WorldWideScience

Sample records for nancy mckenzie dupont

  1. Inspirations from Dupont Safety Management System

    Institute of Scientific and Technical Information of China (English)

    Ma Yong

    2009-01-01

    @@ Dupont,with its 200 years of safety management experience,tells us:all safety accidents can be prevented. Dupont has a history of more than 200 years,the concept of "safety is priority"has never changed.Dupont is just another word for safety.

  2. Instant Nancy web development

    CERN Document Server

    Horsdal, Christian

    2013-01-01

    Filled with practical, step-by-step instructions and clear explanations for the most important and useful tasks.A practical, step-by-step guide featuring recipes that will get you up and running quickly with Nancy.A practical, step-by-step guide featuring recipes that will get you up and running quickly with Nancy.If you are a .NET oriented web developer who is curious to find out what lies beyond the Microsoft provided frameworks, then this book is for you! It's beneficial to have a good knowledge of C# and .NET, as well as a basic working knowledge of HTTP. If testability is important to you

  3. DuPont Chemical Vapor Technical Report

    International Nuclear Information System (INIS)

    MOORE, T.L.

    2003-01-01

    DuPont Safety Resources was tasked with reviewing the current chemical vapor control practices and providing preventive recommendations on best commercial techniques to control worker exposures. The increased focus of the tank closure project to meet the 2024 Tri-Party Agreement (TPA) milestones has surfaced concerns among some CH2MHill employees and other interested parties. CH2MHill is committed to providing a safe working environment for employees and desires to safely manage the tank farm operations using appropriate control measures. To address worker concerns, CH2MHill has chartered a ''Chemical Vapors Project'' to integrate the activities of multiple CH2MHill project teams, and solicit the expertise of external resources, including an independent Industrial Hygiene expert panel, a communications consultant, and DuPont Safety Resources. Over a three-month time period, DuPont worked with CH2MHill ESH and Q, Industrial Hygiene, Engineering, and the independent expert panel to perform the assessment. The process included overview presentations, formal interviews, informal discussions, documentation review, and literature review. DuPont Safety Resources concluded that it is highly unlikely that workers in the tank farms are exposed to chemicals above established standards. Additionally, the conventional and radiological chemistry is understood, the inherent chemical hazards are known, and the risk associated with chemical vapor exposure is properly managed. The assessment highlighted management's commitment to addressing chemical vapor hazards and controlling the associated risks. Additionally, we found the Industrial Hygiene staff to be technically competent and well motivated. The tank characterization data resides in a comprehensive database containing the tank chemical compositions and relevant airborne concentrations

  4. Nancy Kassebaum: Education's New Voice.

    Science.gov (United States)

    Penning, Nick

    1989-01-01

    U.S. Senator Nancy Kassebaum has become the leading Republican advocate for education. She shares AASA's support for the Head Start program, but is skeptical about financing a federal day care program. She also supports latchkey, intergenerational, and vocational/technical programs, and favors community volunteering over a national youth service…

  5. McKenzie River Subbasin Assessment, Summary Report 2000.

    Energy Technology Data Exchange (ETDEWEB)

    Alsea Geospatial, Inc.

    2000-02-01

    This document summarizes the findings of the McKenzie River Subbasin Assessment: Technical Report. The subbasin assessment tells a story about the McKenzie River watershed. What is the McKenzie's ecological history, how is the McKenzie doing today, and where is the McKenzie watershed headed ecologically? Knowledge is a good foundation for action. The more we know, the better prepared we are to make decisions about the future. These decisions involve both protecting good remaining habitat and repairing some of the parts that are broken in the McKenzie River watershed. The subbasin assessment is the foundation for conservation strategy and actions. It provides a detailed ecological assessment of the lower McKenzie River and floodplain, identifies conservation and restoration opportunities, and discusses the influence of some upstream actions and processes on the study area. The assessment identifies restoration opportunities at the reach level. In this study, a reach is a river segment from 0.7 to 2.7 miles long and is defined by changes in land forms, land use, stream junctions, and/or cultural features. The assessment also provides flexible tools for setting priorities and planning projects. The goal of this summary is to clearly and concisely extract the key issues, findings, and recommendations from the full-length Technical Report. The high priority recommended action items highlight areas that the McKenzie Watershed Council can significantly influence, and that will likely yield the greatest ecological benefit. People are encouraged to read the full Technical Report if they are interested in the detailed methods, findings, and references used in this study.

  6. McKenzie River Subbasin Assessment, Technical Report 2000.

    Energy Technology Data Exchange (ETDEWEB)

    Alsea Geospatial, Inc.

    2000-02-01

    This document details the findings of the McKenzie River Subbasin Assessment team. The goal of the subbasin assessment is to provide an ecological assessment of the McKenzie River Floodplain, identification of conservation and restoration opportunities, and discussion of the influence of some upstream actions and processes. This Technical Report can be viewed in conjunction with the McKenzie River Subbasin Summary or as a stand-alone document. The purpose of the technical report is to detail the methodology and findings of the consulting team that the observations and recommendations in the summary document are based on. This part, Part I, provides an introduction to the subbasin and a general overview. Part II details the specific findings of the science team. Part III provides an explanation and examples of how to use the data that has been developed through this assessment to aid in prioritizing restoration activities. Part III also includes the literature cited and appendices.

  7. McKenzie River Focus Watershed Coordination: Fiscal Year 1998.

    Energy Technology Data Exchange (ETDEWEB)

    Runyon, John; Davis-Born, Renee

    1998-01-01

    This report summarizes accomplishments made by the McKenzie River Focus Watershed Council in the areas of coordination and administration during Fiscal Year 1998. Coordination and administration consists of tasks associated with Focus Watershed Council staffing, project management, and public outreach.

  8. Weyerhaeuser Export Facility at DuPont. Volume I.

    Science.gov (United States)

    1982-05-01

    exists on the DuPont site, in which the most common trees are lodgepole pine ( Pinus contorta) and western hemlock (Tsuga heterophtlla). Bog birch (Betula...Weyerhaeuser production facilities and storage at the proposed export facility. Tropolone methyl ethers have also been mentioned as potential contam

  9. Nancy McCormick Rambusch: A Reflection

    Science.gov (United States)

    Povell, Phyllis

    2005-01-01

    Fall of 2005 marks the 12th anniversary of Nancy McCormick Rambusch's death. As the founder of the American Montessori Society and as its first president, Rambusch reintroduced Maria Montessori to America at a time--1960--when education for the young was floundering, and a second look at the Montessori method, which had changed the early childhood…

  10. Comments on Nancy Snow, "Generativity and Flourishing"

    Science.gov (United States)

    Kamtekar, Rachana

    2015-01-01

    In her rich and wide-ranging paper, Nancy Snow argues that there is a virtue of generativity--an other-regarding desire to invest one's substance in forms of life and work that will outlive the self (p. 10). By "virtue" Snow means not just a desirable or praiseworthy quality of a person, but more precisely, as Aristotle defined it, a…

  11. The effects of McKenzie and Brunkow exercise program on spinal mobility comparative study

    Directory of Open Access Journals (Sweden)

    Emela Mujić Skikić

    2004-02-01

    Full Text Available This study encompassed 64 participants with symptoms of low back pain, 33 in McKenzie group and 31 in Brunkow group. Patients attended exercise program daily and they were asked to do the same exercise at home--five times a day in series of 5 to 10 repetition each time, depending of stage of disease and pain intensity. All patients were assessed for the spinal motion, before and after the treatment. All parameters for spinal movements showed improvement after exercising McKenzie program for lower back pain with a significant difference of p<0.01 for all motions. Also, in Brunkow group, all of the parameters showed statistically significant improvement at the end of treatment in relation to pre-treatment values, with significant difference of p<0.01 for all motions. Statistically comparison between McKenzie and Brunkow difference in score at the end of the treatment showed statistically significant improvement in McKenzie group, for extension, right and left side flexion, while flexion score didn't show statistically significant difference. McKenzie exercises seemed to be more effective than Brunkow exercises for improvement in spinal motion. Both, McKenzie and Brunkow exercises can be used for spinal mobility improvement in patients with lower back pain, but is preferable to use McKenzie exercises first, to decrease the pain and increase spinal mobility, and then Brunkow exercises to strengthen the paravertebral muscles.

  12. 2016 Oregon Department of Geology and Mineral Industries (DOGAMI) Oregon Lidar: McKenzie River

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Quantum Spatial collected Light Detection and Ranging (LiDAR) data for the Oregon LiDAR Consortium (OLC) McKenzie River study area. This study area is located near...

  13. 2016 Oregon Department of Geology and Mineral Industries (DOGAMI) Oregon Lidar DEM: McKenzie River

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Quantum Spatial collected Light Detection and Ranging (LiDAR) data for the Oregon LiDAR Consortium (OLC) McKenzie River study area. This study area is located near...

  14. Nancy Rivard. The color of love.

    Science.gov (United States)

    2002-12-01

    Nancy Rivard's personal journey to be a part of something bigger than herself resulted in the founding of Airline Ambassadors International (AAI). As a flight attendant for American Airlines, she enrolled the industry through a large-scale volunteer effort and established Airline Ambassadors, whose programs have delivered school supplies, food, medicine, and medical supplies to upwards of 100,000 children in 25 nations.

  15. Marion duPont Scott Equine Medical Center uses innovative lameness treatment

    OpenAIRE

    Lee, Kate

    2009-01-01

    Virginia Tech's Marion duPont Scott Equine Medical Center is now offering an equine lameness therapy that prevents further degeneration of the affected joint and offers a longer-lasting benefit than traditional steroid treatment.

  16. DuPont IsoTherming clean fuel technology

    Energy Technology Data Exchange (ETDEWEB)

    Levinski, E. [E.I. DuPont Co., Wilmington, DE (United States)

    2009-07-01

    This poster described a hydroprocessing technology that DuPont has acquired from Process Dynamics, Inc. The IsoTherming clean fuel technology significantly reduces sulphur in motor fuels. The technology provides petroleum refiners the solution for meeting ultra low sulphur diesel requirements, at much lower costs than conventional technologies. IsoTherming hydroprocessing operates in a kinetically limited mode, with no mass transfer limitation. Hydrogen is delivered to the reactor in the liquid phase as soluble hydrogen, allowing for much higher space velocities than conventional hydrotreating reactors. Treated diesel is recycled back to the inlet of the reactor, generating less heat and more hydrogen into the reactor. The process results in a more isothermal reactor operation that allows for better yields, fewer light ends and greater catalyst life. The technology reduces coking, because the process provides enough hydrogen in the solution when cracking reactions take place. As a result, the process yields longer catalyst life. Other advantages for refiners include lower total investment; reduced equipment delivery lead times; reduced maintenance and operating costs; and configuration flexibility. tabs., figs.

  17. NOAA Ship Nancy Foster Underway Meteorological Data, Near Real Time

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Nancy Foster Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System (SAMOS)...

  18. NOAA Ship Nancy Foster Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Nancy Foster Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic System...

  19. McKenzie Classification of Extremity Lesions - An audit of primary care patients in 3 clinics

    DEFF Research Database (Denmark)

    Melbye, Martin

    2007-01-01

    Syndrome classification based on mechanical testing guides clinical decision making in conservative musculoskeletal care. The aim of this audit was to investigate how many patients presenting with problems in the extremities could be classified into the mechanical syndromes described by Robin Mc...... ranged from 4,5 to 6 years. The mechanical classification  determined by the therapists,  and was recorded on the first three visits. Mechanical classification was based on strict operational definitions. Assessment sheets were collected from each therapist, to determine their adherence...... to the operational definitions. 135 consecutive patients were included over an 18 months period and 28 patients were excluded. Of  the 107 patients with extremity joint problems, 73% were classified into one of McKenzie's mechanical syndromes by therapists trained in the McKenzie method. 34% of patients were...

  20. McKenzie River focus watershed coordination: year-end report, 2001; ANNUAL

    International Nuclear Information System (INIS)

    Thrailkil, Jim

    2001-01-01

    BPA funding, in conjunction with contributions from numerous partners organizations, supports the McKenzie Watershed Council's efforts to coordinate restoration and monitoring programs of federal, state, local government, and residents within the watershed. The goal of the MWC is to improve resource stewardship and conserve fish, wildlife, and water quality resources. The MWC will always have a baseline program centered on relationship building and information sharing. Objectives for FY01 included: (1) Continue to coordinate McKenzie Watershed activities among diverse groups that restore fish and wildlife habitat in the watershed, with a focus on the lower McKenzie, including private lands and the McKenzie-Willamette confluence area; (2) Influence behavior of watershed residents to benefit watershed function though a strategic and comprehensive outreach and education program, utilizing Assessment and Conservation Strategy information to provide a context for prioritized action; (3) Continue to maintain and sustain a highly functional watershed council; (4) Maintain and improve water quality concerns through the continuation of Council-sponsored monitoring and evaluation programs; and (5) Continue to secure other funding for watershed restoration and protection projects and Council operations

  1. McKenzie River Watershed Coordination, Annual Report 2001-2002.

    Energy Technology Data Exchange (ETDEWEB)

    Thrailkil, Jim

    2003-11-01

    BPA funding, in conjunction with contributions from numerous partners organizations and grant funds supports the McKenzie Watershed Council's (MWC) efforts to coordinate restoration and monitoring programs of federal, state, local government, and residents within the watershed. Primary goals of the MWC are to improve resource stewardship and conserve fish, wildlife, and water quality resources. Underpinning the goals is the MWC's baseline program centered on relationship building and information sharing. Objectives for FY02 included: (1) Continue to coordinate McKenzie Watershed activities among diverse groups to restore fish and wildlife habitat in the watershed, with a focus on the middle to lower McKenzie, including private lands and the McKenzie-Willamette confluence area; (2) Influence behavior of watershed residents to benefit watershed function though an outreach and education program, utilizing (BPA funded) Assessment and Conservation Strategy information to provide a context for prioritized action; (3) Continue to maintain and sustain a highly functional watershed council; (4) Maintain and improve water quality concerns through the continuation of Council-sponsored monitoring and evaluation programs; and (5) Continue to secure other funding for watershed restoration and protection projects and Council operations.

  2. McKenzie River Focus Watershed Coordination: Year-End Report 2000.

    Energy Technology Data Exchange (ETDEWEB)

    Thrailkil, Jim

    2000-01-01

    This report summarizes accomplishments of the McKenzie River Focus Watershed Council (MWC) in the areas of coordination and administration during Fiscal Year 2000. Coordination and administration consist of prioritization and planning for projects; project management and implementation; procurement of funding for long-term support of the Council; and watershed education/outreach program for residents and local schools. Key accomplishments in the area of project planning include coordinating: monthly Council and executive committee meetings; staffing the Upper Willamette Spring Chinook Working Group; staffing the water quality technical committee; and guiding education and stewardship projects. Key accomplishments in the area of project management include the completion of the McKenzie-Willamette Confluence Assessment; securing funds for project planning in the confluence area; near completion of the BPA funded McKenzie sub-basin assessment; development of a framework for a McKenzie Watershed Conservation Strategy; an evaluation of Council's monitoring programs - ambient water quality, storm-event water quality, Tier III water quality, and macroinvertebrate monitoring. The Council, in cooperation with the McKenzie River Cooperative, completed habitat enhancements in the Gate Creek and Deer Creek sub-watersheds. This partnership recently submitted Bring Back the Natives grant for initiation of projects in other McKenzie tributaries. The Council will also be working with a local business to develop a river-side riparian enhancement and native landscaping project on the lodge grounds. This will serve as a demonstration project for blending fish and wildlife habitat concerns with maintaining grounds for business opportunities. Accomplishments in the area of procurement of funding included developing the FY2000 Scope of Work and budget for approval by the Council and BPA; providing quarterly budget and work program progress reports to the Council; and securing

  3. Development of an Environmental Flow Framework for the McKenzie River Basin, Oregon

    Science.gov (United States)

    Risley, John; Wallick, J. Rose; Waite, Ian; Stonewall, Adam J.

    2010-01-01

    The McKenzie River is a tributary to the Willamette River in northwestern Oregon. The McKenzie River is approximately 90 miles in length and has a drainage area of approximately 1,300 square miles. Two major flood control dams, a hydropower dam complex, and two hydropower canals significantly alter streamflows in the river. The structures reduce the magnitude and frequency of large and small floods while increasing the annual 7-day minimum streamflows. Stream temperatures also have been altered by the dams and other anthropogenic factors, such as the removal of riparian vegetation and channel simplification. Flow releases from one of the flood control dams are cooler in the summer and warmer in the fall in comparison to unregulated flow conditions before the dam was constructed. In 2006, the Oregon Department of Environmental Quality listed a total of 112.4, 6.3, and 55.7 miles of the McKenzie River basin mainstem and tributary stream reaches as thermally impaired for salmonid rearing, salmonid spawning, and bull trout, respectively. The analyses in this report, along with previous studies, indicate that dams have altered downstream channel morphology and ecologic communities. In addition to reducing the magnitude and frequency of floods, dams have diminished sediment transport by trapping bed material. Other anthropogenic factors, such as bank stabilization, highway construction, and reductions of in-channel wood, also have contributed to the loss of riparian habitat. A comparison of aerial photography taken in 1939 and 2005 showed substantial decreases in secondary channels, gravel bars, and channel sinuosity, particularly along the lower alluvial reaches of the McKenzie River. In addition, bed armoring and incision may contribute to habitat degradation, although further study is needed to determine the extent of these processes. Peak streamflow reduction has led to vegetation colonization and stabilization of formerly active bar surfaces. The large flood control

  4. Evaluating Bank Profitability in Ghana: A five step Du-Pont Model Approach

    Directory of Open Access Journals (Sweden)

    Baah Aye Kusi

    2015-09-01

    Full Text Available We investigate bank profitability in Ghana using periods before, during and after the globe financial crises with the five step du-pont model for the first time.We adapt the variable of the five step du-pont model to explain bank profitability with a panel data of twenty-five banks in Ghana from 2006 to 2012. To ensure meaningful generalization robust errors fixed and random effects models are used.Our empirical results suggests that bank operating activities (operating profit margin, bank efficiency (asset turnover, bank leverage (asset to equity and financing cost (interest burden  were positive and significant determinants of bank profitability (ROE during the period of study implying that bank in Ghana can boost return to equity holders through the above mentioned variables. We further report that the five step du-pont model better explains the total variation (94% in bank profitability in Ghana as compared to earlier findings suggesting that bank specific variables are keen in explaining ROE in banks in Ghana.We cited no empirical study that has employed five step du-pont model making our study unique and different from earlier studies as we assert that bank specific variables are core to explaining bank profitability.                

