; Wong, Mitchell D; Chung, Paul J
2017-03-01
Studies suggest adolescent substance use aligns with academic and behavioral self-concept (whether teens think of themselves as good or bad students and as rule followers or rule breakers) as well as peer and adult social networks. Schools are an important context in which self-concept and social networks develop, but it remains unclear how school environments might be leveraged to promote healthy development and prevent substance use. We sought to describe how youth perceive the relationships among school environments, adolescent self-concept, social networks, and substance use. Semistructured interviews with 32 low-income minority youth (aged 17-22 years) who participated in a prior study, explored self-concept development, school environments, social networks, and substance use decisions. Recruitment was stratified by whether, during high school, they had healthy or unhealthy self-concept profiles and had engaged in or abstained from substance use. Youth described feeling labeled by peers and teachers and how these labels became incorporated into their self-concept. Teachers who made students feel noticed (eg, by learning students' names) and had high academic expectations reinforced healthy self-concepts. Academic tracking, extracurricular activities, and school norms determined potential friendship networks, grouping students either with well-behaving or misbehaving peers. Youth described peer groups, combined with their self-concept, shaping their substance use decisions. Affirming healthy aspects of their self-concept at key risk behavior decision points helped youth avoid substance use in the face of peer pressure. Youth narratives suggest school environments shape adolescent self-concept and adult and peer social networks, all of which impact substance use. Copyright © 2016 Academic Pediatric Association. Published by Elsevier Inc. All rights reserved.
Chatzaki, Magda; Sartzetakis, Stelios
1998-09-01
As telecom providers introduce new and more sophisticated services the necessity of a global, unified view of the network infrastructure becomes demanding. Today, heterogenous backbone networks are interconnected in order to provide global connectivity. Due to technological impairments the cost of network operation, the maintenance complexity and the overuse of resources are extremely high under the goal of supporting the diverting customer requirements. We propose a scheme for ATM QoS support in such heterogenous, multi-domain, multi-technology network environment. The objective is to optimize users' and networks' profits by giving them the opportunity to satisfy their requirements. Our approach introduces a manager able to take routing decisions supporting quality of service guarantees for the customers, while making efficient use of network resources.
10 CFR 1040.123 - Consolidated or joint hearings.
2010-01-01
... ACTIVITIES Enforcement Opportunity for Hearing § 1040.123 Consolidated or joint hearings. In cases in which... 10 Energy 4 2010-01-01 2010-01-01 false Consolidated or joint hearings. 1040.123 Section 1040.123... departments or agencies, where applicable, provide for the conduct of consolidated or joint hearings and for...
International Nuclear Information System (INIS)
Dougan, H.; Vincent, J.S.; Lyster, D.M.
1989-01-01
The present work explores the basic reactions necessary for the preparation of [ 123 I] 15-(paraiodophenyl)-pentadecanoic acid (IPPA) from organo mercury compounds. It was found that the essential reactions occur readily and with good yield. The steps were as follows: phenyl pentadecanoic acid or its ethyl ester may be mercurated using Hg(TFA) 2 in TFA solvent, and the para-chloromercury compounds may be recovered. [ 123 I] radioiodination may be carried out in a variety of solvents in the presence of chloramine T. When radioiodination was conducted at room temperature the isomeric purity of the ester or fatty acid was found to be 99.9% para. The results indicate that poor solubility of certain mercurated pentadecanoic acid compounds will limit the development of a kit for [ 123 I]IPPA. (author) 16 refs.; 2 tabs
DEFF Research Database (Denmark)
Dirckinck-Holmfeld, Lone; Svendsen, Brian Møller; Ponti, Marisa
The report documents and summarises the elements and dimensions that have been identified to describe and analyse the case studies collected in the Kaleidoscope Jointly Executed Integrating Research Project (JEIRP) on Conditions for productive learning in network learning environments.......The report documents and summarises the elements and dimensions that have been identified to describe and analyse the case studies collected in the Kaleidoscope Jointly Executed Integrating Research Project (JEIRP) on Conditions for productive learning in network learning environments....
Controlling networking multimedia appliances: with an open environment - a plan-based approach
Jantz, D.; Heider, T.
2000-01-01
The need for a better user assistance in technical environments led to the birth of a planning assistant. The principal problems in representing real world tasks in this environment of multimedia home devices are explained. A special issue is the developed EMBASSI Generic Architecture to integrate networked multimedia appliances. The planning assistant engages planning algorithms to fullfill user desires without handling traditional technical control interfaces.
Directory of Open Access Journals (Sweden)
Mona A. Hosny
2012-01-01
Full Text Available We present a short and efficient synthesis of the title compounds starting with cheap and readily available camphor and derivatives of acetophenone. The optimized sequence allows the large-scale preparation of this new type of synthesis in a few steps. New 1,2,3-thiadiazole and 1,2,3-diazaphosphole derivatives 11-20, were prepared from the ketones 1-5 via the corresponding semicarbazones 6-10. The Hurd-Mori and Lalezari methods were used, respectively, for the preparation of these 1,2,3-thiadiazole and 1,2,3-diazaphospholene derivatives. These derivatives exhibit anticancer effect due to their high potential biological activity.
Modeling Network Interdiction Tasks
2015-09-17
118 xiii Table Page 36 Computation times for weighted, 100-node random networks for GAND Approach testing in Python ...in Python . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 38 Accuracy measures for weighted, 100-node random networks for GAND...networks [15:p. 1]. A common approach to modeling network interdiction is to formulate the problem in terms of a two-stage strategic game between two
Hong, Sung-Ryong; Na, Wonshik; Kang, Jang-Mook
2010-01-01
This study suggests an approach to effective transmission of multimedia content in a rapidly changing Internet environment including smart-phones. Guaranteeing QoS in networks is currently an important research topic. When transmitting Assured Forwarding (AF) packets in a Multi-DiffServ network environment, network A may assign priority in an order AF1, AF2, AF3 and AF4; on the other hand, network B may reverse the order to a priority AF4, AF3, AF2 and AF1. In this case, the AF1 packets that received the best quality of service in network A will receive the lowest in network B, which may result in dropping of packets in network B and vice versa. This study suggests a way to guarantee QoS between hosts by minimizing the loss of AF packet class when one network transmits AF class packets to another network with differing principles. It is expected that QoS guarantees and their experimental value may be utilized as principles which can be applied to various mobile-web environments based on smart-phones. PMID:22163453
Social Networks as Learning Environments for Higher Education
Directory of Open Access Journals (Sweden)
J.A.Cortés
2014-09-01
Full Text Available Learning is considered as a social activity, a student does not learn only of the teacher and the textbook or only in the classroom, learn also from many other agents related to the media, peers and society in general. And since the explosion of the Internet, the information is within the reach of everyone, is there where the main area of opportunity in new technologies applied to education, as well as taking advantage of recent socialization trends that can be leveraged to improve not only informing of their daily practices, but rather as a tool that explore different branches of education research. One can foresee the future of higher education as a social learning environment, open and collaborative, where people construct knowledge in interaction with others, in a comprehensive manner. The mobility and ubiquity that provide mobile devices enable the connection from anywhere and at any time. In modern educational environments can be expected to facilitate mobile devices in the classroom expansion in digital environments, so that students and teachers can build the teaching-learning process collectively, this partial derivative results in the development of draft research approved by the CONADI in “Universidad Cooperativa de Colombia”, "Social Networks: A teaching strategy in learning environments in higher education."
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.123..., or Transportation to a Manufacturing Bonded Warehouse § 28.123 Export marks. (a) General. In addition... filled under the provisions of part 24 of this chapter, the proprietor shall mark the word “Export” on...
International Nuclear Information System (INIS)
Hosokawa, Ryohei; Nohara, Ryuji; Hirai, Taku; Fujita, Masatoshi; Sasayama, Shigetake; Fujibayashi, Yasuhisa; Magata, Yasuhiro; Tadamura, Eiji; Konishi, Junji
2001-01-01
Risk stratification of coronary artery disease may provide a basis for selection of treatment to prevent myocardial events and to assist functional recovery. Iodine-123 (ρ-iodophenyl)-3-R,S-methylpentadecanoic acid ( 123 I-BMIPP) is a radioiodinated fatty acid analogue for single-photon emission tomographic (SPET) imaging, and several reports have demonstrated that the abnormal uptake of 123 I-BMIPP is associated with wall motion abnormality and severe coronary artery stenosis. Clarification of the contribution of fatty acids to myocardial metabolism would be highly valuable in recognising this critical condition. In this study, we investigated the myocardial uptake of 123 I-BMIPP under low-flow ischaemia, and compared it with the uptake of fluorine-18 fluorodeoxyglucose ( 18 F-FDG). Using open chest dogs, the flow of the left anterior descending coronary artery was controlled using a pneumatic occluder in order to maintain a 30%-40% reduction of Doppler flow. 123 I-BMIPP and 18 F-FDG were injected into the left atrium after 90 min of ischaemia (protocols 1 and 3). Canine hearts were excised after 120 min of ischaemia for the measurement of radioactivity. In protocol 2, 123 I-BMIPP alone was injected and hearts were excised 8 min after the injection. A time-course biopsy study was also performed at the same time (protocol 3). Wall thickening was evaluated using a wall tracker module. The uptake of 18 F-FDG increased significantly in the ischaemic region (232%±135% vs non-ischaemic, P 18 F-FDG did not correlate well with the severity of MBF. On the other hand, 123 I-BMIPP uptake decreased gradually (78.9%±23.6%, P 123 I-BMIPP was associated not only with wall motion abnormality but also with the severity of MBF. In the biopsy study (protocol 3), the radioactivity of either 123 I-BMIPP or 18 F-FDG correlated well with the MBF at the time of tracer injection and was similar to post-mortem analysis. It is concluded that 18 F-FDG is a valid tool for identifying
Wuebbles, Donald J; Patten, Kenneth O
2009-05-01
HCFC-123 (C2HCl2F3) is used in large refrigeration systems and as a fire suppression agent blend. Like other hydrochlorofluorocarbons, production and consumption of HCFC-123 is limited under the Montreal Protocol on Substances that Deplete the Ozone Layer. The purpose of this study is to update the understanding of the current and projected impacts of HCFC-123 on stratospheric ozone and on climate and to discuss the potential environmental effects from continued use of this chemical for specific applications. For the first time, the Ozone Depletion Potential (ODP) of a HCFC is determined using a three-dimensional model (MOZART-3) of atmospheric physics and chemistry. All previous studies have relied on results from two-dimensional models. The derived HCFC-123 ODP of 0.0098 is smaller than previous values. Analysis of the projected uses and emissions of HCFC-123, assuming reasonable levels of projected growth and use in centrifugal chiller and fire suppressant applications, suggests an extremely small impact on the environment due to its short atmospheric lifetime, low ODP, low Global Warming Potential (GWP), and the small production and emission of its limited applications. The current contribution of HCFC-123 to stratospheric reactive chlorine is too small to be measurable.
International Nuclear Information System (INIS)
Feng, Yong-qiang; Hung, Tzu-Chen; He, Ya-Ling; Wang, Qian; Wang, Shuang; Li, Bing-xi; Lin, Jaw-Ren; Zhang, Wenping
2017-01-01
Highlights: • Experimental comparison using R123, R245fa and their mixtures has been investigated. • The basic operation parameters and the detailed operation characteristics of pure and mixture working fluids are addressed. • The mixture owns a relatively higher pump power consumption, 10–50% higher than that of R245fa and 2–47% higher than that of R123. • The highest system generating efficiency of 4.53% is obtained by 0.67R245fa/0.33R123. - Abstract: The operation characteristic and performance comparison of low-grade organic Rankine cycle (ORC) using R245fa, R123 and their mixtures have been investigated. The heat source temperature is set to be 120 °C, while the mass flow rate is controlled by adjusting the pump frequency. The basic operation parameters are first examined, while the detailed operation characteristics of pure and mixture working fluids are addressed. The system overall performance, including thermal efficiency and system generating efficiency, for pure and mixture working fluids are explored. The experimental results show that the mixtures own a relatively higher pump power consumption and enhancing the pump performance is also significant for ORC application. Whether the mixtures exhibit better thermodynamic performance than the pure working fluids depend on the operation parameters and mass fraction of mixtures. 0.67R245fa/0.33R123 owns the highest maximum net electricity output of 1.67 kW, 4.38% higher than that of R245fa and 63.73% higher than that of R123. Compared to the pure working fluids, the mixture working fluids own a better thermodynamic performance and a moderate economic performance.
Environment Aware Cellular Networks
Ghazzai, Hakim
2015-02-01
The unprecedented rise of mobile user demand over the years have led to an enormous growth of the energy consumption of wireless networks as well as the greenhouse gas emissions which are estimated currently to be around 70 million tons per year. This significant growth of energy consumption impels network companies to pay huge bills which represent around half of their operating expenditures. Therefore, many service providers, including mobile operators, are looking for new and modern green solutions to help reduce their expenses as well as the level of their CO2 emissions. Base stations are the most power greedy element in cellular networks: they drain around 80% of the total network energy consumption even during low traffic periods. Thus, there is a growing need to develop more energy-efficient techniques to enhance the green performance of future 4G/5G cellular networks. Due to the problem of traffic load fluctuations in cellular networks during different periods of the day and between different areas (shopping or business districts and residential areas), the base station sleeping strategy has been one of the main popular research topics in green communications. In this presentation, we present several practical green techniques that provide significant gains for mobile operators. Indeed, combined with the base station sleeping strategy, these techniques achieve not only a minimization of the fossil fuel consumption but also an enhancement of mobile operator profits. We start with an optimized cell planning method that considers varying spatial and temporal user densities. We then use the optimal transport theory in order to define the cell boundaries such that the network total transmit power is reduced. Afterwards, we exploit the features of the modern electrical grid, the smart grid, as a new tool of power management for cellular networks and we optimize the energy procurement from multiple energy retailers characterized by different prices and pollutant
21 CFR 123.7 - Corrective actions.
2010-04-01
... of their HACCP plans in accordance with § 123.6(c)(5), by which they predetermine the corrective... in accordance with § 123.10, to determine whether the HACCP plan needs to be modified to reduce the risk of recurrence of the deviation, and modify the HACCP plan as necessary. (d) All corrective actions...
27 CFR 31.123 - New corporation.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false New corporation. 31.123... Requiring Registration As A New Business § 31.123 New corporation. Where a new corporation is formed to take over and conduct the business of one or more corporations that have registered under this part, the new...
Single-photon emission tomography (SPECT) with 123I-amphetamine in cerebral ischemia
International Nuclear Information System (INIS)
Koenig, B.; Donis, J.; Mostbeck, A.; Koehn, H.
1987-01-01
The uptake of 123 I-amphetamine (IMP) in brain mainly corresponds to regional perfusion. Distribution of IMP can be visualized in tomographic slices by single-photon emission computed tomography (SPECT). For better evaluation and comparison in follow-up studies, right/left ratios were computed and an asymmetry index calculated. The most sensitive asymmetry index was achieved by 120 average circumferential profiles. In 52 patients with stroke and 16 controls the respective sensitivities of IMP-SPECT, computed tomography (CT), static and dynamic brain scanning and angiography were evaluated. In patients with TIA and PRIND the IMP-SPECT had the highest sensitivity of all non-invasive methods. In patients with completed stroke, the sensitivity of IMP-SPECT was comparable with that of CT (90 vs. 93%). There was a significant correlation between the IMP asymmetry index and the clinical and social score (p [de
Production of 123I for medical use with small accelerators
International Nuclear Information System (INIS)
Beyer, G.J.; Pimentel, G.; Solin, O.; Heselius, S.J.; Taka, T.
1988-01-01
The possibilities of 123 I production with small accelerators are discussed. Among the possible nuclear reactions the 122 Te(d,n) 123 I and the 123 Te(p,n) 123 I reaction are of particular interest for those institutions, who do not run a cyclotron with particle energies for protons above 18-20 MeV. The use of TeO 2 as target material is advantaged over Te. The 123 I preparations contain resonable amounts of 130 I and 124 I. The most 'dangerous' impurity is 130 I due to its high energy gamma radiation. Nevertheless, high quality imagings may be obtained using medium or high energy collimators loosing some of the advantages of 123 I. The proposed approach is the only way to make 123 I available for a number of institutions or countries running small cyclotrons and for which commercial 123 I is difficult or impossible to obtain for economical or geographical reasons. (author)
Wireless local area network in a prehospital environment
Directory of Open Access Journals (Sweden)
Grimes Gary J
2004-08-01
Full Text Available Abstract Background Wireless local area networks (WLANs are considered the next generation of clinical data network. They open the possibility for capturing clinical data in a prehospital setting (e.g., a patient's home using various devices, such as personal digital assistants, laptops, digital electrocardiogram (EKG machines, and even cellular phones, and transmitting the captured data to a physician or hospital. The transmission rate is crucial to the applicability of the technology in the prehospital setting. Methods We created two separate WLANs to simulate a virtual local are network environment such as in a patient's home or an emergency room (ER. The effects of different methods of data transmission, number of clients, and roaming among different access points on the file transfer rate were determined. Results The present results suggest that it is feasible to transfer small files such as patient demographics and EKG data from the patient's home to the ER at a reasonable speed. Encryption, user control, and access control were implemented and results discussed. Conclusions Implementing a WLAN in a centrally managed and multiple-layer-controlled access control server is the key to ensuring its security and accessibility. Future studies should focus on product capacity, speed, compatibility, interoperability, and security management.
Emergence of microbial networks as response to hostile environments
Directory of Open Access Journals (Sweden)
Dario eMadeo
2014-08-01
Full Text Available The majority of microorganisms live in complex communities under varying conditions. One pivotal question in evolutionary biology is the emergence of cooperative traits and their sustainment in altered environments or in the presence of free-riders. Co-occurrence patterns in the spatial distribution of biofilms can help define species' identities, and systems biology tools are revealing networks of interacting microorganisms. However, networks of inter-dependencies involving micro-organisms in the planktonic phase may be just as important, with the added complexity that they are not bounded in space. An integrated approach linking imaging, ``Omics'' and modeling has the potential to enable new hypothesis and working models. In order to understand how cooperation can emerge and be maintained without abilities like memory or recognition we use evolutionary game theory as the natural framework to model cell-cell interactions arising from evolutive decisions. We consider a finite population distributed in a spatial domain (biofilm, and divided into two interacting classes with different traits. This interaction can be weighted by distance, and produces physical connections between two elements allowing them to exchange finite amounts of energy and matter. Available strategies to each individual of one class in the population are the propensities or ``willingness'' to connect any individual of the other class. Following evolutionary game theory, we propose a mathematical model which explains the patterns of connections which emerge when individuals are able to find connection strategies that asymptotically optimize their fitness. The process explains the formation of a network for efficiently exchanging energy and matter among individuals and thus ensuring their survival in hostile environments.
Indoor location system based on discriminant-adaptive neural network in IEEE 802.11 environments.
Fang, Shih-Hau; Lin, Tsung-Nan
2008-11-01
This brief paper presents a novel localization algorithm, named discriminant-adaptive neural network (DANN), which takes the received signal strength (RSS) from the access points (APs) as inputs to infer the client position in the wireless local area network (LAN) environment. We extract the useful information into discriminative components (DCs) for network learning. The nonlinear relationship between RSS and the position is then accurately constructed by incrementally inserting the DCs and recursively updating the weightings in the network until no further improvement is required. Our localization system is developed in a real-world wireless LAN WLAN environment, where the realistic RSS measurement is collected. We implement the traditional approaches on the same test bed, including weighted kappa-nearest neighbor (WKNN), maximum likelihood (ML), and multilayer perceptron (MLP), and compare the results. The experimental results indicate that the proposed algorithm is much higher in accuracy compared with other examined techniques. The improvement can be attributed to that only the useful information is efficiently extracted for positioning while the redundant information is regarded as noise and discarded. Finally, the analysis shows that our network intelligently accomplishes learning while the inserted DCs provide sufficient information.
A Pseudomonas putida Strain Genetically Engineered for 1,2,3-Trichloropropane Bioremediation
Samin, Ghufrana; Pavlova, Martina; Arif, M. Irfan; Postema, Christiaan P.; Damborsky, Jiri; Janssen, Dick B.
2014-01-01
1,2,3-Trichloropropane (TCP) is a toxic compound that is recalcitrant to biodegradation in the environment. Attempts to isolate TCP-degrading organisms using enrichment cultivation have failed. A potential biodegradation pathway starts with hydrolytic dehalogenation to 2,3-dichloro-1-propanol (DCP), followed by oxidative metabolism. To obtain a practically applicable TCP-degrading organism, we introduced an engineered haloalkane dehalogenase with improved TCP degradation activity into the DCP...
Rhodamine-123: a p-glycoprotein marker complex with sodium lauryl sulfate.
Al-Mohizea, Abdullah M; Al-Jenoobi, Fahad Ibrahim; Alam, Mohd Aftab
2015-03-01
Aim of this study was to investigate the role of sodium lauryl sulfate (SLS) as P-glycoprotein inhibitor. The everted rat gut sac model was used to study in-vitro mucosal to serosal transport of Rhodamine-123 (Rho-123). Surprisingly, SLS decreases the serosal absorption of Rho-123 at all investigated concentrations. Investigation reveals complex formation between Rhodamine-123 and sodium lauryl sulfate. Interaction profile of SLS & Rho-123 was studied at variable SLS concentrations. The SLS concentration higher than critical micelle concentration (CMC) increases the solubility of Rho-123 but could not help in serosal absorption, on the contrary the absorption of Rho-123 decreased. Rho-123 and SLS form pink color complex at sub-CMC. The SLS concentrations below CMC decrease the solubility of Rho-123. For further studies, Rho-123 & SLS complex was prepared by using solvent evaporation technique and characterized by using differential scanning calorimeter (DSC). Thermal analysis also proved the formation of complex between SLS & Rho-123. The P values were found to be significant (<0.05) except group comprising 0.0001% SLS, and that is because 0.0001% SLS is seems to be very low to affect the solubility or complexation of Rho-123.
Myocardial scintigraphy with I-123 labeled fatty acids
International Nuclear Information System (INIS)
Dudczak, R.
1983-01-01
This study presents experimental and clinical data in the use of I-123 labeled aromatic and aliphatic fatty acids. I-123 p-phenylpentadecanoic acid (p-IPPA) and I-123 heptadecanoic acid (HDA) were applied for myocardial scintigraphy. The feasibility of p-IPPA and HDA for myocardial scintigraphy was substantiated in animal experiments. Clinical studies were performed in patients with coronary artery disease (CAD) and cardiomyopathy (CMP). In CAD the results of fatty acid studies were compared with those of Tl-201. I-123 labeled fatty acids proved to be a useful tool for myocardial scintigraphy. The possibility to evaluate non invasively the myocardial metabolic function in man may add a complementary diagnostic tool in the clinical follow up of patients with heart disease. In CAD studies with I-123 p-IPPA and I-123 HDA might provide a means to assess the degree of myocardial viability and to identify a subgroup of patients who are at increased risk for irreversible myocardial damage. In patients with CMP it is probable that these studies may be used as a means of separating groups of patients with this disease. (Author)
Ion chemistry of 1H-1,2,3-triazole.
Ichino, Takatoshi; Andrews, Django H; Rathbone, G Jeffery; Misaizu, Fuminori; Calvi, Ryan M D; Wren, Scott W; Kato, Shuji; Bierbaum, Veronica M; Lineberger, W Carl
2008-01-17
A combination of experimental methods, photoelectron-imaging spectroscopy, flowing afterglow-photoelectron spectroscopy and the flowing afterglow-selected ion flow tube technique, and electronic structure calculations at the B3LYP/6-311++G(d,p) level of density functional theory (DFT) have been employed to study the mechanism of the reaction of the hydroxide ion (HO-) with 1H-1,2,3-triazole. Four different product ion species have been identified experimentally, and the DFT calculations suggest that deprotonation by HO- at all sites of the triazole takes place to yield these products. Deprotonation of 1H-1,2,3-triazole at the N1-H site gives the major product ion, the 1,2,3-triazolide ion. The 335 nm photoelectron-imaging spectrum of the ion has been measured. The electron affinity (EA) of the 1,2,3-triazolyl radical has been determined to be 3.447 +/- 0.004 eV. This EA and the gas-phase acidity of 2H-1,2,3-triazole are combined in a negative ion thermochemical cycle to determine the N-H bond dissociation energy of 2H-1,2,3-triazole to be 112.2 +/- 0.6 kcal mol-1. The 363.8 nm photoelectron spectroscopic measurements have identified the other three product ions. Deprotonation of 1H-1,2,3-triazole at the C5 position initiates fragmentation of the ring structure to yield a minor product, the ketenimine anion. Another minor product, the iminodiazomethyl anion, is generated by deprotonation of 1H-1,2,3-triazole at the C4 position, followed by N1-N2 bond fission. Formation of the other minor product, the 2H-1,2,3-triazol-4-ide ion, can be rationalized by initial deprotonation of 1H-1,2,3-triazole at the N1-H site and subsequent proton exchanges within the ion-molecule complex. The EA of the 2H-1,2,3-triazol-4-yl radical is 1.865 +/- 0.004 eV.
Napolitano, Rebecca; Blyth, Anna; Glisic, Branko
2018-01-16
Visualization of sensor networks, data, and metadata is becoming one of the most pivotal aspects of the structural health monitoring (SHM) process. Without the ability to communicate efficiently and effectively between disparate groups working on a project, an SHM system can be underused, misunderstood, or even abandoned. For this reason, this work seeks to evaluate visualization techniques in the field, identify flaws in current practices, and devise a new method for visualizing and accessing SHM data and metadata in 3D. More precisely, the work presented here reflects a method and digital workflow for integrating SHM sensor networks, data, and metadata into a virtual reality environment by combining spherical imaging and informational modeling. Both intuitive and interactive, this method fosters communication on a project enabling diverse practitioners of SHM to efficiently consult and use the sensor networks, data, and metadata. The method is presented through its implementation on a case study, Streicker Bridge at Princeton University campus. To illustrate the efficiency of the new method, the time and data file size were compared to other potential methods used for visualizing and accessing SHM sensor networks, data, and metadata in 3D. Additionally, feedback from civil engineering students familiar with SHM is used for validation. Recommendations on how different groups working together on an SHM project can create SHM virtual environment and convey data to proper audiences, are also included.
Concept for trusted personal devices in a mobile and networked environment
Bormann, Frank C.; Manteau, Laurent; Linke, Andreas; Pailles, Jean C.; van Dijk, Johannes A.G.M.
2006-01-01
In this article we present a concept for Trusted Personal Devices, which are intended to be the common platform for the next generation of Smart Cards and other secure devices in mobile and networked environments. The concept is based on a classification of technical profiles for different potential
CCNA routing and switching study guide exams 100-101, 200-101, and 200-120
Lammle, Todd
2013-01-01
Prepare for the new CCNA exams with this Todd Lammle study guide Cisco author, speaker, and trainer Todd Lammle is considered the authority on all things networking, and his books have sold almost a million copies worldwide. This all-purpose CCNA study guide methodically covers all the objectives of the ICND1 (100-101) and ICND2 (200-101) exams as well as providing additional insight for those taking CCNA Composite (200-120) exam. It thoroughly examines operation of IP data networks, LAN switching technologies, IP addressing (IPv4/IPv6), IP routing technologies, IP services, network device s
Co-creation and Co-innovation in a Collaborative Networked Environment
Klen, Edmilson Rampazzo
Leveraged by the advances in communication and information Technologies, producers and consumers are developing a new behavior. Together with the new emerging collaborative manifestations this behavior may directly impact the way products are developed. This powerful combination indicates that consumers will be involved in a very early stage in product development processes supporting even more the creation and innovation of products. This new way of collaboration gives rise to a new collaborative networked environment based on co-creation and co-innovation. This work will present some evolutionary steps that point to the development of this environment where prosumer communities and virtual organizations interact and collaborate.
Morrison, Sarah A; Lorenz, Douglas; Eskay, Carol P; Forrest, Gail F; Basso, D Michele
2018-03-01
To determine the impact of long-term, body weight-supported locomotor training after chronic, incomplete spinal cord injury (SCI), and to estimate the health care costs related to lost recovery potential and preventable secondary complications that may have occurred because of visit limits imposed by insurers. Prospective observational cohort with longitudinal follow-up. Eight outpatient rehabilitation centers that participate in the Christopher & Dana Reeve Foundation NeuroRecovery Network (NRN). Individuals with motor incomplete chronic SCI (American Spinal Injury Association Impairment Scale C or D; N=69; 0.1-45y after SCI) who completed at least 120 NRN physical therapy sessions. Manually assisted locomotor training (LT) in a body weight-supported treadmill environment, overground standing and stepping activities, and community integration tasks. International Standards for Neurological Classification of Spinal Cord Injury motor and sensory scores, orthostatic hypotension, bowel/bladder/sexual function, Spinal Cord Injury Functional Ambulation Inventory (SCI-FAI), Berg Balance Scale, Modified Functional Reach, 10-m walk test, and 6-minute walk test. Longitudinal outcome measure collection occurred every 20 treatments and at 6- to 12-month follow-up after discharge from therapy. Significant improvement occurred for upper and lower motor strength, functional activities, psychological arousal, sensation of bowel movement, and SCI-FAI community ambulation. Extended training enabled minimal detectable changes at 60, 80, 100, and 120 sessions. After detectable change occurred, it was sustained through 120 sessions and continued 6 to 12 months after treatment. Delivering at least 120 sessions of LT improves recovery from incomplete chronic SCI. Because walking reduces rehospitalization, LT delivered beyond the average 20-session insurance limit can reduce rehospitalizations and long-term health costs. Copyright © 2018 American Congress of Rehabilitation Medicine
Hot seeding using large Y-123 seeds
International Nuclear Information System (INIS)
Scruggs, S J; Putman, P T; Zhou, Y X; Fang, H; Salama, K
2006-01-01
There are several motivations for increasing the diameter of melt textured single domain discs. The maximum magnetic field produced by a trapped field magnet is proportional to the radius of the sample. Furthermore, the availability of trapped field magnets with large diameter could enable their use in applications that have traditionally been considered to require wound electromagnets, such as beam bending magnets for particle accelerators and electric propulsion. We have investigated the possibility of using large area epitaxial growth instead of the conventional point nucleation growth mechanism. This process involves the use of large Y123 seeds for the purpose of increasing the maximum achievable Y123 single domain size. The hot seeding technique using large Y-123 seeds was employed to seed Y-123 samples. Trapped field measurements indicate that single domain samples were indeed grown by this technique. Microstructural evaluation indicates that growth can be characterized by a rapid nucleation followed by the usual peritectic grain growth which occurs when large seeds are used. Critical temperature measurements show that no local T c suppression occurs in the vicinity of the seed. This work supports the suggestion of using an iterative method for increasing the size of Y-123 single domains that can be grown
12 CFR 225.123 - Activities closely related to banking.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities closely related to banking. 225.123 Section 225.123 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... Holding Companies Interpretations § 225.123 Activities closely related to banking. (a) Effective June 15...