  5. Marion duPont Scott Equine Medical Center offers new treatment for lameness

    OpenAIRE

    Musick, Marjorie

    2006-01-01

    The Virginia-Maryland Regional College of Veterinary Medicine's Marion duPont Scott Equine Medical Center has begun offering a new therapy for treating lameness associated with osteoarthritis and cartilage damage in horses, a problem that affects all segments of the equine industry.

  6. Award for Distinguished Scientific Applications of Psychology: Nancy E. Adler

    Science.gov (United States)

    American Psychologist, 2009

    2009-01-01

    Nancy E. Adler, winner of the Award for Distinguished Scientific Applications of Psychology, is cited for her research on reproductive health examining adolescent decision making with regard to contraception, conscious and preconscious motivations for pregnancy, and perception of risk for sexually transmitted diseases, and for her groundbreaking…

  7. Investigating the effect of adjusted DuPont ratio and its components on investor's decisions in short and long term

    Directory of Open Access Journals (Sweden)

    Parvaneh Khaleghi Kasbi

    2014-03-01

    Full Text Available This paper investigates the effect of adjusted DuPont ratio and its components on investors’ decisions in short and long term. The primary objective of this study is to find the effect of adjusted DuPont ratio and its components on herding behavior of investors in one and several year period. Hence, 85 corporations as the member of Tehran stock exchange over the period 2006-2011 are selected. In order to recognize the herding, by market index consideration, the herded β and in order to hypothesis validity SPSS software and multivariable linear regression have been used. As the results of this study indicate, the adjusted DuPont ratio and its components have more effect on investors’ decisions in short term but in long the period, the effect of this ratio on herding investors’ behavior are reduced. Furthermore, from the two components of adjusted DuPont ratio, profit margin has more effect on investor's decisions.

  8. The DuPont Conference: Implications for the Chemical Technology Curriculum

    Science.gov (United States)

    Kenkel, John; Rutledge, Sue; Kelter, Paul B.

    1998-05-01

    Southeast Community College (SCC) hosted the first DuPont Conference for Chemical Technology Education at its Lincoln, Nebraska campus October 4-6, 1997. The conference brought together fourteen practicing chemists and chemistry technicians and five college and university faculty members for the express purpose of suggesting new laboratory activities that would help relate the real world of work to the education of chemical laboratory technicians in community colleges. Participants included seven men and seven women from DuPont, Procter & Gamble, Eastman Chemical, Eastman Kodak, Dow Chemical, Air Products and Chemicals, Monsanto, Union Carbide, the Nebraska Agriculture Laboratory, and the University of Nebraska Biological Process Development Facility, Department of Food Science. The conference, sponsored by the E. I. DuPont DeNemours & Company through a grant awarded to SCC in June 1997, was intended to help further the goals of the two major projects underway at SCC, funded by the National Science Foundation's Advanced Technological Education Program. These projects, dubbed "Assignment: Chemical Technology I and II", or ACT-I and ACT-II, are curriculum and materials development projects. The invited scientists had between 2 and 32 years of experience that ranged from bench work to management levels. Many are or have been active on the national scene as members and officers of the American Chemical Society's Division of Chemical Technicians and the ACS Committee on Technician Activities.

  9. Reconnaissance of land-use sources of pesticides in drinking water, McKenzie River, Oregon

    Science.gov (United States)

    Kelly, Valerie J.; Anderson, Chauncey W.; Morgenstern, Karl

    2012-01-01

    The Eugene Water and Electric Board (EWEB) provides water and electricity to the City of Eugene, Oregon, from the McKenzie River. In the spring of 2002, EWEB initiated a pesticide monitoring program in cooperation with the U.S. Geological Survey as part of their Drinking Water Source Protection Plan. Approximately twice yearly pesticide samples were collected from 2002 to 2010 at a suite of sampling sites representing varying land uses in the lower McKenzie River basin. A total of 117 ambient samples were collected from 28 tributary and mainstem sites, including those dominated by forestry, urban, and agricultural activities, as well as the mouths of major tributaries characterized by a mixture of upstream land use. Constituents tested included 175 compounds in filtered water (72 herbicides, 43 insecticides, 10 fungicides, and 36 of their degradation products, as well as 14 pharmaceutical compounds). No attempt was made to sample different site types equivalently; sampling was instead designed primarily to characterize representative storm events during spring and fall runoff conditions in order to assess or confirm the perceived importance of the different site types as sources for pesticides. Sampling was especially limited for agricultural sites, which were only sampled during two spring storm surveys. A total of 43 compounds were detected at least once, with many of these detected only at low concentrations (urban stormwater drains. Urban sites also were associated with the highest concentrations, occasionally exceeding 1 microgram per liter. Many of the compounds detected at urban sites were relatively hydrophobic (do not mix easily with water), persistent, and suspected of endocrine disruption. In contrast, forestry compounds were rarely detectable in the McKenzie River, even though forest land predominates in the basin and forestry pesticide use was detected in small tributaries draining forested lands following application. Agricultural pesticide runoff was

  10. A simple method to predict regional fish abundance: an example in the McKenzie River Basin, Oregon

    Science.gov (United States)

    D.J. McGarvey; J.M. Johnston

    2011-01-01

    Regional assessments of fisheries resources are increasingly called for, but tools with which to perform them are limited. We present a simple method that can be used to estimate regional carrying capacity and apply it to the McKenzie River Basin, Oregon. First, we use a macroecological model to predict trout densities within small, medium, and large streams in the...

  11. Analysis of DuPont and Kodak duplicating films and chemistries in a Fultron spray processor

    Science.gov (United States)

    Weinstein, M. S.

    1972-01-01

    A test program was conducted with duPont duplicating film type SR 112 and SCOLOR developer and Kodak duplicating film types 2430, 2422, and FE 2628 (SO-467) and MX-641 developer to determine sensitometric and image quality characteristics of these materials when used with a fultron spray processor. The test results show that the SCOLOR developer foams excessively in the fultron processor when used with or without the addition of an antifoaming agent. The Kodak type FE 2628 film with MX-641 chemistry had the longest linear Log E range at a 1.0 gamma. Sensitometric curves and granularity traces for all film process combinations tested are included.

  12. A Decomposition of Hospital Profitability: An Application of DuPont Analysis to the US Market.

    Science.gov (United States)

    Turner, Jason; Broom, Kevin; Elliott, Michael; Lee, Jen-Fu

    2015-01-01

    This paper evaluates the drivers of profitability for a large sample of U.S. hospitals. Following a methodology frequently used by financial analysts, we use a DuPont analysis as a framework to evaluate the quality of earnings. By decomposing returns on equity (ROE) into profit margin, total asset turnover, and capital structure, the DuPont analysis reveals what drives overall profitability. Profit margin, the efficiency with which services are rendered (total asset turnover), and capital structure is calculated for 3,255 U.S. hospitals between 2007 and 2012 using data from the Centers for Medicare & Medicaid Services' Healthcare Cost Report Information System (CMS Form 2552). The sample is then stratified by ownership, size, system affiliation, teaching status, critical access designation, and urban or non-urban location. Those hospital characteristics and interaction terms are then regressed (OLS) against the ROE and the respective DuPont components. Sensitivity to regression methodology is also investigated using a seemingly unrelated regression. When the sample is stratified by hospital characteristics, the results indicate investor-owned hospitals have higher profit margins, higher efficiency, and are substantially more leveraged. Hospitals in systems are found to have higher ROE, margins, and efficiency but are associated with less leverage. In addition, a number of important and significant interactions between teaching status, ownership, location, critical access designation, and inclusion in a system are documented. Many of the significant relationships, most notably not-for-profit ownership, lose significance or are predominately associated with one interaction effect when interaction terms are introduced as explanatory variables. Results are not sensitive to the alternative methodology. The results of the DuPont analysis suggest that although there appears to be convergence in the behavior of NFP and IO hospitals, significant financial differences remain

  13. Comparative study on DuPont analysis and DEA models for measuring stock performance using financial ratio

    Science.gov (United States)

    Arsad, Roslah; Shaari, Siti Nabilah Mohd; Isa, Zaidi

    2017-11-01

    Determining stock performance using financial ratio is challenging for many investors and researchers. Financial ratio can indicate the strengths and weaknesses of a company's stock performance. There are five categories of financial ratios namely liquidity, efficiency, leverage, profitability and market ratios. It is important to interpret the ratio correctly for proper financial decision making. The purpose of this study is to compare the performance of listed companies in Bursa Malaysia using Data Envelopment Analysis (DEA) and DuPont analysis Models. The study is conducted in 2015 involving 116 consumer products companies listed in Bursa Malaysia. The estimation method of Data Envelopment Analysis computes the efficiency scores and ranks the companies accordingly. The Alirezaee and Afsharian's method of analysis based Charnes, Cooper and Rhodes (CCR) where Constant Return to Scale (CRS) is employed. The DuPont analysis is a traditional tool for measuring the operating performance of companies. In this study, DuPont analysis is used to evaluate three different aspects such as profitability, efficiency of assets utilization and financial leverage. Return on Equity (ROE) is also calculated in DuPont analysis. This study finds that both analysis models provide different rankings of the selected samples. Hypothesis testing based on Pearson's correlation, indicates that there is no correlation between rankings produced by DEA and DuPont analysis. The DEA ranking model proposed by Alirezaee and Asharian is unstable. The method cannot provide complete ranking because the values of Balance Index is equal and zero.

  14. The outside of phenomenology: Jean-Luc Nancy on world and sense

    African Journals Online (AJOL)

    In this essay, I examine Jean-Luc Nancy's notion of the sense of the world in relation to the phenomenological investigation of the life-world in Husserl and the worldhood of the world in Heidegger. My aim is to address the reasons why Nancy stresses the need for a different thinking that goes beyond the phenomenological ...

  15. For Dr. Nancy Snyderman's Parents, Staying Close to Family Is Key

    Science.gov (United States)

    ... to move closer to their daughter and her family, as part of the next chapter in their lives. Photo courtesy of Dr. Nancy Snyderman As Chief Medical Editor for NBC News and host of the popular MSNBC show, Dr. Nancy , Dr. ...

  16. The Enunciation of the Subject: Sharing Jean-Luc Nancy's Singular Plural in the Classroom

    Science.gov (United States)

    Collins, Ashok

    2015-01-01

    This article seeks to explore the implications of Jean-Luc Nancy's reading of the subject for educational philosophy by connecting his re-interpretation of Descartes to his later thinking on what he names the ontological singular plural. Nancy's re-imagining of the Cogito coalesces around the figure of the mouth ("la bouche") through…

  17. A comparison of the effects of pilates and mckenzie training on pain and general health in men with chronic low back pain: A randomized trial

    Directory of Open Access Journals (Sweden)

    Ali Hasanpour-Dehkordi

    2017-01-01

    Full Text Available Background: Today, chronic low back pain is one of the special challenges in healthcare. There is no unique approach to treat chronic low back pain. A variety of methods are used for the treatment of low back pain, but the effects of these methods have not yet been investigated adequately. Aim: The aim of this study was to compare the effects of Pilates and McKenzie training on pain and general health of men with chronic low back pain. Materials and Methods: Thirty-six patients with chronic low back pain were chosen voluntarily and assigned to three groups of 12 each: McKenzie group, Pilates group, and control group. The Pilates group participated in 1-h exercise sessions, three sessions a week for 6 weeks. McKenzie group performed workouts 1 h a day for 20 days. The control group underwent no treatment. The general health of all participants was measured by the General Health Questionnaire 28 and pain by the McGill Pain Questionnaire. Results: After therapeutic exercises, there was no significant difference between Pilates and McKenzie groups in pain relief (P = 0.327. Neither of the two methods was superior over the other for pain relief. However, there was a significant difference in general health indexes between Pilates and McKenzie groups. Conclusion: Pilates and McKenzie training reduced pain in patients with chronic low back pain, but the Pilates training was more effective to improve general health.

  18. A Comparison of the Effects of Pilates and McKenzie Training on Pain and General Health in Men with Chronic Low Back Pain: A Randomized Trial.

    Science.gov (United States)

    Hasanpour-Dehkordi, Ali; Dehghani, Arman; Solati, Kamal

    2017-01-01

    Today, chronic low back pain is one of the special challenges in healthcare. There is no unique approach to treat chronic low back pain. A variety of methods are used for the treatment of low back pain, but the effects of these methods have not yet been investigated adequately. The aim of this study was to compare the effects of Pilates and McKenzie training on pain and general health of men with chronic low back pain. Thirty-six patients with chronic low back pain were chosen voluntarily and assigned to three groups of 12 each: McKenzie group, Pilates group, and control group. The Pilates group participated in 1-h exercise sessions, three sessions a week for 6 weeks. McKenzie group performed workouts 1 h a day for 20 days. The control group underwent no treatment. The general health of all participants was measured by the General Health Questionnaire 28 and pain by the McGill Pain Questionnaire. After therapeutic exercises, there was no significant difference between Pilates and McKenzie groups in pain relief ( P = 0.327). Neither of the two methods was superior over the other for pain relief. However, there was a significant difference in general health indexes between Pilates and McKenzie groups. Pilates and McKenzie training reduced pain in patients with chronic low back pain, but the Pilates training was more effective to improve general health.

  19. Rapid resolution of chronic shoulder pain classified as derangement using the McKenzie method: a case series

    Science.gov (United States)

    Aytona, Maria Corazon; Dudley, Karlene

    2013-01-01

    The McKenzie method, also known as Mechanical Diagnosis and Therapy (MDT), is primarily recognized as an evaluation and treatment method for the spine. However, McKenzie suggested that this method could also be applied to the extremities. Derangement is an MDT classification defined as an anatomical disturbance in the normal resting position of the joint, and McKenzie proposed that repeated movements could be applied to reduce internal joint displacement and rapidly reduce derangement symptoms. However, the current literature on MDT application to shoulder disorders is limited. Here, we present a case series involving four patients with chronic shoulder pain from a duration of 2–18 months classified as derangement and treated using MDT principles. Each patient underwent mechanical assessment and was treated with repeated movements based on their directional preference. All patients demonstrated rapid and clinically significant improvement in baseline measures and the disabilities of the arm, shoulder, and hand (QuickDASH) scores from an average of 38% at initial evaluation to 5% at discharge within 3–5 visits. Our findings suggest that MDT may be an effective treatment approach for shoulder pain. PMID:24421633

  20. InSAR-based detection of McKenzie River Delta Permafrost loss

    Science.gov (United States)

    Oliver-Cabrera, T.; Wdowinski, S.

    2017-12-01

    Permafrost underlies most of the McKenzie River, North America's largest delta. The in the delta is catalogued as discontinuous permafrost due to the influence of shifting river channels on near-surface ground temperatures. The area is affected by climate change, studies show that ground temperature has increased by 1.5°C since 1970, due to rising annual mean air temperature. Flooding regimes within the delta are also affected by the changing climate due to melting of near surface ground ice together with sea-level rise increasing the potential of land subsidence. Observed consequences of changes occurring in the region are vegetation growth and northward migration of the tree line. The growing vegetation can affect physical properties of the accumulated snow, including depth, density and thermal conductivity. Thogether these variations affect permafrost stability. Permafrost changes can be measured throughout the impacts on river runoffs, ground water, drainages, carbon release, land subsidence and even infrastructure damages. Degradation of permafrost can also be measured by observing ecological changes in the area. In this study, we use InSAR observations to detect permafrost changes and their transition to wetland or vegetated land cover. Our data consist of four ALOS-PALSAR frames covering the entire McKenzie River Delta with temporal coverage spanning from January 2007 to March of 2011. Each frame has 20 to 24 acquisitions, in which half of the data acquired with HH polarization and the other half with HH+HV. We process the data using ROI_PAC and PYSAR software packages. Preliminary results have detected the following spatial patterns: (1) An overall good coherence of summer interferograms with 46-92 day interferograms, (2) Low coherence of winter interferograms (November to February), probably to the increase in snow coverage, (3) Phase jumps along the border of the river reflecting morphological differences between the region near to the river and other

  1. Holocene volcanism of the upper McKenzie River catchment, central Oregon Cascades, USA

    Science.gov (United States)

    Deligne, Natalia I.; Conrey, Richard M.; Cashman, Katharine V.; Champion, Duane E.; Amidon, William H.