Labeling and quality control of 123I-MIBG
International Nuclear Information System (INIS)
Figols de Barboza, Marycel Rosa
2002-01-01
This report describes a method to facilitate routine production of 123 I-MIBG in Radiopharmacy Centre of IPEN-CNEN/SP. Iodine-123 radioisotope is produced in the form of sodium iodide in Cyclone-30 (IBA) at IPEN-CNEN/SP through proton irradiation of gaseous 124 Xe target. The labelling procedure uses MIBG-sulphate and leads to 123 I-MIBG with radiochemical purity at least 98% and specific activity of 300-380 MBq/mg
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17
International Nuclear Information System (INIS)
Hara, Masafumi; Tomiguchi, Seiji; Kojima, Akihiro; Nakashima, Rumi; Ooyama, Youichi; Takahashi, Mutsumasa; Matsumoto, Masanori.
1994-01-01
123 I-IMP clearance on dynamic lung scintigraphy was studied by two exponential compartments analysis in order to evaluate the effects of aging and smoking on the pulmonary function. Twenty-four patients (14 smokers and 10 non-smokers), referred for 123 I-IMP brain perfusion study, underwent lung dynamic scintigraphy for 42 min immediately after 123 I-IMP injection. In the non-smoking group 123 I-IMP lung clearance was delayed with aging. A significant correlation was found between aging and clearance rate in the lung. There was also a significant difference in the clearance rates between smoker and non-smoker groups. These findings suggest that smoking and aging affect the pulmonary function. (author)
High-precision multi-node clock network distribution.
Chen, Xing; Cui, Yifan; Lu, Xing; Ci, Cheng; Zhang, Xuesong; Liu, Bo; Wu, Hong; Tang, Tingsong; Shi, Kebin; Zhang, Zhigang
2017-10-01
A high precision multi-node clock network for multiple users was built following the precise frequency transmission and time synchronization of 120 km fiber. The network topology adopts a simple star-shaped network structure. The clock signal of a hydrogen maser (synchronized with UTC) was recovered from a 120 km telecommunication fiber link and then was distributed to 4 sub-stations. The fractional frequency instability of all substations is in the level of 10 -15 in a second and the clock offset instability is in sub-ps in root-mean-square average.
Recent developments in the field of 123I-radiopharmaceuticals
International Nuclear Information System (INIS)
Machulla, H.J.; Knust, E.J.
1984-01-01
Due to its advantageous nuclear physical properties iodine-123 is an excellent label for radiopharmaceuticals very well suited for measurements by γ-cameras and single-photon emission tomography. The development of 123 I-radiopharmaceuticals should be based on a clear biochemical concept, reliable labelling procedures and careful pharmacokinetic studies in order to evaluate the physiological behaviour of the radioiodinated compounds being analogues of metabolic substrates. The development of 123 I-labelled fatty acids and biogenic amines clearly proved the successful use of 123 I for labelling compounds applied in medical diagnosis. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Palumbo, Barbara [University of Perugia, Nuclear Medicine Section, Department of Surgical, Radiological and Odontostomatological Sciences, Ospedale S. Maria della Misericordia, Perugia (Italy); Fravolini, Mario Luca [University of Perugia, Department of Electronic and Information Engineering, Perugia (Italy); Nuvoli, Susanna; Spanu, Angela; Madeddu, Giuseppe [University of Sassari, Department of Nuclear Medicine, Sassari (Italy); Paulus, Kai Stephan [University of Sassari, Department of Neurology, Sassari (Italy); Schillaci, Orazio [University Tor Vergata, Department of Biopathology and Diagnostic Imaging, Rome (Italy); IRCSS Neuromed, Pozzilli (Italy)
2010-11-15
To contribute to the differentiation of Parkinson's disease (PD) and essential tremor (ET), we compared two different artificial neural network classifiers using {sup 123}I-FP-CIT SPECT data, a probabilistic neural network (PNN) and a classification tree (ClT). {sup 123}I-FP-CIT brain SPECT with semiquantitative analysis was performed in 216 patients: 89 with ET, 64 with PD with a Hoehn and Yahr (H and Y) score of {<=}2 (early PD), and 63 with PD with a H and Y score of {>=}2.5 (advanced PD). For each of the 1,000 experiments carried out, 108 patients were randomly selected as the PNN training set, while the remaining 108 validated the trained PNN, and the percentage of the validation data correctly classified in the three groups of patients was computed. The expected performance of an ''average performance PNN'' was evaluated. In analogy, for ClT 1,000 classification trees with similar structures were generated. For PNN, the probability of correct classification in patients with early PD was 81.9{+-}8.1% (mean{+-}SD), in patients with advanced PD 78.9{+-}8.1%, and in ET patients 96.6{+-}2.6%. For ClT, the first decision rule gave a mean value for the putamen of 5.99, which resulted in a probability of correct classification of 93.5{+-}3.4%. This means that patients with putamen values >5.99 were classified as having ET, while patients with putamen values <5.99 were classified as having PD. Furthermore, if the caudate nucleus value was higher than 6.97 patients were classified as having early PD (probability 69.8{+-}5.3%), and if the value was <6.97 patients were classified as having advanced PD (probability 88.1%{+-}8.8%). These results confirm that PNN achieved valid classification results. Furthermore, ClT provided reliable cut-off values able to differentiate ET and PD of different severities. (orig.)
National Research Council Canada - National Science Library
Bakshi, Amol
2003-01-01
Networks of inexpensive, low-power sensing nodes that can monitor the environment, perform limited processing on the samples, and detect events of interest in a collaborative fashion are fast becoming a reality...
Energy Technology Data Exchange (ETDEWEB)
Caschili, Simone, E-mail: s.caschili@ucl.ac.uk [UCL QASER Lab, University College London, Gower Street, London WC1E 6BT (United Kingdom); De Montis, Andrea; Ganciu, Amedeo; Ledda, Antonio; Barra, Mario [Dipartimento di Agraria, University of Sassari, viale Italia, 39, 07100 Sassari (Italy)
2014-07-01
Academic literature has been continuously growing at such a pace that it can be difficult to follow the progression of scientific achievements; hence, the need to dispose of quantitative knowledge support systems to analyze the literature of a subject. In this article we utilize network analysis tools to build a literature review of scientific documents published in the multidisciplinary field of Strategic Environment Assessment (SEA). The proposed approach helps researchers to build unbiased and comprehensive literature reviews. We collect information on 7662 SEA publications and build the SEA Bibliographic Network (SEABN) employing the basic idea that two publications are interconnected if one cites the other. We apply network analysis at macroscopic (network architecture), mesoscopic (sub graph) and microscopic levels (node) in order to i) verify what network structure characterizes the SEA literature, ii) identify the authors, disciplines and journals that are contributing to the international discussion on SEA, and iii) scrutinize the most cited and important publications in the field. Results show that the SEA is a multidisciplinary subject; the SEABN belongs to the class of real small world networks with a dominance of publications in Environmental studies over a total of 12 scientific sectors. Christopher Wood, Olivia Bina, Matthew Cashmore, and Andrew Jordan are found to be the leading authors while Environmental Impact Assessment Review is by far the scientific journal with the highest number of publications in SEA studies. - Highlights: • We utilize network analysis to analyze scientific documents in the SEA field. • We build the SEA Bibliographic Network (SEABN) of 7662 publications. • We apply network analysis at macroscopic, mesoscopic and microscopic network levels. • We identify SEABN architecture, relevant publications, authors, subjects and journals.
International Nuclear Information System (INIS)
Caschili, Simone; De Montis, Andrea; Ganciu, Amedeo; Ledda, Antonio; Barra, Mario
2014-01-01
Academic literature has been continuously growing at such a pace that it can be difficult to follow the progression of scientific achievements; hence, the need to dispose of quantitative knowledge support systems to analyze the literature of a subject. In this article we utilize network analysis tools to build a literature review of scientific documents published in the multidisciplinary field of Strategic Environment Assessment (SEA). The proposed approach helps researchers to build unbiased and comprehensive literature reviews. We collect information on 7662 SEA publications and build the SEA Bibliographic Network (SEABN) employing the basic idea that two publications are interconnected if one cites the other. We apply network analysis at macroscopic (network architecture), mesoscopic (sub graph) and microscopic levels (node) in order to i) verify what network structure characterizes the SEA literature, ii) identify the authors, disciplines and journals that are contributing to the international discussion on SEA, and iii) scrutinize the most cited and important publications in the field. Results show that the SEA is a multidisciplinary subject; the SEABN belongs to the class of real small world networks with a dominance of publications in Environmental studies over a total of 12 scientific sectors. Christopher Wood, Olivia Bina, Matthew Cashmore, and Andrew Jordan are found to be the leading authors while Environmental Impact Assessment Review is by far the scientific journal with the highest number of publications in SEA studies. - Highlights: • We utilize network analysis to analyze scientific documents in the SEA field. • We build the SEA Bibliographic Network (SEABN) of 7662 publications. • We apply network analysis at macroscopic, mesoscopic and microscopic network levels. • We identify SEABN architecture, relevant publications, authors, subjects and journals
Investigation of 123I production using electron accelerator
International Nuclear Information System (INIS)
Avetisyan, Albert; Avagyan, Robert; Dallakyan, Ruben; Avdalyan, Gohar; Dobrovolsky, Nikolay; Gavalyan, Vasak; Kerobyan, Ivetta; Harutyunyan, Gevorg
2017-01-01
The possibility of 123 I isotope production with the help of the high-intensity bremsstrahlung photons produced by the electron beam of the LUE50 linear electron accelerator at the A.I. Alikhanyan National Science Laboratory (Yerevan Physics Institute [YerPhI]) is considered. The production method has been established and shown to be successful. The 124 Xe(γ,n) 123 Xe → 123 I nuclear reaction has been investigated and the cross-section was calculated by nuclear codes TALYS 1.6 and EMPIRE 3.2. The optimum parameter of the thickness of the target was determined by GEANT4 code. For the normalized yield of 123 I, the value of 143 Bq/(mg·μA·h) has been achieved.
Energy Technology Data Exchange (ETDEWEB)
Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji [Jikei Univ., Tokyo (Japan). School of Medicine
1997-01-01
{sup 123}I-Iomazenil ({sup 123}I-IMZ) and {sup 123}I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On {sup 123}I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on {sup 123}I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower {sup 123}I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of {sup 123}I-IMZ, negative correlation (R<-0.7) was recognized hippocampus and parahippocampal gyrus, frontal and occipital cortices. Compared between HAS and the count ratio to the cerebellum on {sup 123}I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)
Integrating a social network group with a 3D collaborative learning environment
Pourmirza, S.; Gardner, M.; Callaghan, V; Augusto, J.C.; Zhang, T.
2014-01-01
Although extensive research has been carried out on virtual learning environments and the role of groups and communities in social networks, few studies exist which adequately cover the relationship between these two domains. In this paper, the authors demonstrate the effectiveness of integrating
7 CFR 1955.123 - Sale procedures (chattel).
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Sale procedures (chattel). 1955.123 Section 1955.123 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS... be notified of the opportunity to appeal in accordance with subpart B of part 1900 of this chapter...
9 CFR 113.123 - Salmonella Dublin Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...
Information Sharing Mechanism among Mobile Agents In Ad-hoc Network Environment and Its Applications
Directory of Open Access Journals (Sweden)
Kunio Umetsuji
2004-12-01
Full Text Available Mobile agents are programs that can move from one site to another in a network with their data and states. Mobile agents are expected to be an essential tool in pervasive computing. In multi platform environment, it is important to communicate with mobile agents only using their universal or logical name not using their physical locations. More, in an ad-hoc network environment, an agent can migrate autonomously and communicate with other agents on demand. It is difficult that mobile agent grasps the position information on other agents correctly each other, because mobile agent processes a task while moving a network successively. In order to realize on-demand mutual communication among mobile agents without any centralized servers, we propose a new information sharing mechanism within mobile agents. In this paper, we present a new information sharing mechanism within mobile agents. The method is a complete peer based and requires no agent servers to manage mobile agent locations. Therefore, a mobile agent can get another mobile agent, communicate with it and shares information stored in the agent without any knowledge of the location of the target mobile agent. The basic idea of the mechanism is an introduction of Agent Ring, Agent Chain and Shadow Agent. With this mechanism, each agent can communicate with other agents in a server-less environment, which is suitable for ad-hoc agent network and an agent system can manage agents search and communications efficiently.
Directory of Open Access Journals (Sweden)
Darya-Anna Alekseevna Kaibiyainen
2015-03-01
Full Text Available Objective to elaborate theoretical and applied aspects of the processes of forming the new network institutional environment of the Russian regional economy under the influence of the developing integral educational network structures basing on the study of the experience of national research universities of Tatarstan Republic Methods general scientific logical methods of analysis and synthesis induction and deduction scientific abstraction as well as the method of systemicfunctional analysis. Results the practical examples are revealed and analyzed of introducing the new network integral principles into the functioning of national research universities which have a real economic effect and influencing such indicators of regional economy as the growth of employment reduction of unemployment etc. Scientific novelty problems of network structures development in the Russian education have not been thoroughly studied yet. The article analyzes the experience reveals and describes the methods and techniques of forming the network educational structures in the functioning of national research universities in Tatarstan Republic Practical value the author shows the ability of network university structures not only to play a significant role forming the new institutional environment of the regional economy but also to influence the macro and microeconomic indicators of development of the region and the country. nbsp
A Wearable Wireless Sensor Network for Indoor Smart Environment Monitoring in Safety Applications.
Antolín, Diego; Medrano, Nicolás; Calvo, Belén; Pérez, Francisco
2017-02-14
This paper presents the implementation of a wearable wireless sensor network aimed at monitoring harmful gases in industrial environments. The proposed solution is based on a customized wearable sensor node using a low-power low-rate wireless personal area network (LR-WPAN) communications protocol, which as a first approach measures CO₂ concentration, and employs different low power strategies for appropriate energy handling which is essential to achieving long battery life. These wearables nodes are connected to a deployed static network and a web-based application allows data storage, remote control and monitoring of the complete network. Therefore, a complete and versatile remote web application with a locally implemented decision-making system is accomplished, which allows early detection of hazardous situations for exposed workers.
A Wearable Wireless Sensor Network for Indoor Smart Environment Monitoring in Safety Applications
Directory of Open Access Journals (Sweden)
Diego Antolín
2017-02-01
Full Text Available This paper presents the implementation of a wearable wireless sensor network aimed at monitoring harmful gases in industrial environments. The proposed solution is based on a customized wearable sensor node using a low-power low-rate wireless personal area network (LR-WPAN communications protocol, which as a first approach measures CO2 concentration, and employs different low power strategies for appropriate energy handling which is essential to achieving long battery life. These wearables nodes are connected to a deployed static network and a web-based application allows data storage, remote control and monitoring of the complete network. Therefore, a complete and versatile remote web application with a locally implemented decision-making system is accomplished, which allows early detection of hazardous situations for exposed workers.
DEFF Research Database (Denmark)
Gao, B.; Huang, Q.; Jie, Q.
2015-01-01
/2 cascade, while low concentrations elevated P38 and increased adipogenesis. The fine molecular regulation of GPR120 was implemented by up-regulating different integrin subunits (alpha 1, alpha 2 and beta 1; alpha 5 and beta 3). The administration of high doses of TUG-891 rescued oestrogen-deficient bone...... was involved in the cytoplasmic regulation of a seesaw-like balance between ERK and p38 phosphorylation. These findings provide new hope for developing novel remedies to treat osteoporosis by adjusting the GPR120-mediated differentiation balance of BMMSCs....
Azpilicueta, Leire; López-Iturri, Peio; Aguirre, Erik; Mateo, Ignacio; Astrain, José Javier; Villadangos, Jesús; Falcone, Francisco
2014-12-10
The use of wireless networks has experienced exponential growth due to the improvements in terms of battery life and low consumption of the devices. However, it is compulsory to conduct previous radio propagation analysis when deploying a wireless sensor network. These studies are necessary to perform an estimation of the range coverage, in order to optimize the distance between devices in an actual network deployment. In this work, the radio channel characterization for ISM 2.4 GHz Wireless Sensor Networks (WSNs) in an inhomogeneous vegetation environment has been analyzed. This analysis allows designing environment monitoring tools based on ZigBee and WiFi where WSN and smartphones cooperate, providing rich and customized monitoring information to users in a friendly manner. The impact of topology as well as morphology of the environment is assessed by means of an in-house developed 3D Ray Launching code, to emulate the realistic operation in the framework of the scenario. Experimental results gathered from a measurement campaign conducted by deploying a ZigBee Wireless Sensor Network, are analyzed and compared with simulations in this paper. The scenario where this network is intended to operate is a combination of buildings and diverse vegetation species. To gain insight in the effects of radio propagation, a simplified vegetation model has been developed, considering the material parameters and simplified geometry embedded in the simulation scenario. An initial location-based application has been implemented in a real scenario, to test the functionality within a context aware scenario. The use of deterministic tools can aid to know the impact of the topological influence in the deployment of the optimal Wireless Sensor Network in terms of capacity, coverage and energy consumption, making the use of these systems attractive for multiple applications in inhomogeneous vegetation environments.
Directory of Open Access Journals (Sweden)
Leire Azpilicueta
2014-12-01
Full Text Available The use of wireless networks has experienced exponential growth due to the improvements in terms of battery life and low consumption of the devices. However, it is compulsory to conduct previous radio propagation analysis when deploying a wireless sensor network. These studies are necessary to perform an estimation of the range coverage, in order to optimize the distance between devices in an actual network deployment. In this work, the radio channel characterization for ISM 2.4 GHz Wireless Sensor Networks (WSNs in an inhomogeneous vegetation environment has been analyzed. This analysis allows designing environment monitoring tools based on ZigBee and WiFi where WSN and smartphones cooperate, providing rich and customized monitoring information to users in a friendly manner. The impact of topology as well as morphology of the environment is assessed by means of an in-house developed 3D Ray Launching code, to emulate the realistic operation in the framework of the scenario. Experimental results gathered from a measurement campaign conducted by deploying a ZigBee Wireless Sensor Network, are analyzed and compared with simulations in this paper. The scenario where this network is intended to operate is a combination of buildings and diverse vegetation species. To gain insight in the effects of radio propagation, a simplified vegetation model has been developed, considering the material parameters and simplified geometry embedded in the simulation scenario. An initial location-based application has been implemented in a real scenario, to test the functionality within a context aware scenario. The use of deterministic tools can aid to know the impact of the topological influence in the deployment of the optimal Wireless Sensor Network in terms of capacity, coverage and energy consumption, making the use of these systems attractive for multiple applications in inhomogeneous vegetation environments.
16 CFR 1.23 - Quantity limit rules.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Quantity limit rules. 1.23 Section 1.23 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... Robinson-Patman Act. These rules have the force and effect of law. [32 FR 8444, June 13, 1967. Redesignated...
Ergün, Esin; Usluel, Yasemin Koçak
2016-01-01
In this study, we assessed the communication structure in an educational online learning environment using social network analysis (SNA). The communication structure was examined with respect to time, and instructor's participation. The course was implemented using ELGG, a network learning environment, blended with face-to-face sessions over a…
V123 Beam Synchronous Encoder Module
International Nuclear Information System (INIS)
Kerner, T.; Conkling, C. R.; Oerter, B.
1999-01-01
The V123 Synchronous Encoder Module transmits events to distributed trigger modules and embedded decoders around the RHIC rings where they are used to provide beam instrumentation triggers [1,2,3]. The RHIC beam synchronous event link hardware is mainly comprised of three VMEbus board designs, the central input modules (V201), and encoder modules (V123), and the distributed trigger modules (V124). Two beam synchronous links, one for each ring, are distributed via fiberoptic and fanned out via twisted wire pair cables. The V123 synchronizes with the RF system clock derived from the beam bucket frequency and a revolution fiducial pulse. The RF system clock is used to create the beam synchronous event link carrier and events are synchronized with the rotation fiducial. A low jitter RF clock is later recovered from this carrier by phase lock loops in the trigger modules. Prioritized hardware and software triggers fill up to 15 beam event code transmission slots per revolution while tracking the ramping RF acceleration frequency and storage frequency. The revolution fiducial event is always the first event transmitted which is used to synchronize the firing of the abort kicker and to locate the first bucket for decoders distributed about the ring
2010-07-01
... NATIONAL POLLUTANT DISCHARGE ELIMINATION SYSTEM Permit Application and Special NPDES Program Requirements... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Concentrated aquatic animal production facilities (applicable to State NPDES programs, see § 123.25). 122.24 Section 122.24 Protection of...
Treglia, Giorgio; Cason, Ernesto; Cortelli, Pietro; Gabellini, Anna; Liguori, Rocco; Bagnato, Antonio; Giordano, Alessandro; Fagioli, Giorgio
2014-01-01
To compare myocardial sympathetic imaging using (123)I-Metaiodobenzylguanidine (MIBG) scintigraphy and striatal dopaminergic imaging using (123)I-Ioflupane (FP-CIT) single photon emission computed tomography (SPECT) in patients with suspected Lewy body diseases (LBD). Ninety-nine patients who performed both methods within 2 months for differential diagnosis between Parkinson's disease (PD) and other parkinsonism (n = 68) or between dementia with Lewy bodies (DLB) and other dementia (n = 31) were enrolled. Sensitivity, specificity, accuracy, positive and negative predictive values of both methods were calculated. For (123) I-MIBG scintigraphy, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 83%, 79%, 82%, 86%, and 76%, respectively. For (123)I-FP-CIT SPECT, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 93%, 41%, 73%, 71%, and 80%, respectively. There was a statistically significant difference between these two methods in patients without LBD, but not in patients with LBD. LBD usually present both myocardial sympathetic and striatal dopaminergic impairments. (123)I-FP-CIT SPECT presents high sensitivity in the diagnosis of LBD; (123)I-MIBG scintigraphy may have a complementary role in differential diagnosis between PD and other parkinsonism. These scintigraphic methods showed similar diagnostic accuracy in differential diagnosis between DLB and other dementia. Copyright © 2012 by the American Society of Neuroimaging.
50 CFR 14.123 - Care in transit.
2010-10-01
... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Care in transit. 14.123 Section 14.123 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... transit. (a) A primate shall be observed for signs of distress and given food and water according to the...
27 CFR 22.123 - Losses on premises.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses on premises. 22.123... OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Losses § 22.123 Losses on premises. (a) Recording of losses. A permittee shall determine and record, in the records prescribed by subpart...
17 CFR 12.3 - Business address; hours.
2010-04-01
... REPARATIONS General Information and Preliminary Consideration of Pleadings § 12.3 Business address; hours. The... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Business address; hours. 12.3..., DC 20581. It is open each day, except Saturdays, Sundays, and legal public holidays, from 8:15 a.m...
Security Technologies for Open Networking Environments (STONE)
Energy Technology Data Exchange (ETDEWEB)
Muftic, Sead
2005-03-31
Under this project SETECS performed research, created the design, and the initial prototype of three groups of security technologies: (a) middleware security platform, (b) Web services security, and (c) group security system. The results of the project indicate that the three types of security technologies can be used either individually or in combination, which enables effective and rapid deployment of a number of secure applications in open networking environments. The middleware security platform represents a set of object-oriented security components providing various functions to handle basic cryptography, X.509 certificates, S/MIME and PKCS No.7 encapsulation formats, secure communication protocols, and smart cards. The platform has been designed in the form of security engines, including a Registration Engine, Certification Engine, an Authorization Engine, and a Secure Group Applications Engine. By creating a middleware security platform consisting of multiple independent components the following advantages have been achieved - Object-oriented, Modularity, Simplified Development, and testing, Portability, and Simplified extensions. The middleware security platform has been fully designed and a preliminary Java-based prototype has been created for the Microsoft Windows operating system. The Web services security system, designed in the project, consists of technologies and applications that provide authentication (i.e., single sign), authorization, and federation of identities in an open networking environment. The system is based on OASIS SAML and XACML standards for secure Web services. Its topology comprises three major components: Domain Security Server (DSS) is the main building block of the system Secure Application Server (SAS) Secure Client In addition to the SAML and XACML engines, the authorization system consists of two sets of components An Authorization Administration System An Authorization Enforcement System Federation of identities in multi
2006-06-01
networks is home automation . Wireless sensor networks can be employed in a home environment similar to the ways they are deployed in environmental...and industrial settings. Home automation provides increased control of home appliances and security. Climate control and security systems are the...most common types of home automation applications. However, as technology 12 has increased, new applications are emerging. For example
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1280.120 Section 1280.120 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE LAMB PROMOTION, RESEARCH, AND INFORMATION ORDER Lamb Promotion, Research, and Information Order Definitions § 1280.120 Research. Research...
BKR 26(4) pp. 120-123 (Achuba)
African Journals Online (AJOL)
Femi J. Olorunniji
2014-12-31
Dec 31, 2014 ... ABSTRACT: The purpose of this study was to investigate the effects of palm oil ... haematological parameters of rats fed with diesel-contaminated diets. ..... haematological parameters in Rat following ingestion of crude oil (Nigeria Bonny Light), petrol, kerosene and diesel. ... Comparative effect of vitamins A.
Three Dimensional Virtual Environments as a Tool for Development of Personal Learning Networks
Directory of Open Access Journals (Sweden)
Aggeliki Nikolaou
2013-01-01
Full Text Available Technological advances have altered how, where, when, and what information is created, presented and diffused in working and social environments as well as how learners interact with that information. Virtual worlds constitute an emerging realm for collaborative play, learning and work. This paper describes how virtual worlds provide a mechanism to facilitate the creation and development of Personal Learning Networks. This qualitative investigation focuses on the role of three-dimensional virtual environments (3DVEs in the creation and development of Personal Learning Networks (PLNs. More specifically, this work investigates the reasons that drive members of Education Orientated Groups (hereafter “Groups” in Second Life (SL, to adopt a technological innovation as a milieu of learning, the ways they use it and the types of learning that are occurring in it. The authors also discuss the collaborative and social characteristics of these environments which, provide access to excellence of a specific area of interest and promote innovative ideas on a global scale, through sharing educational resources and developing good educational practices without spatial and temporal constraints.
Scholarly information discovery in the networked academic learning environment
Li, LiLi
2014-01-01
In the dynamic and interactive academic learning environment, students are required to have qualified information literacy competencies while critically reviewing print and electronic information. However, many undergraduates encounter difficulties in searching peer-reviewed information resources. Scholarly Information Discovery in the Networked Academic Learning Environment is a practical guide for students determined to improve their academic performance and career development in the digital age. Also written with academic instructors and librarians in mind who need to show their students how to access and search academic information resources and services, the book serves as a reference to promote information literacy instructions. This title consists of four parts, with chapters on the search for online and printed information via current academic information resources and services: part one examines understanding information and information literacy; part two looks at academic information delivery in the...
Medical necessity for shorter lived radionuclides, specifically pure Iodine-123
International Nuclear Information System (INIS)
DeNardo, G.L.; DeNardo, S.J.; Hines, H.H.; Lagunas-Solar, M.C.; Jungerman, J.A.
1985-01-01
Iodine-123 has physical and radiochemical characteristics ideal for most tracer procedures performed in patients. Its use is generally preferable to the use of 131 I for diagnosis. The potential for 123 I can be realized only if a radiopharmaceutical of lesser radionuclide contamination is generally and economically available. Iodine-123 produced by direct methods has significant disadvantages relative to quality of procedure and radiation dosimetry. Our experience with 123 I(p,5n) during the past 12 years causes us to vigorously encourage general availability of an 123 I radiopharmaceutical of this quality. Using this product, the authors have prepared radiopharmaceuticals for use in the study of cancer, coagulation, and renal and thyroid diseases
Radioiodinated Rhodamine-123: a potential cationic hepatobiliary imaging agent
International Nuclear Information System (INIS)
Moonen, P.; Gorree, G.C.M.; Hoekstra, A.
1987-01-01
The labelling of the cationic dye Rhodamine-123 with 125 I is described. The biodistribution of the iodinated Rhodamine-123 has been determined at different time intervals after intravenous injection into fasted rats. It turned out that the dye is predominantly cleared by the liver and discharged into the bile. The bile acid taurocholate did not enhance the rate of excretion of 125 I-Rhodamine-123. (author)
International Nuclear Information System (INIS)
Busatto, G.F.; Pilowsky, L.S.; Costa, D.C.; Mertens, J.; Terriere, D.; Ell, P.J.; Mulligan, R.; Travis, M.J.; Leysen, J.E.; Lui, D.; Gacinovic, S.; Waddington, W.; Lingford-Hughes, A.; Kerwin, R.W.
1997-01-01
The mapping of 5-HT 2 receptors in the brain using functional imaging techniques has been limited by a relative lack of selective radioligands. Iodine-123 labelled 4-amino-N-[1-[3-(4-fluorophenoxy)propyl]-4-methyl-4-piperidinyl]-5-iodo-2-methox ybenzamide ( 123 I-5-I-R91150 or 123 I-R93274) is a new ligand for single-photon emission tomography (SPET), with high affinity and selectivity for 5-HT 2A receptors. This study reports on preliminary 123 I-5-I-R91150 SPET, whole-body and blood distribution findings in five healthy human volunteers. Maximal brain uptake was approximately 2% of total body counts at 180 min post injection (p.i.). Dynamic SPET sequences were acquired with the brain-dedicated, single-slice multi-detector system SME-810 over 200 min p.i. Early peak uptake (at 5 min p.i.) was seen in the cerebellum, a region free from 5HT 2A receptors. In contrast, radioligand binding in the frontal cortex increased steadily over time, up to a peak at approximately 100-120 min p.i. Frontal cortex-cerebellum activity ratios reached values of 1.4, and remained stable from approximately 100 min p.i. onwards. Multi-slice SPET sequences showed a pattern of regional variation of binding compatible with the autoradiographic data on the distribution of 5-HT 2A receptors in humans (cerebral cortex >striatum >cerebellum). These findings suggest that 123 I-5-I-R91150 may be used for the imaging of 5-HT 2A receptors in the living human brain with SPET. (orig.). With 4 figs., 2 tabs
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Chicken. 65.120 Section 65.120 Agriculture Regulations..., PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.120 Chicken. Chicken has the meaning given the term in...
Network and user interface for PAT DOME virtual motion environment system
Worthington, J. W.; Duncan, K. M.; Crosier, W. G.
1993-01-01
The Device for Orientation and Motion Environments Preflight Adaptation Trainer (DOME PAT) provides astronauts a virtual microgravity sensory environment designed to help alleviate tye symptoms of space motion sickness (SMS). The system consists of four microcomputers networked to provide real time control, and an image generator (IG) driving a wide angle video display inside a dome structure. The spherical display demands distortion correction. The system is currently being modified with a new graphical user interface (GUI) and a new Silicon Graphics IG. This paper will concentrate on the new GUI and the networking scheme. The new GUI eliminates proprietary graphics hardware and software, and instead makes use of standard and low cost PC video (CGA) and off the shelf software (Microsoft's Quick C). Mouse selection for user input is supported. The new Silicon Graphics IG requires an Ethernet interface. The microcomputer known as the Real Time Controller (RTC), which has overall control of the system and is written in Ada, was modified to use the free public domain NCSA Telnet software for Ethernet communications with the Silicon Graphics IG. The RTC also maintains the original ARCNET communications through Novell Netware IPX with the rest of the system. The Telnet TCP/IP protocol was first used for real-time communication, but because of buffering problems the Telnet datagram (UDP) protocol needed to be implemented. Since the Telnet modules are written in C, the Adap pragma 'Interface' was used to interface with the network calls.
21 CFR 123.11 - Sanitation control procedures.
2010-04-01
... records are subject to the requirements of § 123.9. (d) Relationship to HACCP plan. Sanitation controls may be included in the HACCP plan, required by § 123.6(b). However, to the extent that they are monitored in accordance with paragraph (b) of this section they need not be included in the HACCP plan, and...