    2016-01-01

    To assess the complexity of eruptive activity within mafic volcanic fields, we present a detailed geologic investigation of Holocene volcanism in the upper McKenzie River catchment in the central Oregon Cascades, United States. We focus on the Sand Mountain volcanic field, which covers 76 km2 and consists of 23 vents, associated tephra deposits, and lava fields. We find that the Sand Mountain volcanic field was active for a few decades around 3 ka and involved at least 13 eruptive units. Despite the small total volume erupted (∼1 km3 dense rock equivalent [DRE]), Sand Mountain volcanic field lava geochemistry indicates that erupted magmas were derived from at least two, and likely three, different magma sources. Single units erupted from one or more vents, and field data provide evidence of both vent migration and reoccupation. Overall, our study shows that mafic volcanism was clustered in space and time, involved both explosive and effusive behavior, and tapped several magma sources. These observations provide important insights on possible future hazards from mafic volcanism in the central Oregon Cascades.

  2. Application of DuPont photopolymer films to automotive holographic display

    Science.gov (United States)

    Nakazawa, Norihito; Ono, Motoshi; Takeuchi, Shoichi; Sakurai, Hiromi; Hirano, Masahiro

    1998-03-01

    Automotive holographic head-up display (HUD) systems employing DuPont holographic photopolymer films are presented. Holographic materials for automotive application are exposed to severe environmental conditions and are required high performance. This paper describes the improvement of DuPont photopolymer films for the automotive use, critical technical issues such as optical design, external color and stray light. The holographic HUD combiner embedded in a windshield of an automobile has peculiar problems called external color. Diffraction light from holographic combiner makes its external color tone stimulative. We have introduced RGB three color recording and color simulation in order to improve the external color. A moderate external color tone was realized by the optimization in terms of wavelengths and diffraction efficiencies of the combiner hologram. The stray light called flare arises from a reflection by glass surface of windshield. We have developed two techniques to avoid the flare. First is a diffuser type trap beam guard hologram which reduces the intensity of the flare. Second is the optimization of the design of hologram so that the incident direction of flare is lower than the horizon line. As an example of automotive display a stand-alone type holographic HUD system attached on the dashboard of an automobile is demonstrated, which provides useful driving information such as route guidance. The display has a very simple optical system that consists of only a holographic combiner and a vacuum fluorescent display. Its thin body is only 35 mm high and does not obstruct driver's view. The display gives high contrast and wide image.

  3. Nancy Huston, Self-Translation and a Transnational Poetics

    Directory of Open Access Journals (Sweden)

    Giorgia Falceri

    2014-10-01

    Full Text Available Nancy Huston (Calgary, 1953 is one of the francophone authors who contributed – with an essay entitled Traduttore non è traditore – to the theo- retical volume Pour une littérature-monde (Michel Le Bris and Jean Rouaud, 2007, which inscribes as an important step in the ongoing theoretical definition of world literature. With reference to a selection of Huston’s non-fiction publications, I am going to outline her poetics of self-translation and how the latter intimately relates to what she regards as the very task of Literature. Finally, I am going to briefly sketch the content of three of her novels: L’empreinte de l’ange/The Mark of the Angel (1998- 9, Lignes de faille/Fault Lines (2006-7 and Danse Noire/Black Dance (2013-14, which epitomize Huston’s transnational/translational poetics. The peculiar nature of the experience as a bilingual writer and self-translator opens to new possible prospects on the theorization of world literature, by question- ing the boundaries of linguistic and cultural identity and by defining an ethical aspiration for both literature and translation. Nancy Huston (Calgary, 1953 ha contribuito con il saggio Traduttore non è traditore alla raccolta Pour une littérature-monde (Michel Le Bris e Jean Rouaud, 2007, volume che costituisce una tappa significativa nella teorizzazione contemporanea sulla letteratura-mondo. Attraverso l’analisi di questa e di altre pubblicazioni, il presente articolo si propone di indagare la poetica di auto-traduzione della Huston, per mostrare come essa sia intimamente connessa a quella che l’autrice ritiene essere la funzione fonda- mentale della Letteratura. Vengono inoltre presi in considerazione tre dei suoi romanzi – L’empreinte de l’ange/The Mark of the Angel (1998-9, Lignes de faille/Fault Lines (2006-7 e Danse Noire/Black Dance (2013-14 – che incarnano, a livello di conte- nuti, tale poetica traduttiva e transnazionale. Riflettendo sulla particolarit

  4. Soil salinity data from Bayou Dupont and flanking marshes, New Orleans, LA, 2015-09-16 to 2016-03-30 (NCEI Accession 0151633)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The project restored both structural and habitat functions of Bayou Dupont and flanking marshes. The project created and nourished marsh and restored a ridge on the...

  5. A COMPARATIVE STUDY TO FIND OUT THE EFFECTIVENESS BETWEEN CORE STABILIZATION VS MCKENZIE EXERCISES IN THE TREATMENT OF PATIENTS WITH MECHANICAL LOW BACK PAIN

    Directory of Open Access Journals (Sweden)

    Abhijit Dutta

    2015-10-01

    Full Text Available Background: Mechanical Low back pain is a leading cause of disability. It occurs in similar proportions in all cultures, interferes with quality of life and work performance. Both male and female populations are affected; however, there is a tendency towards a higher incidence in male patients. Mechanical low back pain is associated with pain and clinical instability in lumbar motion segments. Exercises play an important part in the rehabilitation of low back pain. The aim of this study was to compare the effectiveness between Core stabilization vs McKenzie exercises in the treatment of patients with mechanical low back pain. Methods: 30 patients were selected between the age groups of 20 yrs to 50 yrs and having a past history of low back pain for one month. 15 patients were allotted to each group of experiment. Group I was given Core stabilization exercises and Group II with McKenzie exercises. Interferential therapy was a common treatment for both the groups. Evaluations of the subjects were done using the Revised Oswestry Disability Index and Dynamic Endurance tests. Results: Data analysis revealed statistically significant difference between both the groups (p<0.05 and proved that Core stabilization exercises is more effective than McKenzie exercises in mechanical low back pain. Conclusion: This study shows that core stabilization exercises possess a greater potential over McKenzie exercises in treating Mechanical Low back pain patients.

  6. THINKING ART, POETRY AND LITERATURE OF PERSPECTIVE BY JEAN-LUC NANCY

    Directory of Open Access Journals (Sweden)

    José Oleriano Monteiro Filho

    2010-07-01

    Full Text Available Jean-Luc Nancy, one of the most influential philosophers of today, is part of a group to some extent antagonistic. Marked by Heidegger's phenomenology, for a certain Hegelianism and the grounds of literary criticism of Maurice Blanchot, Nancy is coming from philosophers like Derrida and Philippe Lacoue-Labarthe. He teaches philosophy at the Faculty of Philosophy, Science of Language and Communication at the University of Strasbourg. Author of several works, his thoughts are evoked by quotations from scholarly works in many different areas. In this study, without attempting to exhaust the subject, we will discuss art, poetry and literature in light of the thought of Nancy, also featuring, when needed, the help of other established names.

  7. Nancy B. v. Hôtel-Dieu de Québec.

    Science.gov (United States)

    1992-01-06

    The Superior Court of Quebec granted an injunction permitting a physician and hospital to remove a respirator from Nancy B., a young woman suffering from an incurable neurological disease. Guillain-Barré syndrome had left Nancy B. incapable of movement, including respiration, although her mental capacities remained unaltered. After a psychological evaluation, including a determination of sanity, Nancy B. continued to persist in her objections to life-sustaining treatment, i.e., use of the respirator. The court held that a patient's right to consent or withhold consent to any medical process has been recognized throughout legal history. Further supporting its decision, the court cited other jurisdictions that have granted permission to cease life-sustaining treatment in similar situations. Although Nancy B. would have remained alive for some time with the help of a respirator, she soundly determined and expressed that this quality of life was not of her choosing. The court further concluded that her imminent death would be considered a natural occurrence and would not carry any criminal culpability for the doctor or hospital.

  8. Landscape and Social Values in Popular Children's Literature: Nancy Drew Mysteries.

    Science.gov (United States)

    Brooker-Gross, Susan R.

    1981-01-01

    Examines the covert lessons in moral social geography found in a set of popular juvenile fiction published between 1924 and 1978--the Nancy Drew mystery stories. Topics discussed include landscape symbolism, urban environments, uses of geographical elements in the stories, rural settings, wilderness settings, social stereotypes, and landscape…

  9. Nancy Huston's Polyglot Texts: Linguistic Limits and Transgressions

    Science.gov (United States)

    Waite, Genevieve

    2015-01-01

    Throughout her career, Nancy Huston has both accepted and transgressed the limits of bilingualism. "Limbes"/"Limbo" (1998), "L'empreinte de l'ange" (1998), "The Mark of the Angel" (2000), "Danse noire" (2013), and "Black Dance" (2014) are five texts that demonstrate Huston's diverse use…

  10. De dood staat op. Naar een seculier opstandingsverhaal − een onderzoek met Jean-Luc Nancy

    NARCIS (Netherlands)

    Kate, L. ten

    2013-01-01

    In his philosophical project of a ‘deconstruction of monotheism’, Jean-Luc Nancy explores the hypothesis that the historical roots of secularization should be traced back to the beginnings of the monotheistic traditions. The secular is not exclusively a feature of modern culture. The complex

  11. The evidence of film and the presence of the world: Jean-Luc Nancy's cinematic ontology

    NARCIS (Netherlands)

    Früchtl, J.; Kavanaugh, L.

    2010-01-01

    Following Deleuze's theory, the emergence of the "time-image" following the Second World War led to (our relationship to) the world disappearing from film. Following Jean-Luc Nancy, the Iranian film-maker Abbas Kiarostami is a privileged witness to a cinema that liberates itself from a "postmodern"

  12. A Randomized Controlled Trial Comparing the McKenzie Method to Motor Control Exercises in People With Chronic Low Back Pain and a Directional Preference.

    Science.gov (United States)

    Halliday, Mark H; Pappas, Evangelos; Hancock, Mark J; Clare, Helen A; Pinto, Rafael Z; Robertson, Gavin; Ferreira, Paulo H

    2016-07-01

    Study Design Randomized clinical trial. Background Motor control exercises are believed to improve coordination of the trunk muscles. It is unclear whether increases in trunk muscle thickness can be facilitated by approaches such as the McKenzie method. Furthermore, it is unclear which approach may have superior clinical outcomes. Objectives The primary aim was to compare the effects of the McKenzie method and motor control exercises on trunk muscle recruitment in people with chronic low back pain classified with a directional preference. The secondary aim was to conduct a between-group comparison of outcomes for pain, function, and global perceived effect. Methods Seventy people with chronic low back pain who demonstrated a directional preference using the McKenzie assessment were randomized to receive 12 treatments over 8 weeks with the McKenzie method or with motor control approaches. All outcomes were collected at baseline and at 8-week follow-up by blinded assessors. Results No significant between-group difference was found for trunk muscle thickness of the transversus abdominis (-5.8%; 95% confidence interval [CI]: -15.2%, 3.7%), obliquus internus (-0.7%; 95% CI: -6.6%, 5.2%), and obliquus externus (1.2%; 95% CI: -4.3%, 6.8%). Perceived recovery was slightly superior in the McKenzie group (-0.8; 95% CI: -1.5, -0.1) on a -5 to +5 scale. No significant between-group differences were found for pain or function (P = .99 and P = .26, respectively). Conclusion We found no significant effect of treatment group for trunk muscle thickness. Participants reported a slightly greater sense of perceived recovery with the McKenzie method than with the motor control approach. Level of Evidence Therapy, level 1b-. Registered September 7, 2011 at www.anzctr.org.au (ACTRN12611000971932). J Orthop Sports Phys Ther 2016;46(7):514-522. Epub 12 May 2016. doi:10.2519/jospt.2016.6379.

  13. Evaluating Banking Profit Performance in Ghana during and post Profit Decline: A five Step Du-Pont Approach

    Directory of Open Access Journals (Sweden)

    Baah Aye Kusi

    2015-11-01

    Full Text Available In this study we aimed at three objectives. First, identify and rank banks based on a composite score comprising of all five du-pont variables. Second, we identify variables in the five step du-pont set up that are most likely to influence bank ROE during and post profit declining periods. And third, we estimate a model to capture the variables that drive bank ROE during and post profit declining periods. We first establish from our rankings that, foreign banks in Ghana performed better during profit declining periods while the local banks performed better in post profit decline periods using the top ten banks as a benchmark in both periods. Employing Pearson correlation coefficients matrix, we recognized that operating profit margin, asset turnover and leverage were most likely to influence bank ROE in both time periods. We further employ OLS regression and find that bank ROE was impacted by operating profit margin and leverage during profit declining periods and post profit decline while tax effect added up in post profit declining periods.

  14. Health assessment for E. I. Dupont Newport Plant Landfill, Newport, Delaware, Region 3. CERCLIS No. DED980555122. Preliminary report

    International Nuclear Information System (INIS)

    1988-01-01

    The E.I. Dupont Newport Plant Landfill, a seven acre site located adjacent to the Dupont Pigment Plant in Newport, Delaware, was used to bury paint pigments (heavy metals and chlorinated solvents) and radioactive materials from 1902 to 1975. The site was closed in 1975, the surface covered, graded and vegetated, and groundwater monitoring wells installed on- and off-site. Heavy metals (cadmium, barium, lead, zinc), and chlorinated solvents (trichloroethylene, tetrachloroethylene) have been measured in groundwater on-site. Radiation levels appear to be close to background. The site is considered to be of potential public health concern because of the risk to human health caused by the possibility of exposure to hazardous substances via groundwater. More information is needed concerning levels of contamination in private wells and the Christina River, the direction of groundwater flow, the size and extent of the groundwater contamination plume, the location of the private wells and the public water supply wells, and the composition of the population down gradient of the site

  15. DIAGNÓSTICO E TRATAMENTO NA DOR LOMBAR INESPECÍFICA ATRAVÉS DO MÉTODO MCKENZIE: UMA REVISÃO BIBLIOGRÁFICA

    Directory of Open Access Journals (Sweden)

    Marilia de Souza Vieira Fabre

    2017-02-01

    Full Text Available Resumo – Introdução: O método Mckenzie consiste em um programa de movimentos prescritos por fisioterapeuta, sem o auxílio de equipamentos específicos, onde o paciente aprende a identificar os movimentos, posturas e atividades que aumentam e pioram a sua dor, podendo tratá-las restaurando os mecanismos funcionais. Objetivo: Verificar as publicações na área da fisioterapia relacionadas aos benefícios do método Mckenzie no tratamento da dor lombar inespecífica. Método: Revisão bibliográfica na base de dados PubMed e Lilacs utilizando as palavras-chave: “Method Mckenzie”, “treatment”, “low back pain”. Resultados: foram encontrados 101 artigos, sendo que apenas 22 encontravam- se nos critérios de inclusão, palavra-chave, pesquisas realizadas nos ultimos 10 anos e em seres humanos com textos completo em inglês. Conclusão: O método Mckenzie apesar de ainda mostrar poucas evidências específicas, possui características próprias de autocuidado e de tratamento que agem de forma positiva na gestão da dor, mostrando à sua importância fundamental na avaliação e na classificação das disfunções.

  16. South Atlantic Bight Habitat Mapping on NOAA Ship Nancy Foster in North Atlantic Ocean between 20070626 and 20070702

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This expedition on the NOAA Ship Nancy Foster used the recently-developed National Undersea Research Center for the North Atlantic and Great Lakes (NURC-NAGL) ROV...

  17. The resilient banality of catastrophes: about After Fukushima by Jean-Luc Nancy

    International Nuclear Information System (INIS)

    Tonaki, Yotetsu

    2016-01-01

    The author proposes some thoughts based on a book (The equivalence of catastrophes - After Fukushima) written by the French philosopher Jean-Luc Nancy for whom Fukushima cannot be reduced to technological dysfunctions, nor to a factor attributable to men in charge, but reveals a system of general equivalence which supports a whole civilisation. The author refers to the speech on safety engineering and on resilience in Japan, and outlines some surprising correspondences with Nancy's writings. With a reference to Heidegger, the author shows that what the catastrophe reveals is not only daunting or abnormal phenomena, but also and above all an almost ontological condition which command the normal operation of every day life. Based on Anders' works, he examines what is on in this techno-sphere which is finally similar to a 'self-transformation of the human being'

  18. The DuPont, Monsanto, General Electric open-quotes Lasagnaclose quotes Remediation Project - joint R ampersand D and financing

    International Nuclear Information System (INIS)

    Palmer, P.A.

    1995-01-01

    The Lasagna project is the first of what we expect will be several large cooperative projects between industry consortia and government to develop improved remediation technologies. In 1992, Monsanto Company began contacting other major corporations to see if they were experiencing similar difficulties in applying cost-effective, or even workable technologies for industrial site remediation. Both General Electric and DuPont were early participants in the effort to develop a meeting with the EPA to discuss technical problems faced in cleanup, research needs, and ways to accelerate development of more cost-effective techniques. This paper provides some background on how this cooperative process came to reality, what the Lasagna process is and how the cooperative arrangements and financing are structured

  19. Charting shifts and moving forward in abnormal times: An interview with Nancy Fraser

    Directory of Open Access Journals (Sweden)

    Julia Sichieri Moura

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2016v15n1p1 In this interview Nancy Fraser elucidates important conceptual topics of her theory, she also shares her analysis of the global financial crisis and how it has changed the setting for theorists of justice. Her account reminds us of critical theory’s important role in helping us think - and act – differently in difficult times.