Imaging with 123I labelled fatty acids
International Nuclear Information System (INIS)
Dudczak, R.
1985-01-01
This report describes the clinical results obtained with radioiodinated aromatic and aliphatic fatty acids. The radiopharmaceuticals were 123 I labelled p-phenylpentadecanoic (p-IPPA) and 123 I labelled heptadecanoic acid (HDA). The possibility to evaluate the myocardial metabolic function in man noninvasively add a complementary diagnostic tool in the clinical follow-up of patients with heart disease. (Auth.)
Lee, Wei-Po; Hsiao, Yu-Ting; Hwang, Wei-Che
2014-01-16
To improve the tedious task of reconstructing gene networks through testing experimentally the possible interactions between genes, it becomes a trend to adopt the automated reverse engineering procedure instead. Some evolutionary algorithms have been suggested for deriving network parameters. However, to infer large networks by the evolutionary algorithm, it is necessary to address two important issues: premature convergence and high computational cost. To tackle the former problem and to enhance the performance of traditional evolutionary algorithms, it is advisable to use parallel model evolutionary algorithms. To overcome the latter and to speed up the computation, it is advocated to adopt the mechanism of cloud computing as a promising solution: most popular is the method of MapReduce programming model, a fault-tolerant framework to implement parallel algorithms for inferring large gene networks. This work presents a practical framework to infer large gene networks, by developing and parallelizing a hybrid GA-PSO optimization method. Our parallel method is extended to work with the Hadoop MapReduce programming model and is executed in different cloud computing environments. To evaluate the proposed approach, we use a well-known open-source software GeneNetWeaver to create several yeast S. cerevisiae sub-networks and use them to produce gene profiles. Experiments have been conducted and the results have been analyzed. They show that our parallel approach can be successfully used to infer networks with desired behaviors and the computation time can be largely reduced. Parallel population-based algorithms can effectively determine network parameters and they perform better than the widely-used sequential algorithms in gene network inference. These parallel algorithms can be distributed to the cloud computing environment to speed up the computation. By coupling the parallel model population-based optimization method and the parallel computational framework, high
Human absorbed dose calculations for 123I labeled phenyl pentadecanoic acid
International Nuclear Information System (INIS)
Kulkarni, P.V.; Clark, G.; Corbett, J.R.; Willerson, J.T.; Parkey, R.W.
1986-01-01
I-123 labeled fatty acids have been proposed for studying myocardial metabolism by scintigraphic methods. With the availability of clean I-123 and the advent of single photon emission tomography, I-123 labeled fatty acids would be well suited to study regional myocardial viability or metabolism in humans. The authors have studied I-125 and I-123 labeled iodophenyl pentadecanoic acid (IPPA) in rats and dogs. Clinical studies are in progress with I-123 (IPPA). They have studied the pharmacokinetics of this tracer in male Sprague-Dawley rats at 0.25, 0.5, 1, 3, 6, and 24 hours postinjection. The cumulated doses, due to both pure I-123 and a version contaminated with 1.4% I-125, in various organs and the total body in humans are estimated. The average dose to organs for humans injected with I-123 IPPA with pure I-123 and contaminated I-123 respectively, are (rads to organ per mCi injected): heart wall (0.0507, 0.0514), liver (0.0792, 0.0875), kidneys (0.0479, 0.0561), thyroid (0.0517, 0.0638), ovaries (0.0427, 0.0561), testes (0.0307, 0.0309), total body (0.0386, 0.0392). 12 references, 9 figures, 5 tables
Terrain Mapping and Classification in Outdoor Environments Using Neural Networks
Alberto Yukinobu Hata; Denis Fernando Wolf; Gustavo Pessin; Fernando Osório
2009-01-01
This paper describes a three-dimensional terrain mapping and classification technique to allow the operation of mobile robots in outdoor environments using laser range finders. We propose the use of a multi-layer perceptron neural network to classify the terrain into navigable, partially navigable, and non-navigable. The maps generated by our approach can be used for path planning, navigation, and local obstacle avoidance. Experimental tests using an outdoor robot and a laser sensor demonstra...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.351 Section 120.351 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans Qualified Employee Trusts (esop) § 120.351 Definitions. All terms specific to ESOPs have the same definition...
2010-04-01
... CONSUMPTION HAZARD ANALYSIS AND CRITICAL CONTROL POINT (HACCP) SYSTEMS General Provisions § 120.12 Records. (a... Analysis and Critical Control Point (HACCP) system: (1) Records documenting the implementation of the... § 120.7; (3) The written HACCP plan required by § 120.8; (4) Records documenting the ongoing application...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Collateral. 120.343 Section 120.343 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans Export Working Capital Program (ewcp) § 120.343 Collateral. A Borrower must give SBA a first security...
Dynamic myocardial scintigraphy with 123I-labelled free fatty acids
International Nuclear Information System (INIS)
Wall, E.E. van der.
1981-01-01
In this thesis, long-chain radioiodinated free fatty acids ( 123 I-FFA), 16-iodo- 123 I-cis-Δ 9 -hexadecenoic acid ( 123 I-HA) and 17-iodo- 123 I-heptade-canoic acid ( 123 I-Hsup(o)A), were employed for myocardial scintigraphy in patients with coronary artery disease. The results indicate that clearance of 123 I-FFA from the myocardium is dependent on the nature of ischemic injury. Clearance is delayed if the injury is reversible and accelerated in case of irreversible ischemia. Mechanisms responsible for divergent behaviour of FFA in patients with acute myocardial infarction versus patients with angina pectoris are purely speculative. This differential clearance from normally perfused, transiently ischemic and infarcted myocardium has practical application. The test provides a means to assess the nature of ischemic injury rapidly. These findings may have major consequences for logical management of patients presenting with chest pain and suspected coronary artery disease. (Auth.)
(123I)-IMP SPECT findings in Machado-Joseph disease
International Nuclear Information System (INIS)
Suzuki, Masahiko
1997-01-01
Single photon emission computed tomography (SPECT) with N-isopropyl-p-( 123 I)iodoamphetamine (IMP) was used to study the dynamics of cerebellar and brainstem metabolic function in patients with Mochado-Joseph disease (MJD), the diagnosis of which was confirmed with genetic analysis. The SPECT data obtained was analyzed semiquantitatively. In patients with MJD, ( 123 I)-IMP accumulation in the cerebellum and brainstem was decreased, and the degree of decrease reflected the clinical severity of MJD. When MJD was mild, the decrease in ( 123 I)-IMP accumulation was much greater in the brainstem than in the cerebellum. However, the decrease in ( 123 I)-IMP accumulation in the cerebellum and brainstem was not correlated with the severity of atrophy or with the number of CAG repeats. ( 123 I)-IMP SPECT was useful for evaluating the decrease in cerebellum and brainstem function in patients with MJD. Results of this study suggest that the functional decrease in MJD may begin in the brainstem. (author)
A document preparation system in a large network environment
Energy Technology Data Exchange (ETDEWEB)
Vigil, M.; Bouchier, S.; Sanders, C.; Sydoriak, S.; Wheeler, K.
1988-01-01
At Los Alamos National Laboratory, we have developed an integrated document preparation system that produces publication-quality documents. This system combines text formatters and computer graphics capabilities that have been adapted to meet the needs of users in a large scientific research laboratory. This paper describes the integration of document processing technology to develop a system architecture, based on a page description language, to provide network-wide capabilities in a distributed computing environment. We describe the Laboratory requirements, the integration and implementation issues, and the challenges we faced developing this system.
[11 C]Rhodamine-123: Synthesis and biodistribution in rodents
International Nuclear Information System (INIS)
Bao Xiaofeng; Lu Shuiyu; Liow, Jeih-San; Morse, Cheryl L.; Anderson, Kacey B.; Zoghbi, Sami S.; Innis, Robert B.; Pike, Victor W.
2012-01-01
Introduction: Rhodamine-123 is a known substrate for the efflux transporter, P-glycoprotein (P-gp). We wished to assess whether rhodamine-123 might serve as a useful substrate for developing probes for imaging efflux transporters in vivo with positron emission tomography (PET). For this purpose, we aimed to label rhodamine-123 with carbon-11 (t 1/2 = 20.4 min) and to study its biodistribution in rodents. Methods: [ 11 C]Rhodamine-123 was prepared by treating rhodamine-110 (desmethyl-rhodamine-123) with [ 11 C]methyl iodide. The biodistribution of this radiotracer was studied with PET in wild-type mice and rats, in efflux transporter knockout mice, in wild-type rats pretreated with DCPQ (an inhibitor of P-gp) or with cimetidine (an inhibitor of organic cation transporters; OCT), and in P-gp knockout mice pretreated with cimetidine. Unchanged radiotracer in forebrain, plasma and peripheral tissues was also measured ex vivo at 30 min after radiotracer administration to wild-type and efflux transporter knockout rodents. Results: [ 11 C]Rhodamine-123 was obtained in 4.4% decay-corrected radiochemical yield from cyclotron-produced [ 11 C]carbon dioxide. After intravenous administration of [ 11 C]rhodamine-123 to wild-type rodents, PET and ex vivo measurements showed radioactivity uptake was very low in brain, but relatively high in some other organs such as heart, and especially liver and kidney. Inhibition of P-gp increased uptake in brain, heart, kidney and liver, but only by up to twofold. Secretion of radioactivity from kidney was markedly reduced by OCT knockout or pretreatment with cimetidine. Conclusions: [ 11 C]Rhodamine-123 was unpromising as a PET probe for P-gp function and appears to be a strong substrate of OCT in kidney. Cimetidine appears effective for blocking OCT in kidney in vivo.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false License. 120.20 Section 120.20 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.20 License. License means a document bearing the word “license” issued by the Directorate of Defense Trade...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Preferences. 120.925 Section 120.925 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development Company... Preference. (See § 120.10 for a definition of Preference.) [61 FR 3235, Jan. 31, 1996, as amended at 68 FR...
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Discovery. 1264.120 Section 1264.120... PENALTIES ACT OF 1986 § 1264.120 Discovery. (a) The following types of discovery are authorized: (1..., discovery is available only as ordered by the presiding officer. The presiding officer shall regulate the...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Elevators. 120.540 Section 120.540 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150 PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS ELECTRICAL INSTALLATION Miscellaneous Systems and Requirements § 120.540 Elevators....
2010-01-01
... Provider is an entity that contracts with a Lender or CDC to perform management, marketing, legal or other... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.10 Section 120.10 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Definitions § 120.10...
Air-Sense: indoor environment monitoring evaluation system based on ZigBee network
Huang, Yang; Hu, Liang; Yang, Disheng; Liu, Hengchang
2017-08-01
In the modern life, people spend most of their time indoors. However, indoor environmental quality problems have always been affecting people’s social activities. In general, indoor environmental quality is also related to our indoor activities. Since most of the organic irritants and volatile gases are colorless, odorless and too tiny to be seen, because we have been unconsciously overlooked indoor environment quality. Consequently, our body suffer a great health problem. In this work, we propose Air-Sense system which utilizes the platform of ZigBee Network to collect and detect the real-time indoor environment quality. What’s more, Air-Sense system can also provide data analysis, and visualizing the results of the indoor environment to the user.
Phillips, A. A.; Andreoiu, C.; Ball, G. C.; Bandyopadhyay, D.; Behr, J. A.; Chupp, T. E.; Finlay, P.; Garrett, P. E.; Grinyer, G. F.; Hackman, G.; Hayden, M. E.; Hyland, B.; Nuss-Warren, S. R.; Pearson, M. R.; Schumaker, M. A.; Smith, M. B.; Svensson, C. E.; Tardiff, E. R.; Valiente-Dobón, J. J.; Warner, T.
2006-08-01
We have measured the half-life of Xe120 using a high-purity germanium (HPGe) detector to monitor the 176, 178, and 762 keV γ rays from Xe120 β+ decay. The result, 46±0.6 min, differs significantly from the value 40±1 min reported by Andersson [Ark. Fys. 28, 37 (1964)]. We have also measured the half-lives of Cs120 and I120 to be 60±0.7 s and 82.1±0.6 min, respectively, both of which are consistent with previous measurements.
Myocardial kinetics of 123I-labeled-16-hexadecanoic acid
International Nuclear Information System (INIS)
Okada, R.D.; Elmaleh, D.; Werre, G.S.; Strauss, H.W.; Massachusetts General Hospital, Boston
1983-01-01
To determine if the myocardial clearance of omega 123 I-16-hexadecanoic acid ( 123 I-HDA) is affected by decreased coronary blodood flow, six anesthetized dogs had partial occlusion of the left anterior descending coronary artery. One hour later, 113 Sn-microspheres were injected into the left atrium, followed immediately by the IV administration of 123 I-HDA. Following injection, regional myocardial 123 I activities were monitored continuously with miniature cadmium telluride radiation detectors placed against the endocardium in both ischemic and nonischemic zones. After 3 h continuous monitoring, 46 Sc-microspheres were injected into the left atrium and the dogs were killed. Ischemic and nonischemic areas of myocardium were sectioned and counted in a well counter. (orig./WL)
Casquero, Oskar; Ovelar, Ramón; Romo, Jesús; Benito, Manuel; Alberdi, Mikel
2016-01-01
The main objective of this paper is to analyse the effect of the affordances of a virtual learning environment and a personal learning environment (PLE) in the configuration of the students' personal networks in a higher education context. The results are discussed in light of the adaptation of the students to the learning network made up by two…
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Options. 35.120 Section 35.120... and Definitions for All Programs. § 35.120 Options. (a) Standard treatments. Where interim controls are required by this part, the designated party has the option to presume that lead-based paint or...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Default. 120.938 Section 120.938... Program (504) 504 Loans and Debentures § 120.938 Default. (a) Upon occurrence of an event of default... occurrence of an event of default which does not require automatic acceleration, SBA may forbear acceleration...
2010-01-01
... Loan Program (504) 504 Loans and Debentures § 120.934 Collateral. The CDC usually takes a second lien position on the Project Property to secure the 504 loan. Sometimes additional collateral is required. (In... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Collateral. 120.934 Section 120...
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Reciprocity. 8.120 Section 8.120 Shipping COAST GUARD... § 8.120 Reciprocity. (a) The Commandant may delegate authority to a classification society that has... determine reciprocity on a “case-by-case” basis. (b) In order to demonstrate that the conditions described...
Iodine-123 and bromine-75 production and development program at Juelich
International Nuclear Information System (INIS)
Stoecklin, G.
1985-01-01
The iodine-123 and bromine-75 production and development program at the Nuclear Research Center in Juelich as of 1982 is described, and examples of recent 123 I- and 75 Br-analogue tracers that have been developed to the level of clinical trial are given. Iodine-123 is produced via the 127 I(d,6n) 123 Xe → 123 I process and by the 124 Te(p,2n) 123 I and 122 Te(d,n) 123 I reactions. These production methods are critically reviewed. Bromine-75-labeled benzodiazenes have been prepared for in vivo mapping of benzodiazepine receptor sites. The 7-( 75 Br)-5-(2-fluorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepine-2-one (BFB) was prepared with a specific activity of > 10 4 Ci/mmole. Finally, preparation and applications of the halogenated amino acid L-3-( 123 I)-iodo-α-methyltyrosine (IMT) and the analogous 75 Br compound (BMT) are reported. Both IMT and BMT have been successfully applied for pancreas imaging and tomography, and IMT has been used for imaging both melanotic and amelanotic malignant melanoma of the eye
123I research and production at Brookhaven
International Nuclear Information System (INIS)
Mausner, L.F.; Srivastava, S.C.; Mirzadeh, S.; Meinken, G.E.; Prach, T.
1985-01-01
The procedures for preparing high purity 123 I at the BLIP using the 127 I(p,5n) 123 Xe reaction on an NaI target are described. The activity is supplied in a glass ampoule with anhydrous 123 I deposited on the interior walls, allowing maximum flexibility in subsequent iodinations. Preliminary experience with a continuous flow target is also described. The results of a series of measurements of specific activity by neutron activation, x-ray fluorescence, uv absorption, and wet chemistry generally showed no detectable carrier. HPLC methods to analyse the chemical form of radioiodine and to characterize various iodinated radiopharmaceuticals have been developed. These methods provide higher sensitivity, speed and resolution than commonly used techniques. 19 refs., 6 figs., 2 tabs
Virtual Learning Environments as Sociomaterial Agents in the Network of Teaching Practice
Johannesen, Monica; Erstad, Ola; Habib, Laurence
2012-01-01
This article presents findings related to the sociomaterial agency of educators and their practice in Norwegian education. Using actor-network theory, we ask how Virtual Learning Environments (VLEs) negotiate the agency of educators and how they shape their teaching practice. Since the same kinds of VLE tools have been widely implemented…
Melt processing of Yb-123 tapes
International Nuclear Information System (INIS)
Athur, S. P.; Balachandran, U.; Salama, K.
2000-01-01
The innovation of a simple, scalable process for manufacturing long-length conductors of HTS is essential to potential commercial applications such as power cables, magnets, and transformers. In this paper the authors demonstrate that melt processing of Yb-123 tapes made by the PIT route is an alternative to the coated conductor and Bi-2223 PIT tape fabrication techniques. Ag-clad Yb-123 tapes were fabricated by groove rolling and subsequently, melt processed in different oxygen partial pressures in a zone-melting furnace with a gradient of 140 C/cm. The transition temperatures measured were found to be around 81 K undermost processing conditions. EPMA of the tapes processed under different conditions show the 123 phase to be Ba deficient and Cu and Yb rich. Critical current was measured at various temperatures from 77 K to 4.2 K. The J c increased with decrease in pO 2 . The highest I c obtained was 52 A at 4.2 K
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Export. 120.17 Section 120.17 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.17 Export. (a) Export means: (1) Sending or taking a defense article out of the United States in any manner, except by...
22 CFR 120.10 - Technical data.
2010-04-01
... information in the public domain as defined in § 120.11. It also does not include basic marketing information... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Technical data. 120.10 Section 120.10 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.10...
49 CFR 37.123 - ADA paratransit eligibility: Standards.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Standards. 37.123... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.123 ADA... complementary paratransit service shall provide the service to the ADA paratransit eligible individuals...
I-123 IMP SPECT in Parkinson's disease
International Nuclear Information System (INIS)
Kawabata, Keita; Tachibana, Kyudai; Sugita, Minoru
1990-01-01
To examine semiquantitatively regional cerebral blood flow, SPECT with N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) was undertaken in 17 patients with Parkinson's disease. Seven patients with Alzheimer's disease and 9 senile control subjects were also imaged for comparison. Both the Parkinson's disease group and the Alzheimer's disease group had a decreased uptake of I-123 IMP in the frontal lobe, in comparison with the control group. A remarkably decreased uptake was seen in the lateral and parietal lobes in the group of Parkinson's disease associated with dementia, as well as in the Alzheimer's disease group. A significantly decreased uptake was observed in the frontal lobe, lateral lobe, thalamus, and basal ganglia in the Parkinson's disease group, irrespective of the presence or absence of dementia. For Parkinson's disease associated with dementia, there was much more significant decrease in I-123 IMP uptake. The pattern of regional cerebral blood flow in the Alzheimer's disease group was analogous to that in the Parkinson's disease group associated with dementia. This supports the hypothesis that Alzheimer's disease may be somewhat involved in the occurrence of dementia for Parkinson's disease. (N.K.)
International Nuclear Information System (INIS)
Hohn, A.; Coenen, H.H.; Qaim, S.M.
2000-01-01
Excitation functions of the nuclear reactions 120 Te(d,xn) 121,120m,g I were measured for the first time from their respective thresholds up to 13.5 MeV. Thin samples prepared by electrolytic deposition of 99.0% enriched 120 Te on Ti-backing were used. Integral yields of 121,120m,g I were calculated from the measured cross section data. A comparison of the 122 Te(p,3n)-, 120 Te(p,n)- and 120 Te(d,2n)-processes for the production of 120g I is given. The 120 Te(d,2n)-process is unsuitable for production purposes since the yield of 120g I is very low and the level of 121 I impurity very high. The choice lies either on the 122 Te(p,3n)- or the 120 Te(p,n)-reaction and is governed by the available proton energy and the financial resources for procuring the enriched target material
Alsibyani, Hassan M.
2018-05-15
Cloud computing usage is increasing and a common concern is the privacy and security of the data and computation. Third party cloud environments are not considered fit for processing private information because the data will be revealed to the cloud provider. However, Trusted Execution Environments (TEEs), such as Intel SGX, provide a way for applications to run privately and securely on untrusted platforms. Nonetheless, using a TEE by itself for stream processing systems is not sufficient since network communication patterns may leak properties of the data under processing. This work addresses leaky topology structures and suggests mitigation techniques for each of these. We create specific metrics to evaluate leaks occurring from the network patterns; the metrics measure information leaked when the stream processing system is running. We consider routing techniques for inter-stage communication in a streaming application to mitigate this data leakage. We consider a dynamic policy to change the mitigation technique depending on how much information is currently leaking. Additionally, we consider techniques to hide irregularities resulting from a filtering stage in a topology. We also consider leakages resulting from applications containing cycles. For each of the techniques, we explore their effectiveness in terms of the advantage they provide in overcoming the network leakage. The techniques are tested partly using simulations and some were implemented in a prototype SGX-based stream processing system.
Degradation of benzodiazepines after 120 days of EMS deployment.
McMullan, Jason T; Jones, Elizabeth; Barnhart, Bruce; Denninghoff, Kurt; Spaite, Daniel; Zaleski, Erin; Silbergleit, Robert
2014-01-01
EMS treatment of status epilepticus improves outcomes, but the benzodiazepine best suited for EMS use is unclear, given potential high environmental temperature exposures. To describe the degradation of diazepam, lorazepam, and midazolam as a function of temperature exposure and time over 120 days of storage on active EMS units. Study boxes containing vials of diazepam, lorazepam, and midazolam were distributed to 4 active EMS units in each of 2 EMS systems in the southwestern United States during May-August 2011. The boxes logged temperature every minute and were stored in EMS units per local agency policy. Two vials of each drug were removed from each box at 30-day intervals and underwent high-performance liquid chromatography to determine drug concentration. Concentration was analyzed as mean (and 95%CI) percent of initial labeled concentration as a function of time and mean kinetic temperature (MKT). 192 samples were collected (2 samples of each drug from each of 4 units per city at 4 time-points). After 120 days, the mean relative concentration (95%CI) of diazepam was 97.0% (95.7-98.2%) and of midazolam was 99.0% (97.7-100.2%). Lorazepam experienced modest degradation by 60 days (95.6% [91.6-99.5%]) and substantial degradation at 90 days (90.3% [85.2-95.4%]) and 120 days (86.5% [80.7-92.3%]). Mean MKT was 31.6°C (95%CI 27.1-36.1). Increasing MKT was associated with greater degradation of lorazepam, but not midazolam or diazepam. Midazolam and diazepam experienced minimal degradation throughout 120 days of EMS deployment in high-heat environments. Lorazepam experienced significant degradation over 120 days and appeared especially sensitive to higher MKT exposure.
Gao, Ying; Wkram, Chris Hadri; Duan, Jiajie; Chou, Jarong
2015-12-10
In order to prolong the network lifetime, energy-efficient protocols adapted to the features of wireless sensor networks should be used. This paper explores in depth the nature of heterogeneous wireless sensor networks, and finally proposes an algorithm to address the problem of finding an effective pathway for heterogeneous clustering energy. The proposed algorithm implements cluster head selection according to the degree of energy attenuation during the network's running and the degree of candidate nodes' effective coverage on the whole network, so as to obtain an even energy consumption over the whole network for the situation with high degree of coverage. Simulation results show that the proposed clustering protocol has better adaptability to heterogeneous environments than existing clustering algorithms in prolonging the network lifetime.
Long-term performance of the SwissQuantum quantum key distribution network in a field environment
International Nuclear Information System (INIS)
Stucki, D; Gisin, N; Thew, R; Legré, M; Clausen, B; Monat, L; Page, J-B; Ribordy, G; Rochas, A; Robyr, S; Trinkler, P; Buntschu, F; Perroud, D; Felber, N; Henzen, L; Junod, P; Monbaron, P; Ventura, S; Litzistorf, G; Tavares, J
2011-01-01
In this paper, we report on the performance of the SwissQuantum quantum key distribution (QKD) network. The network was installed in the Geneva metropolitan area and ran for more than one-and-a-half years, from the end of March 2009 to the beginning of January 2011. The main goal of this experiment was to test the reliability of the quantum layer over a long period of time in a production environment. A key management layer has been developed to manage the key between the three nodes of the network. This QKD-secure network was utilized by end-users through an application layer. (paper)
[sup 123]I-iodobenzoylglucosamines: glucose analogues for heart imaging
Energy Technology Data Exchange (ETDEWEB)
Lutz, T [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences; Dougan, H [TRIUMF, Vancouver, BC (Canada); Rihela, T; Vo, C V [Vancouver General Hospital (Canada). Div. of Nuclear Medicine; Lyster, D M [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences Vancouver General Hospital (Canada). Div. of Nuclear Medicine
1993-01-01
The ortho-, meta- and para-[[sup 123]I]-2-deoxy-2-N-(iodobenzoyl)-D-glucosamine (BGA) derivatives were investigated to determine the effect of iodine position and lipophilicity on tissue distribution. There was no correlation between tissue uptake and lipophilicity. Maximum uptake was observed for o-BGA displaying a heart:blood ratio of 36.0 at 18 hours post injection. Yeast hexokinase phosphorylation studies in vitro and an in vivo insulin experiment were carried out on o-BGA. No phosphorylation was detected, but the insulin study indicated that o-BGA uses the glucose transporter. o-BGA showed maximum tissue uptake in mice at an optimal specific activity of 0.004mg/[mu]Ci. Mouse biodistribution studies of o-[[sup 123]I]-iodobenzamide(o-[sup 123]IBA) indicated that the glucose moiety of o-BGA may be involved in the heart accumulation process in mice. Heart tissue extraction studies showed unmetabolized o-[[sup 123]I]BGA was the predominant species. A rabbit image of o-[[sup 123]I]BGA, recorded at 14 hours post injection, showed significant heart uptake. (author).
Design and Test of the Cross-Format Schema Protocol (XFSP) for Networked Virtual Environments
National Research Council Canada - National Science Library
Serin, Ekrem
2003-01-01
A Networked Virtual Environment (Net-VE) is a distributed software system in which multiple users interact with each other in real time even though these users may be located around the world Zyda 99...
21 CFR 123.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 123.5 Section...) FOOD FOR HUMAN CONSUMPTION FISH AND FISHERY PRODUCTS General Provisions § 123.5 Current good manufacturing practice. (a) Part 110 of this chapter applies in determining whether the facilities, methods...
19 CFR 123.41 - Truck shipments transiting Canada.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Truck shipments transiting Canada. 123.41 Section... OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO United States and Canada In-Transit Truck Procedures § 123.41 Truck shipments transiting Canada. (a) Manifest required. Trucks with merchandise...
7 CFR 457.123 - Almond crop insurance provisions.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Almond crop insurance provisions. 457.123 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.123 Almond crop insurance provisions. The Almond Crop Insurance Provisions for the 2008 and succeeding crop years are as follows: FCIC...
International Nuclear Information System (INIS)
Soeki, Takeshi; Tamura, Yoshiyuki; Bandou, Kanji; Tanaka, Hideji; Takeichi, Naoki; Shinohara, Hisanori; Yui, Yasuko; Fukuda, Nobuo; Sui, Osamu
1998-01-01
To examine the long-term effects of the angiotensin-converting enzyme (ACE) inhibitor enalapril on chronic heart failure, 10 patients (7 men and 3 women, mean age: 62±11 years) with chronic stable heart failure, classified as New York Heart Association (NYHA) functional class 2-3 for more than 3 months, and a left ventricular ejection fraction less than 45% were treated with 2.5-5.0 mg of enalapril once a day for 3-15 months (mean 7 months). The causes of heart failure were old myocardial infarction (n=7), hypertension (n=2), and atrial fibrillation (n=1). Radioiodinated metaiodobenzyl guanidine ( 123 I-MIBG) imaging, radionuclide angiography, and treadmill exercise test were performed before and after the treatment. With enalapril treatment, left ventricular ejection fraction (LVEF) increased significantly from 38.3±6.9% to 47.5±14.7%; sub-maximal exercise time increased significantly from 205±112 to 272±120 seconds; the heart to mediastinum (H/M) ratio of 123 I-MIBG increased significantly (early image: 1.99±0.38 versus 2.20±0.50; delayed image: 1.86±0.44 versus 2.09±0.51); and the washout rate of 123 I-MIBG decreased slightly from 29.1±9.1% to 25.4±7.0%. The improvement rate of LVEF was significantly correlated with the improvement rates of the H/M ratio and washout rate after treatment with enalapril. Thus, the long-term effects of enalapril can be observed in the cardiac sympathetic nervous system, and 123 I-MIBG imaging appears to be useful for evaluating the therapeutic effects of enalapril on the cardiac sympathetic nervous system in patients with chronic heart failure. (author)
I-123-insulin: A new marker for hepatoma
International Nuclear Information System (INIS)
Sodoyez, J.C.; Goffaux, F.S.; Fallais, C.; Bourgeois, P.
1984-01-01
Previous studies have demonstrated that carrier-free I-123-Tyr Al4 insulin was taken up by the liver (by a saturable mechanism) and by the kidneys (by a non saturable mechanism). Autoradiographs of rat liver after injection of I-125-insulin showed that binding specifically occurred at the plasma membrane of the hepatocytes. I-123-Insulin binding to the hepatocyte plasma membrane appeared mediated by specific receptors. Indeed it was blocked by antibodies to the insulin receptors and by an excess of native insulin. Futhermore insulin derivatives with low biological potency (proinsulin and desoctapeptide insulin) did not inhibit I-123-insulin binding to the hepatocytes. I-123-Insulin (1.3 mCi) was I.V. injected into a patient in whom the right liver lobe was normal (normal uptake of Tc-99m-colloid sulfur) but the left liver lobe was occupied by a voluminous hepatoma (no uptake of Tc-99m-colloid sulfur). Liver blood supply was also studied by Tc-99m-pyrophosphate-labeled red cells. Computer analysis of the data revealed that compared to the normal liver lobe, binding of I-123-insulin to the hepatoma was more precocious (vascularization through the hepatic artery and not the portal vein), more intense and more prolonged (half-lives were 6 min in the normal liver and 14 min in the hepatoma). These results are consistent with characteristics of hepatoma cells in culture in which high insulin binding capacity contrasts with a markedly decreased insulin degrading activity. It is concluded that I-123-insulin may be used as a specific marker of hepatoma in man
Tweeting badges: user motivations for displaying achievement in publicly networked environments.
Kwon, K Hazel; Halavais, Alexander; Havener, Shannon
2015-02-01
Badge systems, a common mechanism for gamification on social media platforms, provide a way for users to present their knowledge or experience to others. This study aims to contribute to the understanding of why social media users publicize their achievements in the form of online badges. Five motivational factors for badge display in public networked environments are distinguished-self-efficacy, social incentives, networked support, passing time, and inattentive sharing-and it is suggested that different badge types are associated with different motivations. System developers are advised to consider these components in their designs, applying the elements most appropriate to the communities they serve. Comparing user motivations associated with badges shared across boundaries provides a better understanding of how online badges relate to the larger social media ecosystem.
Supporting tactical intelligence using collaborative environments and social networking
Wollocko, Arthur B.; Farry, Michael P.; Stark, Robert F.
2013-05-01
Modern military environments place an increased emphasis on the collection and analysis of intelligence at the tactical level. The deployment of analytical tools at the tactical level helps support the Warfighter's need for rapid collection, analysis, and dissemination of intelligence. However, given the lack of experience and staffing at the tactical level, most of the available intelligence is not exploited. Tactical environments are staffed by a new generation of intelligence analysts who are well-versed in modern collaboration environments and social networking. An opportunity exists to enhance tactical intelligence analysis by exploiting these personnel strengths, but is dependent on appropriately designed information sharing technologies. Existing social information sharing technologies enable users to publish information quickly, but do not unite or organize information in a manner that effectively supports intelligence analysis. In this paper, we present an alternative approach to structuring and supporting tactical intelligence analysis that combines the benefits of existing concepts, and provide detail on a prototype system embodying that approach. Since this approach employs familiar collaboration support concepts from social media, it enables new-generation analysts to identify the decision-relevant data scattered among databases and the mental models of other personnel, increasing the timeliness of collaborative analysis. Also, the approach enables analysts to collaborate visually to associate heterogeneous and uncertain data within the intelligence analysis process, increasing the robustness of collaborative analyses. Utilizing this familiar dynamic collaboration environment, we hope to achieve a significant reduction of time and skill required to glean actionable intelligence in these challenging operational environments.
Filimonov, Valeriy O; Dianova, Lidia N; Galata, Kristina A; Beryozkina, Tetyana V; Novikov, Mikhail S; Berseneva, Vera S; Eltsov, Oleg S; Lebedev, Albert T; Slepukhin, Pavel A; Bakulev, Vasiliy A
2017-04-21
High yield solvent-base-controlled, transition metal-free synthesis of 4,5-functionalized 1,2,3-thiadiazoles and 1,2,3-triazoles from 2-cyanothioacetamides and sulfonyl azides is described. Under diazo transfer conditions in the presence of a base in an aprotic solvent 2-cyanothioacetamides operating as C-C-S building blocks produce 5-amino-4-cyano-1,2,3-thiadiazoles exclusively. The use of alkoxide/alcohol system completely switches the reaction course due to the change of one of the reaction centers in the 2-cyanothioacetamide (C-C-N building block) resulting in the formation of 5-sulfonamido-1,2,3-triazole-4-carbothioamide sodium salts as the only products. The latter serve as good precursors for 5-amino-1,2,3-thiadiazole-4-carboximidamides, the products of Cornforth-type rearrangement occurring in neutral protic medium or under acid conditions. According to DFT calculations (B3LYP/6-311+G(d,p)) the rearrangement proceeds via intermediate formation of a diazo compound, and can be catalyzed by acids via the protonation of oxygen atom of the sulfonamide group.
Chen, Jiajia; Zhao, Pan; Liang, Huawei; Mei, Tao
2014-09-18
The autonomous vehicle is an automated system equipped with features like environment perception, decision-making, motion planning, and control and execution technology. Navigating in an unstructured and complex environment is a huge challenge for autonomous vehicles, due to the irregular shape of road, the requirement of real-time planning, and the nonholonomic constraints of vehicle. This paper presents a motion planning method, based on the Radial Basis Function (RBF) neural network, to guide the autonomous vehicle in unstructured environments. The proposed algorithm extracts the drivable region from the perception grid map based on the global path, which is available in the road network. The sample points are randomly selected in the drivable region, and a gradient descent method is used to train the RBF network. The parameters of the motion-planning algorithm are verified through the simulation and experiment. It is observed that the proposed approach produces a flexible, smooth, and safe path that can fit any road shape. The method is implemented on autonomous vehicle and verified against many outdoor scenes; furthermore, a comparison of proposed method with the existing well-known Rapidly-exploring Random Tree (RRT) method is presented. The experimental results show that the proposed method is highly effective in planning the vehicle path and offers better motion quality.
Managing Complex Battlespace Environments Using Attack the Network Methodologies
DEFF Research Database (Denmark)
Mitchell, Dr. William L.
This paper examines the last 8 years of development and application of Attack the Network (AtN) intelligence methodologies for creating shared situational understanding of complex battlespace environment and the development of deliberate targeting frameworks. It will present a short history...... of their development, how they are integrated into operational planning through strategies of deliberate targeting for modern operations. The paper will draw experience and case studies from Iraq, Syria, and Afghanistan and will offer some lessons learned as well as insight into the future of these methodologies....... Including their possible application on a national security level for managing longer strategic endeavors....
14 CFR 415.123 - Computing systems and software.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 415.123... Launch Vehicle From a Non-Federal Launch Site § 415.123 Computing systems and software. (a) An applicant's safety review document must describe all computing systems and software that perform a safety...
Anatomy and histology as socially networked learning environments: some preliminary findings.
Hafferty, Frederic W; Castellani, Brian; Hafferty, Philip K; Pawlina, Wojciech
2013-09-01
An exploratory study to better understand the "networked" life of the medical school as a learning environment. In a recent academic year, the authors gathered data during two six-week blocks of a sequential histology and anatomy course at a U.S. medical college. An eight-item questionnaire captured different dimensions of student interactions. The student cohort/network was 48 first-year medical students. Using social network analysis (SNA), the authors focused on (1) the initial structure and the evolution of informal class networks over time, (2) how informal class networks compare to formal in-class small-group assignments in influencing student information gathering, and (3) how peer assignment of professionalism role model status is shaped more by informal than formal ties. In examining these latter two issues, the authors explored not only how formal group assignment persisted over time but also how it functioned to prevent the tendency for groupings based on gender or ethnicity. The study revealed an evolving dynamic between the formal small-group learning structure of the course blocks and the emergence of informal student networks. For example, whereas formal group membership did influence in-class questions and did prevent formation of groups of like gender and ethnicity, outside-class questions and professionalism were influenced more by informal group ties where gender and, to a much lesser extent, ethnicity influence student information gathering. The richness of these preliminary findings suggests that SNA may be a useful tool in examining an array of medical student learning encounters.
Diagnosis of pheochromocytoma using (123I)-compared with (131I)-metaiodobenzylguanidine scintigraphy
International Nuclear Information System (INIS)
Furuta, Nozomu; Kiyota, Hiroshi; Yoshigoe, Fukuo; Hasegawa, Norio; Ohishi, Yukihiko
1999-01-01
Patient with pheochromocytoma (PCT) cannot be cured without operation, therefore, preoperative determination of the localization of PCT should be performed accurately. ( 131 I)-Metaiodobenzylguanidine (MIBG) scintigraphy is a gold standard for the diagnosis of PCT. However, ( 123 I)-MIBG is also found to accumulate in PCT. In order to clarify the usefulness of ( 123 I)-MIBG scintigraphy for the local detection of PCT, we compared the distribution of ( 123 I)- and ( 131 I)-MIBG in patients with or without PCT. ( 131 I)- and ( 123 I)-MIBG scintigraphy was performed in 29 and 16 patients, respectively. In the former group, 14 patients had PCT, 12 had hypertension without any adrenal disorder and three had other diseases. In the latter group, eight patients had PCT, two had hypertension without any adrenal disorder and six had other diseases. The sensitivity, specificity and accuracy of ( 123 I)- with ( 131 I)-MIBG scintigraphy were compared. The sensitivity of ( 131 I)- and ( 123 I)-MIBG scintigraphy was 85.7 and 90%, respectively. The specificity of each test was 100%. The accuracy of ( 131 I)- and ( 123 I)-MIBG scintigraphy was 93.1 and 95%, respectively. The quality of images obtained using ( 123 I)-MIBG was better than with ( 131 I)-MIBG, because ( 123 I)-MIBG generated a higher dose of γ-rays with a higher specificity than ( 131 I)-MIBG. In addition, normal adrenal grands were visualized in 50% of patients tested with ( 123 I)-MIBG scintigraphy. These results indicate that ( 123 I)-MIBG scintigraphy is a valuable tool for the local detection of PCT, as is ( 131 I)-MIBG scintigraphy. Furthermore, it is possible that ( 123 I)-MIBG can be used as an alternative to ( 131 I)-MIBG for the detection of PCT. Our study was not a prospective study and the background of the patients was not matched. Further prospective studies are needed in order to determine the efficacy of ( 123 I)-MIBG scintigraphy for the diagnosis of PCT. (author)
Effect of light rare earth doping in 123 high temperature supercoductors
Directory of Open Access Journals (Sweden)
M. Mirzadeh
2006-09-01
Full Text Available We have studied the structural and electrical properties of Gd(Ba2-xLaxCu3O7+δ [Gd(BaLa123], Gd(Ba2-xNdxCu3O7+δ [Gd(BaNd123], and Nd(Ba2-xPrxCu3O7+δ [Nd(BaPr123] compounds with 0.0≤x≤0.8 prepared by the standard solid-state reaction. The XRD patterns show that all of the samples with x≤0.5 are isosructure 123 phase, but in Gd(BaNd123 and Nd(BaPr123 there are several impurity peaks in the XRD patterns for x≥0.6. We estimated the xcsolubility=1.1, 0.6 and 0.55 in Gd(BaLa123, Nd(BaPr123, and Gd(BaNd123, respectively. The resistivity increases with the increase of doping. The decrease of Tc with the increase of Pr doping is faster than Nd and La doping. The normal-state resistivity is fitted for two and three dimensional variable range hopping (2D&amp3D-VRH and Coulomb gap (CG regimes, separately. Our results indicate that the dominant mechanism for x≥xcSIT is 3D-VRH. The broadening of magnetoresistance have been investigated by TAFC and AH models. The pinning energy and Josephson coupling energy, decrease with the increase of applied magnetic field as U~H-β, these values also decrease with doping concentration Pr is more effective than Nd and La.
Sugarcane bagasse powder as biosorbent for reactive red 120 removals from aqueous solution
Ahmad, S.; Wong, Y. C.; Veloo, K. V.
2018-04-01
Reactive red 120 is used as a textile dye for fabric coloring. The dye waste is produced during textile finishing process subsequently released directly to water bodies which giving harmful effects to the environment due to the carcinogenic characteristic. Adsorption process becomes an effective treatment to treat textile dye. This research emphasizes the treatment of textile dye namely reactive red 120 (RR120) by using sugarcane bagasse powder. The batch study was carried out under varying parameters such as 60 minutes contact time, pH (1-8), dye concentration (5-25 mg/L), particle size (125-500 μm) and biosorbent dosage (0.01-0.2 g/L). The maximum adsorption percentage of RR120 was 94.62%. The adsorption of dye was increased with the decreasing of pH, initial dye concentration and particle size. Sugarcane bagasse powder as low-cost biosorbent was established using Fourier Transform Infrared (FTIR) and scanning electron microscopy (SEM). This locally agricultural waste could be upgraded into useful material which is biosorbent that promising for decolorization of colored textile wastewater.
Localization of mitochondria in living cells with rhodamine 123.
Johnson, L V; Walsh, M L; Chen, L B
1980-01-01
The laser dye rhodamine 123 is shown to be a specific probe for the localization of mitochondria in living cells. By virtue of its selectivity for mitochondria and its fluorescent properties, the detectability of mitochondria stained with rhodamine 123 is significantly improved over that provided by conventional light microscopic techniques. With the use of rhodamine 123, it is possible to detect alterations in mitochondrial distribution following transformation by Rous sarcoma virus and changes in the shape and organization of mitochondria induced by colchicine treatment. Images PMID:6965798
5 CFR 610.123 - Travel on official time.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel on official time. 610.123 Section... DUTY Weekly and Daily Scheduling of Work Work Schedules § 610.123 Travel on official time. Insofar as practicable travel during nonduty hours shall not be required of an employee. When it is essential that this...
Representing the environment 3.0. Maps, models, networks.
Directory of Open Access Journals (Sweden)
Letizia Bollini
2014-05-01
Full Text Available Web 3.0 is changing the world we live and perceive the environment anthropomorphized, making a stratifation of levels of experience and mediated by the devices. If the urban landscape is designed, shaped and planned space, there is a social landscape that overwrite the territory of values, representations shared images, narratives of personal and collective history. Mobile technology introduces an additional parameter, a kind of non-place, which allows the coexistence of the here and elsewhere in an sort of digital landscape. The maps, mental models, the system of social networks become, then, the way to present, represented and represent themselves in a kind of ideal coring of the co-presence of levels of physical, cognitive and collective space.
/sup 123m/Te-labeled biochemicals and method of preparation
International Nuclear Information System (INIS)
Knapp, F.
1980-01-01
A process for preparing a /sup 123m/Te-labeled organic compound of the formula R-/sup 123m/Te-CH 2 -R', R being alkyl, substituted alkyl, aryl or substituted aryl and R' being a steroidal side chain, alkyl amino acid or amino acid group, said process comprising the steps of: (A) reaching a /sup 123m/Te-symmetric diorgano ditelluride, R 2 /sup 123m/Te 2 , R being alkyl, substituted alkyl, aryl or substituted aryl, with a hydride reducing agent and a source of alkali metal ions to form an alkali metal organo telluride M-/sup 123m/Te-R; (B) reacting said alkali metal organo telluride with a primary halogenated organic compound R/sub a/'-X, R/sub a/' being a 17 alkyl steroid group having 1-4 carbon atoms in said alkyl group, an alkyl amino acid group, or a group hydrolyzable to an alkyl amino acid group
49 CFR 176.120 - Lightning protection.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Lightning protection. 176.120 Section 176.120 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Requirements for Class 1 (Explosive) Materials Stowage § 176.120 Lightning protection. A lightning conductor...
MDA-image: an environment of networked desktop computers for teleradiology/pathology.
Moffitt, M E; Richli, W R; Carrasco, C H; Wallace, S; Zimmerman, S O; Ayala, A G; Benjamin, R S; Chee, S; Wood, P; Daniels, P
1991-04-01
MDA-Image, a project of The University of Texas M. D. Anderson Cancer Center, is an environment of networked desktop computers for teleradiology/pathology. Radiographic film is digitized with a film scanner and histopathologic slides are digitized using a red, green, and blue (RGB) video camera connected to a microscope. Digitized images are stored on a data server connected to the institution's computer communication network (Ethernet) and can be displayed from authorized desktop computers connected to Ethernet. Images are digitized for cases presented at the Bone Tumor Management Conference, a multidisciplinary conference in which treatment options are discussed among clinicians, surgeons, radiologists, pathologists, radiotherapists, and medical oncologists. These radiographic and histologic images are shown on a large screen computer monitor during the conference. They are available for later review for follow-up or representation.
Energy Technology Data Exchange (ETDEWEB)
Yonekura, Yoshiharu; Sadato, Norihiro; Nakamura, Satoshi [Fukui Medical Univ., Matsuoka (Japan). High Energy Medical Research Center; Tsuchida, Tatsuro; Uematsu, Hidemasa; Onishi, Yoshihiro; Yamamoto, Kazutaka; Ishii, Yasushi
1999-02-01
The pharmacokinetics of (S)-5-iodo-7-N-((1-ethyl-2-pyrrolidinyl)methyl) carboxamido-2,3-dihydro-benzofuran ({sup 123}I-IBF) in the brain were studied in 12 healthy male volunteers as a Phase 1 clinical study. The striatum-to-frontal cortex count ratio (-1)(St/Fc-1), which is a semi-quantitative index of the binding potential of {sup 123}I-IBF reached 1.81{+-}0.19 and 2.21{+-}0.39 at 90-120 min and 180-210 min after intravenous injection of {sup 123}I-IBF. St/Fc-1 obtained by SPECT at these times correlated well with the distribution volume ratio (-1)(Vd(St)/Vd(Fc)-1) based on three-compartment model analysis using an input function obtained by intermittent arterial sampling. The binding potential (BP{sub R}), calculated by the curvefitting method using the time-activity curve in the reference region, also correlated well with the Vd(St)/Vd(Fc)-1. The intra-observer and inter-observer reproducibilities of the striatum-to-cerebral cortex count ratios obtained using fixed-shape regions of interest (template ROIs) were superior to those obtained using manual ROIs. These results suggest that {sup 123}I-IBF is a promising agent for non-invasive quantification of the dopamine D{sub 2} receptor (D{sub 2}-R) binding potential by SPECT. (author)
Energy Technology Data Exchange (ETDEWEB)
Soeki, Takeshi; Tamura, Yoshiyuki; Bandou, Kanji; Tanaka, Hideji; Takeichi, Naoki; Shinohara, Hisanori; Yui, Yasuko; Fukuda, Nobuo; Sui, Osamu [Zentsuji National Hospital, Kagawa (Japan)
1998-11-01
To examine the long-term effects of the angiotensin-converting enzyme (ACE) inhibitor enalapril on chronic heart failure, 10 patients (7 men and 3 women, mean age: 62{+-}11 years) with chronic stable heart failure, classified as New York Heart Association (NYHA) functional class 2-3 for more than 3 months, and a left ventricular ejection fraction less than 45% were treated with 2.5-5.0 mg of enalapril once a day for 3-15 months (mean 7 months). The causes of heart failure were old myocardial infarction (n=7), hypertension (n=2), and atrial fibrillation (n=1). Radioiodinated metaiodobenzyl guanidine ({sup 123}I-MIBG) imaging, radionuclide angiography, and treadmill exercise test were performed before and after the treatment. With enalapril treatment, left ventricular ejection fraction (LVEF) increased significantly from 38.3{+-}6.9% to 47.5{+-}14.7%; sub-maximal exercise time increased significantly from 205{+-}112 to 272{+-}120 seconds; the heart to mediastinum (H/M) ratio of {sup 123}I-MIBG increased significantly (early image: 1.99{+-}0.38 versus 2.20{+-}0.50; delayed image: 1.86{+-}0.44 versus 2.09{+-}0.51); and the washout rate of {sup 123}I-MIBG decreased slightly from 29.1{+-}9.1% to 25.4{+-}7.0%. The improvement rate of LVEF was significantly correlated with the improvement rates of the H/M ratio and washout rate after treatment with enalapril. Thus, the long-term effects of enalapril can be observed in the cardiac sympathetic nervous system, and {sup 123}I-MIBG imaging appears to be useful for evaluating the therapeutic effects of enalapril on the cardiac sympathetic nervous system in patients with chronic heart failure. (author)
13 CFR 120.860 - Required objectives.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Required objectives. 120.860 Section 120.860 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development Company Loan Program (504) Project Economic Development Goals § 120.860 Required objectives. A Project...
Effect of growth anisotropy on the morphology and property of directionally solidified RE123
International Nuclear Information System (INIS)
Nakamura, Yuichi; Shibusawa, Akira; Ooishi, Yoshihiro; Misu, Tomohiko; Inada, Ryoji; Oota, Akio
2005-01-01
The REBa 2 Cu 3 O y (RE123: RE = Y, Sm, Gd etc.) superconducting current lead is a favorable application due to the high J c properties and low thermal conductivity. Since the RE123 crystal shows the anisotropy in the J c properties as well as the mechanical properties, the ab-plane of the crystal parallel to the growth direction is preferable. The preferential growth direction during directional solidification is determined by the growth anisotropy in the early stage of the growth. In order to get the fundamental information to control the growth orientation, we investigated the growth rates of the Gd123 and Sm123 crystals against the undercooling and the continuous growth condition of Sm123 in directional solidification process. The growth rates of Sm123 and Gd123 were found to be about 5-10 times larger than that of Y123 at the same undercooling. The Sm123 showed the continuous growth structure up to 15 mm/h for fiber samples and up to 10 mm/h for 2 mm circle rods by the zone melting process. These pulling rates for continuous growth are larger than those of Y123 although the difference in growth rates between Sm123 and Y123 is much larger than this difference
Energy Technology Data Exchange (ETDEWEB)
Gueray, R T; Oezkan, N; Yalcin, C [Kocaeli University, Kocaeli (Turkey); Goerres, J; DeBoer, R; Palumbo, A; Tan, W P; Wiescher, M [University of Notre Dame, (United States); Fueloep, Zs; Somorjai, E [Institute of Nuclear Research ATOMKI (Hungary); Lee, H Y [Argonne National Laboratory (United States)
2009-07-01
Astrophysical S-factors for the {sup 1}20Te(p,{gamma}){sup 1}21I and {sup 1}20Te(p,n){sup 1}20I reactions have been measured in the effective center-of-mass energies between 2.47 MeV and 7.93 MeV. Experimental data have been compared with the Hauser-Fesbach statistical model calculations obtained with the model codes NON-SMOKER and TALYS. The discrepancies between the experimental results and calculations can mainly be attributed to the optical model potentials used in the codes.
13 CFR 120.170 - Flood insurance.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Flood insurance. 120.170 Section 120.170 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Applying to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.170 Flood insurance...
[Evaluation of myocardial uptake of beta-methyl-(123I)-iodophenylpentadecanoic acid (123I-BMIPP)].
Momose, M; Kobayashi, H; Saito, K; Matsumoto, N; Maki, M; Hosoda, S; Kusakabe, K
1994-12-01
To evaluate the myocardial uptake of beta-methyl-(123I)-iodophenylpentadecanoic acid (123I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63 +/- 7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior view of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r = 0.676, p < 0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r = -0.671, p < 0.01). Further studies for the significance of MU/LVM will be required.
Evaluation of myocardial uptake of β-methyl-(123I)-iodophenylpentadecanoic acid (123II-BMIPP)
International Nuclear Information System (INIS)
Momose, Mitsuru; Kobayashi, Hideki; Matsumoto, Nobusuke; Maki, Masako; Kusakabe, Kiyoko; Saito, Katsumi; Hosoda, Saichi.
1994-01-01
To evaluate the myocardial uptake of β-methyl-( 123 I)-iodophenylpentadecanoic acid ( 123 I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63±7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior veiw of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r=0.676, p<0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r=-0.671, p<0.01). Further studies for the significance of MU/LVM will be required. (author)
Feasibility of dual radionuclide brain imaging with I-123 and Tc-99m
International Nuclear Information System (INIS)
Ivanovic, M.; Weber, D.A.; Loncaric, S.; Franceschi, D.
1994-01-01
A study was conducted to evaluate the feasibility of simultaneous dual radionuclide brain imaging with 123 I and 99m Tc using photopeak image subtraction techniques or offset photopeak image acquisition. The contribution of the photons from one radionuclide to a second radionuclide's photopeak energy window (crosstalk) was evaluated for SPECT and planar imaging of a brain phantom containing 123 I and 99m Tc for a range of activity levels and distribution properties approximating those in rCBF images of the adult human brain. Crosstalk was evaluated for 10% symmetrical energy windows centered on the 123 I and 99m Tc photopeaks and for 10% energy windows asymmetrically placed to the left and right of the center of the respective photopeaks. It was observed that the centered photopeak windows, 99m Tc crosstalk in the 123 I window is 8.9% of the 99m Tc seen in the 99m Tc window and ranges from 37.5% to 75.0% of the 123 I in the 123 I window. 123 I crosstalk is 37.8% of the 123 I seen in the 123 I window and ranges from 4.4% to 8.9% of the 99m Tc seen in the 99m Tc window. The spatial distribution of a radionuclide's crosstalk photons differs from that observed in the radionuclide's photopeak window. A 99m Tc photopeak window offset to the left does not decrease 123 I crosstalk, and the percentage of 99m Tc scattered photons is significantly increased in the window. Offsetting the 123 I window to the right decreases 99m Tc crosstalk to 9.0% to 17.9% of the 123 I counts, but decreases 123 I sensitivity by 39.9%. Offsetting both photopeak windows to the right decreases the 99m Tc scattered photons in the 99m Tc window, but increases 123 I crosstalk to 17.0% to 33.8% of the 99m Tc counts
Towards Effective Trust-Based Packet Filtering in Collaborative Network Environments
DEFF Research Database (Denmark)
Meng, Weizhi; Li, Wenjuan; Kwok, Lam-For
2017-01-01
compromised by insider attacks. In this paper, we adopt the existing CIDN framework and aim to apply a collaborative trust-based approach to reduce unwanted packets. More specifically, we develop a collaborative trust-based packet filter, which can be deployed in collaborative networks and be robust against...... typical insider attacks (e.g., betrayal attacks). Experimental results in various simulated and practical environments demonstrate that our filter can perform effectively in reducing unwanted traffic and can defend against insider attacks through identifying malicious nodes in a quick manner, as compared...
13 CFR 120.1702 - Program fee.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Program fee. 120.1702 Section 120.1702 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1702 Program fee. Ongoing...
46 CFR 120.350 - Batteries-general.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Batteries-general. 120.350 Section 120.350 Shipping... and Distribution Systems § 120.350 Batteries—general. (a) Where provisions are made for charging batteries, there must be natural or induced ventilation sufficient to dissipate the gases generated. (b...
46 CFR 130.120 - Propulsion control.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion control. 130.120 Section 130.120 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Vessel Control § 130.120 Propulsion control. (a) Each vessel must have— (1...
22 CFR 120.23 - Distribution agreement.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Distribution agreement. 120.23 Section 120.23... § 120.23 Distribution agreement. An agreement (e.g., a contract) to establish a warehouse or distribution point abroad for defense articles exported from the United States for subsequent distribution to...
International Nuclear Information System (INIS)
Ohtsuki, Katsuichi; Sugihara, Hiroki; Umamoto, Ikuo
1992-01-01
123 I-β-methyl-p-iodophenylpentadecanoic acid ( 123 I-BMIPP) myocardial scintigraphy was performed in 13 patients with hypertrophic cardiomyopathy and compared with 201 Tl myocardial scintigraphy performed within 3 months for evaluating the clinical significance of 123 I-BMIPP myocardial scintigraphy. SPECT images were divided into 13 segments and segmental images were visually scored on a 4 (increased tracer uptake) to 0 (severely decreased tracer uptake) scale according to the tracer uptake. In comparison of 123 I-BMIPP early images and 201 Tl perfusion images, mismatches were seen in about 70% of all segments. The number of segments demonstrating lower myocardial uptake of 123 I-BMIPP was larger than that of 201 Tl. In hypertrophic regions, the tracer uptake of 123 I-BMIPP early images was significantly lower than that of 201 Tl images and the lower uptake of 123 I-BMIPP delayed images was more marked. In non-hypertrophic regions, no significant difference was seen between the tracer uptakes of 123 I-BMIPP early images and 201 Tl images but the tracer uptake of 123 I-BMIPP delayed images was significantly lower than that of 201 Tl images. The mismatch between the tracer uptakes of 123 I-BMIPP images and 201 Tl images was thought to be a reflection of disordered myocardial fatty acid metabolism. 'Washout', the difference between the tracer uptakes of 123 I-BMIPP early images and delayed images was also thought to be a reflection of disordered myocardial fatty acid metabolism. These results suggest that 123 I-BMIPP is a promising radiopharmaceutical for evaluating disordered myocardial fatty acid metabolism in patients with HCM. (author)
[(123)I]FP-CIT ENC-DAT normal database
DEFF Research Database (Denmark)
Tossici-Bolt, Livia; Dickson, John C; Sera, Terez
2017-01-01
BACKGROUND: [(123)I]FP-CIT is a well-established radiotracer for the diagnosis of dopaminergic degenerative disorders. The European Normal Control Database of DaTSCAN (ENC-DAT) of healthy controls has provided age and gender-specific reference values for the [(123)I]FP-CIT specific binding ratio...... quantifications methods, BRASS and Southampton, and explores the performance of the striatal phantom calibration in their harmonisation. RESULTS: BRASS and Southampton databases comprising 123 ENC-DAT subjects, from gamma cameras with parallel collimators, were reconstructed using filtered back projection (FBP......) and iterative reconstruction OSEM without corrections (IRNC) and compared against the recommended OSEM with corrections for attenuation and scatter and septal penetration (ACSC), before and after applying phantom calibration. Differences between databases were quantified using the percentage difference...
Ghazzai, Hakim
2016-09-16
Over the last decade, mobile communications have been witnessing a noteworthy increase of data traffic demand that is causing an enormous energy consumption in cellular networks. The reduction of their fossil fuel consumption in addition to the huge energy bills paid by mobile operators is considered as the most important challenges for the next-generation cellular networks. Although most of the proposed studies were focusing on individual physical layer power optimizations, there is a growing necessity to meet the green objective of fifth-generation cellular networks while respecting the user\\'s quality of service. This paper investigates four important techniques that could be exploited separately or together in order to enable wireless operators achieve significant economic benefits and environmental savings: 1) the base station sleeping strategy; 2) the optimized energy procurement from the smart grid; 3) the base station energy sharing; and 4) the green networking collaboration between competitive mobile operators. The presented simulation results measure the gain that could be obtained using these techniques compared with that of traditional scenarios. Finally, this paper discusses the issues and challenges related to the implementations of these techniques in real environments. © 2016 IEEE.
Unmanned Aerial Vehicle Based Wireless Sensor Network for Marine-Coastal Environment Monitoring.
Trasviña-Moreno, Carlos A; Blasco, Rubén; Marco, Álvaro; Casas, Roberto; Trasviña-Castro, Armando
2017-02-24
Marine environments are delicate ecosystems which directly influence local climates, flora, fauna, and human activities. Their monitorization plays a key role in their preservation, which is most commonly done through the use of environmental sensing buoy networks. These devices transmit data by means of satellite communications or close-range base stations, which present several limitations and elevated infrastructure costs. Unmanned Aerial Vehicles (UAV) are another alternative for remote environmental monitoring which provide new types of data and ease of use. These aircraft are mainly used in video capture related applications, in its various light spectrums, and do not provide the same data as sensing buoys, nor can they be used for such extended periods of time. The aim of this research is to provide a flexible, easy to deploy and cost-effective Wireless Sensor Network (WSN) for monitoring marine environments. This proposal uses a UAV as a mobile data collector, low-power long-range communications and sensing buoys as part of a single WSN. A complete description of the design, development, and implementation of the various parts of this system is presented, as well as its validation in a real-world scenario.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Shore power. 120.390 Section 120.390 Shipping COAST... PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS ELECTRICAL INSTALLATION Power Sources and Distribution Systems § 120.390 Shore power. A vessel with an electrical system operating at more...
13 CFR 120.932 - Interest rate.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Interest rate. 120.932 Section 120.932 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development Company Loan Program (504) 504 Loans and Debentures § 120.932 Interest rate. The interest rate of the 504 Loan...
14 CFR 120.31 - Prohibited drugs.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Prohibited drugs. 120.31 Section 120.31... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM... Under § 91.147 of This Chapter and Safety-Sensitive Employees § 120.31 Prohibited drugs. (a) Each...
22 CFR 120.6 - Defense article.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Defense article. 120.6 Section 120.6 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.6 Defense article. Defense article means any item or technical data designated in § 121.1 of this subchapter...
13 CFR 120.554 - Conflict of laws.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Conflict of laws. 120.554 Section 120.554 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Servicing... Conflict of laws. In the event of a conflict between the homestead provisions at §§ 120.550 through 120.553...