  20. Anthropocene Knowledge Practices in McKenzie Wark’s Molecular Red and Kim Stanley Robinson’s Aurora

    Directory of Open Access Journals (Sweden)

    Gib Prettyman

    2018-02-01

    Full Text Available Through a close reading of McKenzie Wark’s theoretical treatise 'Molecular Red' (2015 and Kim Stanley Robinson’s novel 'Aurora' (2015, this essay examines how Anthropocene knowledge practices challenge our conceptions of human agency in provocative and potentially productive ways. For example, our knowledge of climate science arises through global material infrastructures. As material components of Anthropocene knowledge practices, these infrastructures reveal the material labors and cyborg structures by means of which our knowledge is produced. Wark sees the heterogenous materiality of Anthropocene knowledge practices as evidence for the value of ‘low theories’ based on a ‘labor point of view.’ At the same time, Anthropocene knowledge practices reveal ‘eco-logical’ complexities and fundamental recognitions of the ‘intra-action’ of entangled matter. These complexities produce very estranged views of human agency. Robinson’s novel highlights the eco-logical implications of contemporary knowledge practices by imagining an interstellar ship that must function as a completely artificial ecosystem for a 170-year voyage to another solar system. The significance of knowledge practices and eco-logical complexity is most evident when failures or crises arise, and 'Aurora' tells the story of many such failures. However, I argue that Robinson’s novel and Wark’s ‘low theory’ ultimately function as hopeful accounts of Anthropocene knowledge practices. Among other things, these practices show the material importance of storytelling and point the way toward more complexly realist theories of human agency.

  1. Habitat Evaluation Procedures (HEP) Report; Big Island - The McKenzie River, Technical Report 1998-2001.

    Energy Technology Data Exchange (ETDEWEB)

    Sieglitz, Greg

    2001-03-01

    The Big Island site is located in the McKenzie River flood plain, containing remnant habitats of what was once more common in this area. A diverse array of flora and fauna, representing significant wildlife habitats, is present on the site. Stands of undisturbed forested wetlands, along with riparian shrub habitats and numerous streams and ponds, support a diversity of wildlife species, including neotropical migratory songbirds, raptors, mammals, reptiles, and amphibians (including two State-listed Sensitive Critical species). The project is located in eastern Springfield, Oregon (Figure 1). The project area encompasses 187 acres under several ownerships in Section 27 of Township 17S, Range 2W. Despite some invasion of non-native species, the site contains large areas of relatively undisturbed wildlife habitat. Over several site visits, a variety of wildlife and signs of wildlife were observed, including an active great blue heron rookery, red-Legged frog egg masses, signs of beaver, and a bald eagle, Wildlife habitat values resulting from the purchase of this site will contribute toward the goal of mitigating for habitat lost as outlined in the Bonneville Power Administration's (BPA) Mitigation and Enhancement Plan for the Willamette River Basin. Under this Plan, mitigation goals and objectives were developed as a result of the loss of wildlife habitat due to the construction of Federal hydroelectric facilities in the Willamette River Basin. Results of the Habitat Evaluation Procedures (HEP) will be used to: (1) determine the current habitat status of the study area and habitat enhancement potential of the site consistent with wildlife mitigation goals and objectives; and (2) develop a management plan for the area.

  2. A Comparison of the Effects of Pilates and McKenzie Training on Pain and General Health in Men with Chronic Low Back Pain: A Randomized Trial

    OpenAIRE

    Hasanpour-Dehkordi, Ali; Dehghani, Arman; Solati, Kamal

    2017-01-01

    Background: Today, chronic low back pain is one of the special challenges in healthcare. There is no unique approach to treat chronic low back pain. A variety of methods are used for the treatment of low back pain, but the effects of these methods have not yet been investigated adequately. Aim: The aim of this study was to compare the effects of Pilates and McKenzie training on pain and general health of men with chronic low back pain. Materials and Methods: Thirty-six patients with chronic l...

  3. Jean Luc Nancy and the community: trascendence and immanence, ecstasy and death

    Directory of Open Access Journals (Sweden)

    Edgar Straehle Porras

    2012-01-01

    Full Text Available The community is one of the recurring themes of political philosophy today, especially by streams as communitarianism. Jean Luc Nancy has problematized this notion and tried to free it from any trace of what might be a thought or identity politics. The community is not the affirmation of a being of us but the breakdown of any form of essentialism which entails the need to recognize the role of otherness and difference. Hence, linking the community to a finitude that relates to concepts such as death, “clinamen”, transcendence and especially the absence of Oeuvre

  4. Marketingová strategie u vybraného produktu na příkladu společnosti DuPont

    OpenAIRE

    Wojnar, Michal

    2009-01-01

    The bachelor thesis "Marketing Strategy of a Chosen Product on The Example of DuPont" is aimed at analyzing the marketing strategy and marketing mix of the Elvaloy material which is used in paving segment. The main applied methodology is called situation analysis through which the author compares individual key markets, reviews internal and external conditions of the company and studies the competition. The main objective of the thesis is also to present diminishing differences between indust...

  5. Causes of death of thoroughbred racehorses at Octavio Dupont Veterinary Hospital, Brazilian Jockey Club, Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Marsel C. Pereira

    2012-03-01

    Full Text Available There are few studies that approach the epidemiology of deaths in racehorses in a broad manner. The majority focus on a specific affection or procedure. Brazil does not have a program instituted for the monitoring of deaths of horses. By means of a descriptive study in association with a multivariate analysis method, an epidemiologic profile was determined for deaths related to musculoskeletal (MS, gastrointestinal (GI, respiratory (RES systems, neurologic origin (NEU and sudden death (SD for the years of 2002 to 2008, at the Octavio Dupont Veterinary Hospital-Rio de Janeiro (ODVH. Males comprised the majority of deaths and that deaths were related to, decreasing order, MS>GI>SD>NEU>RES, with respect to general mortality rate per large group of determined causes (TSPMr. The majority of deaths registered included horses aged four to five years (ID4-ID5. We observed the following correspondence relations: (3-year period = SM - ID>5 - SD; ID>5 - GI; ID4-5 - MS; SF - ID5 - GI; SF - ID5. The present study points out the importance and necessity of epidemiologic studies of lesions in horses, based on diagnosis for the recognition of predisposing factors and prevention.

  6. From Nancy to Copenhagen to the World: The internationalization of Laurent Schwartz and his theory of distributions

    DEFF Research Database (Denmark)

    Barany, Michael J.; Paumier, Anne-Sandrine; Lützen, Jesper

    2017-01-01

    Nancy, via Copenhagen, to the world stage, culminating in his 1950 Fields Medal awarded in Cambridge, Massachusetts. We identify, based on new archival findings, the pivotal role of Danish mathematician Harald Bohr along this trajectory. Our analysis reveals the emerging dynamics of early postwar...

  7. The Mysterious Case of the Detective as Child Hero: Sherlock Holmes, Encyclopedia Brown and Nancy Drew as Role Models?

    Science.gov (United States)

    Sugarman, Sally

    In the mystery genre, the one characteristic that the enduring figures of Sherlock Holmes, Nancy Drew, and Encyclopedia Brown have in common is a rational mind. The source of their strength is their ability to think and think well. A study examined some typical examples of the mystery genre in young adult literature and surveyed children and…

  8. Business process management : 3rd international conference, BPM 2005, Nancy, France, September 5-8, 2005 : proceedings

    NARCIS (Netherlands)

    Aalst, van der W.M.P.; Benatallah, B.; Casati, F.; Curbera, F.

    2005-01-01

    This volume contains the proceedings of the 3rd International Conference on Business Process Management (BPM 2005), organized by LORIA in Nancy, France, September 5–8, 2005. This year, BPM included several innovations with respect to previous editions, most notably the addition of an industrial

  9. Nancy B and Nancy F.

    Science.gov (United States)

    Burkholder, L

    2001-01-01

    In this article I provide a virtuous slippery slope argument which shows that there is no morally significant difference between passive and active euthanasia. At the top of the slope is an example of passive euthanasia; at the bottom, an example of active euthanasia. For each pair of cases down the slope there is nothing that sensibly makes a morally significant difference between the pair of cases. Thus, there is no morally significant difference between passive euthanasia and active euthanasia.

  10. Award for Distinguished Career Contributions to Education and Training in Psychology: Nancy S. Elman.

    Science.gov (United States)

    2017-12-01

    The Award for Distinguished Career Contributions to Education and Training in Psychology is given in recognition of the efforts of psychologists who have made distinguished contributions to education and training, who have produced imaginative innovations, or who have been involved in the developmental phases of programs in education and training in psychology. The Career designation is added to the award at the discretion of the Education and Training Awards Committee to recognize continuous significant contributions made over a lifelong career in psychology. The 2017 recipient of this award is Nancy S. Elman, whose leadership roles have brought significant advancements for the education and training of psychologists. Her award citation, biography, and a selected bibliography are presented here. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  11. « Nancy Spero. Autour d’Antonin Artaud »

    Directory of Open Access Journals (Sweden)

    Kamila Benayada

    2008-01-01

    Full Text Available Le FRAC Haute Normandie montrait cet été des œuvres sur papier de l’artiste américaine Nancy Spero (1926-, en association avec la galerie Lelong, Paris, qui présentait de son côté les Paris Black Paintings, série de toiles peintes à Paris de 1959 à 1964. Ces expositions précédaient l’installation de Spero au Pavillon international de la Biennale de Venise 2007 et coïncidaient avec le réaccrochage de Azur (2000 au Musée national d’art moderne. Parmi les œuvres accrochées au FRAC figuraient n...

  12. Le contrôle de l’activité législative de la nation en 1789 : l’opinion de Dupont de Nemours

    Directory of Open Access Journals (Sweden)

    Anthony Mergey

    2014-06-01

    Full Text Available On the eve of the French Revolution, Dupont de Nemours became infatuated with constitutional issues that had hitherto been the exclusive domain of some of his fellow physiocrats, in particular Le Mercier de La Rivière. Endorsing the ideas of the time, he was convinced of the necessity of creating a new political regime that would take the features of a moderate monarchy. The prince would thus be submitted to constitutional rules, sovereignty transferred to the nation and the legislative power exercised by its representatives. However, even if sharing authority between the nation and the king was then claimed, the representatives of the nation should not exercise their prerogatives outside a clearly established, defined constitutional framework. Partly consistent with the original physiocratic theories, Dupont de Nemours identified constitutional norms that should be promoted and protected from abuses of the legislature. With this aim in mind, he didn’t plan to resort to a jurisdictional authority, because abuses of Ancien Régime parliaments were still live memories. He decided, in an original way, to entrust the heavy burden of controlling legislative activity to political instances, namely, successively, the people and the monarch. Quite naturally, these suggestions, expressed a few months apart, exposed various forms of control. The examination carried out by the nation appeared as a prerequisite and tended to verify the constitutionality of the law, while the one carried out by the monarch through his veto, as holder of the executive power, was more of a control of opportunity devoid of binding. Although the omnipotence of the revolutionary legicentrism seemed incompatible with such a system of verification of the norm, it remains that Dupont de Nemours was part of a current which considerably developed during the XVIIIth century and which found a certain resonance in the decade following the Revolution.

  13. The effects of cervical traction, cranial rhythmic impulse, and Mckenzie exercise on headache and cervical muscle stiffness in episodic tension-type headache patients.

    Science.gov (United States)

    Choi, Sung-Yong; Choi, Jung-Hyun

    2016-03-01

    [Purpose] The purpose of this study was to examine the effects of cervical traction treatment, cranial rhythmic impulse treatment, a manual therapy, and McKenzie exercise, a dynamic strengthening exercise, on patients who have the neck muscle stiffness of the infrequent episodic tension-type (IETTH) headache and frequent episodic tension-type headache(FETTH), as well as to provide the basic materials for clinical interventions. [Subjects] Twenty-seven subjects (males: 15, females: 12) who were diagnosed with IETTH and FETTH after treatment by a neurologist were divided into three groups: (a cervical traction group (CTG, n=9), a cranial rhythmic contractiongroup (CRIG, n=9), and a McKenzie exercise group (MEG, n=9). An intervention was conducted for each group and the differences in their degrees of neck pain and changes in muscle tone were observed. [Results] In the within-group comparison of each group, headache significantly decreased in CTG. According to the results of the analysis of the muscle tone of the upper trapezius, there was a statistically significant difference in MEG on the right side and in CRIG on the left side. According to the results of the analysis of the muscle tone of the sternocleidomastoid muscle, there was a statistically significant difference in MEG on the right side and in CRIG on the left side. [Conclusion] In the comparison of the splenius capitis muscle between the groups, there was a statistically significant difference on the right side. Hence, compared to the other methods, cervical traction is concluded to be more effective at reducing headaches in IETTH and FETTH patients.

  14. Quantifying Contaminant Mass for the Feasibility Study of the DuPont Chambers Works FUSRAP Site - 13510

    Energy Technology Data Exchange (ETDEWEB)

    Young, Carl; Rahman, Mahmudur; Johnson, Ann; Owe, Stephan [Cabrera Services Inc., 1106 N. Charles St., Ste. 300, Baltimore, MD 21201 (United States)

    2013-07-01

    The U.S. Army Corps of Engineers (USACE) - Philadelphia District is conducting an environmental restoration at the DuPont Chambers Works in Deepwater, New Jersey under the Formerly Utilized Sites Remedial Action Program (FUSRAP). Discrete locations are contaminated with natural uranium, thorium-230 and radium-226. The USACE is proposing a preferred remedial alternative consisting of excavation and offsite disposal to address soil contamination followed by monitored natural attenuation to address residual groundwater contamination. Methods were developed to quantify the error associated with contaminant volume estimates and use mass balance calculations of the uranium plume to estimate the removal efficiency of the proposed alternative. During the remedial investigation, the USACE collected approximately 500 soil samples at various depths. As the first step of contaminant mass estimation, soil analytical data was segmented into several depth intervals. Second, using contouring software, analytical data for each depth interval was contoured to determine lateral extent of contamination. Six different contouring algorithms were used to generate alternative interpretations of the lateral extent of the soil contamination. Finally, geographical information system software was used to produce a three dimensional model in order to present both lateral and vertical extent of the soil contamination and to estimate the volume of impacted soil for each depth interval. The average soil volume from all six contouring methods was used to determine the estimated volume of impacted soil. This method also allowed an estimate of a standard deviation of the waste volume estimate. It was determined that the margin of error for the method was plus or minus 17% of the waste volume, which is within the acceptable construction contingency for cost estimation. USACE collected approximately 190 groundwater samples from 40 monitor wells. It is expected that excavation and disposal of

  15. Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, from 2015-03-18 to 2015-04-07 (NCEI Accession 0131859)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration with NOAA vessel NOAA Ship Nancy Foster and territory, federal, and private sector partners, conducted the...

  16. Hull-Mounted Acoustic Doppler Current Profiler Data (SADCP) collected aboard the NOAA Ship NANCY FOSTER during cruise NF-10-01 and NF-10-02

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Upper ocean current velocity measurements collected with NOAA Ship NANCY FOSTER's Teledyne RD Instruments 150 kHz hull-mounted acoustic Doppler current profiler...

  17. ESCREVER ENTRE AS LÍNGUAS: TRADUÇÃO E GÊNERO EM NANCY HUSTON

    OpenAIRE

    WILHELM, Jane Elisabeth; COSTA, Pâmela Berton; DEÂNGELI, Maria Angélica

    2017-01-01

    O entre duas línguas da auto-tradução em Nancy Huston subverte as relações hierárquicas entre o original e a tradução, ou a oposição entre língua materna e língua estrangeira, e nos convida assim a nos interrogarmos sobre nossas práticas e representações de escrita e de tradução. Buscamos compreender em que medida a escrita entre o francês e o inglês de Nancy Huston questiona não somente as categorias tradicionais de tradução, mas também o gênero como construção social. A história da tradução...

  18. The Stone and its Images: The Poetry of Nancy Morejón

    Directory of Open Access Journals (Sweden)

    Alan West

    1996-01-01

    Full Text Available The essay explores the roots of Nancy Morejón's poetry within the context of a transculturated afro-Cuban identity. Beginning by an examination of the poems that directly deal with the orishas of santería, the essay moves on to some of her more lyric poetry. Morejón's relationship to Dulce María Loynaz provides particular interest in how both writers treat the metaphor of the house in two important poems. This is followed by a discussion of some of Morejón's overtly feminist poetry, placed both within a Cuban context of the history of its revolution, and the displacement of exile (in dialogue with Cuban women outside the island. Morejón's aesthetic scope is wide and her affinities with Poe, the French symbolists, the Cuban poetic tradition, and the plastic arts (Mendive, Brueghel, as well as the essays of Bachelard, are drawn upon to understand the multiple sources of her work. Throughout the essay different critical methods are brought to bear on how Morejón weaves together nature, politics, myth, aesthetic insight, and personal testimony in a poetry with enormous historical resonance.

  19. Grupo residencial «Le Haut du Lièvre». Nancy

    Directory of Open Access Journals (Sweden)

    Hereng, J. M.