International Nuclear Information System (INIS)
Yufu, Kunio; Takahashi, Naohiko; Okada, Norihiro; Shinohara, Tetsuji; Nakagawa, Mikiko; Hara, Masahide; Yoshimatsu, Hironobu; Saikawa, Tetsunori
2012-01-01
Cardiac iodine-123 metaiodobenzylguanidine ( 123 I-MIBG) scintigraphy is an established method of assessment of cardiovascular sympathetic function. The aim of the present study was to investigate the long-term cardiovascular predictive value of cardiac 123 I-MIBG scintigraphy parameters in Japanese type 2 diabetic patients without structural heart disease. Cardiac 123 I-MIBG scintigraphy in 108 patients with type 2 diabetes who did not have structural heart disease, was evaluated. The washout rate (WR) was considered enhanced if it was ≥40%. Accurate follow-up information for 4.6 years was obtained in 54 enhanced WR patients (27 male; mean age, 61±11 years) and in 54 sex- and age-matched preserved WR patients (27 male; mean age, 61±10 years). Major adverse cardiac and cerebrovascular events (MACCE) were investigated. During follow-up, 10 enhanced WR patients developed MACCE including cardiac death, coronary revascularization, stroke, and congestive heart failure, while MACCE occurred in only 3 male patients. The Kaplan-Meier curves indicated that enhanced WR patients had higher incidence of MACCE than those with preserved WR (P 123 I-MIBG scintigraphy at baseline has long-term cardiovascular predictive value in Japanese patients with type 2 diabetes without structural heart disease. (author)
Apparatus of hot cell for iodine-123 production
International Nuclear Information System (INIS)
Almeida, G.L. de; Rautenberg, F.A.; Souza, A.S.F. de.
1986-01-01
The hot cell installation at IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. Several devices, such as, tube furnace coupling system, tube furnace driving system, sup(123)I target transfer system, product extraction system, furnace control system, and effluent systems, were constructed and modified for implanting process engineering. The requirements of safety engineering for operation process were based on ALARA concept. (M.C.K.)
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Action level. 62.120 Section 62.120 Mineral... OCCUPATIONAL NOISE EXPOSURE § 62.120 Action level. If during any work shift a miner's noise exposure equals or exceeds the action level the mine operator must enroll the miner in a hearing conservation program that...
46 CFR 28.120 - Survival craft.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Survival craft. 28.120 Section 28.120 Shipping COAST... VESSELS Requirements for All Vessels § 28.120 Survival craft. (a) Except as provided in paragraphs (b) through (h) of this section and 28.305, each vessel must carry the survival craft specified in Table 28...
Tewoldeberhan, T.W.
2005-01-01
In today's world, organizations are becoming increasingly interested in using business networks as a means to adapt to the ever-changing environment to increase their performance level. As a result, the focus of efforts to improve the performance of organizations has shifted from organizational
Klerkx, L.W.A.; Aarts, M.N.C.; Leeuwis, C.
2010-01-01
The purpose of this article is to investigate effective reformism: strategies that innovation networks deploy to create changes in their environment in order to establish a more conducive context for the realization and durable embedding of their innovation projects. Using a case study approach,
Cyber entertainment system using an immersive networked virtual environment
Ihara, Masayuki; Honda, Shinkuro; Kobayashi, Minoru; Ishibashi, Satoshi
2002-05-01
Authors are examining a cyber entertainment system that applies IPT (Immersive Projection Technology) displays to the entertainment field. This system enables users who are in remote locations to communicate with each other so that they feel as if they are together. Moreover, the system enables those users to experience a high degree of presence, this is due to provision of stereoscopic vision as well as a haptic interface and stereo sound. This paper introduces this system from the viewpoint of space sharing across the network and elucidates its operation using the theme of golf. The system is developed by integrating avatar control, an I/O device, communication links, virtual interaction, mixed reality, and physical simulations. Pairs of these environments are connected across the network. This allows the two players to experience competition. An avatar of each player is displayed by the other player's IPT display in the remote location and is driven by only two magnetic sensors. That is, in the proposed system, users don't need to wear any data suit with a lot of sensors and they are able to play golf without any encumbrance.
47 CFR 80.123 - Service to stations on land.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Service to stations on land. 80.123 Section 80... STATIONS IN THE MARITIME SERVICES Operating Requirements and Procedures Special Procedures-Public Coast Stations § 80.123 Service to stations on land. Marine VHF public coast stations, including AMTS coast...
Clinical applications of brain spect with N-isopropyl-123I-p-iodoamphetamine
International Nuclear Information System (INIS)
Moretti, J.L.; Sergent, A.; Raynaud, C.; Baron, J.C.; Samson, Y.; Lassen, N.; Bourdoiseau, M.
1985-01-01
Single-photon emission computed tomography (SPECT) with N-isopropyl- 123 I-p-iodoamphetamine (IAMP-I-123) was used for 250 patients suffering from brain disorders, comprising brain tumours (36), normal-pressure hydrocephalus (NPH) (23), cerebrovascular pathologies (127) and partial epilepsy (64). Brain tumours were found to be hypoactive, whatever the grade and nature. Frontal hypoactivity was found in NPH patients, and IAMP-I-123 perfusion was improved after cerebral spinal fluid (CSF) lumbar drainage, giving a good predictive criterion of clinical outcome after CSF diversion. For cerebrovascular disorders, it was possible to obtain with IAMP-I-123 SPECT larger pictures of hypoactive areas than the pictures of hypodense lesions obtained with X-ray CT scans; other hypoactive areas that could not be observed with CT were also delineated by IAMP-I-123 SPECT. The hypoactive areas found in constituted infarctions can present two types of kinetics - those which are 'persistent' (still present on delayed scans performed 5 h after IAMP-I-123 injection) and those which disappear with time, thereby suggesting hypofunctional parenchyma without tissue impairment. IAMP-I-123 SPECT was proved to be useful in assessing ischaemia, especially in reversible ischaemia patients, by defining the affected arterial territory and guiding complementary arteriographic exploration in view of surgical procedures. IAMP-I-123 SPECT was able to accurately delineate the affected parenchymal areas. It could also be of help in the follow-up of the efficiency of drug therapy and surgery, and it can be regarded as a good predictive criterion for stroke rehabilitation. The results obtained with IAMP-I-123 indicate that the lesional and epileptogenic areas in epileptic patients are hypoactive. The localization of these territories by IAMP-I-123 SPECT correlates well with other, more accurate, neuroradiological and stereotactic techniques. (author)
DNA and chromosome breaks induced by 123I-estrogen in CHO cells
International Nuclear Information System (INIS)
Schwartz, J.L.
1997-01-01
The effects of the Auger electron-emitting isotope I-123, covalently bound to estrogen, on DNA single- and double-strand breakage and on chromosome breakage was determined in estrogen positive Chinese hamster ovary (CHO-ER) cells. Exposure to the 123 I-estrogen induced both single- and double-strand breaks with a ratio of single- to double-strand breaks of 2.2. The corresponding ratio with 60 Co gamma rays was 15.6. The dose-response was biphasic suggesting that either receptor sites are saturated at high does, or that there is a nonrandom distribution of breaks induced by the 123 I-estrogen. The 123 I-estrogen treatment induced chromosome aberrations with an efficiency of about 1 aberration for each 1,000 disintegrations per cell. This corresponds to the mean lethal dose of 123 I-estrogen for these cells suggesting that the lethal event induced by the Auger electron emitter bound to estrogen is a chromosome aberration. Most of the chromosome-type aberrations were dicentrics and rings, suggesting that 123 I-estrogen-induced chromosome breaks are rejoined. The F-ratio, the ratio of dicentrics to centric rings, was 5.8 ± 1.7, which is similar to that seen with high LET radiations. Their results suggest that I-123 bound to estrogen is an efficient clastogenic agent, that the cytotoxic damage produced by I-123 bound to estrogen is very like high LET-induced damage, and the I-123 in the estrogen-receptor-DNA complex is probably in close proximity to the sugar-phosphate backbone of the DNA
Energy Technology Data Exchange (ETDEWEB)
Gemmell, H G; Sharp, P F; Besson, J A.O.; Ebmeier, K P; Smith, F W
1988-10-01
SPECT images of the brain can be obtained using either /sup 123/I labelled amines or /sup 99m/Tc-hexamethylpropyleneamineoxime (HM-PAO). Both materials produce images which are blood flow dominated and so appear similar in normal subjects, although the respective mechanisms of uptake are not yet finally established. It seems likely, however, that the different mechanisms of uptake are responsible for recent reports of some differences seen in images obtained with the two types of agent in patients with cerebral pathology, mainly cerebrovascular disease. In this study, 12 demented patients, 6 with dementia of the Alzheimer type (DAT) and 6 with multi infarct dementia (MID), were imaged with /sup 123/I-isopropylamphetamine (IMP) and /sup 99m/Tc-HM-PAO and the images compared. Significantly more lesions were seen with IMP than HM-PAO (P < 0.02); out of a possible 120 sites, 41 lesions were seen with IMP compared to 28 with HM-PAO, 23 being seen with both agents. However, it is concluded that either agent can be used for the differential diagnosis of dementia, a task for which the new cerebral blood flow agents seem well suited.
I-123 IMP brain scintigraphies in asphyxiated newborns
International Nuclear Information System (INIS)
Maeda, Hisatoshi; Konishi, Yukuo; Kuriyama, Masanori; Ishii, Yasushi; Sudo, Masakatsu
1987-01-01
Brain scintigraphies with N-Isopropyl (I-123) p-Iodoamphetamine (I-123 IMP) were conducted in eight patients who had asphyxia at the time of birth. Two patients, 15 and 26 year-old, had local defects and diffuse low cerebral uptakes. Two children, 70 day and 2 year-old, had no cerebral uptake. Brain scintigraphies were carried out twice in three among four newborns. Only slight I-123 IMP brain uptakes were observed in the first 10 days. The lateral views of the brain scintigraphies showed increased uptake in the middle region of the brain between 10 to 30 days and reached almost equally distributed in frontal, middle and posterior regions after 30 days. These results were thought to represent rather developmental changes of the cerebral blood flow after ischemic attacks at birth. (author)
Successful therapy with hemoperfusion and plasma exchange in acute 1,2,3-trichloropropane poisoning.
Liu, P; Liang, Y-G; Meng, Q-Y; Zhang, C-G; Wang, H-C; Zhang, X-G; Li, G; Liu, Z-Y; He, Y-Z
2012-05-01
1,2,3-trichloropropane (1,2,3-TCP) is commonly used as an intermediate in pesticide and an industrial specialty solvent. Acute 1,2,3-TCP poisoning is rare but a medical emergency. Sporadic cases of toxic hepatic injury from 1,2,3-TCP in humans have been reported. Liver is a target organ for 1,2,3-TCP toxicity, which may ensue in a short period after ingestion. A specific antidote against 1,2,3-TCP is not available. So it is important to distinguish that a patient with 1,2,3-TCP poisoning constitutes a medical emergency. In this case study, the poisoned patient's clinical condition and laboratory values improved gradually after she received hemoperfusion (HP) and plasma exchange, which indicated that the therapy with HP and plasma exchange were helpful in the treatment of 1,2,3-TCP poisoning.
Clinical evaluation of 123I-IMP SPECT in patients with various neurological diseases
International Nuclear Information System (INIS)
Yoneda, Naoto
1993-01-01
Single photon emission computed tomography with N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP SPECT) was performed in 57 patients with various neurological disease, and compared with the findings of brain CT, MRI, and EEG. The author also evaluated the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack after treatment with antiepileptic drugs in idiopathic epileptic patients. Abnormality of accumulation of 123 I-IMP SPECT was observed in 62.3% of all cases. Focal abnormality was detected in 28.3% of all cases by brain CT and 54.1% by MRI. The detectability of focal abnormality in brain CT and MRI was found to be lower than that of 123 I-TMP SPECT. There was very little significance in detectability between 123 I-IMP SPECT and EEG. But it infers that 123 I-IMP SPECT can detect the subictal state in epileptic patients. One comparative study of the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack by antiepileptic drugs in patients with idiopathic epilepsy, abnormality of 123 I-IMP SPECT findings was found to be higher in patients who were not controlled sufficiently than in patients who were controlled sufficiently, and a significant difference is found by X 2 test. 123 I-IMP SPECT is useful for the evaluation of treatment in patients with epilepsy. (author)
Himwich, Ed; Strand, Richard
2013-01-01
This report includes an assessment of the network performance in terms of lost observing time for the 2012 calendar year. Overall, the observing time loss was about 12.3%, which is in-line with previous years. A table of relative incidence of problems with various subsystems is presented. The most significant identified causes of loss were electronics rack problems (accounting for about 21.8% of losses), antenna reliability (18.1%), RFI (11.8%), and receiver problems (11.7%). About 14.2% of the losses occurred for unknown reasons. New antennas are under development in the USA, Germany, and Spain. There are plans for new telescopes in Norway and Sweden. Other activities of the Network Coordinator are summarized.
Labeling of 3H11 With 123I and Its Biodistribution
International Nuclear Information System (INIS)
Qin Hongbin; Yin Wei; Gao Huibo; Chen Daming; Qi Benzhong; Jin Xiaohai; Bai Hongsheng; Zhang Wenhui; Yang Zhi
2010-01-01
3H11 was labeled with 123 I by Iodogen method,and the labeling product were purified with PD-10 column. The labeling yield and the radiochemical purity of the product was determined by paper chromatography. The biodistribution of 123 I-3H11 in normal mice was car ride out as well. The optimal experimental conditions of 123 I-3H11 was as follow: Iodogen 10 μg, 3H11 30 μg, Na 123 I solution 20 μL (13.3 MBq), PBS 100 μL (pH 7.4, 0.2 mol/L), the normal temperature for 8 min. The labeling yield of 123 I-3H11 was 70%-80%. After stored at 4 degree C for 48 h in human serum,the radiochemical purity was more than 92%. The results of biodistribution showed that the clearance of radiolabeled antibody in blood (half time, T 1/2 ) was 12.25±0.25 h, and the radioactivity in the stomach was up taken obviously. The above results indicated that 123 I-3H11 appears to show some potential as gastric cancer imaging diagnostic agent. (authors)
Basic studies on the hepatobiliary scintigraphy with 123I-rose bengal
International Nuclear Information System (INIS)
Narabayashi, Isamu; Ito, Yasuhiko; Otsuka, Nobuaki; Muranaka, Akira; Konno, Katsunobu.
1979-01-01
The purpose of this investigation is to evaluate the values of 123 I-rose bengal. sup(99m)Tc-labels for the hepatobiliary radiopharmaceutical are not fully satisfied because of greater urinary excretion, especially in cases of hyperbilirubinemia. 123 I is a lower gamma ray energy emitter more suitable for imaging and has a short half life with 13 hours. Commercially obtained rose bengal was purified using Sephadex G-25 column on gelfiltration. 123 I-rose bengal was prepared using iodine exchange reaction between nonradioactive rose bengal and Na 123 I. Radiochemical purity of 123 I-rose bengal was examined by paper chromatography. Biological distribution of 123 I-rose bengal in rabbits at 1 hours after intravenous injection indicated that the tracer was cleared from the blood to the liver, thereafter excreted into the small intestine through the common bile duct. Hepatic uptake and excretion of activity has been measured for 60 minutes using a scintillation camera in conjunction with a VTR system. There existed no significant relative to those of 131 I-rose bengal. Serial scintigraphic images showed satisfactorily better images even in a rabbit with complete obstructive jaundice. (author)
Effects of cigarette smoking on I-123 IMP clearance from the lung
International Nuclear Information System (INIS)
Katoh, Kunihiko; Takahashi, Tsuneo
1990-01-01
N-isopropyl-p-I-123-iodoamphetamine (I-123 IMP), originally developed as a brain scanning agent, is also taken up by the lung. To evaluate the cigarette smoking on the uptake of IMP by the lung, we studied I-123 IMP clearance from the lung on 14 volunteers; 5 non-smokers and 9 smokers. After the injection of 111 MBq (3mCi) of I-123 IMP into the medial cubital vein, the time-activity curve for 60 minutes and the regional activity using 1 frame per minute and a 64 x 64 matrix was obtained. I-123 IMP clearance curve was described as follows: C(t)=A 1 e -k1t +A 2 e -k2t (A 1 , A 2 : intercepts, and k 1 , k 2 : slopes of the exponential components). I-123 IMP clearance was delayed in smokers, and k 2 was smaller in smokers. Also a significant correlations between k 1 , k 2 , and the number of cigarettes smoked per day were found. In conclusion, this study suggests that the delayed clearance and retention of I-123 IMP in the lung indicate the lung metabolic disorders due to cigarette smoking. (author)
Baldominos, Alejandro; Saez, Yago; Isasi, Pedro
2018-04-23
Human activity recognition is a challenging problem for context-aware systems and applications. It is gaining interest due to the ubiquity of different sensor sources, wearable smart objects, ambient sensors, etc. This task is usually approached as a supervised machine learning problem, where a label is to be predicted given some input data, such as the signals retrieved from different sensors. For tackling the human activity recognition problem in sensor network environments, in this paper we propose the use of deep learning (convolutional neural networks) to perform activity recognition using the publicly available OPPORTUNITY dataset. Instead of manually choosing a suitable topology, we will let an evolutionary algorithm design the optimal topology in order to maximize the classification F1 score. After that, we will also explore the performance of committees of the models resulting from the evolutionary process. Results analysis indicates that the proposed model was able to perform activity recognition within a heterogeneous sensor network environment, achieving very high accuracies when tested with new sensor data. Based on all conducted experiments, the proposed neuroevolutionary system has proved to be able to systematically find a classification model which is capable of outperforming previous results reported in the state-of-the-art, showing that this approach is useful and improves upon previously manually-designed architectures.
International Nuclear Information System (INIS)
Verstappen, C.C.P.; Bloem, B.R.; Haaxma, C.A.; Horstink, M.W.I.M.; Oyen, W.J.G.
2007-01-01
Striatal postsynaptic D 2 receptors in Parkinson's disease (PD) are thought to be upregulated in the first years of the disease, especially contralateral to the clinically most affected side. The aim of this study was to evaluate whether the highest striatal D 2 binding is found contralateral to the most affected side in PD, and whether this upregulation can be used as a diagnostic tool. Cross-sectional survey was undertaken of 81 patients with clinically asymmetric PD, without antiparkinsonian drugs and with a disease duration of ≤5 years and 26 age-matched controls. Striatal D 2 binding was assessed with [ 123 I]IBZM SPECT, and severity of the presynaptic dopaminergic lesion with [ 123 I]FP-CIT SPECT. The mean striato-occipital ratio of [ 123 I]IBZM binding was significantly higher in PD patients (1.56 ±0.09) than in controls (1.53 ±0.06). In PD patients, higher values were found contralateral to the clinically most affected side (1.57 ±0.09 vs 1.55 ±0.10 ipsilaterally), suggesting D 2 receptor upregulation, and the reverse was seen using [ 123 I]FP-CIT SPECT. However, on an individual basis only 56% of PD patients showed this upregulation. Our study confirms asymmetric D 2 receptor upregulation in PD. However, the sensitivity of contralateral higher striatal [ 123 I]IBZM binding is only 56%. Therefore, the presence of contralateral higher striatal IBZM binding has insufficient diagnostic accuracy for PD, and PD cannot be excluded in patients with parkinsonism and no contralateral upregulation of D 2 receptors, assessed with [ 123 I]IBZM SPECT. (orig.)
Sensor and Communication Network Technology for Harsh Environments in the Nuclear Power Plant
International Nuclear Information System (INIS)
Cho, Jai Wan; Choi, Young Soo; Lee, Jae Chul; Choi, Yu Rak; Jung, Gwang Il; Jung, Jong Eun; Park, Hee Yoon; Hong, Seok Bong; Koo, In Soo
2008-02-01
One of the challenges in harsh environments qualification and verification for emerging new I and C system of the nuclear power plant is to define the operational environment of these new emerging I and C sensor and communication network such that they are tested to the limits of a mission without requiring expensive over design. To aid this, this report defines, discusses and recommends environmental guideline and verification requirements for using state-of-the-art RPS sensors, fiber optic communication system, wireless communication and wireless smart sensors in nuclear harsh environments. This report focuses on advances in sensors (e.g., temperature, pressure, neutron and thermal power sensors) and their potential impact. Discussed are: radiation, thermal, electromagnetic, and electrical environment specifications. Presented are the typical performance data (survivability guidelines and experimental data), evaluation procedure and standard test method of communication devices, state-of-the-art RPS sensors, and communication systems
Sensor and Communication Network Technology for Harsh Environments in the Nuclear Power Plant
Energy Technology Data Exchange (ETDEWEB)
Cho, Jai Wan; Choi, Young Soo; Lee, Jae Chul; Choi, Yu Rak; Jung, Gwang Il; Jung, Jong Eun; Park, Hee Yoon; Hong, Seok Bong; Koo, In Soo
2008-02-15
One of the challenges in harsh environments qualification and verification for emerging new I and C system of the nuclear power plant is to define the operational environment of these new emerging I and C sensor and communication network such that they are tested to the limits of a mission without requiring expensive over design. To aid this, this report defines, discusses and recommends environmental guideline and verification requirements for using state-of-the-art RPS sensors, fiber optic communication system, wireless communication and wireless smart sensors in nuclear harsh environments. This report focuses on advances in sensors (e.g., temperature, pressure, neutron and thermal power sensors) and their potential impact. Discussed are: radiation, thermal, electromagnetic, and electrical environment specifications. Presented are the typical performance data (survivability guidelines and experimental data), evaluation procedure and standard test method of communication devices, state-of-the-art RPS sensors, and communication systems.
13 CFR 120.354 - Creditworthiness.
2010-01-01
... earnings history and projected future earnings of the employer small business. SBA may consider the... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Creditworthiness. 120.354 Section 120.354 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose...
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Policy. 959.120 Section 959.120 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... of any such onions in trade channels other than those for which intended. Such information and...
2010-07-01
....120 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY VESSEL OPERATING REGULATIONS RULES FOR THE SAFE OPERATION OF VESSELS AND SAFETY MANAGEMENT SYSTEMS General § 96.120 Definitions... management operate in accordance with the approved safety management system. Safety Management System means a...
Iodine-123-labelled serum amyloid P component scintigraphy in amyloidosis
International Nuclear Information System (INIS)
Saile, R.; Deveaux, M.; Marchandise, X.; Duquesnoy, B.
1993-01-01
This study describes the results of scintigraphy with iodine-123-labelled serum amyloid P component (SAP) as a means of establishing the distribution of organ involvement in amyloidosis. The significance of 123 I-SAP scans obtained in 15 patients with biopsy-proven AA or AL amyloidosis is discussed. Biopsy-proven amyloidosis was typically confirmed by scintigraphy, though such confirmation was not obtained in the kidneys in six patients with histological proof of extensive renal amyloid deposition. This lack of uptake may have been due to the accumulation of a major part of the 123 I-SAP in the spleen and/or liver. Twenty-four hour whole-body retention of 123 I-SAP was higher in patients with amyloidosis than in controls. Twenty-four hour tracer accumulation of the radioactivity in the extravascular compartment was notably greater in patients than in controls and appeared to be a good diagnostic criterion. We conclude that 123 I-SAP scintigraphy may be helpful for the evaluation of organ involvement not only in patients with biopsy-proven amyloidosis but also when a biopsy cannot be performed or when a strong suspicion of amyloidosis exists in spite of repeated negative biopsises. (orig.)
Some observations on the use of iodine-123 for thyroid imaging
International Nuclear Information System (INIS)
Ryo, U.Y.; Pinsky, S.
1985-01-01
Efficacy of /sup 99m/Tc and 123 I for thyroid imaging was studied in 122 subjects with a variety of thyroid abnormalities. Both agents produced images that were equivalent in quality in 51 subjects, the image with 123 I was in better quality in 22, and the /sup 99m/Tc image was better in 9. In the remaining 40 cases, discordant findings existed between the 123 I image and /sup 99m/Tc image. In the majority of cases, i.e., 32 or 40, the discrepancy was caused by hot or warm lesions on the /sup 99m/Tc image that became cold or normal (nonvisualization) on the 123 I image. Advantages with /sup 99m/Tc appeared to be (1) the saving of time and cost for patients and physicians and (2) superior sensitivity in detecting thyroid lesions, whereas the advantages with 123 I appeared to be better quality of thyroid images and accurate representation of function of thyroid nodules
The modern research environment
DEFF Research Database (Denmark)
Topsøe, Flemming
1993-01-01
Information Technology, research environment, structured documents, networked information retrieval......Information Technology, research environment, structured documents, networked information retrieval...
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false General. 945.120 Section 945.120 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... entry of any such potatoes into trade channels other than those for which intended. Such information and...
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false General. 948.120 Section 948.120 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... shipments as safeguards against the entry of any such potatoes into trade channels other than those for...
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Application. 946.120 Section 946.120 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... safeguarding against entry of such potatoes into trade channels other than those for which the special purpose...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.600 Section 120.600 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market... listed in FTA's records. (k) SBA's Secondary Market Program Guide is an issuance from SBA which describes...
2010-01-01
... businesses and which provides marketing, management, and technical assistance to its borrowers. It may be: (1... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.701 Section 120.701 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Microloan Program...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Eligibility. 120.346 Section 120.346 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans... will significantly expand an existing export market or develop new export markets; or (2) The applicant...
Myocardial turnover rates of I-123 heptadecanoic acid (HDA)
International Nuclear Information System (INIS)
Dudczak, R.; Schmoliner, R.; Kletter, K.; Derfler, D.K.; Frischauf, H.; Angelberger, P.; Losert, U.
1982-01-01
Myocardial scintigraphy was performed with I-123 labeled HDA in patients with coronary artery disease (CAD, n=37), cardiomyopathy (COCM, n=7) and controls (n=10). These results were compared with coronary angiography, Tl 201 scintigraphy and radionuclide angiography. Results from animal experiments (intracoronary application in calfes) and patient studies supported the assumption that myocardial scintigraphy with I-123 HDA reveals information about myocardial fatty acid utilisation. Summarizing all clinical results using I-123 HDA showed that from the myocardial accumulation pattern of the labeled fatty acid, as well as from Tl 201 perfusion scintigraphy, the value of the regional elimination rate (t/2) could not be predicted. In patients with COCM the mean t/2 was prolonged, but overlapped with controls. In ischemic regions ''shortened'', normal and prolonged elimination rates were found. These findings were related to the observed wall motion and the calculated regional ejection fraction (r=0.73, p<0.001). This data indicate, that I-123 HDA add a further aspect in nuclear cardiology; the results obtained bear a relation to the functional state of the diseased heart
30 CFR 250.123 - Will MMS allow gas storage on unleased lands?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Will MMS allow gas storage on unleased lands? 250.123 Section 250.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... § 250.123 Will MMS allow gas storage on unleased lands? You may not store gas on unleased lands unless...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.311 Section 120.311 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans... which: (1) Is organized under federal or state law to operate in the interest of disabled individuals...
2010-01-01
... percent of total Project cost plus 100 percent of eligible administrative costs. For good cause shown, SBA... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Amount. 120.930 Section 120.930 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development Company Loan...
2010-01-01
... a qualified employee trust (“ESOP”) to: (a) Help finance the growth of its employer's small business... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Policy. 120.350 Section 120.350 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans Qualified...
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Discovery. 2.120 Section 2... COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Procedure in Inter Partes Proceedings § 2.120 Discovery. (a... to disclosure and discovery shall apply in opposition, cancellation, interference and concurrent use...
2010-04-01
... CONSUMPTION HAZARD ANALYSIS AND CRITICAL CONTROL POINT (HACCP) SYSTEMS General Provisions § 120.13 Training... measures, as required by § 120.7. (2) Developing a Hazard Analysis and Critical Control Point (HACCP) plan...) Verifying and modifying the HACCP plan in accordance with the corrective action procedures specified in...
123I and 13I purification for biomolecules labelling
International Nuclear Information System (INIS)
Catanoso, Marcela Forli
2011-01-01
The 123 I and 131 I are iodine radioisotopes widely used in Nuclear Medicine. The radioisotope 123 I is used in diagnosis through the SPECT technique and is routinely produced at IPEN in cyclotron through the reaction: '1 24 Xe (p, 2n) '1 23 Cs -> 123 Xe -> 123 I. The radioisotope 131 I is used both in diagnosis and therapy due to its physical characteristics of decay by β - and its γ-ray emissions that are softened with the use of specific collimators for diagnosis. It is routinely produced at IPEN using the nuclear reactor through the indirect reaction: 130 Te (n, γ) -> 131 Te -> 131 I, irradiating compounds containing Te. The radiopharmaceuticals prepared with these radioisotopes go through rigorous quality control tests and the chemical purity of the primary radioisotopes 123 I and 131 I are within the permissible limits currently defined. However, the presence of some chemical contaminants can prejudice the biomolecules labeling (monoclonal antibodies and peptides), that will produce radiopharmaceuticals of first generation to the oncology area. The aim of this work was to obtain a new purification method of these radioisotopes, allowing the labeling of biomolecules and also to established a process control on those radioisotopes. The methodology was separated on 3 steps: Evaluation of '1 23 I e 131 I radionuclidic purity using a hyper pure germanium detector, chemical purity using ICP-OES and the retention and elution study of 131 I in several absorbers to choose the most appropriate for the purification tests analyzing the behavior of the possible contaminants. The radionuclidic analyses showed the presence of Te and Co on 131 I samples and Te, Tc e Co on 123 I samples. The chemical purity analyses showed the presence of Al and Mo in 123 I, coming from the window material of the target holder and the presence of Al and Te in 131 I samples, coming from the target holder and the target, respectively. The retention and elution study selected the most
Environment Aware Cellular Networks
Ghazzai, Hakim
2015-01-01
. This significant growth of energy consumption impels network companies to pay huge bills which represent around half of their operating expenditures. Therefore, many service providers, including mobile operators, are looking for new and modern green solutions
Acute 1,2,3-trichloropane poisoning: a case report and literature review.
Han, Hui
2010-12-01
1,2,3-Trichloropropane is widely used in industrial and agricultural production. However 1,2,3-trichloropropane poisoning has been rarely encountered in clinical practices. Here, a 45-year-old farmer who suffered fulminant hepatic failure due to ingestion of 1,2,3-trichloropropane has been reported and literature about 1,2,3-trichloropane poisoning has been reviewed. For this case, reduced glutathione, vitamin K, pantoprazole were infused intravenously, and transfusion of blood plasma, platelets and red blood cells were carried out. Unfortunately, the patient's family gave up treatment and they left the hospital with the patient because of the low chance of recovery 20 hr after admission. Based on blood toxicology screening, patient history and rapid deterioration of the patient, the cause of fulminant hepatic failure was determined to be acute intoxication of 1,2,3-trichloropropane by unintentional toxicity. 1,2,3-trichloropropane has histopathological toxic effects on many organs and this toxic effect occurs within a short period after ingestion, with liver as the major affected organ. © 2010 The Author. Basic & Clinical Pharmacology & Toxicology © 2010 Nordic Pharmacological Society.
I-123(131)-metyrapone for imaging of the adrenal cortex
International Nuclear Information System (INIS)
Zolle, I.; Bergmann, H.; Hoefer, R.; Robien, W.
1982-01-01
Attempts to label metyrapone with radioiodine resulted in the synthesis of 4'-bromometyrapone that is labelled with I-123(131) by halogen exchange before use. The synthesis of I-123(131)-metyrapone involves 4 intermediate compounds. 4'-bromometyrapone serves as a precursor with indefinite shelf-life that is labelled selectively in the 4'-position of ring B. Studies of the biodistribution of I-131-metyrapone indicate the highest concentration in the adrenal gland 10-20 min after injection, peak uptake in the normal adrenal corresponds to 0.2% of the administered dose. In hyperfunctioning adrenals the uptake is higher. In a patient with bilateral modular hyperplasia, 0.8% of the injected radioactivity were measured in the enlarged adrenals at 2 resp. 2.8 hrs after injection of I-123-metyrapone. We have performed the first adrenal scintigram on the same patient with 1.25 mCi of I-123-metyrapone. (Author)
Synthesis of 123I-16 iodo estradiol
International Nuclear Information System (INIS)
Therain, F.; Gros, J.; Souchu, A.
1982-01-01
16α iodo estradiol has been demonstrated to have as good an affinity as estradiol for estrogen-receptors and, labeled with iodine 123, may provide a good scanning agent fot visualisation of tissues containing estrogen-repectors, especially mammary tumors. 123 I-16α iodo estradiol has been synthesized by an halogen exchange of 16ν bromo estradiol according to the procedure described by Hochberg for 125 I-16α iodo estradiol labeling. Radiochemical yields are much lower than with iodine 125 (1 to 30%) and extremely variable. Specific activity range from 1,000 to 2,000 Ci/mmole [fr
Iodine-123 program at the TRIUMF laboratory
International Nuclear Information System (INIS)
Vincent, J.S.
1985-01-01
A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction
Coulomb excitation of {sup 123}Cd
Energy Technology Data Exchange (ETDEWEB)
Hartig, Anna-Lena; Kroell, Thorsten; Ilieva, Stoyanka; Boenig, Sabine; Thuerauf, Michael [IKP, TU Darmstadt (Germany); Simpson, Gary; Drouet, Floriane; Ramdhane, Mourad [LPSC, Grenoble (France); Georgiev, Georgi [CSNSM, Orsay (France); Kesteloot, Nele; Wrzosek-Lipska, Kasia [KU, Leuven (Belgium); Jungclaus, Andrea; Illana Sison, Andres [CSIC, Madrid (Spain); Balabanski, Dimiter [INRNE-BAS, Sofia (Bulgaria); Warr, Nigel [Koeln Univ. (Germany). IKP; Voulot, Didier; Wenander, Fredrik; Marsh, Bruce [CERN, Geneva (Switzerland)
2013-07-01
On the neutron-rich side of the valley of stability in the vicinity of the double magic nucleus {sup 132}Sn one can find the {sup 123}Cd isotope. Surprisingly the neutron-rich even-A Cd isotopes in this region are showing signs of collectivity beyond that calculated by modern shell-model predictions. In order to gain a deeper insight in this phenomenon we started to extend these studies to odd-A Cd isotopes. As first isotope the exotic nucleus {sup 123}Cd was produced for safe Coulomb excitation by the ISOLDE facility at CERN and post-accelerated by REX-ISOLDE. The γ-decay from excited states was detected with the MINIBALL array. A report on the status of the ongoing analysis is given.
Energy Technology Data Exchange (ETDEWEB)
Ohtsuki, Katsuichi; Sugihara, Hiroki; Umamoto, Ikuo (Kyoto Prefectural Univ. of Medicine (Japan)) (and others)
1992-02-01
{sup 123}I-{beta}-methyl-p-iodophenylpentadecanoic acid ({sup 123}I-BMIPP) myocardial scintigraphy was performed in 13 patients with hypertrophic cardiomyopathy and compared with {sup 201}Tl myocardial scintigraphy performed within 3 months for evaluating the clinical significance of {sup 123}I-BMIPP myocardial scintigraphy. SPECT images were divided into 13 segments and segmental images were visually scored on a 4 (increased tracer uptake) to 0 (severely decreased tracer uptake) scale according to the tracer uptake. In comparison of {sup 123}I-BMIPP early images and {sup 201}Tl perfusion images, mismatches were seen in about 70% of all segments. The number of segments demonstrating lower myocardial uptake of {sup 123}I-BMIPP was larger than that of {sup 201}Tl. In hypertrophic regions, the tracer uptake of {sup 123}I-BMIPP early images was significantly lower than that of {sup 201}Tl images and the lower uptake of {sup 123}I-BMIPP delayed images was more marked. In non-hypertrophic regions, no significant difference was seen between the tracer uptakes of {sup 123}I-BMIPP early images and {sup 201}Tl images but the tracer uptake of {sup 123}I-BMIPP delayed images was significantly lower than that of {sup 201}Tl images. The mismatch between the tracer uptakes of {sup 123}I-BMIPP images and {sup 201}Tl images was thought to be a reflection of disordered myocardial fatty acid metabolism. 'Washout', the difference between the tracer uptakes of {sup 123}I-BMIPP early images and delayed images was also thought to be a reflection of disordered myocardial fatty acid metabolism. These results suggest that {sup 123}I-BMIPP is a promising radiopharmaceutical for evaluating disordered myocardial fatty acid metabolism in patients with HCM. (author).
13 CFR 120.644 - Transfers of Certificates.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Transfers of Certificates. 120.644 Section 120.644 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Miscellaneous Provisions § 120.644 Transfers of Certificates. (a) General rule. Certificates are...
13 CFR 120.645 - Redemption of Certificates.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Redemption of Certificates. 120.645 Section 120.645 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Miscellaneous Provisions § 120.645 Redemption of Certificates. (a) Redemption of Individual...
13 CFR 120.641 - Disclosure to purchasers.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Disclosure to purchasers. 120.641 Section 120.641 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Miscellaneous Provisions § 120.641 Disclosure to purchasers. (a) Information to purchaser. Prior...
Directory of Open Access Journals (Sweden)
Alejandro Baldominos
2018-04-01
Full Text Available Human activity recognition is a challenging problem for context-aware systems and applications. It is gaining interest due to the ubiquity of different sensor sources, wearable smart objects, ambient sensors, etc. This task is usually approached as a supervised machine learning problem, where a label is to be predicted given some input data, such as the signals retrieved from different sensors. For tackling the human activity recognition problem in sensor network environments, in this paper we propose the use of deep learning (convolutional neural networks to perform activity recognition using the publicly available OPPORTUNITY dataset. Instead of manually choosing a suitable topology, we will let an evolutionary algorithm design the optimal topology in order to maximize the classification F1 score. After that, we will also explore the performance of committees of the models resulting from the evolutionary process. Results analysis indicates that the proposed model was able to perform activity recognition within a heterogeneous sensor network environment, achieving very high accuracies when tested with new sensor data. Based on all conducted experiments, the proposed neuroevolutionary system has proved to be able to systematically find a classification model which is capable of outperforming previous results reported in the state-of-the-art, showing that this approach is useful and improves upon previously manually-designed architectures.
2018-01-01
Human activity recognition is a challenging problem for context-aware systems and applications. It is gaining interest due to the ubiquity of different sensor sources, wearable smart objects, ambient sensors, etc. This task is usually approached as a supervised machine learning problem, where a label is to be predicted given some input data, such as the signals retrieved from different sensors. For tackling the human activity recognition problem in sensor network environments, in this paper we propose the use of deep learning (convolutional neural networks) to perform activity recognition using the publicly available OPPORTUNITY dataset. Instead of manually choosing a suitable topology, we will let an evolutionary algorithm design the optimal topology in order to maximize the classification F1 score. After that, we will also explore the performance of committees of the models resulting from the evolutionary process. Results analysis indicates that the proposed model was able to perform activity recognition within a heterogeneous sensor network environment, achieving very high accuracies when tested with new sensor data. Based on all conducted experiments, the proposed neuroevolutionary system has proved to be able to systematically find a classification model which is capable of outperforming previous results reported in the state-of-the-art, showing that this approach is useful and improves upon previously manually-designed architectures. PMID:29690587
Path planning in GPS-denied environments via collective intelligence of distributed sensor networks
Jha, Devesh K.; Chattopadhyay, Pritthi; Sarkar, Soumik; Ray, Asok
2016-05-01
This paper proposes a framework for reactive goal-directed navigation without global positioning facilities in unknown dynamic environments. A mobile sensor network is used for localising regions of interest for path planning of an autonomous mobile robot. The underlying theory is an extension of a generalised gossip algorithm that has been recently developed in a language-measure-theoretic setting. The algorithm has been used to propagate local decisions of target detection over a mobile sensor network and thus, it generates a belief map for the detected target over the network. In this setting, an autonomous mobile robot may communicate only with a few mobile sensing nodes in its own neighbourhood and localise itself relative to the communicating nodes with bounded uncertainties. The robot makes use of the knowledge based on the belief of the mobile sensors to generate a sequence of way-points, leading to a possible goal. The estimated way-points are used by a sampling-based motion planning algorithm to generate feasible trajectories for the robot. The proposed concept has been validated by numerical simulation on a mobile sensor network test-bed and a Dubin's car-like robot.
Clinical significance of I-123 IMP brain SPECT in children with brain diseases
International Nuclear Information System (INIS)
Takishima, Teruo; Machida, Kikuo; Honda, Norinari; Mamiya, Toshio; Takahashi, Taku; Kamano, Tsuyoshi; Hasegawa, Noriko
1990-01-01
Single photon emission computed tomography (SPECT) of the brain using N-isopropyl p-I-123-iodoamphetamine (I-123 IMP) was performed in 43 children with suspected brain diseases. Forty-three children (25 males and 18 females), with an age range of 24 days-15 years (mean: 6.6 years), were included in the study. Six patients were subsequently diagnosed as normal. Early SPECT of the brain was performed 30 minutes after intravenous administration of 74-111 MBq (2-3 mCi) I-123 IMP using a rotating gamma camera equipped with a 30-degree slant hole and medium energy collimator. Transverse images were reconstructed by Shepp-Logan filtered back projection method with attenuation correction after spatial filtering using an 8th order Butterworth-Wiener filter. Findings of I-123 IMP SPECT were compared with those of X-ray computed tomography (CT) and electroencephalography (EEG). The results showed that in I-123 IMP SPECT, abnormality was found in 30 out of 37 children with brain diseases. The incidence of abnormal findings in the 37 patients was 81% in I-123 IMP SPECT, 61% in X-ray CT, and 78% in EEG; in both cryptogenic and secondary epilepsy, the incidence of abnormality was higher in I-123 IMP SPECT than in X-ray CT. (70% and 94% vs 50% and 81% respectively), and epileptic foci detected by EEG did not correspond with defects found using I-123 IMP SPECT in 27% of the patients; and in asphyxiated infants, a high incidence of abnormality was observed on both I-123 IMP SPECT (86%) and X-ray CT (86%). In conclusion, I-123 IMP SPECT is a clinically useful examination in children with brain disease. (author)
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Applicability. 120.1 Section 120.1 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Applicability. (a) Any juice sold as such or used as an ingredient in beverages shall be processed in accordance...
13 CFR 120.931 - 504 Lending limits.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false 504 Lending limits. 120.931 Section 120.931 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development... enumerated in § 120.862(b) applies to the Project). [68 FR 57988, Oct. 7, 2003] ...
44 CFR 19.120 - Transfers of property.
2010-10-01
... RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.120 Transfers of property. If a recipient sells or... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Transfers of property. 19.120 Section 19.120 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF...
13 CFR 120.601 - SBA Secondary Market.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false SBA Secondary Market. 120.601 Section 120.601 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Fiscal and Transfer Agent (fta) § 120.601 SBA Secondary Market. The SBA secondary market...
13 CFR 120.660 - Suspension or revocation.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Suspension or revocation. 120.660 Section 120.660 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Suspension Or Revocation of Participant in Secondary Market § 120.660 Suspension or revocation. (a...
International Nuclear Information System (INIS)
Jongho Jeon; So-Young Ma; Dae Seong Choi; Beom-Su Jang; Jung Ae Kang; You Ree Nam; Seonhye Yoon; Sang Hyun Park; Korea University of Science and Technology, Daejeon
2015-01-01
The purpose of this study is to synthesize 123 I-labeled hesperetin and to investigate its in vivo behavior. The optimized labeling condition provided two isomers of 123 I-labeled hesperetin with high radiochemical yields and radiochemical purities. Both 123 I-labeled products were orally administered to normal ICR mice, and the initial result showed that most of 123 I activity was detected in the stomach and the intestines. A part of 123 I-labeled hesperetin was absorbed from the small intestine to bloodstream and then it was distributed in normal organs. The results in the present study provided an efficient radiolabeling method of flavonoid and quantitative organ distribution of orally administered hesperetin. (author)
Directory of Open Access Journals (Sweden)
Gong Xue
2018-02-01
Full Text Available This paper first based on the theory of cooperative learning research. It analyses the characteristics and advantages of cooperative learning under the multimedia network environment.And then take China Three Gorges University and Taiwan I-Shou University English major students for example, using questionnaires and interviews to investigate the students's cooperative learning in the network environment. Survey results showed that cooperative learning teaching mode has been widely used in English classrooms across the Taiwan Strait. Students think highly of cooperative learning in the multimedia-aided, and it can have a positive effect on learning; but on cooperative learning ability and the specific learning process, students still have some problems.Nowadays,cooperative learning in the network environment has various ways, but there exist certain differences in the learning styles across the Strait. Taiwan students rely more on teachers’ help and teachers feedback, while students in mainland depend mainly on networking and panel discussion. On qualitative analysis of interview is a supplement to the questionnaire and further explore its deeper causes, which provide valuable evidence for the study and learning practice. Finally, according to the comparative analysis ,the author puts forward some constructive suggestions.
13 CFR 120.175 - Coastal barrier islands.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Coastal barrier islands. 120.175 Section 120.175 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Applying to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.175 Coastal barrier...
46 CFR 120.360 - Semiconductor rectifier systems.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Semiconductor rectifier systems. 120.360 Section 120.360... INSTALLATION Power Sources and Distribution Systems § 120.360 Semiconductor rectifier systems. (a) Each semiconductor rectifier system must have an adequate heat removal system that prevents overheating. (b) Where a...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false FTA fees. 120.652 Section 120.652 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Miscellaneous... Market ...
DEFF Research Database (Denmark)
Matessi, Giuliano; Matos, Ricardo Jorge Santa Clara; Peake, Tom M.
2010-01-01
of the individuals surrounding it within a network. We investigated the effects of a change of local social environment on two behavioural types, ‘persistent' versus ‘sporadic' signaller, in Siamese fighting fish, Betta splendens. Males visually interacted for 1 day in a communication network of seven fish in tanks...... the time spent in the inner front part of their tank, from which they could observe but not interact with the neighbours. Social instability (i.e. number of changed neighbours) raised the signalling levels of individuals independently of their behavioural types. We discuss the relationship between...... information gathering in a communication network and network composition in terms of behavioural types of its members....
Lessons Learnt from and Sustainability of Adopting a Personal Learning Environment & Network (Ple&N)
Tsui, Eric; Sabetzadeh, Farzad
2014-01-01
This paper describes the feedback from the configuration and deployment of a Personal Learning Environment & Network (PLE&N) tool to support peer-based social learning for university students and graduates. An extension of an earlier project in which a generic and PLE&N was deployed for all learners, the current PLE&N is a…
21 CFR 516.123 - Informal conferences regarding agency administrative actions.
2010-04-01
... exemption, determining that a qualified expert panel does not meet the selection criteria, denying a request... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Informal conferences regarding agency administrative actions. 516.123 Section 516.123 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...
Energy Technology Data Exchange (ETDEWEB)
Momose, Mitsuru; Kobayashi, Hideki; Matsumoto, Nobusuke; Maki, Masako; Kusakabe, Kiyoko [Tokyo Women`s Medical Coll. (Japan); Saito, Katsumi; Hosoda, Saichi
1994-12-01
To evaluate the myocardial uptake of {beta}-methyl-({sup 123}I)-iodophenylpentadecanoic acid ({sup 123}I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63{+-}7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior veiw of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r=0.676, p<0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r=-0.671, p<0.01). Further studies for the significance of MU/LVM will be required. (author).
Kinetics of 17-(123I) iodoheptadecanoic acid in myocardium of rats
International Nuclear Information System (INIS)
Reske, S.N.; Auner, G.; Winkler, C.
1983-01-01
Myocardial uptake and turnover of 17-( 123 I)-iodoheptadecanoic acid, injected i.v., was studied in rats. Kinetics of radioactivity incorporated into myocardial tissue and heart lipids as well as myocardial radioactivity recovered as 123 I iodide were determined. Maximal heart uptake of IHA (7.9% dose/g) heart was observed as early as 30 sec., p.i., followed by monocomponent elimination period. Already 10 to 30 sec p.i. 70 to 80% of total myocardial radioactivity was recovered as 123 I iodide. IHA was incorporated only in modest amounts into myocardial phospholipids and triglycerides. Time course of total myocardial radioactivity grossly paralleled to that recovered as 123 I iodide. These findings indicate stringent limitations in utility of IHA as a tracer for assessment of β-oxidation. (author)
21 CFR 131.120 - Sweetened condensed milk.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweetened condensed milk. 131.120 Section 131.120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.120...
13 CFR 120.173 - Lead-based paint.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Lead-based paint. 120.173 Section 120.173 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Applying to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.173 Lead-based paint. If...
13 CFR 120.1015 - Risk Rating System.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Risk Rating System. 120.1015 Section 120.1015 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Risk-Based Lender Oversight Supervision § 120.1015 Risk Rating System. (a) Risk Rating. SBA may assign a Risk Rating...
14 CFR 120.21 - Testing for alcohol.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Testing for alcohol. 120.21 Section 120.21... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Air Traffic Controllers § 120.21 Testing for alcohol. (a) Each air traffic control facility not...
14 CFR 120.19 - Misuse of alcohol.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Misuse of alcohol. 120.19 Section 120.19... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Air Traffic Controllers § 120.19 Misuse of alcohol. (a) This section applies to covered employees who...
26 CFR 509.120 - Double taxation claims.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Double taxation claims. 509.120 Section 509.120... CONVENTIONS SWITZERLAND General Income Tax § 509.120 Double taxation claims. (a) General. Under Article XVII... United States or Switzerland has resulted, or will result, in double taxation contrary to the provisions...
13 CFR 120.400 - Loan Guarantee Agreements.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Loan Guarantee Agreements. 120.400 Section 120.400 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Lenders § 120... specific proposed loan that a Lender may submit. The existence of a Loan Guarantee Agreement does not limit...
International Nuclear Information System (INIS)
Kazuta, Toshinari; Hayashi, Michiyuki; Yoshita, Mitsuhiro; Hirai, Shunsaku
1998-01-01
Iodine-123-labeled meta-iodobenzylguanidine (( 123 I)MIBG), an analogue of guanetidine, is used as a tracer for evaluation of the function of sympathetic neurons. To investigate cardiac sympathetic function in Machado-Joseph disease (MJD), ( 123 I)MIBG myocardial scintigraphy was performed in 12 patients with MJD and 20 controls. In planar imaging studies, the heart to the mediastinum of the average count ratio (H/M) was calculated for both early and delayed images. The mean values of H/M in delayed images of MJD was lower than those of controls (p 123 I)MIBG myocardial scintigraphy in MJD can be seen earlier than abnormal sudomotor system detected by SSR. (author)
21 CFR 163.123 - Sweet chocolate.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.123 Sweet chocolate. (a... specified in paragraph (b)(3) of this section are used in the breakfast cocoa, the label shall bear an...
Network Traffic Features for Anomaly Detection in Specific Industrial Control System Network
Directory of Open Access Journals (Sweden)
Matti Mantere
2013-09-01
Full Text Available The deterministic and restricted nature of industrial control system networks sets them apart from more open networks, such as local area networks in office environments. This improves the usability of network security, monitoring approaches that would be less feasible in more open environments. One of such approaches is machine learning based anomaly detection. Without proper customization for the special requirements of the industrial control system network environment, many existing anomaly or misuse detection systems will perform sub-optimally. A machine learning based approach could reduce the amount of manual customization required for different industrial control system networks. In this paper we analyze a possible set of features to be used in a machine learning based anomaly detection system in the real world industrial control system network environment under investigation. The network under investigation is represented by architectural drawing and results derived from network trace analysis. The network trace is captured from a live running industrial process control network and includes both control data and the data flowing between the control network and the office network. We limit the investigation to the IP traffic in the traces.
The national network of measurements of radioactivity in the environment. Management report - 2010
International Nuclear Information System (INIS)
Leprieur, Fabrice; Chaptal-Gradoz, Nathalie; Wyckaert, Laure; Guldner, Bruno; Jaunet, Pierrick; Levelut, Marie-Noelle
2010-01-01
This report presents the objectives and challenges of the French national network for the measurement of radioactivity in the environment, its legal and regulatory context, its operation, its actors (ASN, IRSN and other actors). It proposes the moral report on the steering committee and work-groups. It describes the development of the information system: main stages, synthetic description, process from data transmission to edition on Internet sites, exploitation of the public Internet site, of the requester internet site, of hosting platforms, harmonization of transmitted data, planning for 2011. It presents the exploitation assessment for 2011: technical support activities, interactions between the IRSN and the national network information system host, and so on. The last part deals with communication and publication activities
Designing for Learning: Online Social Networks as a Classroom Environment
Directory of Open Access Journals (Sweden)
Gail Casey
2011-11-01
Full Text Available This paper deploys notions of emergence, connections, and designs for learning to conceptualize high school students’ interactions when using online social media as a learning environment. It makes links to chaos and complexity theories and to fractal patterns as it reports on a part of the first author’s action research study, conducted while she was a teacher working in an Australian public high school and completing her PhD. The study investigates the use of a Ning online social network as a learning environment shared by seven classes, and it examines students’ reactions and online activity while using a range of social media and Web 2.0 tools.The authors use Graham Nuthall’s (2007 “lens on learning” to explore the social processes and culture of this shared online classroom. The paper uses his extensive body of research and analyses of classroom learning processes to conceptualize and analyze data throughout the action research cycle. It discusses the pedagogical implications that arise from the use of social media and, in so doing, challenges traditional models of teaching and learning.
Myocardial imaging with 9-[Te-123m]tellurapheptadecanoic acid
International Nuclear Information System (INIS)
Elmaleh, D.R.; Knapp, F.F.; Yasuda, T.; Coffey, J.L.; Kopiwoda, S.; Okada, R.; Strauss, W.H.
1981-01-01
The distribution of radioactivity in the myocardium of rats and dogs infarcted by ligation of the left anterior coronary artery has been determined after intravenous injection of 9-[Te-123m]telluraheptadecanoic acid (Te-123m HDA). In rats the normal myocardium concentrated radioactivity (3.7% +/- 0.28 injected dose/g) to nearly three times that in the zones of infarction (1.12% +/- 0.18 dose/g). The focal defects detected in the gamma-camera images of rats and dogs correspond well with areas of infarction identified in the excised hearts by staining with triphenyltetrazolium chloride. The distribution of radioactivity from Te-123m HDA in dog hearts sectioned at autopsy showed a linear correlation (r = 0.94) with blood flow as determined with scandium-46-labeled microspheres
Scott, David W.
2010-01-01
The Mission Operations Laboratory (MOL) at Marshall Space Flight Center (MSFC) is responsible for Engineering Support capability for NASA s Ares rocket development and operations. In pursuit of this, MOL is building the Ares Engineering and Operations Network (AEON), a web-based portal to support and simplify two critical activities: Access and analyze Ares manufacturing, test, and flight performance data, with access to Shuttle data for comparison Establish and maintain collaborative communities within the Ares teams/subteams and with other projects, e.g., Space Shuttle, International Space Station (ISS). AEON seeks to provide a seamless interface to a) locally developed engineering applications and b) a Commercial-Off-The-Shelf (COTS) collaborative environment that includes Web 2.0 capabilities, e.g., blogging, wikis, and social networking. This paper discusses how Web 2.0 might be applied to the typically conservative engineering support arena, based on feedback from Integration, Verification, and Validation (IV&V) testing and on searching for their use in similar environments.
123I-IMP SPECT studies in schizophrenia and atypical psychosis
International Nuclear Information System (INIS)
Hayashi, Takuji; Suga, Hidemichi
1993-01-01
According to the classification of Mitsuda, 23 patients with endogenous psychosis aged 40 years or younger, presenting with hallucination and delusion, were classified as having schizophrenia (n=12) or atypical psychosis (n=11). These patients were studied by single photon emission computed tomography (SPECT) with N-isopropyl-p-I-123-iodoamphetamine (I-123 IMP). Sixteen healthy persons served as controls. Early and delayed SPECT images were obtained 30 min and 4 hr, respectively, after intravenous injection of I-123 IMP. The group of schizophrenic patients had markedly decreased uptake of I-123 in the basal ganglia, as well as the right temporal and left occipital areas on both early and delayed images. In the group of atypical psychosis patients, however, decreased uptake of I-123 was noted in both the right basal ganglia and left occipital area on early images, but none of such findings were seen on delayed images. Regarding the uptake ratio in the frontal area on both early and delayed images, there were significant differences between the two groups. These findings have important implications for the different etiology of both disease types: not only functional disturbance in the frontal area but also irreversible changes may be involved in the occurrence of schizophrenia, and functional disturbance particularly in the right basal ganglia may be involved in the occurrence of atypical psychosis. (N.K.)
14 CFR 120.39 - Testing for alcohol.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Testing for alcohol. 120.39 Section 120.39... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM... Under § 91.147 of This Chapter and Safety-Sensitive Employees § 120.39 Testing for alcohol. (a) Each...
14 CFR 120.37 - Misuse of alcohol.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Misuse of alcohol. 120.37 Section 120.37... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM... Under § 91.147 of This Chapter and Safety-Sensitive Employees § 120.37 Misuse of alcohol. (a) General...
2010-04-01
... HACCP principles to fish and fishery product processing at least equivalent to that received under... standardized curriculum. (a) Developing a HACCP plan, which could include adapting a model or generic-type HACCP plan, that is appropriate for a specific processor, in order to meet the requirements of § 123.6(b...
Serial lung imaging with 123I-IMP in localized pulmonary lesions
International Nuclear Information System (INIS)
Nakajo, Masayuki; Shimada, Jurio; Shimozono, Michiko; Uchiyama, Noriaki; Hiraki, Yoshiyuki; Shinohara, Shinji.
1988-01-01
123 I-IMP (N-isopropyl-p-[ 123 I]-iodoamphetamine) dynamic (1 frame/min for 25 mins), 30-min and 4-hr static lung imaging was performed in a total of 65 patients with roentgenographic evidence of localized pulmonary lesion (12 with pneumonia, one with lung abscess, 5 with pulmonary tuberculosis, 3 with pneumoconiosis, one with lung fluke disease and 43 with various histological types of primary lung cancer). The findings in 65 of 70 (95 %) lesions in the initial 1 or 2-min dynamic 123 I-IMP images were analogous to those obtained by 99m Tc-MAA lung perfusion imaging and decreased activity was observed in 68 of 70 (97 %) lesions, suggesting that the initial images mainly reflected the relative distribution of pulmonary arterial blood flow. However, 123 I-IMP accumulated differently according to the pathological conditions afterwards. Decrease activity from 123 I-IMP was contineously observed in a cavity of the lung abscess, 2 of 2 tuberculomas, 3 of 7 large nodules of pneumoconiosis and all of the 42 cancerous lesions which were possible to be evaluated. Gradual increased in activity relative to that of ''normal lung fields'' was observed in all 14 lesions of pneumonia; pneumonic lesions of the lung abscess, tuberculosis and lung fluke disease; 4 of 7 large nodules of pneumoconiosis; all of 8 atelectatic lesions and 32 of 44 areas surrounding cancers (most of them had roentgenographic evidence of infiltrating shadows). Thus 123 I-IMP accumulated increasingly in pneumonic and atelectatic lesions, while it appeared not to accumulate in such lesions replacing lung tissues as cavity, caseous and fibrous lesions and primary lung cancers. 123 I-IMP can be used as a new lung imaging agent to provide diagnostic informations on the property of pulmonary lesions. (author)
19 CFR 123.27 - Feeding and watering animals in Canada.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Feeding and watering animals in Canada. 123.27...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.27 Feeding and watering animals in Canada. If animals in sealed conveyances or compartments...
Work of scientific and technological information under network environment
International Nuclear Information System (INIS)
Chen Yingxi; Huang Daifu; Yang Lifeng
2010-01-01
With the development of internet and information technology, the work of scientific and technological information is faced with great challenge. This article expounds the new changes of scientific and technological information in enterprise under network environment by giving a minute description on the situation the work faced and characteristic of the work. Not only does it carry out enthusiastic discussion upon problems which are present in the work of scientific and technological information in the company, but puts forward proposals and specific measures as well. Service theory is also offered by adjusting and reforming the resources construction, service ways and the job of providing contents. We should take vigorous action to the research work of scientific and technological information, changing the information directional service into knowledge providing service. (authors)
WR 120bb and WR 120bc: a pair of WN9h stars with possibly interacting circumstellar shells
Burgemeister, S.; Gvaramadze, V. V.; Stringfellow, G. S.; Kniazev, A. Y.; Todt, H.; Hamann, W.-R.
2013-03-01
Two optically obscured Wolf-Rayet (WR) stars have been recently discovered by means of their infrared (IR) circumstellar shells, which show signatures of interaction with each other. Following the systematics of the WR star catalogues, these stars obtain the names WR 120bb and WR 120bc. In this paper, we present and analyse new near-IR, J-, H- and K-band spectra using the Potsdam Wolf-Rayet model atmosphere code. For that purpose, the atomic data base of the code has been extended in order to include all significant lines in the near-IR bands. The spectra of both stars are classified as WN9h. As their spectra are very similar the parameters that we obtained by the spectral analyses hardly differ. Despite their late spectral subtype, we found relatively high stellar temperatures of 63 kK. The wind composition is dominated by helium, while hydrogen is depleted to 25 per cent by mass. Because of their location in the Scutum-Centaurus Arm, WR 120bb and WR 120bc appear highly reddened, A_{K_s} ≈ 2 mag. We adopt a common distance of 5.8 kpc to both stars, which complies with the typical absolute K-band magnitude for the WN9h subtype of -6.5 mag, is consistent with their observed extinction based on comparison with other massive stars in the region, and allows for the possibility that their shells are interacting with each other. This leads to luminosities of log ({textit {L}/L}_{odot }) = 5.66 and 5.54 for WR 120bb and WR 120bc, with large uncertainties due to the adopted distance. The values of the luminosities of WR 120bb and WR 120bc imply that the immediate precursors of both stars were red supergiants (RSG). This implies in turn that the circumstellar shells associated with WR 120bb and WR 120bc were formed by interaction between the WR wind and the dense material shed during the preceding RSG phase.
123I-β-CIT SPECT imaging study in early Parkinson's disease
International Nuclear Information System (INIS)
Li Peiyong
1998-01-01
Purpose: To investigate the loss of dopamine transporters in hemi-Parkinson's disease (PD) using 123 I-β-CIT/SPECT. Methods: Seven patients with hemi-Parkinson's disease and 7 age- and sex- matched healthy subjects were studied by 123 I-β-CIT/SPECT. Striatal specific uptake of 123 I-β-CIT was calculated in the ratio of striatal uptake to cerebellar uptake. Results: Mean striatal specific uptake of 123 I-β-CIT in healthy subjects was 3.0 +- 0.5 and 5.5 +- 0.6 at 3h and 18h after injection. Striatal specific uptake in contralateral to the clinical symptom side was 2.0 +- 0.8 and 3.1 +- 0.4; in ipsilateral striatum was 2.3 +- 0.4 and 4.0 +- 0.5. There was a significant reduction of striatal tracer uptake in PD patients compared to the controls. Patient age correlated with the reduction in contralateral striatum but did not correlate with that in ipsilateral striatum. Conclusions: Striatal dopamine transporters bilaterally lost in early PD patients. 123 I-β-CIT uptake in contralateral striatum was reduced more severely than in ipsilateral striatum
Development of the radiosynthesis of high-specific-activity 123I-NKJ64
International Nuclear Information System (INIS)
Tavares, Adriana Alexandre S.; Jobson, Nicola K.; Dewar, Deborah; Sutherland, Andrew; Pimlott, Sally L.