    1964-07-01

    Full Text Available The site occupied by this residential group has an area of 35 hectares, and its main axis runs East-West. The view of the city of Nancy is to the South-Southeast. This article describes blocks A and B. Block A is 400 m long, 43 m high, has 15 storeys and 920 dwellings. Block B is 300 m long, 50 m high, has 17 storeys and 800 dwellings. The ground floor has entrances to the lifts, room for storing perambulators, motorbikes, and other available space. Each apartment of the first floor has either 4 or 5 rooms, and apartments on all higher floors have either 3 or 4 rooms. A feature of the construction is that the foundations have been made in the traditional manner, but the structure and enclosing walls have been carried out using a special type of heavy prefabrication technique. In addition to the blocks of flats, the amenities of the residential project have also been completed. Two commercial centres, a cinema, a cultural centre, three schools, a church, a sports ground, garages, and parking sites are already available. In the near future apartment towers will be built, in the shape of a three armed star. These will accommodate 786 further dwellings.El terreno sobre el que se ha construido este núcleo residencial ocupa una extensión de 35 Ha, goza de orieníación axil este-oeste, y sus vistas sobre la ciudad de Nancy se desarrollan en sentido sur-sureste. Las dos unidades que presentamos aquí son los bloques A y B: el A, de 400 m de longitud, 43 m de altura y 15 plantas, contiene 920 viviendas; el B, de 300 m de longitud, 50 m de altura y 17 p lantas, aloja 800 viviendas. En las plantas bajas están: los zaguanes, arranque de comunicaciones verticales y locales para guardar los caches de niños, motos, e tc. Ocupan la primera planta—en cada elemento unitario— dos viviendas, con cuatro y cinco habitaciones, respectivamente; y las restantes plantas, otras dos viviendas con tres y cuatro habitaciones. Como características constructivas se

  20. ‘Speaking to Others' in Nancy Huston’s The Goldberg Variations and Slow Emergencies

    Directory of Open Access Journals (Sweden)

    Polly Galis

    2016-04-01

    Full Text Available Nancy Huston has previously claimed that her lack of any clear-cut national identity, or of any strong affiliation to her original cultural heritage, enables her to take on multiple identities within her literature. Huston’s claim, however, can be deemed problematic if it presupposes a right to speak on the behalf of minority or ‘subaltern’ figures. This is particularly problematic in view of Huston’s position as a white middle-class writer. In other words, the representation of others in literature can entail imperial repercussions. I will begin this article by postulating that literature can constitute a means of representing ourselves as other, or others tout-court (in keeping with Huston’s transnational approach to(self-representation, before turning to the work of Gayatri Spivak to illustrate how literary representations of others can betray a neo-colonial or imperial character. I will then establish the ways in which Huston avoids an imperial representation of others in The Goldberg Variations and Slow Emergencies by speaking to rather than for others. This article will also explore how this process is underpinned by an intersectional reading of otherness, in keeping with the critical work of Kimberlé Crenshaw and Elisabeth Spelman, and reminiscent of Gilles Deleuze and Félix Guattari’s concept of ‘becoming-minoritarian’ and Rosi Braidotti’s of ‘becoming-woman’ which, in the case of Huston’s literature, are key to distinguishing between minority and ‘subaltern’ figures. In both cases, I will demonstrate how Huston speaks to not for others in both of the studied novels, and how, in so doing, she challenges monolithic and binary categories of being.

  1. Effectiveness of McKenzie Method-Based Self-Management Approach for the Secondary Prevention of a Recurrence of Low Back Pain (SAFE Trial): Protocol for a Pragmatic Randomized Controlled Trial.

    Science.gov (United States)

    de Campos, Tarcisio F; Maher, Chris G; Clare, Helen A; da Silva, Tatiane M; Hancock, Mark J

    2017-08-01

    Although many people recover quickly from an episode of low back pain (LBP), recurrence is very common. There is limited evidence on effective prevention strategies for recurrences of LBP. The purpose of this study was to determine the effectiveness of a McKenzie method-based self-management approach in the secondary prevention of LBP. This will be a pragmatic randomized controlled trial. Participants will be recruited from the community and primary care, with the intervention delivered in a number of physical therapist practices in Sydney, Australia. The study will have 396 participants, all of whom are at least 18 years old. Participants will be randomly assigned to either the McKenzie method-based self-management approach group or a minimal intervention control group. The primary outcome will be days to first self-reported recurrence of an episode of activity-limiting LBP. The secondary outcomes will include: days to first self-reported recurrence of an episode of LBP, days to first self-reported recurrence of an episode of LBP leading to care seeking, and the impact of LBP over a 12-month period. All participants will be followed up monthly for a minimum of 12 months or until they have a recurrence of activity-limiting LBP. All participants will also be followed-up at 3, 6, 9, and 12 months to assess the impact of back pain, physical activity levels, study program adherence, credibility, and adverse events. Participants and therapists will not be masked to the interventions. To our knowledge, this will be the first large, high-quality randomized controlled trial investigating the effectiveness of a McKenzie method-based self-management approach for preventing recurrences of LBP. If this approach is found to be effective, it will offer a low-cost, simple method for reducing the personal and societal burdens of LBP. © 2017 American Physical Therapy Association

  2. THE IMPACT OF THE CONVERSION OF HISTORICAL COST TO CORRECTED CURRENT COST ON RETURN ON ASSETS AND EQUITY: ANALYSIS FROM DUPONT SYSTEM.

    Directory of Open Access Journals (Sweden)

    Roberto Silva da Penha

    2013-12-01

    Full Text Available Historical cost is the most used form of accounting valuation, but it does not reflect the effect of currency in time. The Theory of Corrected Current Cost, albeit with limitations, may show evidence of real and relevant accounting information of the entity. In this context, a question can be formulated: What is the impact of the conversion of historical cost to corrected current cost in return on assets and equity? In order to answer this question, the DuPont system was applied in a model company as a tool for analysis. The results showed that the return of assets at historical cost and corrected current cost were 12.11% and 3.14%, respectively, a decrease of 74.07%, and the result of the return on equity, the historical cost and corrected current cost were 20.59% and 4.96%, respectively, decreased 75.91%. Based on these variations it is observed that the impacts of the conversion of the corrected current cost were significant,confirming the importance of the adoption of this practice, whenever possible.

  3. The Third Turn toward the Social: Nancy Welch's "Living Room," Tony Scott's "Dangerous Writing," and Rhetoric and Composition's Turn toward Grassroots Political Activism

    Science.gov (United States)

    Kinney, Kelly; Girshin, Thomas; Bowlin, Barrett

    2013-01-01

    This review essay examines recent texts by Nancy Welch and Tony Scott, both of which use embodied activism as a starting point for their inquiries. Taken together, these works point to a distinct shift in composition studies' turn toward the social, one that calls on workers both within and outside the academy to actively engage in grassroots…

  4. Justicia como redistribución, reconocimiento y representación: las reconciliaciones de Nancy Fraser

    Directory of Open Access Journals (Sweden)

    Clara Iglesias

    2013-01-01

    Full Text Available Si nos preguntamos por el desarrollo de la Teoría Crítica y sus marcos conceptuales, es imprescindible tener en cuenta el pensamiento de Nancy Fraser. Con el presente artículo se pretende desglosar el entramado conceptual del que se vale Fraser, tomando para ello principalmente dos de sus obras: ¿Redistribución o reconocimiento? y Escalas de justicia. Con ello el artículo se centra en la consideración de conceptos clave para la elaboración de una teoría crítica capaz de integrar las reivindicaciones actuales presentes en los movimientos sociales, y con ello la puesta de manifiesto de la injusticia y su posible reparación, sin perder de vista en ningún momento el correlato social fáctico de la teoría.

  5. Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, southern coast of Isla de Mona, western coast of Puerto Rico from 2007-04-14 to 2007-04-24 (NCEI Accession 0131853)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the fourth year of an ongoing scientific research mission on board NOAA Ship NANCY FOSTER. The...

  6. Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, offshore of Cabo San Juan from 2012-04-03 to 2012-04-20 (NCEI Accession 0131856)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the ninth year of an ongoing scientific research mission on board NOAA Ship Nancy Foster from April...

  7. Water Depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in the US Caribbean/ Puerto Rico and St. Thomas from 2016-04-07 to 2016-04-26 (NCEI Accession 0157612)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration with NOAA Ship Nancy Foster, federal, academic, and private sector partners conducted the 2016 Seafloor...

  8. Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, Western coast of Puerto Rico, Mona Island, Southern coast of Vieques Island from 2008-02-25 to 2008-03-08 (NCEI Accession 0131852)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) completed the fifth year of an ongoing scientific research mission on board NOAA Ship NANCY FOSTER. The...

  9. Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, Northeast Grand Reserve, Puerto Rico from 2013-03-05 to 2013-03-29 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the tenth year of an ongoing scientific research mission onboard NOAA Ship Nancy Foster. The...

  10. The McKenzie method compared with manipulation when used adjunctive to information and advice in low back pain patients presenting with centralization or peripheralization. A randomized controlled trial

    DEFF Research Database (Denmark)

    Petersen, Tom; Larsen, Kristian; Nordsteen, Jan

    2011-01-01

    .Methods. A total of 350 patients suffering from low back pain with a duration of more than 6 weeks who presented with centralization or peripheralization of symptoms with or without signs of nerve root involvement, were enrolled in the trial. Main outcome was number of patients with treatment success defined...... a structured exercise programme tailored to the individual patient as well as manual therapy for the treatment of persistent low back pain. There is presently insufficient evidence to recommend the use of specific decision methods tailoring specific therapies to clinical subgroups of patients in primary care...... for more than six weeks presenting with centralization or peripheralization of symptoms, we found the McKenzie method to be slightly more effective than manipulation when used adjunctive to information and advice....

  11. Filosofía del cuerpo de Jean-Luc Nancy y Bioética de la trasplantología

    Directory of Open Access Journals (Sweden)

    Francisco Quesada Rodríguez

    2012-01-01

    Full Text Available El artículo presenta un análisis ético de la donación y trasplante de órganos a partir de la filosofía del cuerpo de Jean-Luc Nancy comprendida como ontología narrativa, considerando la noción antropológica que subyace en la historia de la trasplantología.

  12. “Some of the Best Movement People Are Political Ecologists at Heart”: An Interview About Political Ecology With Nancy Peluso

    OpenAIRE

    Melanie Pichler

    2016-01-01

    Nancy Peluso pioneered political ecology research in Southeast Asia with her book on Rich Forest, Poor People (1992) that untangles peasant resistance and state control in Indonesian forest politics. Since then, the professor of political ecology at UC Berkeley, California, has done extensive ethnographic research on the effects of social difference (ethnic identity, class, gender) on resource access and control, dealing with forests, land, mining, and water conflicts in Indonesia and Malays...

  13. [Remy Willemet (1735-1807), naturalist, professor of natural history and chairman of the botanical garden of Nancy].

    Science.gov (United States)

    Labrude, Pierre

    2015-03-01

    Rémy Willemet is above all a local botanist whose first work was selected by the academy of Nancy in 1766. His notoriety began when another work with Jean-François Coste was chosen by the academy of Lyon ten years later. He published then in many papers and was elected in numerous academies and scientific societies. During the Revolution, he was a professor of the Ecole centrale de la Meurthe and of the Société de santé, and he became the chairman of the botanical garden. Willemet wrote some botanical books. Today, what is the memory of his researchs and papers? Fairly few things because he never undertook botanical travels in order to discover and compare pharmaceutical plants. However, Willemetia was the name used to denominate some species and honour his family. His name was also engraved on the wall of some university buidings and it was chosen some years ago to entitle a botanical paper in Lorraine.

  14. Identity, recognition and redistribution: a critical analysis of Charles Taylor, Axel Honneth and Nancy Fraser’s theories

    Directory of Open Access Journals (Sweden)

    Javier Amadeo

    2017-06-01

    Full Text Available http://dx.doi.org/10.5007/2175-7984.2017v16n35p242 The politics of identity and the idea of recognition have become dominant issues in contemporary political theory. Recognition, as a concept, means that an individual or a social group claims the right to have their identity recognized, directly or throw the mediation of set of institutions. The theories that have evaluated these questions address both important theoretical issues and central political subjects, as the definition of minority rights, national self-determination claims or the challenges posed of our increasingly multicultural societies. The main objective of this paper is to discuss the central arguments presents by Charles Taylor, Axel Honneth and Nancy Fraser emphasizing the discussion around the relationship between recognition and redistribution. A more specific purpose is to analyze the relation between the question of injustice based on the demand of identity and the problem of economic inequality. Finally, we try to understand some of the theoretical and political implications of the idea of difference and the recognition theory in a broader conceptual perspective.

  15. When Art Meets Gardens: Does It Enhance the Benefits? The Nancy Hypothesis of Care for Persons with Alzheimer's Disease.

    Science.gov (United States)

    Jonveaux, Thérèse Rivasseau; Fescharek, Reinhard

    2018-01-01

    The creation of healing gardens for persons with Alzheimer's disease and related diseases (ADRD) offers vast potential. They can play a role in the scaffolding of cognitive disorders, emotional stress, sensory processing, sense of harmony, and appeasement. These effects are achieved through a distributed interplay of psychological functions with the immediate environment and local culture on the one hand, and dialogue on the other. The garden, a natural canvas created by man, shares with art the ability to foster an esthetic sense for which the perception can be measured by functional neurological imaging exploration. Art represents a mediator for the collaborative realization of distributed psychological functions between different individuals. Based on the hypothesis of an optimization of the therapeutic potential of a garden by a design adapted to the neuro-psycho-social and cultural specificities of its users combined with the thoughtful introduction of an artistic dimension, the "art, memory and life" healing garden was created at the University Hospital of Nancy as a prototype for persons with ADRD. The design concept was based on two hypotheses that we formulate herein, discuss their theoretical foundation, and suggest enhanced design for therapeutic gardens based upon our experience.

  16. [The "conclusions of Pharmacy" in Nancy, at the end of the 18th century: between "synthèses" and "thèses"].

    Science.gov (United States)

    Julien, P; Martin, J

    1995-01-01

    A special requirement of the law for apothecaries in Nancy in 1764 imposed on the candidates for a master's degree was the written response to four questions following their practical examinations. Two documents heretofore unpublished show the results of this obligation: the Conclusions de Pharmacie by Joseph Pierson (1765) and the Conclusions de Pharmacie et de Chimie by François Mandel (1771). The authors of the present article comment on these documents and make an attempt to place them in the confused history of "synthèses" and "thèses".

  17. “Some of the Best Movement People Are Political Ecologists at Heart”: An Interview About Political Ecology With Nancy Peluso

    Directory of Open Access Journals (Sweden)

    Melanie Pichler

    2016-06-01

    Full Text Available Nancy Peluso pioneered political ecology research in Southeast Asia with her book on Rich Forest, Poor People (1992 that untangles peasant resistance and state control in Indonesian forest politics. Since then, the professor of political ecology at UC Berkeley, California, has done extensive ethnographic research on the effects of social difference (ethnic identity, class, gender on resource access and control, dealing with forests, land, mining, and water conflicts in Indonesia and Malaysia. Her recent work investigates the relationships between migration and environmental change. Melanie Pichler spoke with her during the International Conference of the European Network of Political Ecology (ENTITLE from 20 to 24 March in Stockholm where she delivered a keynote lecture on the unexpected impacts of women’s migration on the environment in a forest village in East Java. During the interview, Nancy reflected on current trends in political ecology research, the potential pitfalls of indigenous peoples’ rights, the contradictory role of NGOs in socio-ecological conflicts, and the potential of political ecology research beyond academia.

  18. Nancy Dowe | NREL

    Science.gov (United States)

    Bench scale integration and scale up of biological processes to produce fuels and chemicals from Zymomonas mobilis strain 8b through continuous adaptation on dilute acid pretreated corn stover hydrolysate development and integration. Please do NOT contact me directly for jobs-see instead information on NREL's

  19. [The transfer from Strasbourg, and the primary ten years (1872-1882) of the "Ecole supérieure de pharmacie" of Nancy. An example of the difficulty of creating an university structure almost from nothing and in urgency].

    Science.gov (United States)

    Labrude, Pierre; Strohl, Stéphanie

    2007-05-01

    The conclusion of the war conducted by France in 1870 was the annexation of Alsace and Moselle to the German Empire. The question of the becoming of the University of Strasbourg was put a long time before the Francfort treaty.... After many discussions, the transfer of the Faculty of medicine and of the School of pharmacy to Nancy was decided on October 1st 1872. First bound to the faculty, the school became independent in 1876. It suffered some difficult years because of the terms of the transfer decree, of the retirement of two of its four professors, of the ministerial decision to keep free the chairs for some time in order to save money, and of the difficulties of the recruitment of new professors. The paper describes successively the difficulties of the choice of Nancy for the transfer, the situation of the schools of Strasbourg and Nancy in the year 1870, the text of the decree, the beginning of the teachings and the difficulties encountered with the chairs of pharmacy and natural history, and finally the pharmacy students come in Nancy during the early years. Some thoughts on this transfer and on the difficulties occured during these years precede the conclusion.