2011-01-01
Introduction: 123 I-NKJ64, a reboxetine analogue, is currently under development as a potential novel single photon emission computed tomography radiotracer for imaging the noradrenaline transporter in brain. This study describes the development of the radiosynthesis of 123 I-NKJ64, highlighting the advantages and disadvantages, pitfalls and solutions encountered while developing the final radiolabelling methodology. Methods: The synthesis of 123 I-NKJ64 was evaluated using an electrophilic iododestannylation method, where a Boc-protected trimethylstannyl precursor was radioiodinated using peracetic acid as an oxidant and deprotection was investigated using either trifluoroacetic acid (TFA) or 2 M hydrochloric acid (HCl). Results: Radioiodination of the Boc-protected trimethylstannyl precursor was achieved with an incorporation yield of 92±6%. Deprotection with 2 M HCl produced 123 I-NKJ64 with the highest radiochemical yield of 98.05±1.63% compared with 83.95±13.24% with TFA. However, the specific activity of the obtained 123 I-NKJ64 was lower when measured after using 2 M HCl (0.15±0.23 Ci/μmol) as the deprotecting agent in comparison to TFA (1.76±0.60 Ci/μmol). Further investigation of the 2 M HCl methodology found a by-product, identified as the deprotected proto-destannylated precursor, which co-eluted with 123 I-NKJ64 during the high-performance liquid chromatography (HPLC) purification. Conclusions: The radiosynthesis of 123 I-NKJ64 was achieved with good isolated radiochemical yield of 68% and a high specific activity of 1.8 Ci/μmol. TFA was found to be the most suitable deprotecting agent, since 2 M HCl generated a by-product that could not be fully separated from 123 I-NKJ64 using the HPLC methodology investigated. This study highlights the importance of HPLC purification and accurate measurement of specific activity while developing new radiosynthesis methodologies.
20 CFR 655.120 - Offered wage rate.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Offered wage rate. 655.120 Section 655.120... the United States (H-2A Workers) Prefiling Procedures § 655.120 Offered wage rate. (a) To comply with... wage that is the highest of the AEWR, the prevailing hourly wage or piece rate, the agreed-upon...
46 CFR 120.320 - Generators and motors.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Generators and motors. 120.320 Section 120.320 Shipping... and Distribution Systems § 120.320 Generators and motors. (a) Each generator and motor must be: (1) In... generator and motor must be designed for an ambient temperature of 50 °C (122 °F) except that: (1) If the...
I sup(123) target transfer system
International Nuclear Information System (INIS)
Almeida, G.L. de; Rautenberg, F.A.
1986-01-01
The construction of target transfer system using a robot into hot cell of IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. The system operation is described, and the advantages are shown. (M.C.K.)
International Nuclear Information System (INIS)
Kim, H. J.; Bong, J. K.; Nam, K. P.; Yang, S. O.; Moon, D. H.; Ryu, J. S.; Lee, H. K.
1997-01-01
[I-123]IPT has been used to measure changes in dopamine trasnporters with Parkinson's patients (PP). However, 2 hrs of imaging time without movement of patient's head partially limits its widespread use in routine clinical SPECT protocol. The purpose of this study was to evaluate the feasibility of a simplified IPT SPECT scan protocol using three 10 min scan data obtained at 0-10, 55-65, and 110-120 min postinjection and compared to current protocol using 23 scans obtained from O-120 min to quantify dopamine transporter binding in normal controls (NC) and PP. IPT labeled with 6.74±0.88mCi of I-123 was intravenously injected into 12 NC (age: 41±9) and 22 PP (age : 55±8) and the 5 min dynamic SPECT data were acquired for 2 hrs with Trionix triple-headed SPECT camera. SPECT images were reconstructed and attenuation corrected. [I-123] IPT quickly penetratd the blood-brain barrier and began to Ioacalize higher concentrations at the basal ganglia at 20 min after injection. The transporter parameter was measured using a variation of graphical analysis (VGA) and area ratio method (ARM) that derive the distribution volume ratios (R v =V 3 /V 2 for VGA, R A =V 3 /V 2 for ARM ) from multiple scan data without blood data, R v ' and R A ' measured from three 10 min scan data and compared with R v and R A measured from 23 scans for both NC and PP, (R v ', R v ') or NC and PP were (1.83±0.29, 2.21±0.34) and (0.63±0.34, 0.77±0.31), respectively. (R v ', R A ) for NC and PP were (1.11±0.22, 1.62±0.28) and (0.43±0.21, 0.65±0.24), respectively, Both (R v ', R v ) and (R A ', R A ) for NC were clearly separated from those for PP. R' v and R' A underestimated R v and R A by 18.4% and 33.5%, respectively, but R v ' and R A ' showed excellent correlations with R v (r=0.95) and R A (r=0.97), respectively. The results indicate that the three 10 min scan protocol may be feasible and allows us to differentiate dopamine transporter parameters in PP from those in NC
123I-BMIPP delayed scintigraphic imaging in patients with chronic heart failure
International Nuclear Information System (INIS)
Kida, Keisuke; Akashi, Yoshihiro J.; Yoneyama, Kihei; Shimokawa, Mitsuhiro; Musha, Haruki
2008-01-01
The objective of the present study was to clarify the ability of 123 I-beta-methyl-iodophenylpentadecanoic acid ( 123 I-BMIPP) to evaluate the heart-to-mediastinum (H/M) ratio and myocardial global washout rate (WR) in patients with chronic heart failure (CHF). The severity of CHF was evaluated on the basis of the New York Heart Association (NYHA) classification. Twenty patients with CHF (13 with idiopathic dilated cardiomyopathy and 7 with ischemic cardiomyopathy) and 11 age-matched controls underwent myocardial radionuclide imaging. Scintigraphic images were obtained from each participant at the early (30 min following radio-isotope injection) and late (4 h) phases using 123 I-BMIPP. The H/M ratio and WR were calculated from planar images. Concentrations of plasma brain natriuretic peptide (BNP) were measured prior to the scintigraphic study. The 123 I-BMIPP uptake of early H/M and global WR did not significantly differ among groups, but uptake of delayed H/M was significantly lower in patients with NYHA class III than in controls (control 2.47±0.39; class III 1.78±0.28 P 123 I-BMIPP uptake of delayed H/M enhances the image of CHF severity. The myocardial WR of 123 I-BMIPP also effectively depicted the severity of CHF. (author)
2010-01-01
... Reservist Economic Injury Disaster Loans § 123.500 Definitions. The following terms have the same meaning wherever they are used in this subpart: (a) Essential employee is an individual (whether or not an owner of... economic injury means an economic harm to the small business such that it cannot: (1) Meet its obligations...
VRML and Collaborative Environments: New Tools for Networked Visualization
Crutcher, R. M.; Plante, R. L.; Rajlich, P.
We present two new applications that engage the network as a tool for astronomical research and/or education. The first is a VRML server which allows users over the Web to interactively create three-dimensional visualizations of FITS images contained in the NCSA Astronomy Digital Image Library (ADIL). The server's Web interface allows users to select images from the ADIL, fill in processing parameters, and create renderings featuring isosurfaces, slices, contours, and annotations; the often extensive computations are carried out on an NCSA SGI supercomputer server without the user having an individual account on the system. The user can then download the 3D visualizations as VRML files, which may be rotated and manipulated locally on virtually any class of computer. The second application is the ADILBrowser, a part of the NCSA Horizon Image Data Browser Java package. ADILBrowser allows a group of participants to browse images from the ADIL within a collaborative session. The collaborative environment is provided by the NCSA Habanero package which includes text and audio chat tools and a white board. The ADILBrowser is just an example of a collaborative tool that can be built with the Horizon and Habanero packages. The classes provided by these packages can be assembled to create custom collaborative applications that visualize data either from local disk or from anywhere on the network.
EFFECT OF A PLURONIC® P123 FORMULATION ON THE NITRIC OXIDE-GENERATING DRUG JS-K
Kaur, Imit; Kosak, Ken M.; Terrazas, Moises; Herron, James N.; Kern, Steven E.; Boucher, Kenneth M.; Shami, Paul J.
2014-01-01
Purpose O2-(2,4-dinitrophenyl)1-[(4-ethoxycarbonyl)piperazin-1-yl]diazen-1-ium-1,2-diolate] or JS-K is a nitric oxide-producing prodrug of the arylated diazeniumdiolate class with promising anti-tumor activity. JS-K has challenging solubility and stability properties. We aimed to characterize and compare Pluronic® P123-formulated JS-K (P123/JS-K) with free JS-K. Methods We determined micelle size, shape, and critical micelle concentration of Pluronic® P123. Efficacy was evaluated in vitro using HL-60 and U937 cells and in vivo in a xenog raft in NOD/SCID IL2Rγnull mice using HL-60 cells. We compared JS-K and P123/JS-K stability in different media. We also compared plasma protein binding of JS-K and P123/JS-K. We determined the binding and Stern Volmer constants, and thermodynamic parameters. Results Spherical P123/JS-K micelles were smaller than blank P123. P123/JS-K formulation was more stable in buffered saline, whole blood, plasma and RPMI media as compared to free JS-K. P123 affected the protein binding properties of JS-K. In vitro it was as efficacious as JS-K alone when tested in HL-60 and U937 cells and in vivo greater tumor regression was observed for P123/JS-K treated NOD/SCID IL2Rγnull mice when compared to free JS-K-treated NOD/SCID IL2Rγnull mice. Conclusions Pluronic® P123 solubilizes, stabilizes and affects the protein binding characteristics of JS-K. P123/JS-K showed more in vivo anti-tumor activity than free JS-K. PMID:25330743
Abnormal I-123 HIPDM images in various disease entities
International Nuclear Information System (INIS)
Shih, W.J.; Magoun, S.; Coupal, J.J.; Clark, D.B.; Dekosky, S.T.; Kung, H.F.; Beihn, R.; Ryo, U.Y.
1987-01-01
Eighty patients who were referred from neurology service for evaluation of stroke, Alzheimer disease (AD), and/or other neurologic diseases underwent the study. Four views of planar images were obtained following the intravenous injection of 3-5 mCi of I-123 HIPDM. SPECT images were then obtained using a camera interfaced to a PDP-11 computer. Forty of the 80 patients had scintigraphic findings of stroke, which correlated well with head CT/cerebral angiogram. Sixteen patients with AD had good correlation between the degree of temporoparietal abnormality in the images. Severe AD and severe stroke patients almost always had a positive planar image. Normal I-123 HIPDM localization in the brain requires intact cerebral flow and cerebral neuronal function. A focal area of decreased I-123 HIPDM localization may represent either interruption of blood flow or neurochemical dysfunction
Development of I-123 labeled angiostatin as a novel cancer imaging agent
International Nuclear Information System (INIS)
Lee, Kyung Han; Lee, Sang Yoon; Choe, Yearn Seong; Paik, Jin Young; Kim, Sun A; Han, Yu Mi; Kim, Byung Tae
2000-01-01
Since angiostatin is a promising anticancer agent that target tumor endothelial cells, it may have advantages over many current tumor imaging agents by overcoming problems such as poor delivery or multi-drug resistance. We therefore synthesized radiolabeled agniostatin and tested it in vivo. 123 -angiostatin was synthesized using the Bolton Hunter method. 123 I labeled plasminogen lysin-binding-site (LBS) was also synthesized. Blood clearance of he radiotracer was measured in SD rats, while tissue distribution was assessed in ICR mice at 1,4, and 18 hr. Pinhole scintigraphy was performed in SD rats and in nude mice bearing RR 1022 tumors at various time points. Radiochemical yield of 123 I-angiostatin approximated 20%. In vivo distribution demonstrated stability of the label for at least 20 hr. 123 I-angiostatin was cleared from the circulation in a biexponential manner with rapid early clearance followed by a slower rate of elimination Tissue distribution in mice showed the highest uptake in the kidneys which was the major route of excretion. This was followed by the lung, liver, and myocardium whose uptake of 1.5∼2% ID/gm at 1 hrs gradually decreased over time (all p 123 I-angiostatin and 123 I-LBS images in SD rates showed a similar distribution. Blood pool activity gradually cleared while tumor uptake increased over time, resulting in a high tumor to non tumor ratio at 20 hr. 123 I-angiostatin has promising potential as a new tumor imaging agent. Further study is warranted to assess its mechanism of uptake and precise role in cancer imaging
13 CFR 120.911 - Land contributions.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Land contributions. 120.911 Section 120.911 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development... Project Property) previously acquired by the Borrower. [68 FR 57987, Oct. 7, 2003] ...
Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle
International Nuclear Information System (INIS)
Bomanji, J.; Britton, K.E.
1987-01-01
Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context
Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle
Energy Technology Data Exchange (ETDEWEB)
Bomanji, J.; Britton, K.E.
1987-08-01
Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context.
International Nuclear Information System (INIS)
Dubois, E.A.; Kam, K.L.; Somsen, G.A.; Boer, G.J.; Bruin, K. de; Batink, H.D.; Pfaffendorf, M.; Royen, E.A. van; Zwieten, P.A. van
1996-01-01
The aim of the present study was to evaluate the use of the noradrenaline analogue iodine-123 metaiodobenzylguanidine ([ 123 I]MIBG) for the assessment of cardiac sympathetic activity in the presence of diabetes mellitus and/or hypertension in animal models. One model used Wistar-Kyoto rats (WKY) and spontaneously hypertensive rats (SHR) rendered diabetic at 12 weeks of age by an intravenous injection of streptozotocin (STZ). The other model used lean and obese Zucker rats. In all groups basic haemodynamic values were established and animals received an intravenous injection of 50 μCi [ 123 I]MIBG. Initial myocardial uptake and washout rates of [ 123 I]MIBG were measured scintigraphically during 4 h. After sacrifice, plasma noradrenaline and left cardiac ventricular β-adrenoceptor density was determined. The diabetic state, both in STZ-treated rats (direct induction) and in obese Zucker rats (genetic induction), appeared to induce a lower cardiac density of β-adrenoceptors, indicative of increased sympathetic activity. Cardiac [ 123 I]MIBG then showed increased washouts, thereby confirming enhanced noradrenergic activity. This parallism of results led to the conclusion that [ 123 I]MIBG wash-out measurements could provide an excellent tool to assess cardiac sympathetic activity noninvasively. However, in hypertension (WKY vs SHR), both parameters failed to show parallelism: no changes in β-adrenoceptor density were found, whereas [ 123 I]MIBG wash-out rate was increased. Thus, either [ 123 I]MIBG washout or β-adrenoceptor density may not be a reliable parameter under all circumstances to detect changes in the release of noradrenaline. (orig./MG)
A modified method for preparation of 123I-HDA
International Nuclear Information System (INIS)
Chen Fang; Decristoforo, C.; Staeger, A.; Fridrich, L.
1994-01-01
A modified method for preparation of 123 I-Heptadecanoic acid ( 123 I-HDA) is described. The labelling yield is 92.8%(n = 32, 85%-97%)by heating time of 15 minutes. The overall recovery is about 70%. The time for the whole preparation is about 90 min. The method described is reliable, and convenient. A carrier free and precursor free product of high purity can be prepared in a reasonable short time
The Worldviews Network: Transformative Global Change Education in Immersive Environments
Hamilton, H.; Yu, K. C.; Gardiner, N.; McConville, D.; Connolly, R.; "Irving, Lindsay", L. S.
2011-12-01
Our modern age is defined by an astounding capacity to generate scientific information. From DNA to dark matter, human ingenuity and technologies create an endless stream of data about ourselves and the world of which we are a part. Yet we largely founder in transforming information into understanding, and understanding into rational action for our society as a whole. Earth and biodiversity scientists are especially frustrated by this impasse because the data they gather often point to a clash between Earth's capacity to sustain life and the decisions that humans make to garner the planet's resources. Immersive virtual environments offer an underexplored link in the translation of scientific data into public understanding, dialogue, and action. The Worldviews Network is a collaboration of scientists, artists, and educators focused on developing best practices for the use of immersive environments for science-based ecological literacy education. A central tenet of the Worldviews Network is that there are multiple ways to know and experience the world, so we are developing scientifically accurate, geographically relevant, and culturally appropriate programming to promote ecological literacy within informal science education programs across the United States. The goal of Worldviews Network is to offer transformative learning experiences, in which participants are guided on a process integrating immersive visual explorations, critical reflection and dialogue, and design-oriented approaches to action - or more simply, seeing, knowing, and doing. Our methods center on live presentations, interactive scientific visualizations, and sustainability dialogues hosted at informal science institutions. Our approach uses datasets from the life, Earth, and space sciences to illuminate the complex conditions that support life on earth and the ways in which ecological systems interact. We are leveraging scientific data from federal agencies, non-governmental organizations, and our
7 CFR 28.123 - Costs of practical forms of cotton standards.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Costs of practical forms of cotton standards. 28.123 Section 28.123 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD...
Imaging tissue hypoxia: clinical and pre-clinical experience with 123IAZA
International Nuclear Information System (INIS)
Wiebe, L.I.
1997-01-01
The molecular mechanisms that underline the selective binding of iodazomycin arabinoside, IAZA, and related nitromidazoles are reviewed as a basis for interpretation of preclinical and clinical data for hypoxic binding of radioiodinated IAZA. Clinical data are presented for 123 IAZA uptake in a number of pathologies including metastatic tumours, peripheral vascular disease in diabetes, muscle stress and rheumatoid arthritis. The results of studies to determine the influence of tumour type on uptake of 123 I-IAZA in patients with a variety of deep-seated solid tumours will be presented. Correlations of hypoxia-dependent binding with 99m Tc-HMPAO perfusion images will be reviewed and early correlations of uptake to treatment response in cancer will be presented. Unusual features of 123 I-IAZA biodistribution will also be discussed together with detailed pharmacokinetic and radiation dosimetry data for '2 123 I- IAZA in normal volunteers
THE APPLICATION OF DIGITAL LINE GRAPHS AND MAP IN THE NETWORK ENVIRONMENT
Directory of Open Access Journals (Sweden)
X. Guo
2012-07-01
Full Text Available WebGIS is an important research field in GIS. W3C organization established SVG standard, which laid a foundation for WebGIS based on vector data. In China, Digital Line Graphs(DLG is a significant GIS product and it has been used in many medium and large WebGIS system. Geographic information-portrayal is the common method of DLG visualization. However, the inherent characteristics of Geographic information-portrayal may lead to a relatively higher data production input, still, the visualization effect is not ideal. We put forward a new product named Digital Line Graphs and Map(DLGM, which consists of DLG and DLG's cartographic presentation data. It provides visualization data based on the cartographic standards. Due to the manufacture and management of DLGM data that are independent from software and platform, its data can be used in many fields. Network application is one of them. This paper is to use DLGM in the network applications. First it reveals the connotation and characteristics of DLGM then analyses the model that DLGM organizes, manages DLG and map symbol data. After that, combined with SVG standards, we put forward DLGM’s SVG encoding method without any information loss. Finally we provide a web map system based on local area network by using 1:10000 DLGM data of a certain area. Based on this study, we conclude that DLGM can be used in the network environment providing high quality DLG and cartographic data for WebGIS.
International Nuclear Information System (INIS)
Luukko, A.; Hattula, J.; Helppi, H.; Knuuttila, O.
1980-09-01
The level structure of 123 Xe has been studied with 122 Te( 3 He,2n) and 123 Te( 3 He,3n) reactions using in-beam γ-ray spectroscopic methods. Band-like level structures based on the unique-parity hsub(11/2) neutron state and different low-j states are observed. The isomeric state proposed earlier is established at 185.4 keV with a half-life of 5.6+-0.3 μs, and a new spin assignment of 7/2 - is proposed for this level. A triaxial-rotor-model calculation has been performed to interprete the negative-parity level system. Because of the 7/2 - state, we do not obtain a consistent description of the negative-parity states with the triaxial rotor model, unlike the heavier odd-A Xe nuclei. On the other hand, the positive-parity level structures are interpreted in terms of the core-quasiparticle model supposing a vibrational core. This indicates different core shapes for the positive- and negative-parity level systems. (author)
5 CFR 185.120 - Prehearing conferences.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Prehearing conferences. 185.120 Section 185.120 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM... hearing and to submit only documentary evidence (subject to the objection of other parties) and written...
24 CFR 572.120 - Affordability standards.
2010-04-01
... by homeowners in the eligible property. Financing that would impair the continued affordability of... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Affordability standards. 572.120 Section 572.120 Housing and Urban Development Regulations Relating to Housing and Urban Development...
13 CFR 120.910 - Borrower contributions.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Borrower contributions. 120.910 Section 120.910 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development... percent, if the Project involves the acquisition, construction, conversion, or expansion of a limited or...
Kao, Pan-Fu; Wey, Shiaw-Pyng; Yang, An-Shoei
2009-11-01
[2[[2-[[[3-(4-chlorophenyl)-8-methyl-8-azabicyclo[3,2,1]-oct-2-yl]-methyl](2-mercaptoethyl)-amino]ethyl]amino]ethanethiolato(3-)-N2,N2',S2,S2]oxo-[1R-exo-exo)])-[99mTc]-technetium (99mTc-TRODAT-1) and 123I-iodobenzamide (123I-IBZM) are radiotracers for brain dopamine pre- and postsynaptic neuron imaging. The purpose of this study was to evaluate imaging parameters and crossed energy interference using simultaneous single photon emission computed tomography (SPECT) 99mTc and 123I data acquisition. A five-compartment brain striatal phantom was filled with 99mTc and/or 123I radioactive solutions with different striatal-to-background ratios, ranging from 3:1 to 9:1. SPECT data were acquired with energy window settings of 15% for the centered window at 140 keV for 99mTc and a 10% asymmetric window at 159 keV for 123I. The experiments were carried out using either individual (99mTc or 123I only) or both radionuclides. The striatal-to-background ratios and energy crossed interference between 99mTc and 123I were calculated. The phantom SPECT images demonstrated that the energy crossed interferences from 123I to 99mTc, and vice versa, were 22 +/- 12.4% and 0.4 +/- 1.0%, respectively. A net interference of 7.1 +/- 4.0% for the counts in the 15% centered 99mTc window can be expected from 123I and a net interference of 1.6 +/- 3.3% for the counts in the 10% asymmetric 123I window was derived from 99mTc. The correlation of striatal-to-background ratios between single isotope and simultaneous dual-isotope was excellent (R2 = 0.99). The imaging parameters used in this simultaneous dualisotope SPECT imaging could be used in future clinical practice for imaging patients with movement disorders by using 99mTc-TRODAT-1 and 123I-IBZM. The striatal-to-background ratios were not affected by the crossed interference between 99mTc and 123I.
Directory of Open Access Journals (Sweden)
Pan-Fu Kao
2009-11-01
Full Text Available [2[[2-[[[3-(4-chlorophenyl-8-methyl-8-azabicyclo[3,2,1]-oct-2-yl]-methyl](2-mercaptoethylamino]ethyl]amino]ethanethiolato(3--N2,N2′,S2,S2]oxo-[1R-exo-exo]-[99mTc]-technetium (99mTc-TRODAT-1 and 123I-iodobenzamide (123I-IBZM are radiotracers for brain dopamine preand postsynaptic neuron imaging. The purpose of this study was to evaluate imaging parameters and crossed energy interference using simultaneous single photon emission computed tomography (SPECT 99mTc and 123I data acquisition. A five-compartment brain striatal phantom was filled with 99mTc and/or 123I radioactive solutions with different striatal-to-background ratios, ranging from 3:1 to 9:1. SPECT data were acquired with energy window settings of 15% for the centered window at 140 keV for 99mTc and a 10% asymmetric window at 159 keV for 123I. The experiments were carried out using either individual (99mTc or 123I only or both radionuclides. The striatal-to-background ratios and energy crossed interference between 99mTc and 123I were calculated. The phantom SPECT images demonstrated that the energy crossed interferences from 123I to 99mTc, and vice versa, were 22 ± 12.4% and 0.4 ± 1.0%, respectively. A net interference of 7.1 ± 4.0% for the counts in the 15% centered 99mTc window can be expected from 123I and a net interference of 1.6 ± 3.3% for the counts in the 10% asymmetric 123I window was derived from 99mTc. The correlation of striatal-to-background ratios between single isotope and simultaneous dual-isotope was excellent (R2 = 0.99. The imaging parameters used in this simultaneous dual-isotope SPECT imaging could be used in future clinical practice for imaging patients with movement disorders by using 99mTc-TRODAT-1 and 123I-IBZM. The striatal-to-background ratios were not affected by the crossed interference between 99mTc and 123I.
A Study on Group Key Agreement in Sensor Network Environments Using Two-Dimensional Arrays
Jang, Seung-Jae; Lee, Young-Gu; Lee, Kwang-Hyung; Kim, Tai-Hoon; Jun, Moon-Seog
2011-01-01
These days, with the emergence of the concept of ubiquitous computing, sensor networks that collect, analyze and process all the information through the sensors have become of huge interest. However, sensor network technology fundamentally has wireless communication infrastructure as its foundation and thus has security weakness and limitations such as low computing capacity, power supply limitations and price. In this paper, and considering the characteristics of the sensor network environment, we propose a group key agreement method using a keyset pre-distribution of two-dimension arrays that should minimize the exposure of key and personal information. The key collision problems are resolved by utilizing a polygonal shape’s center of gravity. The method shows that calculating a polygonal shape’s center of gravity only requires a very small amount of calculations from the users. The simple calculation not only increases the group key generation efficiency, but also enhances the sense of security by protecting information between nodes. PMID:22164072
A Study on Group Key Agreement in Sensor Network Environments Using Two-Dimensional Arrays
Directory of Open Access Journals (Sweden)
Moon-Seog Jun
2011-08-01
Full Text Available These days, with the emergence of the concept of ubiquitous computing, sensor networks that collect, analyze and process all the information through the sensors have become of huge interest. However, sensor network technology fundamentally has wireless communication infrastructure as its foundation and thus has security weakness and limitations such as low computing capacity, power supply limitations and price. In this paper, and considering the characteristics of the sensor network environment, we propose a group key agreement method using a keyset pre-distribution of two-dimension arrays that should minimize the exposure of key and personal information. The key collision problems are resolved by utilizing a polygonal shape’s center of gravity. The method shows that calculating a polygonal shape’s center of gravity only requires a very small amount of calculations from the users. The simple calculation not only increases the group key generation efficiency, but also enhances the sense of security by protecting information between nodes.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Gas meter or flow instrumentation... Procedures § 86.120-94 Gas meter or flow instrumentation calibration; particulate, methanol and formaldehyde measurement. (a) Sampling for particulate, methanol and formaldehyde emissions requires the use of gas meters...
The significance of 123I-BMIPP delayed scintigraphic imaging in cardiac patients.
Akashi, Yoshihiro J; Kida, Keisuke; Suzuki, Kae; Inoue, Koji; Kawasaki, Kensuke; Yamauchi, Masahiro; Musha, Haruki; Anker, Stefan D
2007-04-25
Earlier studies have not fully investigated the significance of radionuclide planar imaging in cardiac patients using the fatty acid analogue 123I-beta-methyl-iodophenylpentadecanoic acid (123I-BMIPP). This study was to clarify the effectiveness of 123I-BMIPP in assessing the heart-to-mediastinum ratio (H/M) and myocardial washout rate (WR) in patients with heart disease. Myocardial 123I-BMIPP imaging was performed in 33 patients (20 with chronic heart failure [CHF] and 13 with stable angina pectoris [AP]) and 11 control subjects. Myocardial 123I-BMIPP planner images were obtained 30 min (early image) and 4 h (delayed image) after tracer injection. The left ventricular ejection fraction (LVEF) was measured by quantitative gated single photon emission computed tomography. The concentration of plasma brain natriuretic peptide (BNP) was measured before the scintigraphic study. (1) Delayed H/M was much lower in CHF than in AP (1.93 +/- 0.37 vs. 2.21 +/- 0.38, p acid metabolism disorders in patients with heart disease in both masked and unmasked conditions.
22 CFR 120.9 - Defense service.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Defense service. 120.9 Section 120.9 Foreign... Defense service. (a) Defense service means: (1) The furnishing of assistance (including training) to..., educational, or information publications and media of all kinds, training aid, orientation, training exercise...
13 CFR 120.174 - Earthquake hazards.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Earthquake hazards. 120.174... Applying to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.174 Earthquake..., the construction must conform with the “National Earthquake Hazards Reduction Program (“NEHRP...