  20. Colonial reason, de-colonial imaginary and feminisms: Nancy Morejón, Jamaica Kincaid and the construction of cultural identity in Caribbean poetics

    Directory of Open Access Journals (Sweden)

    Esther Sánchez-Pardo González

    2015-12-01

    Full Text Available This paper raises the crucial question as to whether non-Western feminisms have reached a postcolonial historical moment in which new proposals and alternatives may open up a horizon of expectations to counter the development of colonial history and its patriarchal legacy. Engaged writers like Nancy Morejón (La Habana 1944– and Jamaica Kincaid (St John’s Antigua, 1949– set themselves up to make room for black women in history, a counternarrative to patriarchal History. An analysis of representative pieces of poetry and fiction by both writers in a dialogue with ideas such as the decolonial imaginary, border thinking and rewriting History shed light on alternatives for emancipatory feminist projects for the 21st century.

  1. Radio-contaminated patients intake at the Nancy teaching hospital: study of the resources and implication possibilities of radiation protection referent personnel

    International Nuclear Information System (INIS)

    Guionnet, Christophe

    2011-01-01

    In the events implying radioactive materials, the organization of care in the health facilities requires both the implementation of some skills, which go beyond the usual trade and professional duties of each of the partners, and the identification of the departments and referent staff that are likely to be most affected by these risks. This study, which was conducted within the Radiologie and Medecine Nucleaire Departments of the Centre Hospitalier Universitaire de Nancy, highlights the existence of reference material as means of detecting radiation, the conditions under which they will be developed remain to be defined. Human means can be called for for missions of information, detection, patient screening and decontamination. Volunteering persons, with competences in radiation protection (Personnes Competentes en Radioprotection), and radiographers can lead to the realization of their missions, after an practical training. (author) [fr

  2. Rezension von: Nancy E. Riley: Gender, Work, and Family in a Chinese Economic Zone. Laboring in Paradise. Wiesbaden: Springer VS 2013.

    Directory of Open Access Journals (Sweden)

    Yvonne Berger

    2015-03-01

    Full Text Available Das Buch eignet sich vor allem für Wissenschaftler/-innen, die sich mit den Lebenswirklichkeiten von Arbeitsmigrantinnen in China aus geschlechtertheoretischer Sicht beschäftigen. Nancy E. Riley interessiert sich ethnographisch für den Zusammenhang von Geschlecht, Arbeit und Familie. Konkret geht die Autorin dabei der Frage nach, inwiefern die in der Dalian Economic Zone (DEZ arbeitenden Frauen Erwerbsarbeit als eine Ressource der sozialen Mobilität und der Verhandlung innerfamilialer Machtpositionen nutzbar machen können. Mit Fokus auf dieser (Sonder-Wirtschaftszone und den familialen Lebenswirklichkeiten der Frauen erschließen sich spannende Einsichten in das wirtschaftlich aufstrebende China und den damit einhergehenden sozialen Wandel von Geschlechterverhältnissen.

  3. Pod znakiem serca. „Ja” czujące późnej nowoczesności (Leśmian, Joyce, Derrida, Nancy

    Directory of Open Access Journals (Sweden)

    Aldona Kopkiewicz

    2016-06-01

    Full Text Available In this article I try to show the changing paradigm of romantic expressionism in late modernity. I concentrate on the category of text, which I describe using literature: Bolesław Leśmian’s tale The Adventures of Sindbad the Sailor and a fragment of James Joyce’s Ulysses, as well as theoretical discourses by Jacques Derrida and Jean-Luc Nancy. I am interested first and foremost in the problem of the arbitrary nature of the bond between heart and word, affect and language. I find this problem to be the core of the possibility of thinking about literary creativity, especially its inventive, poetical potention. I try to explain how affect and language meet in the category of textuality and how modern subjectivity can cope with its basic conflict, which lies in the demand of opening and closing itself to the affective experience of otherness.

  4. [The ephemeral historical museum of the École Supérieure de Pharmacie de Nancy (1913-1937) Its collections today].

    Science.gov (United States)

    Labrude, Pierre

    2014-01-01

    In april 1913, the director of the École supérieure de pharmacie, professor Bruntz, undertook the realization of a historical museum and of a gallery of photographies of professors. A society, the Société lorraine du musée historique de la pharmacie, was found in 1.914 and the collections increased rapidly. After First World War, no activity occured until 1926 and space and hands were missing. In 1937, collections, except books, were transfered to the Musée historique lorrain de Nancy and the most interesting objects and documents were exposed. Books were finally deposited and stored in the university library. Today, the renovation undertaken in the Musée lorrain and the approaching transfer of the faculty are the ocasion of a new discovery of these historical collections. Many years after the disparition of the museum, it appears that its collections have been fairly well preserved.

  5. Les Offices du cinéma éducateur et l’émergence du parlant : l’exemple de l’Office de Nancy

    OpenAIRE

    Laborderie, Pascal

    2014-01-01

    Quelle fut la politique des Offices du cinéma scolaire et éducateur durant la période de généralisation du cinéma parlant ? Une première présentation du dispositif de l’Union française des offices du cinéma éducateur laïque permet de décrire les usages du cinéma par les instituteurs, soit dans leurs enseigne­ments (le cinéma scolaire), soit dans l’éducation des adolescents et des adultes (le cinéma éducateur). Puis une étude de l’Office régional d’enseignement cinématographique de Nancy, à pa...

  6. Debates feministas sobre direito, justiça e reconhecimento: uma reflexão a partir do modelo teórico de Nancy Fraser

    Directory of Open Access Journals (Sweden)

    Silvana Mariano

    2009-12-01

    Full Text Available O feminismo pós-estruturalista é a escolha teórica que, em grande parte, orienta aqui nossa perspectiva. Os debates em torno das noções de “direito”, “justiça” e “reconhecimento” ilustram essa discussão. Propomo-nos a fazer uma reflexão sociológica conceitual, de orientação feminista, de forma a constituir um suporte teórico para análises sobre políticas sociais, com o objetivo de investigar as condições de cidadania das mulheres pobres e apreender os determinantes de gênero presentes nos programas estatais. Ao tratar das categorias apontadas, adotamos o modelo proposto por Nancy Fraser, a qual combina a luta pela justiça redistributiva com a luta por justiça de reconhecimento.

  7. O IMPACTO DA CONVERSÃO DO CUSTO HISTÓRICO AO CUSTO CORRENTE CORRIGIDO NO RETORNO SOBRE ATIVOS E PATRIMÔNIO LÍQUIDO: ANÁLISE A PARTIR DO SISTEMA DUPONT.

    Directory of Open Access Journals (Sweden)

    Roberto Silva da Penha

    2013-07-01

    Full Text Available Historical cost is the most used form of accounting valuation, but it does not reflect the effect of currency in time. The Theory of Corrected Current Cost, albeit with limitations, may show evidence of real and relevant accounting information of the entity. In this context, a question can be formulated: What is the impact of the conversion of historical cost to corrected current cost in return on assets and equity? In order to answer this question, the DuPont system was applied in a model company as a tool for analysis. The results showed that the return of assets at historical cost and corrected current cost were 12.11% and 3.14%, respectively, a decrease of 74.07%, and the result of the return on equity, the historical cost and corrected current cost were 20.59% and 4.96%, respectively, decreased 75.91%. Based on these variations it is observed that the impacts of the conversion of the corrected current cost were significant, confirming the importance of the adoption of this practice, whenever possible.

  8. Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, Buck Island Reef and Virgin Islands National Coral Reef Monuments, U.S. Virgin Islands from 2006-03-21 to 2006-04-02 (NCEI Accession 0131851)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the third year of an ongoing scientific research mission on board NOAA Ship NANCY FOSTER. The...

  9. Biological data collected aboard the NOAA Ship NANCY FOSTER during cruise #NF0805, March 11th - March 24th, 2008. Biological data collected during larval collections in St. Thomas April 1- 8th, 2008. Gear used was light traps and beach seine.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Biological data collected from plankton collecting gear aboard the NOAA Ship NANCY FOSTER during cruise #NF0805, March 11th - March 24th, 2008 as part of the Coral...

  10. Water depth, acoustic backscatter, and other data collected from NOAA Ship Nancy Foster and Fugro LADS Mark II Airborne System in Caribbean Sea and US Virgin Islands - Shoals from 2011-03-29 to 2011-04-16 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) completed its eighth year of an ongoing scientific research mission on board NOAA Ship Nancy Foster from...

  11. Homo sacer w świecie chaosu. Szkic o związkach Agambena z Nancym i Serres’em (Homo Sacer in the World of Chaos. Essay about Agamben’s Associations with Nancy and Serres

    Directory of Open Access Journals (Sweden)

    Marcin M. Bogusławski

    2010-12-01

    Full Text Available This paper concerns political philosophy of Agamben, which I consider as variety of philosophy of relations.The important point of reference for Agamben are concepts of Jean-Luc Nancy and Michel Serres. According to this, as I show in my sketch, this associations are only superficial. In my opinion consequent philosophy of relations undermines main theses of Agamben’s philosophical project.

  12. Vegetation - McKenzie Preserve [ds703

    Data.gov (United States)

    California Natural Resource Agency — The California Native Plant Society (CNPS) Vegetation Program produced a vegetation map and classification for approximately 11,600 acres primarily within Millerton...

  13. Two attempts at grounding social critique in „ordinary“ actors’ perspectives: The critical theories of Nancy Fraser and Axel Honneth

    Directory of Open Access Journals (Sweden)

    Ivković Marjan

    2014-01-01

    Full Text Available This paper analyzes two contemporary, „third-generation“ perspectives within critical theory - Nancy Fraser’s and Axel Honneth’s - with the aim of examining the degree to which the two authors succeed in grounding the normative criteria of social critique in the perspectives of ’ordinary’ social actors, as opposed to speculative social theory. To that end, the author focuses on the influential debate between Fraser and Honneth Redistribution or Recognition? which concerns the appropriate normative foundations of a „post-metaphysical“ critical theory, and attempts to reconstruct the fundamental 29 disagreements between Fraser and Honneth over the meaning and tasks of critical theory. The author concludes that both critical theorists ultimately secure the normative foundations of critique through substantive theorizations of the social, which frame the two authors’ „reconstructions“ of the normativity of everyday social action, but argues that post-metaphysical critical theory does not have to abandon comprehensive social theory in order to be epistmologically „non-authoritarian“. [Projekat Ministarstva nauke Republike Srbije, br. 43007: Ethics and Politics of Environment: Institutions, Techniques and Norms Facing the Challenge of Environmental Change

  14. “I Stand Out Like a Raven”: Depicting the Female Detective and Tudor History in Nancy Bilyeau’s The Crown

    Directory of Open Access Journals (Sweden)

    Beyer Charlotte

    2017-06-01

    Full Text Available This article examines the portrayal of female identity and crime in the Tudor period in Nancy Bilyeau’s contemporary historical crime fiction novel, The Crown (2012. Featuring a female detective figure, Joanna Stafford, Bilyeau’s novel forms part of the wealth of contemporary fiction using Tudor history as context, reflecting a continued interest in and fascination with this period and its prominent figures. This article examines Bilyeau’s representation of the Tudor period in The Crown through the depiction of English society and culture from a contemporary perspective, employing genre fiction in order to highlight issues of criminality. My investigation of The Crown as crime fiction specifically involves analysing gender-political questions and their portrayal within the novel and its tumultuous historical context. This investigation furthermore explores the depiction of agency, individuality, religion, and politics. The article concludes that Bilyeau’s suspense-filled novel provides an imaginative representation of Tudor history through the prism of the crime fiction genre. Central to this project is its employment of a resourceful and complex female detective figure at the heart of the narrative.

  15. [The opening lesson in the course on history and geography given by Paul Vidal de la Blache at the Faculty of Nancy: reflections of a historian newly turned geographer].

    Science.gov (United States)

    Lira, Larissa Alves de

    2013-11-30

    The aim of this presentation is to divulge the translation into Portuguese of the inaugural lesson given by French geographer Paul Vidal de la Blache at the Faculty of Nancy, given and published in 1873. This inaugural lesson already reveals the general principles proposed by the undisputed master of the French school of geography, which oriented French geography for many decades. A description is also given of the political and institutional context involving the institutionalization of modern geography in the last nineteenth century and the web of alliances and exchanges with historians, configuring an inheritance that Vidal de la Blache readily incorporated and transformed.

  16. Kirit C. Shah, M.D. v. Stan Harris and Nancy Harris. "Construction of Legal Arguments, Statutes of Limitations, and Medical Malpractice." Lesson Plans for Secondary Teachers on How Lawyers Prepare Their Arguments. Courts in the Classroom: Curriculum Concepts and Other Information on Indiana's Courts for the K-12 Educator.

    Science.gov (United States)

    Osborn, Elizabeth

    Stan and Nancy Harris filed a complaint against Kirit C. Shah, M.D., for misdiagnosing Mr. Harris's illness, charging Dr. Shah with negligence and asking for damages. A medical malpractice action in Indiana is governed by a two year statute of limitations. Because the Harrises failed to bring their action against Dr. Shah within this two year…

  17. Chemical and physical oceanographic profile data collected from CTD casts aboard NOAA Ship NANCY FOSTER in the Gulf of Mexico from 2010-08-13 to 2010-08-21 in response to the Deepwater Horizon oil spill event (NODC Accession 0069614)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Chemical and physical oceanographic profile data were collected aboard NOAA Ship NANCY FOSTER in the Gulf of Mexico from 2010-08-13 to 2010-08-21 in response to the...

  18. Secure of the bi-site radiotherapy activity as part of the resumption of treatments in the Hospital of Epinal by the team of Alexis Vautrin Nancy Cancer Center

    International Nuclear Information System (INIS)

    Marchesi, V.; Aigle, D.; Peiffert, D.; Noel, A.; Noel, A.; Simon, J.M.

    2009-01-01

    In February 2007, the radiation therapy department of the Jean Monnet Hospital in Epinal (France) has stopped the radiotherapy treatments after the discovery of a radiotherapy accident and bad practices leading to overexposure of patients between 1987 and 2006. The Regional Cancer Center 'Centre Alexis Vautrin' in Nancy (France) was given the task of the new start of treatment activity. From February 2007 to January 2008, actions of training, updates of equipment and practices have been performed in the Epinal Hospital, guided by the quality approach, allowing the treatment of new patients in February 2008, with the radiation oncologists and the medical physicists of the Centre Alexis Vautrin, with the highest conditions of security and confidence

  19. As fronteiras da pesquisa antropológica: Ética, Autonomia e Tráfico de Órgãos. Um comentário a The Global Traffic in Human Organs, de Nancy Scheper-Hughes

    Directory of Open Access Journals (Sweden)

    Debora Diniz

    2001-02-01

    Full Text Available O debate sobre os fundamentos éticos da comercialização de partes do corpo humano cresce a cada dia na bioética. Este artigo discute os princípios da ética e da autonomia contidos no mais importante estudo etnográfico sobre o tráfico internacional de órgãos, trabalho coordenado pela antropóloga Nancy Scheper-Hughes. O artigo mostra que a defesa da ética da não-comercialização exige o reconhecimento de fundamentos absolutos e inalienáveis para o ser humano, um pressuposto político cuja legitimidade os antropólogos relativistas resistem em reconhecer.

  20. Secure of the bi-site radiotherapy activity as part of the resumption of treatments in the Hospital of Epinal by the team of Alexis Vautrin Nancy Cancer Center;Securisation de l'activite de radiotherapie bi-site dans le cadre de la reprise des traitements au centre hospitalier d'Epinal par l'equipe du centre Alexis-Vautrin de Nancy

    Energy Technology Data Exchange (ETDEWEB)

    Marchesi, V.; Aigle, D.; Peiffert, D.; Noel, A. [Centre Alexis-Vautrin, 54 - Vandoeuvre-les-Nancy (France); Noel, A. [Institut national Polytechnique de Lorraine, CNRS UMR7039, laboratoire CRAN, 54 - Nancy (France); Simon, J.M. [Groupe hospitalier Pitie-Salpetriere, 75 - Paris (France)

    2009-12-15

    In February 2007, the radiation therapy department of the Jean Monnet Hospital in Epinal (France) has stopped the radiotherapy treatments after the discovery of a radiotherapy accident and bad practices leading to overexposure of patients between 1987 and 2006. The Regional Cancer Center 'Centre Alexis Vautrin' in Nancy (France) was given the task of the new start of treatment activity. From February 2007 to January 2008, actions of training, updates of equipment and practices have been performed in the Epinal Hospital, guided by the quality approach, allowing the treatment of new patients in February 2008, with the radiation oncologists and the medical physicists of the Centre Alexis Vautrin, with the highest conditions of security and confidence

  1. In-house validation study of the DuPont Qualicon BAX system Q7 instrument with the BAX system PCR Assay for Salmonella (modification of AOAC Official Method 2003.09 and AOAC Research Institute Performance-Tested Method 100201).

    Science.gov (United States)

    Tice, George; Andaloro, Bridget; White, H Kirk; Bolton, Lance; Wang, Siqun; Davis, Eugene; Wallace, Morgan

    2009-01-01

    In 2006, DuPont Qualicon introduced the BAX system Q7 instrument for use with its assays. To demonstrate the equivalence of the new and old instruments, a validation study was conducted using the BAX system PCR Assay for Salmonella, AOAC Official Method 2003.09, on three food types. The foods were simultaneously analyzed with the BAX system Q7 instrument and either the U.S. Food and Drug Administration Bacteriological Analytical Manual or the U.S. Department of Agriculture-Food Safety and Inspection Service Microbiology Laboratory Guidebook reference method for detecting Salmonella. Comparable performance between the BAX system and the reference methods was observed. Of the 75 paired samples analyzed, 39 samples were positive by both the BAX system and reference methods, and 36 samples were negative by both the BAX system and reference methods, demonstrating 100% correlation. Inclusivity and exclusivity for the BAX system Q7 instrument were also established by testing 50 Salmonella strains and 20 non-Salmonella isolates. All Salmonella strains returned positive results, and all non-Salmonella isolates returned a negative response.