Energy Technology Data Exchange (ETDEWEB)
Catanoso, Marcela Forli
2011-07-01
The {sup 123}I and {sup 131}I are iodine radioisotopes widely used in Nuclear Medicine. The radioisotope {sup 123}I is used in diagnosis through the SPECT technique and is routinely produced at IPEN in cyclotron through the reaction: '1{sup 24}Xe (p, 2n) '1{sup 23}Cs -> {sup 123}Xe -> {sup 123}I. The radioisotope {sup 131}I is used both in diagnosis and therapy due to its physical characteristics of decay by {beta}{sup -} and its {gamma}-ray emissions that are softened with the use of specific collimators for diagnosis. It is routinely produced at IPEN using the nuclear reactor through the indirect reaction: {sup 130}Te (n, {gamma}) ->{sup 131}Te -> {sup 131}I, irradiating compounds containing Te. The radiopharmaceuticals prepared with these radioisotopes go through rigorous quality control tests and the chemical purity of the primary radioisotopes {sup 123}I and {sup 131}I are within the permissible limits currently defined. However, the presence of some chemical contaminants can prejudice the biomolecules labeling (monoclonal antibodies and peptides), that will produce radiopharmaceuticals of first generation to the oncology area. The aim of this work was to obtain a new purification method of these radioisotopes, allowing the labeling of biomolecules and also to established a process control on those radioisotopes. The methodology was separated on 3 steps: Evaluation of '1{sup 23}I e {sup 131}I radionuclidic purity using a hyper pure germanium detector, chemical purity using ICP-OES and the retention and elution study of {sup 131}I in several absorbers to choose the most appropriate for the purification tests analyzing the behavior of the possible contaminants. The radionuclidic analyses showed the presence of Te and Co on {sup 131}I samples and Te, Tc e Co on {sup 123}I samples. The chemical purity analyses showed the presence of Al and Mo in {sup 123}I, coming from the window material of the target holder and the presence of Al and Te in {sup
Energy Technology Data Exchange (ETDEWEB)
Ettlinger, Dagmar E. [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Haeusler, Daniela; Wadsak, Wolfgang [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Girschele, Friedrich; Sindelar, Karoline M. [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Mien, Leonhard-Key [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Ungersboeck, Johanna [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Viernstein, Helmut; Kletter, Kurt; Dudczak, Robert [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Mitterhauser, Markus [Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria); Department of Nuclear Medicine, Medical University of Vienna, A-1090 Vienna (Austria)], E-mail: markus.mitterhauser@meduniwien.ac.at
2008-05-15
Purpose: Since the late 1980s, cocaine analogues based on the phenyltropane structure, such as [{sup 11}C]CFT and [{sup 123}I]{beta}-CIT have been used for the imaging of the dopamine transporter. FE-CIT (fluoropropyl ester) and FP-CIT (N-fluoropropyl derivative) are further analogues. The aim of this study was to (1) evaluate and compare the metabolic stability of {beta}-CIT, FP-CIT and FE-CIT against carboxyl esterases and (2) evaluate selectivity of [{sup 18}F]FE-CIT compared to [{sup 123}I]{beta}-CIT and [{sup 123}I]FP-CIT using autoradiography. Methods: In vitro enzymatic hydrolysis assays were performed using different concentrations of {beta}-CIT, FE-CIT and FP-CIT with constant concentrations of carboxyl esterase. Autoradiography was performed on coronal 20-{mu}m rat brain sections incubated with different radioactivity concentrations of [{sup 123}I]{beta}-CIT, [{sup 123}I]FP-CIT or [{sup 18}F]FE-CIT and, additionally, with 3-amino-4-(2-dimethylaminomethyl-phenylsulfanyl)-benzonitrile [serotonin transporter (SERT)] and nisoxetine [norepinephrine transporter (NET)] for blocking experiments. Results: In vitro assays showed Michaelis-Menten constants of 175 {mu}mol ({beta}-CIT), 183 {mu}mol (FE-CIT) and 521 {mu}mol (FP-CIT). Limiting velocities were 0.1005 {mu}mol/min ({beta}-CIT), 0.1418 {mu}mol/min (FE-CIT) and 0.1308 {mu}mol/min (FP-CIT). This indicates a significantly increased stability of FP-CIT, whereas carboxyl esterase stability of {beta}-CIT and FE-CIT showed no significant difference. Autoradiographic analyses revealed a good correlation between dopamine transporter (DAT)-rich regions and the uptake pattern of FE-CIT. Blocking experiments showed a higher DAT selectivity for [{sup 18}F]FE-CIT than for the other two tracers. Conclusion: We found that (1) the metabolic stability of FE-CIT was comparable to that of {beta}-CIT, whereas FP-CIT showed higher resistance to enzymatic hydrolysis; and (2) the overall uptake pattern of [{sup 18}F]FE-CIT on
International Nuclear Information System (INIS)
Sone, Teruki; Fukunaga, Masao; Otsuka, Nobuaki
1985-01-01
In 20 patients with cerebrovascular accident, cerebral blood flow was estimated with N-isopropyl-p-[ 123 I]-iodoamphetamine ( 123 I-IMP) using a rotating gamma camera, and the findings were compared with those of X-CT or angiography. 123 I-IMP study demonstrated the areas of diminished cerebral blood flow in 14 cases. X-CT also demonstrated lesions in 14 cases, however, 123 I-IMP study delineated the lesions more precisely corresponding to the neurological findings. In cases with cerebellar hemorrhage or reversible ischemic neurological deficit (RIND), the lesion could be established only by 123 I-IMP study. It was demonstrated by 123 I-IMP study that vascular stenosis or abnormal vessels seen on angiography in patients with vertebro-basilar insufficiency or venous angioma was not necessarily accompanied by diminished blood flow. It was shown that scintigraphy with 123 I-IMP was a non-invasive, safe and extremely useful method to estimate the regional cerebral blood flow. (author)
2010-06-03
... EMB120 Aircraft Maintenance Manual, Revision 24, dated March 30, 2009. Corrective actions include... tank, and corrective actions as applicable. Corrective actions include replacing the measuring stick... 28 of the EMBRAER EMB120 Aircraft Maintenance Manual, Revision 24, dated March 30, 2009. The actions...
Prediction of Thermal Environment in a Large Space Using Artificial Neural Network
Directory of Open Access Journals (Sweden)
Hyun-Jung Yoon
2018-02-01
Full Text Available Since the thermal environment of large space buildings such as stadiums can vary depending on the location of the stands, it is important to divide them into different zones and evaluate their thermal environment separately. The thermal environment can be evaluated using physical values measured with the sensors, but the occupant density of the stadium stands is high, which limits the locations available to install the sensors. As a method to resolve the limitations of installing the sensors, we propose a method to predict the thermal environment of each zone in a large space. We set six key thermal factors affecting the thermal environment in a large space to be predicted factors (indoor air temperature, mean radiant temperature, and clothing and the fixed factors (air velocity, metabolic rate, and relative humidity. Using artificial neural network (ANN models and the outdoor air temperature and the surface temperature of the interior walls around the stands as input data, we developed a method to predict the three thermal factors. Learning and verification datasets were established using STAR CCM+ (2016.10, Siemens PLM software, Plano, TX, USA. An analysis of each model’s prediction results showed that the prediction accuracy increased with the number of learning data points. The thermal environment evaluation process developed in this study can be used to control heating, ventilation, and air conditioning (HVAC facilities in each zone in a large space building with sufficient learning by ANN models at the building testing or the evaluation stage.
Caporali, E.; Tuneski, A.
2012-12-01
, following the criteria and conditions for setting up a Joint Postgraduate Degree. The new second cycle degree courses are going to be activated in the academic year 2012/2012. Both the first and second cycle curricula, developed through the co-operation, exchange of know-how and expertise between partners, are based on the European Credit Transfer System and are in accordance with the Bologna Process. In DEREL a second objective is to implement a sustainable regional network aimed to offer lifelong learning seminars for environment and resources engineering education and training of interested stakeholders and organize workshops focused on strengthening the links in the knowledge triangle: environment education-innovation-research, with participation of postgraduate students, public services, enterprises and NGO's. Also, the good collaborative environment created, since 2005, with the project partners can be surely mentioned as an additional valuable objective of the two TEMPUS projects, enabling implementation of a sustainable international network for environment and resources engineering studies enhancement and development.
International Nuclear Information System (INIS)
Sumida, Masaki; Shiohara, Yuh; Umeda, Takateru
2000-01-01
The interface stability of the Sm 123 superconductor was analyzed in accordance with the constitutional undercooling criterion. As the single-crystal growth of the 123 phase is largely dependent on the growth-interface stability, a quantitative analysis was very much required. From this analysis, it was clarified that the constitutional undercooling must exist in the liquid when the 123 growth interface comes close to a 211 particle during the peritectic solidification. It was also predicted that the larger 211 particle radius, smaller volume fraction of the 211 particles, larger growth rate, or smaller imposed temperature gradient would cause easy occurrence of the constitutional undercooling ahead of the 123 growth interface. Taking into account the nucleation at the L/211 interface just ahead of the 123 growth front due to the constitutional undercooling, the transition of 123 growth from a planar-interface morphology to an equiaxed blocky morphology was investigated quantitatively and qualitatively
International Nuclear Information System (INIS)
Guertner, C.; Schacherer, C.; Krause, B.J.; Zickmann, J.; Klepzig, H. Jr.; Hoer, G.
1996-01-01
Stress and rest myocardial perfusion scintigraphy using either Thallium-201 or 99m Tc-isonitrile was performed in SPECT technique in order to localize ischemia or scar associated perfusion defects. 15 min and 4 h p.i. static anterior 123 I-MIBG uptake was acquired. In order to localize norepinephrine depletion 4 h p.i. additional 123 I-MIBG SPECT acquistion was performed. Incidence of arrhythmias was investigated by Holter ECG. Patients with diabetes mellitus were excluded. SPECT images showed in all patients regional 123 I-MIBG depletion which corresponded with scintigraphically infarcted or ischemic regions. Well perfused myocardial regions matched with regular 123 I-MIBG utpake. There was no evidence of increased arrhythmias in long-term ECG. The finding of regular 123 I-MIBG uptake in well-perfused myocardium and infarction- or ischemia-associated regional 123 I-MIBG depletion confirms that silent ischemia is not caused by a global sympathetic nervous dysfunction in a sense of cardiac polyneuropathy. (orig.) [de
Tellurium-123m-labeled isosteres of palmitoleic and oleic acids show high myocardial uptake
International Nuclear Information System (INIS)
Knapp, F.F. Jr.; Ambrose, K.R.; Callahan, A.P.; Grigsby, R.A.; Irgolic, K.J.
1979-01-01
These studies were directed at determining if the telluro fatty acids prepared by the isosteric replacement of the Δ 9 -double bonds of oleic and palmitoleic acids with /sup 123m/Te would show heart uptake in rats. The isostere of palmitoleic acid, 9-tellurapentadecanoic acid(II), was prepared by basic hydrolysis of the product formed by the coupling of /sup 123m/Te-sodium hexyl tellurol with methyl-8-bromooctadecanoate. Similarly, the isostere of oleic acid, 9-telluraheptadecanoic acid(IV), was prepared by the same route beginning with the reaction of /sup 123m/Te-sodium octyl tellurol with methyl-8-bromooctadecanoate. Both /sup 123m/Te-(II) and /sup 123m/Te-(IV) showed remarkably high heart uptake in rats (2 to 3% dose/gm) ten minutes after intravenous administration, and the heart/blood ratios were high (20-30/1). Finally, the hearts of rats injected with /sup 123m/Te-(IV) have been clearly imaged with a rectilinear scanner
Production of high purity iodine-123 from xenon-124 at energies between 15 and 34 MeV
International Nuclear Information System (INIS)
Firouzbakht, M.L.; Teng Renrui; Schlyer, D.J.; Wolf, A.P.
1987-01-01
The production of I-123 from the proton bombardment of isotopically enriched Xe-124 is reported over the energy range of 15 to 34 MeV via the 124 Xe (p,pn) 123 Xe (β + , 2.1 hr) → 123 I and 124 Xe (p,2n) 123 Cs (β + , 6 min) → 123 Xe (β + , 2.1 hr) → 123 I pathways. The thick target yields for this target are tabulated and compared to theoretical cross-section calculations of the nuclear reactions leading to the production of Xe-123. The radiochemical purity of the I-123 is greater than 99.9% and the contamination of I-125 is below detectable limits (< 0.1%) at 6.6 hrs after the end of bombardment. (orig.)
13 CFR 120.952 - Fiscal agent.
2010-01-01
... Fiscal Agent to assess the financial markets, minimize the cost of sales, arrange for the production of... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fiscal agent. 120.952 Section 120.952 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development Company...
21 CFR 820.120 - Device labeling.
2010-04-01
... designed to prevent mixups. (d) Labeling operations. Each manufacturer shall control labeling and packaging... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Device labeling. 820.120 Section 820.120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES...
Peng, Wei; Lan, Wei; Zhong, Jiancheng; Wang, Jianxin; Pan, Yi
2017-07-15
MicroRNAs have been reported to have close relationship with diseases due to their deregulation of the expression of target mRNAs. Detecting disease-related microRNAs is helpful for disease therapies. With the development of high throughput experimental techniques, a large number of microRNAs have been sequenced. However, it is still a big challenge to identify which microRNAs are related to diseases. Recently, researchers are interesting in combining multiple-biological information to identify the associations between microRNAs and diseases. In this work, we have proposed a novel method to predict the microRNA-disease associations based on four biological properties. They are microRNA, disease, gene and environment factor. Compared with previous methods, our method makes predictions not only by using the prior knowledge of associations among microRNAs, disease, environment factors and genes, but also by using the internal relationship among these biological properties. We constructed four biological networks based on the similarity of microRNAs, diseases, environment factors and genes, respectively. Then random walking was implemented on the four networks unequally. In the walking course, the associations can be inferred from the neighbors in the same networks. Meanwhile the association information can be transferred from one network to another. The results of experiment showed that our method achieved better prediction performance than other existing state-of-the-art methods. Copyright © 2017 Elsevier Inc. All rights reserved.
Brain SPECT with 123I-Lisurid in patients with Parkinson's disease and in controls
International Nuclear Information System (INIS)
Hierholzer, J.; Cordes, M.; Schelosky, L.; Richter, W.; Schrag, A.; Poewe, W.; Schulze, P.E.; Semmler, W.; Eichstaedt, H.; Felix, R.
1995-01-01
The goal was to visualize cerebral dopamine-D 2 receptors in 6 patients with Parkinson's disease and in 3 healthy controls using iodine-123-Lisuride-SPECT. In addition, we performed receptor-replacement studies using 123 I-Lisuride and cold Lisuride as competitive ligands. The highest uptake of 123 I-Lisuride was observed in the striatum, a region with known high dopamine receptor density. In two patients premedication with cold Lisuride displaced 123 I-Lisuride from the dopamine receptor. 123 I-Lisuride is valuable as a radiotracer in cerebral dopamine-D 2 receptor scintigraphy. Whether or not it is possible to determine dynamic changes of dopamine receptor density or function by receptor replacement studies needs further evaluation in larger patient populations. (orig.) [de
13 CFR 120.613 - Secondary Participation Guarantee Agreement.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Secondary Participation Guarantee Agreement. 120.613 Section 120.613 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Certificates § 120.613 Secondary Participation Guarantee Agreement. When a Lender...
Effect of a Pluronic(®) P123 formulation on the nitric oxide-generating drug JS-K.
Kaur, Imit; Kosak, Ken M; Terrazas, Moises; Herron, James N; Kern, Steven E; Boucher, Kenneth M; Shami, Paul J
2015-04-01
O(2)-(2,4-dinitrophenyl)1-[(4-ethoxycarbonyl)piperazin-1-yl]diazen-1-ium-1,2-diolate] or JS-K is a nitric oxide-producing prodrug of the arylated diazeniumdiolate class with promising anti-tumor activity. JS-K has challenging solubility and stability properties. We aimed to characterize and compare Pluronic(®) P123-formulated JS-K (P123/JS-K) with free JS-K. We determined micelle size, shape, and critical micelle concentration of Pluronic(®) P123. Efficacy was evaluated in vitro using HL-60 and U937 cells and in vivo in a xenograft in NOD/SCID IL2Rγ (null) mice using HL-60 cells. We compared JS-K and P123/JS-K stability in different media. We also compared plasma protein binding of JS-K and P123/JS-K. We determined the binding and Stern Volmer constants, and thermodynamic parameters. Spherical P123/JS-K micelles were smaller than blank P123. P123/JS-K formulation was more stable in buffered saline, whole blood, plasma and RPMI media as compared to free JS-K. P123 affected the protein binding properties of JS-K. In vitro it was as efficacious as JS-K alone when tested in HL-60 and U937 cells and in vivo greater tumor regression was observed for P123/JS-K treated NOD/SCID IL2Rγ (null) mice when compared to free JS-K-treated NOD/SCID IL2Rγ (null) mice. Pluronic(®) P123 solubilizes, stabilizes and affects the protein binding characteristics of JS-K. P123/JS-K showed more in vivo anti-tumor activity than free JS-K.
24 CFR 245.120 - Meeting space.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Meeting space. 245.120 Section 245... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.120 Meeting space. (a) Owners of... of any community room or other available space appropriate for meetings that is part of the...
22 CFR 120.13 - United States.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false United States. 120.13 Section 120.13 Foreign... United States. United States, when used in the geographical sense, includes the several states, the Commonwealth of Puerto Rico, the insular possessions of the United States, the District of Columbia, the...
GPR 120: The Potential Target for Obesity Treatment.
Tanagho, Peter A; Shohdy, Kyrillus S
2016-01-01
G protein coupled receptor 120 (GPR120) is a class of receptors in the gastrointestinal tract (GIT) that is implicated in nutrient sensing and body weight regulation. Functions of GPR120 are thought to be mediated by the release of a group of hormones known as incretins, such as glucagon like peptide 1 (GLP-1) and gastric inhibitory polypeptide (GIP). We have searched PubMed with the keywords "GPR120","GLP-1" and "obesity". Relevant studies were retrieved and included in the review. Recently, many exogenous compounds have been investigated in their role in the release of GLP-1 and in causing weight loss in obese rats. However, some results question the putative role of GPR120 in metabolic homeostasis. Herein, we evaluate the potential use of GPR120 as a target receptor in obesity and found it to be ubiquitous throughout the GIT, with various functions in each site. In order to find the optimal drug, the role of GPR120 in each site needs to be defined and selectivity of the potential drug needs to be studied to ensure the success of this growing line of obesity management.
21 CFR 123.6 - Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan.
2010-04-01
... Control Point (HACCP) plan. 123.6 Section 123.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... Provisions § 123.6 Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan. (a) Hazard... fish or fishery product being processed in the absence of those controls. (b) The HACCP plan. Every...
Collimator Selection in Nuclear Medicine Imaging Using I-123 Generated by Te-124 Reaction
International Nuclear Information System (INIS)
Kim, Hee Joung; Son, Hye Kyung; Nam, Ki Pyo; Lee, Hee Kyung; Bong, Joung Kyun
1996-01-01
In the case of I-123 from the Te-124(p,2n)reaction, the radionuclidic impurity is the high-energy gamma-emitting I-124, which interferes greatly with nuclear medicine images. The choice of a collimator can affect the quality of clinical SPECT images of [I-123]MIBG, [I-123]μ-CIT, or [I-123]IPT. The tradeoffs that two different collimators make among spatial resolution, sensitivity, and scatter were studied by imaging a line source at 5 cm, 10 cm, 15 cm distance using a number of plexiglass sheets between source and collimator, petridish, two-dimensional Hoffman brain phantom, Jaszczak phantom, and three-dimensional Hoffman brain phantom after filling with I-123. (FWHM, FWTM, Sensitivity) for low-energy ultrahigh-resolution parallel-hole(LEUHRP) collimator and medium-energy general-purpose(MEGP) collimator were measured as (9.27 mm, 61.27 mm, 129 CPM/μCi) and (10.53 mm, 23.17 mm, 105CPM/μ/Ci), respectively. The image quality of two-dimensional Hoffman brain phantom with LEUHRP looked better than the one with MEGP. However, the image quality of Jaszczak phantom and three-dimensional Hoffman brain phantom with LEUHRP looked much worse than the one with MEGP because of scatter contributions in three-dimensional imaging situation. The results suggest that the MEGP is preferable to LEUHRP for three-dimensional imaging studies of [I-123]MIBG, [I-123] β-CIT, or [I-123] IPT.
41 CFR 101-4.120 - Transfers of property.
2010-07-01
... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 101-4.120 Transfers... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Transfers of property. 101-4.120 Section 101-4.120 Public Contracts and Property Management Federal Property Management...
13 CFR 120.1055 - Review and examination results.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Review and examination results. 120.1055 Section 120.1055 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Risk-Based Lender Oversight Supervision § 120.1055 Review and examination results. (a) Written Reports...
13 CFR 120.176 - Compliance with other laws.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Compliance with other laws. 120.176 Section 120.176 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Applying to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.176...
13 CFR 120.611 - Pools backing Pool Certificates.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Pools backing Pool Certificates. 120.611 Section 120.611 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Certificates § 120.611 Pools backing Pool Certificates. (a) Pool characteristics. As set...
13 CFR 120.1000 - Risk-Based Lender Oversight.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Risk-Based Lender Oversight. 120.1000 Section 120.1000 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Risk-Based Lender Oversight Supervision § 120.1000 Risk-Based Lender Oversight. (a) Risk-Based Lender...
Energy Technology Data Exchange (ETDEWEB)
Pessoa, Pinheiro M.C.; Xavier, Salles S.; Lima, Souza Leao R.; Mansur, J.; Almeida, Altino S. de; Carvalho, Pires A.C.; Gutfilen, B.; Fonseca, Barbosa L.M. da [Hospital Univ. Clementino Fraga Filho, Univ. Federal do Rio de Janeiro (Brazil). Dept. de Radiologia
2006-12-15
Purpose: To evaluate the role of cardiac sympathetic innervation in patients whose clinical features consisted of chest pain, transient ST-segment elevation, left ventricular apical akinesis, minimal elevation of cardiac enzymes, and onset of symptoms shortly after a severe stress condition. Material and Methods: Five female patients, mean age 67{+-}14 years, underwent thoracic {sup 123}I-MIBG (planar and SPECT) and 67Ga citrate (planar) scans within 5 days after the onset of symptoms. The {sup 123}I-MIBG myocardial washout rate between early (30 min) and delayed (3 hours) planar images was calculated. All patients presented findings consistent with takotsubo-like syndrome. Echocardiograms showed the characteristic wall motion pattern of significant apical dysfunction. Acute-phase coronary angiographies revealed a non-obstructive pattern. A peculiar apical akinesis and basal normokinesis were observed on the ventriculograms. Results: Impairment of cardiac neuronal uptake of {sup 123}I-MIBG based on a reduction of the heart-to-mediastinum uptake ratio was observed in all patients, while the washout rate was raised in four patients. All patients presented an apical uptake defect in the {sup 123}I-MIBG SPECT and planar images and a normal 67Ga scintigraphy. Conclusion: Our data indicate that ampulla cardiomyopathy (AC) is associated with a cardiac sympathetic innervation deficit characterized by a reduced global {sup 123}I-MIBG uptake and an apical uptake defect. The lack of 67Ga uptake in the acute phase of this syndrome indicates that AC is probably not associated with an inflammatory process.
123 I production using CV-28 cyclotron from IPEN-CNEN/SP
International Nuclear Information System (INIS)
Mestnik, S.A.C.; Mengatti, J.; Nieto, W.; Yanagawa, S.I.; Sumiya, L.C.A.; Silva, C.P.G.; Osso Junior, J.A.
1992-01-01
The main conditions for iodine 123 production by 124 Te (p,2 n) 123 I reaction were presented, using the cyclotron CV-28 at IPEN-CNEN/SP, with protons of E max = 24 MeV. Two types of targets (Te O 2 and Te O 2 + 2% Al 2 O 3 ) and the influence of Al 2 O 3 in iodine release were studied. After the selection, the 124 Te O 2 (96,2%) target, was melted in platinum support and irradiated with proton current until 12 mu A. The separation of 123 I was made by dry distillation, using induction furnace and O 2 atmosphere. (C.G.C.)
21 CFR 120.7 - Hazard analysis.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Hazard analysis. 120.7 Section 120.7 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... hazards. The written hazard analysis shall consist of at least the following: (1) Identification of food...
A Mobile Sensor Network to Map CO2 in Urban Environments
Lee, J.; Christen, A.; Nesic, Z.; Ketler, R.
2014-12-01
Globally, an estimated 80% of all fuel-based CO2 emissions into the atmosphere are attributable to cities, but there is still a lack of tools to map, visualize and monitor emissions to the scales at which emissions reduction strategies can be implemented - the local and urban scale. Mobile CO2 sensors, such as those attached to taxis and other existing mobile platforms, may be a promising way to observe and map CO2 mixing ratios across heterogenous urban environments with a limited number of sensors. Emerging modular open source technologies, and inexpensive compact sensor components not only enable rapid prototyping and replication, but also are allowing for the miniaturization and mobilization of traditionally fixed sensor networks. We aim to optimize the methods and technologies for monitoring CO2 in cities using a network of CO2 sensors deployable on vehicles and bikes. Our sensor technology is contained in a compact weather-proof case (35.8cm x 27.8cm x 11.8cm), powered independently by battery or by car, and includes the Li-Cor Li-820 infrared gas analyzer (Licor Inc, lincoln, NB, USA), Arduino Mega microcontroller (Arduino CC, Italy) and Adafruit GPS (Adafruit Technologies, NY, USA), and digital air temperature thermometer which measure CO2 mixing ratios (ppm), geolocation and speed, pressure and temperature, respectively at 1-second intervals. With the deployment of our sensor technology, we will determine if such a semi-autonomous mobile approach to monitoring CO2 in cities can determine excess urban CO2 mixing ratios (i.e. the 'urban CO2 dome') when compared to values measured at a fixed, remote background site. We present results from a pilot study in Vancouver, BC, where the a network of our new sensors was deployed both in fixed network and in a mobile campaign and examine the spatial biases of the two methods.
19 CFR 123.63 - Examination of baggage from Canada or Mexico.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination of baggage from Canada or Mexico. 123...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Baggage § 123.63 Examination of baggage from Canada or Mexico. (a) Opening vehicle or compartment to examine baggage. Customs officers are...
13 CFR 120.1005 - Bureau of PCLP Oversight.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Bureau of PCLP Oversight. 120.1005 Section 120.1005 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Risk-Based Lender Oversight Supervision § 120.1005 Bureau of PCLP Oversight. SBA's Bureau of PCLP Oversight within...
13 CFR 120.1709 - Transfers of Pool Certificates.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Transfers of Pool Certificates. 120.1709 Section 120.1709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1709...
13 CFR 120.1707 - Seller's retained Loan Interest.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's retained Loan Interest. 120.1707 Section 120.1707 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1707 Seller...
13 CFR 120.1714 - Seller's Pool Loan servicing.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan servicing. 120.1714 Section 120.1714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1714 Seller...
13 CFR 120.1715 - Seller's Pool Loan liquidation.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan liquidation. 120.1715 Section 120.1715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1715 Seller...
13 CFR 120.1713 - Seller's Pool Loan origination.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan origination. 120.1713 Section 120.1713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1713 Seller...
13 CFR 120.1717 - Seller's Pool Loan deferments.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan deferments. 120.1717 Section 120.1717 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1717 Seller...
32 CFR 724.120 - National Capital Region (NCR).
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false National Capital Region (NCR). 724.120 Section 724.120 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.120 National Capital Region (NCR). The District of Columbia; Prince...
Recent developments in melt processed Gd-123 and MgB2 materials at RTRI
International Nuclear Information System (INIS)
Muralidhar, M.; Fukumoto, Y.; Ishihara, A.; Suzuki, K.; Tomita, M.; Koblischka, M.R.; Yamamoto, A.; Kishio, K.
2014-01-01
Highlights: •Large size Gd-123 bulk material grown in air, using novel thin film Nd-123 seeds grown on MgO crystals. •Quality and uniformity of the Gd-123 materials are excellent. •Batch processed Gd-123 material was used for construction of chilled Maglev vehicle. •MgB 2 bulks can be utilized around 20 K similarly to the Gd-123 material at 77 K. -- Abstract: In this contribution we will report on the current status, recent developments in GdBa 2 Cu 3 O y “Gd-123” and MgB 2 material processing, characterization, and applications at the Railway Technical Research Institute (RTRI). Batch-processing of Gd-123 bulk material grown in air was performed using novel thin film Nd-123 seeds grown on MgO crystals. In this way, we are able to fabricate materials with good quality, and uniform performance. We examined the technology of the uniform performance of the large 45 mm diameter, single grain Gd-123 bulks for use in application of NMR. For this purpose, four 5 mm thick pieces are cut vertically from a single grain Gd-123 material and the magnetic field distribution is measured using a scanning hall sensor. We found that all four pieces are single domain and exhibit a quite uniform field distribution. Furthermore, the batch-processed bulk materials are used for the construction of a chilled Maglev vehicle. On the other hand, to optimize the trapped field performance of bulk MgB 2 material, several samples were prepared by solid state reaction at different temperatures ranging from 750 to 950 °C in pure argon atmosphere. X-ray diffraction results indicated that single phase and homogenous MgB 2 bulks are produced when sintering them around 775 °C. Further, atomic force microscopy (AFM) and scanning electron microscopy (SEM) indicated that an uniform grain size results by controlling the processing temperature. So, higher trapped fields can be achieved in sintered MgB 2 material
Serial lung imaging with /sup 123/I-IMP in localized pulmonary lesions
Energy Technology Data Exchange (ETDEWEB)
Nakajo, Masayuki; Shimada, Jurio; Shimozono, Michiko; Uchiyama, Noriaki; Hiraki, Yoshiyuki; Shinohara, Shinji.
1988-05-01
/sup 123/I-IMP (N-isopropyl-p-(/sup 123/I)-iodoamphetamine) dynamic (1 frame/min for 25 mins), 30-min and 4-hr static lung imaging was performed in a total of 65 patients with roentgenographic evidence of localized pulmonary lesion (12 with pneumonia, one with lung abscess, 5 with pulmonary tuberculosis, 3 with pneumoconiosis, one with lung fluke disease and 43 with various histological types of primary lung cancer). The findings in 65 of 70 (95 %) lesions in the initial 1 or 2-min dynamic /sup 123/I-IMP images were analogous to those obtained by /sup 99m/Tc-MAA lung perfusion imaging and decreased activity was observed in 68 of 70 (97 %) lesions, suggesting that the initial images mainly reflected the relative distribution of pulmonary arterial blood flow. However, /sup 123/I-IMP accumulated differently according to the pathological conditions afterwards. Decrease activity from /sup 123/I-IMP was contineously observed in a cavity of the lung abscess, 2 of 2 tuberculomas, 3 of 7 large nodules of pneumoconiosis and all of the 42 cancerous lesions which were possible to be evaluated. Gradual increased in activity relative to that of ''normal lung fields'' was observed in all 14 lesions of pneumonia; pneumonic lesions of the lung abscess, tuberculosis and lung fluke disease; 4 of 7 large nodules of pneumoconiosis; all of 8 atelectatic lesions and 32 of 44 areas surrounding cancers (most of them had roentgenographic evidence of infiltrating shadows). Thus /sup 123/I-IMP accumulated increasingly in pneumonic and atelectatic lesions, while it appeared not to accumulate in such lesions replacing lung tissues as cavity, caseous and fibrous lesions and primary lung cancers. /sup 123/I-IMP can be used as a new lung imaging agent to provide diagnostic informations on the property of pulmonary lesions.
[sup 123]I-IMP SPECT studies in schizophrenia and atypical psychosis
Energy Technology Data Exchange (ETDEWEB)
Hayashi, Takuji; Suga, Hidemichi (Aichi Medical University, Nagakute (Japan))
1993-05-01
According to the classification of Mitsuda, 23 patients with endogenous psychosis aged 40 years or younger, presenting with hallucination and delusion, were classified as having schizophrenia (n=12) or atypical psychosis (n=11). These patients were studied by single photon emission computed tomography (SPECT) with N-isopropyl-p-I-123-iodoamphetamine (I-123 IMP). Sixteen healthy persons served as controls. Early and delayed SPECT images were obtained 30 min and 4 hr, respectively, after intravenous injection of I-123 IMP. The group of schizophrenic patients had markedly decreased uptake of I-123 in the basal ganglia, as well as the right temporal and left occipital areas on both early and delayed images. In the group of atypical psychosis patients, however, decreased uptake of I-123 was noted in both the right basal ganglia and left occipital area on early images, but none of such findings were seen on delayed images. Regarding the uptake ratio in the frontal area on both early and delayed images, there were significant differences between the two groups. These findings have important implications for the different etiology of both disease types: not only functional disturbance in the frontal area but also irreversible changes may be involved in the occurrence of schizophrenia, and functional disturbance particularly in the right basal ganglia may be involved in the occurrence of atypical psychosis. (N.K.).
Online social network use by health care providers in a high traffic patient care environment.
Black, Erik; Light, Jennifer; Paradise Black, Nicole; Thompson, Lindsay
2013-05-17
The majority of workers, regardless of age or occupational status, report engaging in personal Internet use in the workplace. There is little understanding of the impact that personal Internet use may have on patient care in acute clinical settings. The objective of this study was to investigate the volume of one form of personal Internet use-online social networking (Facebook)-generated by workstations in the emergency department (ED) in contrast to measures of clinical volume and severity. The research team analyzed anonymous network utilization records for 68 workstations located in the emergency medicine department within one academic medical center for 15 consecutive days (12/29/2009 to 1/12/2010). This data was compared to ED work index (EDWIN) data derived by the hospital information systems. Health care workers spent an accumulated 4349 minutes (72.5 hours) browsing Facebook, staff cumulatively visited Facebook 9369 times and spent, on average, 12.0 minutes per hour browsing Facebook. There was a statistically significant difference in the time spent on Facebook according to time of day (19.8 minutes per hour versus 4.3 minutes per hour, P<.001). There was a significant, positive correlation between EDWIN scores and time spent on Facebook (r=.266, P<.001). Facebook use constituted a substantive percentage of staff time during the 15-day observation period. Facebook use increased with increased patient volume and severity within the ED.