  2. Validation of the detection of STEC (O26, O45, O103, O111, O121, O145 and O157 in raw burgers using real-time PCR (BAX® System Q7, DuPont in “WET POOLS”

    Directory of Open Access Journals (Sweden)

    Paula Mussio

    2014-12-01

    Full Text Available Shiga toxin-producing Escherichia coli (STEC O157:H7 and no-O157:H7 have been identified as emerging foodborne pathogens responsible for an increasing number of outbreaks worldwide. Many foods have been associated to these outbreaks, mainly undercooked beef burgers. Due to the increasing production and consumption of burgers in our country, it is important to have a rapid technique to identify and isolate the most important STEC strains in foods matrixes.The objective of these investigation was to assess the sensitivity, specificity and limit detection for the screening of the most prevalent STEC in frozen raw beef burgers, using the "STEC Screening stx/eae " kit to detect the stx/eae genes and the "Panel 1 STEC E. coli O26, O111, O121" and "Panel 2 STEC E. coli O45, O103, O145" and "E. coli O157: H7 MP” (DuPont kits for the detection of the different serogroups. The use of composed samples (wet pools, the recovery of each strain from the positives samples on selective media after specified inmunoconcentration and the detection of stx/eae virulence genes in isolates by PCR were also evaluated. We validated a technique that allows the detection of the mentioned STEC strains with limits of detection between 1-5 CFU in 65 grams of raw frozen hamburgers, using wet pools. 

  3. Scientific Opinion related to a notification from DuPont Nutrition Biosciences Aps on behenic acid from mustard seeds to be used in the manufacturing of certain emulsifiers pursuant to Article 21(2) of Regulation (EU) No 1169/2011 – for permanent exemption from labelling

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2016-01-01

    Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion related to a notification from DuPont Nutrition Biosciences Aps on behenic acid from mustard seeds to be used in the manufacturing of certain...... and peptides may not be carried over into behenic acid after the two distillation steps reported in the manufacturing process in amounts beyond 1 mg/kg. The Panel notes that the maximum amount of mustard protein that could be consumed from emulsifiers manufactured from behenic acid (E 470a, E 471 and E 477......) on a single occasion by an adult under the proposed conditions of use would be around 0.00119 mg, which is about 1,000 times lower than the protein doses reported to trigger allergic reactions in mustard-allergic individuals (around 1 mg). On the basis of the data presented, the Panel concludes that oral...

  4. Comparison of survival and toxicities of concurrent radiotherapy with Carboplatin/Paclitaxel or Cisplatin/Etoposide in unresectable stage III non-small cell lung cancers: retrospective analysis in the Department of Pneumology of CHU Nancy between 2008 and 2014

    International Nuclear Information System (INIS)

    Huet, Dimitri

    2015-01-01

    In concomitant chemo-radiotherapy treatment for inoperable stage III NSCLC, different combinations of chemotherapies have been recommended. The objective of this study was to compare progression-free survival, overall survival, and tolerability of two treatment regimens: Cisplatin-etoposide concomitant radio-chemotherapy versus concomitant carboplatin-Paclitaxel based radio-chemotherapy in these patients. A retrospective analysis of 62 patients treated with concomitant radio-chemotherapy for inoperable stage III NSCLC has been carried out in the Department of Pneumology (University Hospital of Nancy). The patients were divided into 2 groups according to the chemotherapy protocol, group 1: Cisplatin-etoposide (27 patients) and group 2: Carboplatin-Paclitaxel (35 patients). The two groups were comparable in terms of age and gender (mean age 58 in group 1 versus age 61 in group 2, and 85 pc of men in group 1 versus 80 pc in group 2). The median overall survival was 19 months in group 1 versus 15.3 months in group 2 (p = 0.22). The median progression-free survival was higher in group 1, 9 months versus 3.3 months in group 2 (p = 0.01). Hematologic toxicity was higher in group 1 than in group 2 (neutropenia 85.2 pc versus 54.3 pc, p = 0.01, anemia 92.3 pc versus 54.3 pc, p = 0.001). Radiation esophagitis and radiation pneumonitis rates were higher in group 1 than in group 2: 44.4 pc versus 11.4 pc (p = 0.01), and 44.4 pc versus 11.4 pc (p = 0.001) respectively. In this mono-centric and retrospective study, the Cisplatin-etoposide - thoracic radiotherapy combination to treat inoperable stage III NSCLC was associated with a significantly higher progression-free survival than the Carboplatin-Paclitaxel-radiotherapy combination. This increase in survival was accompanied by a significantly higher hematological and organ toxicity [fr

  5. Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río

    OpenAIRE

    Isabel Pérez Hernández

    2009-01-01

    El trabajo titulado "Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río”, constituye una extensión del Proyecto Investigativo Medio Ambiente y Deportes; el mismo tiene como finalidad contribuir al mejoramiento de la formación ambiental de los jóvenes y profesores, a través de la puesta en práctica de un sistema de actividades. Este proyecto ha de l...

  6. 76 FR 77768 - Information Collection; Flathead and McKenzie Rivers and McKenzie National Recreational Trail...

    Science.gov (United States)

    2011-12-14

    ... completed and validated, the hardcopy questionnaires will be discarded. Data will be imported into SPSS (Statistical Package for the Social Sciences) for analysis. The database will be maintained at the respective...

  7. Bringing the DuPont Profitability Model to Extension

    Science.gov (United States)

    Roucan-Kane, Maud; Wolfskill, L. A.; Boehlje, Michael D.; Gray, Allan W.

    2013-01-01

    This article discusses a financial training program used by Deere and Company for almost 10 years. The objective is to describe the program and to discuss a pre-test/post-test methodology to test the effectiveness of a program for possible duplication by Extension. Results show that participants significantly improved from the pre-test to the…

  8. Dupont Analysis of An Information Technology Enabled Competitive Advantage

    OpenAIRE

    Nustini, Yuni

    2009-01-01

    The transformation of business caused by e-business and e-commerce applications of the internet and related technologies demonstrates that information systems and information technologies are essential ingredients for business survival and success. The most often cited benefit of IT are integrating business process, increasing efficiency, sales, productivity, and competitiveness. This study is designed for determining where managers considering investment in information technology (IT) projec...

  9. Dupont Analysis of an Information Technology Enabled Competitive Advantage

    OpenAIRE

    Nustini, Yuni

    2003-01-01

    The transformation of business caused by e-business and e-commerce applications of the internet and related technologies demonstrates that information systems and information technologies are essential ingredients for business survival and success. The most often cited benefit of IT are integrating business process, increasing efficiency, sales, productivity, and competitiveness. This study is designed for determining where managers considering investment in information technology (IT) projec...

  10. Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río

    Directory of Open Access Journals (Sweden)

    Isabel Pérez Hernández

    2009-12-01

    Full Text Available El trabajo titulado "Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río”, constituye una extensión del Proyecto Investigativo Medio Ambiente y Deportes; el mismo tiene como finalidad contribuir al mejoramiento de la formación ambiental de los jóvenes y profesores, a través de la puesta en práctica de un sistema de actividades. Este proyecto ha de lograr que los jóvenes participen como agentes transformadores de cambio al modificar roles, actuaciones y conductas hacia el medio ambiente, lográndose una mejoría en la calidad de vida en los mismos y que se irradie al resto de la comunidad. Este conjunto de acciones sustentadas en vías formales, no formales e informales con un enfoque teórico metodológico, posibilitan el reconocimiento de prácticas ambientales sostenibles, desde una concepción dialéctica La formación ambiental en los estudiantes tendrá una repercusión significativa a partir de que los futuros egresados incidirán favorablemente en la actuación de las comunidades propiciando elementos de base para la ejecución de proyectos sostenibles ecológicamente y económicamente viables.

  11. Child-Centered Play Therapy: Nancy from Baldness to Curls.

    Science.gov (United States)

    Barlow, Karen; And Others

    1985-01-01

    Presents a case study of a four-year-old girl who had pulled out all her hair. The child's responsiveness to play therapy is described, and implications for the use of play therapy in school counseling situations are described. (JAC)

  12. Glazunov: From the middle ages, Op.79 / Nancy Malitz

    Index Scriptorium Estoniae

    Malitz, Nancy

    1990-01-01

    Uuest heliplaadist "Glazunov: From the middle ages, Op.79, Scenes de ballet, Op.52; Liadov: A musical snuffbox, Op.31. Scottish National Orchestra, Neeme Järvi. Chandos CD cassette ABTD 1432; CD CHAN 8804"

  13. Playboy Entertainment for Men Braille Edition June 1996:In collaboration with Rosita McKenzie

    OpenAIRE

    Douglas, Caroline

    2010-01-01

    'Playboy Entertainment for Men' features a passage of text read aloud from an article in the 1996 Braille edition of Playboy. The work interrogates issues of femininity, gender and prevailing relations of representation. Capturing the 'female' touch reading the 'male' gaze, it prompts dialogue between touch and the spoken word; seeing and projected fantasy; and text and image. The video was the recipient of the 9th International Keller Award.

  14. On-line retailing : a Canadian perspective / Brent McKenzie

    Index Scriptorium Estoniae

    McKenzie, Brent

    2001-01-01

    Kaanel ajak. ilmumisaeg Winter 2001/2002. Kanadas on interneti teel ostjaid alla 2% neist, kes vastavaid interneti-lehekülgi külastavad. Konservatiivset suhtumist saab aga muuta, kui pakkuda head ja turvalist teenust ning kaupa hea hinnaga

  15. On-line retailing : a Canadian perspective / Brent McKenzie

    Index Scriptorium Estoniae

    McKenzie, Brent

    2002-01-01

    Kaanel ajak. ilmumisaeg 2001/2002. Kanadas on interneti teel ostjaid alla 2% neist, kes vastavaid interneti-lehekülgi külastavad. Konservatiivset suhtumist saab aga muuta, kui pakkuda head ja turvalist teenust ning kaupa hea hinnaga

  16. E.I. duPont de Nemours & Co., Process Section Manufacturing Division, November 1956

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1956-12-15

    This document presents monthly progress at the Savannah River Plant in the 100, 200, 300, and 400 Areas. In the 100 Area (reactors), the power ascension program, the productivity improvement program and general progress is given. Tritium processing, 200-F increased capacity, and waste disposal are reported for the solvent extraction plants in the 200 Area. The increased productivity program is reported for the 300 Area. Dana plant activities and 400-D progress are reported in the 400 area report (heavy water).

  17. Feature-based Detection and Discrimination at DuPont's Lake Success Business Park, Connecticut

    National Research Council Canada - National Science Library

    Keiswetter, Dean A

    2007-01-01

    The objective of this demonstration was to determine if laser-positioned, high-density EM61 data acquired in a moving survey mode could support feature-based discrimination decisions for a canopied...

  18. Weyerhaeuser Export Facility at DuPont. Volume III. Appendices R - T.

    Science.gov (United States)

    1982-05-01

    0 a 0 lo Ř 4 - * a . 4a 44 -1~ a1 .. . 4 4 00. * 4 14 P 14 4 0~~0 6 4 44 14 a 1 4 w 4 Id . - ’U A U44 44 0 U C ’U 4 4 A U4 4 443 4444 %A 4 .41 F6 A...W.4) C) C. 0 -C4JC CCC),)."U! CCA ISC-a~ C" 0 , U 3 C - 4. 0A 00. L .UA.C L O L U CL- C0 .=0 0 0) .-C V C, a 2 0 ) ACCa LC1 LCC0C S C.0 a-. UU~~~ A Cz

  19. Mass customization and system development: case findings from the packaging industry / Andrus Kotri, Brent McKenzie

    Index Scriptorium Estoniae

    Kotri, Andrus

    2010-01-01

    Masstootmise kohandamise süsteemi loomisest keskmise suurusega Eesti tootmisettevõtte näitel. Masstootmise kohandamine on süsteem, mis kasutab paindlikke protsesse, organisatsiooni struktuure ja infotehnoloogiat tootmaks suurt hulka tooteid ja teenuseid, mis vastaksid klientide erinevatele vajadustele. Skeemid, tabel

  20. Numerical simulation studies of gas production scenarios from hydrate accumulations at the Mallik Site, McKenzie Delta, Canada

    International Nuclear Information System (INIS)

    Moridis, George J.; Collett, Timothy S.; Dallimore, Scott R.; Satoh, Tohru; Hancock, Stephen; Weatherill, Brian

    2002-01-01

    The Mallik site represents an onshore permafrost-associated gas hydrate accumulation in the Mackenzie Delta, Northwest Territories, Canada. An 1150 m deep gas hydrate research well was drilled at the site in 1998. The objective of this study is the analysis of various gas production scenarios from several gas-hydrate-bearing zones at the Mallik site. The TOUGH2 general-purpose simulator with the EOSHYDR2 module were used for the analysis. EOSHYDR2 is designed to model the non-isothermal CH(sub 4) (methane) release, phase behavior and flow under conditions typical of methane-hydrate deposits by solving the coupled equations of mass and heat balance, and can describe any combination of gas hydrate dissociation mechanisms. Numerical simulations indicated that significant gas hydrate production at the Mallik site was possible by drawing down the pressure on a thin free-gas zone at the base of the hydrate stability field. Gas hydrate zones with underlying aquifers yielded significant gas production entirely from dissociated gas hydrate, but large amounts of produced water. Lithologically isolated gas-hydrate-bearing reservoirs with no underlying free gas or water zones, and gas-hydrate saturations of at least 50% were also studied. In these cases, it was assumed that thermal stimulation by circulating hot water in the well was the method used to induce dissociation. Sensitivity studies indicated that the methane release from the hydrate accumulations increases with gas-hydrate saturation, the initial formation temperature, the temperature of the circulating water in the well, and the formation thermal conductivity. Methane production appears to be less sensitive to the rock and hydrate specific heat and permeability of the formation

  1. Surface CO2 Exchange Dynamics across a Climatic Gradient in McKenzie Valley: Effect of Landforms, Climate and Permafrost

    Directory of Open Access Journals (Sweden)

    Natalia Startsev

    2016-11-01

    Full Text Available Northern regions are experiencing considerable climate change affecting the state of permafrost, peat accumulation rates, and the large pool of carbon (C stored in soil, thereby emphasizing the importance of monitoring surface C fluxes in different landform sites along a climate gradient. We studied surface net C exchange (NCE and ecosystem respiration (ER across different landforms (upland, peat plateau, collapse scar in mid-boreal to high subarctic ecoregions in the Mackenzie Valley of northwestern Canada for three years. NCE and ER were measured using automatic CO2 chambers (ADC, Bioscientific LTD., Herts, England, and soil respiration (SR was measured with solid state infrared CO2 sensors (Carbocaps, Vaisala, Vantaa, Finland using the concentration gradient technique. Both NCE and ER were primarily controlled by soil temperature in the upper horizons. In upland forest locations, ER varied from 583 to 214 g C·m−2·year−1 from mid-boreal to high subarctic zones, respectively. For the bog and peat plateau areas, ER was less than half that at the upland locations. Of SR, nearly 75% was generated in the upper 5 cm layer composed of live bryophytes and actively decomposing fibric material. Our results suggest that for the upland and bog locations, ER significantly exceeded NCE. Bryophyte NCE was greatest in continuously waterlogged collapsed areas and was negligible in other locations. Overall, upland forest sites were sources of CO2 (from 64 g·C·m−2·year−1 in the high subarctic to 588 g C·m−2·year−1 in mid-boreal zone; collapsed areas were sinks of C, especially in high subarctic (from 27 g·C·m−2 year−1 in mid-boreal to 86 g·C·m−2·year−1 in high subarctic and peat plateaus were minor sources (from 153 g·C·m−2·year−1 in mid-boreal to 6 g·C·m−2·year−1 in high subarctic. The results are important in understanding how different landforms are responding to climate change and would be useful in modeling the effect of future climate change on the soil C balance in the northern regions.

  2. R. Tait McKenzie: Inspirational Sculptor and a Pioneer Advocate of Physical Activity for People with Disabilities

    Science.gov (United States)

    Reid, Greg; Jobling, Ian F.

    2012-01-01

    The London 2012 Summer Paralympics Mascot, "Mandeville", is named after the village of Stoke Mandeville, near Aylesbury in Buckinghamshire, England. This was where the inaugural Stoke Mandeville Games were held in 1948. On 28 July 1948, men and women who had been injured throughout the Second World War assembled in Stoke Mandeville for archery…

  3. Predicting a clinically important outcome in patients with low back pain following McKenzie therapy or spinal manipulation

    DEFF Research Database (Denmark)

    Petersen, Tom; Christensen, Robin; Juhl, Carsten Bogh

    2015-01-01

    Background: Reports vary considerably concerning characteristics of patients who will respond to mobilizing exercises or manipulation. The objective of this prospective cohort study was to identify characteristics of patients with a changeable lumbar condition, i.e. presenting with centralization...

  4. D. McKenzie, C. Miller and D.A. Falk, eds. The Landscape Ecology of Fire [book review

    Science.gov (United States)

    Eric J. Gustafson

    2012-01-01

    In the Foreword of this volume is the statement that "landscape ecology is the 'glue' that holds ecosystem theory together and nowhere is that more evident than in the study of wildland fire ecology." The Landscape Ecology of Fire summarizes how landscape ecology has contributed to, and been formed by, the study...

  5. THE SETTLERS PHOTOGRAPHIC COLLECTION 1894 - 1945 & THE DUPONT PHOTOGRAPHIC COLLECTION 1943 - 1945 BRINGING HISTORY TO LIFE IN SOUTH CENTRAL WASHINGTON

    Energy Technology Data Exchange (ETDEWEB)

    SHULTZ CR (KIT) PH.D.

    2009-07-13

    Washington is called the 'Evergreen State' and it evokes images like this of lush forests, lakes and mountains. However, such images apply primarily to the half of the state west of the Cascade Mountains, where we are today. Eastern Washington state is quite a different matter and I want to draw your attention to a portion of Eastern Washington that is the focus ofmy presentation to you this morning. This image was taken on a part of the Department of Energy's Hanford Site, a 586-square mile government reservation, the second largest DOE facility in the nation . Here you can see where I am talking about, roughly 220 miles southeast of Seattle and about the same distance northeast of Portland.

  6. 75 FR 55613 - Dupont Teijin Films Including On-Site Leased Workers From Schenkers Logistics, Inc., Florence, SC...

    Science.gov (United States)

    2010-09-13

    ... Including On-Site Leased Workers From Schenkers Logistics, Inc., Florence, SC; Amended Certification... Teijin Films, including on-site leased workers from Schenkers Logistics, Inc., Florence, South Carolina... leased workers of Schenkers Logistics, Inc., Florence, South Carolina, who became totally or partially...

  7. E.I. DuPont De Nemours & Company/Oberlin Filter Company Microfiltration Technology. Applications Analysis Report

    Science.gov (United States)

    This report evaluates the DuPont/Oberlin microfiltration technology’s ability to remove metals (present in soluble or insoluble form) and particulates from liquid wastes while producing a dry filter cake and a filtrate that meet applicable disposal requirements. This report also ...

  8. Should DuPont and DUSA International be Considered a Single Source for Title V and PSD

    Science.gov (United States)

    This document may be of assistance in applying the Title V air operating permit regulations. This document is part of the Title V Policy and Guidance Database available at www2.epa.gov/title-v-operating-permits/title-v-operating-permit-policy-and-guidance-document-index. Some documents in the database are a scanned or retyped version of a paper photocopy of the original. Although we have taken considerable effort to quality assure the documents, some may contain typographical errors. Contact the office that issued the document if you need a copy of the original.

  9. Ichthyoplankton (biological) data collected aboard the NOAA ship Nancy Foster during cruise 0903

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Station data and ichthyoplankton (biological) data from cruise 0903 from the US Virgin Islands, British Virgin Islands, Puerto Rico, Anegada Passage, Leeward Islands...

  10. USVI 2011, Ground Validation ROV Transect Points, NOAA Ship Nancy Foster (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile denotes the location of underwater photos and/or video that were collected by NOAA scientists using a Spectrum Phantom S2 ROV (remotely operated...

  11. USVI 2011, Ground Validation ROV Transect Lines, NOAA Ship Nancy Foster (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile denotes the location of underwater photos and/or video that were collected by NOAA scientists using a Spectrum Phantom S2 ROV (remotely operated...

  12. USVI 2011, Ground Validation ROV Transect Lines, NOAA Ship Nancy Foster

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile denotes the location of underwater photos and/or video that were collected by NOAA scientists using a Spectrum Phantom S2 ROV (remotely operated...

  13. USVI 2011, Ground Validation ROV Transect Points, NOAA Ship Nancy Foster

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile denotes the location of underwater photos and/or video that were collected by NOAA scientists using a Spectrum Phantom S2 ROV (remotely operated...

  14. Deepwater Canyons 2012: Pathways to the Abyss on NOAA Ship Nancy Foster between 20120815 and 20121001

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Mid-Atlantic Deep-Water Canyons project is co-funded by the Bureau of Ocean Energy Management (BOEM) and NOAA's Office of Ocean Exploration and Research (which...

  15. 2011 Origins of Solar Systems Gordon Research Conference %A Ryan Gray, Nancy

    Science.gov (United States)

    This proposal requests funding of $30,000 from NASA to support registration and/or travel costs of participants, such as but not limited to world-renown experts and/or young scientists (postdocs, graduate students, etc.) new to the field, who would not otherwise we able to participate in the Gordon Research Conference (GRC) on the Origins of Solar Systems. The past ten GRCs on this topic have fueled the rapid progress of discovery and ignited new areas of inquiry within this theme. The “Origins” GRC is the only forum that brings together the required expertise, at the correct frequency, on a consistent basis in the field today. The goals of this meeting are directly aligned with the strategic goals of NASA (by historical design). The opportunity for professional development for graduate students and young researchers in this interdisciplinary area are unique. We believe NASA Origins support is vital to the long-term success of this meeting series and the role it plays in the success of the “Origins” program overall.

  16. European Cinema and the Postheroic Narrative: Jean-Luc Nancy, Claire Denis, and 'Beau Travail'

    NARCIS (Netherlands)

    Elsaesser, T.

    2012-01-01

    What is European cinema? First: European cinema does not exist, except as a bureaucratic dream or a promotional tool for national producers and distributors of art house films. Second: insofar as it is willed into existence, European cinema has over the past three decades been funded mainly by

  17. Medical and administrative management by computing devices in the service of nuclear medicine of Nancy

    International Nuclear Information System (INIS)

    Legras, B.; Chau, N.; Lambert, J.-P.; Martin, J.; Bertrand, A.

    1977-01-01

    The results of the processing of the administrative and medical data collected in a Department of Nuclear medicine are presented. For a moderate increase in the secretaries' work (limited by the use of carbon copies) and for minor efforts of the doctors, the resulting dvantages are tremendous. A detailed balance of the Department activity can be obtained monthly. From the medical files, the computer provides statistical data and listings in clear form (with or without sort) of the selected records [fr

  18. Pragmatism, feminism ja lingvistiline pööre / Nancy Fraser ; tõlk. Merilin Sikk

    Index Scriptorium Estoniae

    Fraser, Nancy

    2006-01-01

    Üks feministliku teoretiseerimise olulisemaid ja raskemaid ülesandeid on ühendada soolise tähistamise diskursiivsed analüüsid institutsioonide ja poliitökonoomia strukturaalsete analüüsidega, väidab autor

  19. Review: Annette N. Markham & Nancy K. Baym (Eds. (2009. Internet Inquiry: Conversations About Method

    Directory of Open Access Journals (Sweden)

    Alp Biricik

    2010-08-01

    Full Text Available As suggested by the title, this edited collection of articles is aimed at creating a dialogue on crosscutting epistemological and methodological issues relating to qualitative internet study. The scope of the book is not to provide quick tips, but rather encourage the reader to seek new methods of conducting online research. The book is creatively structured into six parts, each one addressing a key question on methods. In addition to the two editors' contributions, 13 accomplished scholars from various disciplines intelligibly respond and share their own qualitative research experiences in online environments, providing a precise and valuable contribution to current debates in internet studies. URN: urn:nbn:de:0114-fqs100396

  20. Revolution without Guarantees: Community and Subjectivity in Nancy, Lingis, Sartre and Levinas

    Directory of Open Access Journals (Sweden)

    Andrew Ryder

    2012-05-01

    Full Text Available Jean-Luc Nancy’s The Inoperative Community, a collection of writings first published in 1985 and 1986, suggests an understanding of community as irreducibly linked to finitude. Alongside this, he advocates a redefinition of the project of revolutionary communism. This endeavor draws equally on the writings on communication of Georges Bataille and the insistence on finitude found in Martin Heidegger. First, we should recapitulate Nancy’s argument in order to determine his presentation of a novel politics as well as the links and disjunctions of his predecessors. More than this, I would like to suggest that a reading of Alphonso Lingis’s The Community of Those Who Have Nothing in Common, published almost a decade later, suggests an intriguing and promising extension or modification of Nancy’s argument. In particular, Lingis suggests an understanding of revolution that appears somewhat closer to the Marxist tradition. I argue that this is partly a result of an inheritance from Emmanuel Levinas, and in particular his account of ethical subjectivity, which, surprisingly, can be productively allied with the political thought of Jean-Paul Sartre. This friendship between the ethics of Levinas and the politics of Sartre suggests the best groundwork for Lingis’s development of Nancy’s insights.

  1. THE SETTLERS PHOTOGRAPHIC COLLECTION 1894 - 1945 and THE DUPONT PHOTOGRAPHIC COLLECTION 1943 - 1945 BRINGING HISTORY TO LIFE IN SOUTH CENTRAL WASHINGTON

    International Nuclear Information System (INIS)

    Shultz, C.R.

    2009-01-01

    Washington is called the 'Evergreen State' and it evokes images like this of lush forests, lakes and mountains. However, such images apply primarily to the half of the state west of the Cascade Mountains, where we are today. Eastern Washington state is quite a different matter and I want to draw your attention to a portion of Eastern Washington that is the focus ofmy presentation to you this morning. This image was taken on a part of the Department of Energy's Hanford Site, a 586-square mile government reservation, the second largest DOE facility in the nation . Here you can see where I am talking about, roughly 220 miles southeast of Seattle and about the same distance northeast of Portland.

  2. The Bert and Peggy DuPont lecture. "Love, death, and commitment: twenty three years of HIV and genocide prevention in Africa" or "Passionate not equal unhinged".

    Science.gov (United States)

    Allen, Susan

    2010-01-01

    Over the last 20 years, HIV emerged as the #1 cause of death in African adults, and the Rwanda genocide became the most concentrated mass murder in recorded history. Though one catastrophe surfaced slowly and inexorably while the other smoldered for years before exploding in 1994, the lessons learned are similar. In both situations, the international community has combined moral bankruptcy with a spectacular display of incompetence. Genocide masterminds continue living in Michigan, Minneapolis and Boston, brazenly planning the final extermination of the Tutsi. Students of law, diplomacy and international development are astoundingly sanguine about this, as though our current abdication of responsibility today is mitigated by the centuries of unprincipled idiots who preceded us. If medicine operated this way we'd still be treating syphilis with arsenic. Unfortunately, medicine has lost the moral high ground in Africa through missed opportunities and misappropriation of resources. In the last five years we have spent 20% of the US bilateral foreign assistance budget putting 2.5 million Africans on anti-retroviral treatment (ART), while twice that number of new HIV infections occurred. We tested 50 million Africans for HIV without acting on the evidence and common sense: rather than-transmission happens between two people. Had we tested Africans as couples, a prevention strategy proven to be effective in multiple publications since the early '90s, we could have averted more HIV infections than we are now treating, and at a fraction of the cost.

  3. NOAA TIFF Image - 50m Backscatter, Charleston Bump - Deep Coral Priority Areas - Nancy Foster - (2006), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 30x30 meter cell size representing the backscatter intensity of the Charleston Bump off of the South Atlantic Bight,...

  4. Infection of foxes by Echinococcocus multilocularis in urban and suburban areas of Nancy, France: influence of feeding habits and environment

    Directory of Open Access Journals (Sweden)

    Robardet E.

    2008-03-01

    Full Text Available This study evaluated the impact of biological and environmental factors on the infection of red foxes (Vulpes vulpes by Echinococcus multilocularis in an endemic area of north-east France. From January 2004 to April 2006, 127 foxes were examined for E. multilocularis and their stomach contents analysed. The effect of year, season, age, sex and urbanisation level on E. multilocularis presence was estimated using a General Linear Model (GLM with logit link, (i.e. logistic regression. Urbanisation level was the only influencing factor, with a decreasing gradient from rural [54%, CI 95% (40-68] to peri-urban [31%, CI 95% (15-52] and urban area [4%, CI 95% (0.7-15]. The consumption of Arvicola terrestris and Microtus sp., grassland species, the main presumed intermediate hosts of E. multilocularis, was studied by the same approach. The two species were consumed less in the urban area and more in autumn than in spring. Anthropogenic food consumption was linked to urbanisation and to age. The frequency of anthropogenic food consumption decreased in the rural area. A global model explaining the presence of E. multilocularis and including urbanisation level and diet was then elaborated. Independently of urbanisation, there was a suggestion of less E. multilocularis infection with anthropogenic food consumption. Red foxes consuming Microtus sp. and A. terrestris had higher worm burden than those that did not. The results suggest that the decreasing gradient observed from rural to urban area is linked to behaviour and feeding habits.

  5. NOAA TIFF Image - 30m Rugosity, Charleston Bump - Deep Coral Priority Areas - Nancy Foster - (2006), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 30x30 meter cell size representing the 2006 multibeam bathymetry of the Charleston Bump off of the South Atlantic Bight,...

  6. NOAA TIFF Image - 30m Slope, Charleston Bump - Deep Coral Priority Areas - Nancy Foster - (2006), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 30x30 meter cell size representing the slope (in degrees) of the 2006 multibeam bathymetry of the Charleston Bump off of...

  7. The brain and the biology of belief: An interview with Andrew Newberg, MD. Interview by Nancy Nachman-Hunt.

    Science.gov (United States)

    Newberg, Andrew

    2009-01-01

    Andrew Newberg, MD, is an associate professor in the Department of Radiology, Division of Nuclear Medicine, at the Hospital of the University of Pennsylvania, Philadelphia, with secondary appointments in the Departments of Psychiatry and Religious Studies. He is actively involved in neuroimaging research projects, including the study of the neurophysiological correlates of meditation and other types of complementary therapies. Dr Newberg's research now largely focuses on how brain function is associated with various mental states, in particular, the relationship between brain function and mystical or religious experiences. He has authored several books, including Why God Won't Go Away: Brain Science and the Biology of Belief (Ballantine/Random House, 2001) and coauthor with Eugene G. d'Aquili, MD, of The Mystical Mind: Probing the Biology of Religious Experience (Fortress Press, 1999). His most recent book is How God Changes Your Brain, with coauthor Mark Waldman (Ballantine Books, 2009).

  8. FILOSOFÍA COMO POLÍTICA, FABULACIÓN Y CINE. NIETZSCHE, BERGSON, NANCY Y DELEUZE

    Directory of Open Access Journals (Sweden)

    Óscar Barragán Martínez

    2012-01-01

    Full Text Available El texto propone una mirada de la filosofía como política a través de la estética. Para ello, recurre a nociones nietzscheanas como las de invención y valoración, con las cuales intenta socavar, con la filosofía deleuziana, la supremacía del concepto de pueblo. Desde el cine podemos apreciar mejor la propuesta de que el pueblo siempre falta, y es con un autor como Jean Marie Straub que la imagen cinematográfica será inmediatamente política en su deriva hacia nuevos derroteros en los que el pueblo está intervenido por actos de habla filosóficos.

  9. Filosofía como política, fabulación y cine. Nietzsche, Bergson, Nancy y Deleuze

    Directory of Open Access Journals (Sweden)

    Óscar Barragán Martínez

    2012-10-01

    Full Text Available El texto propone una mirada de la filosofía como política a través de la estética. Para ello, recurre a nociones nietzscheanas como las de invención y valoración, con las cuales intenta socavar, con la filosofía deleuziana, la supremacía del concepto de pueblo. Desde el cine podemos apreciar mejor la propuesta de que el pueblo siempre falta, y es con un autor como Jean Marie Straub que la imagen cinematográfica será inmediatamente política en su deriva hacia nuevos derroteros en los que el pueblo está intervenido por actos de habla filosóficos.

  10. Väär vastandus: vastus Seyla Benhabibile ja Judith Butlerile / Nancy Fraser ; tõlk. Merilin Sikk

    Index Scriptorium Estoniae

    Fraser, Nancy

    2006-01-01

    Benhabibi-Butleri mõttevahetus tekitab autori arvates väära vastanduse ning ebavajalikke polarisatsioone. Feministid ei pea valima kriitilise teooria ja poststrukturalismi vahel, selle asemel võiks rekonstrueerida kumbagi lähenemist viisil, et see teisega sobituks, leiab autor

  11. Methodological guide for the integration of the evaluation in the study plan d at “Nancy Uranga Romagoza” Faculty

    Directory of Open Access Journals (Sweden)

    Bienvenido Emilio Viera-Sánchez

    2013-08-01

    Full Text Available The integrating evaluation conception in the Study Plan D of the Physical Culture career will be always a pertinent and current topic, according to the new orientations about evaluation which indicate the final test realization in all subjects. This fact demands from a revision of the integration as a way to establish an appropriate equilibration of the evaluation in the academic year, as well as the inclusion of the state test like a form of studies' ending, occasion when the student shall solve a physical culture problem in one of the professional performance fields, which solution will certainly have a remarkable integrating character. As a result of a carried out study there is an instructive material for the teachers that contains different ways to integrate the contents of the subjects, disciplines and academic years in the third school year integrating test of Physical Education Didactics. In this kind of evaluation it can be better seen the students' difficulties on professional competences. Besides the exam's numbers reduced and the self preparation time saving, as well as result's quality are improved.

  12. NURE aerial gamma-ray and magnetic detail survey: Mt. Leona-Nancy Creek, Washington area. Final report

    International Nuclear Information System (INIS)

    1981-07-01

    Volume II contains the following: flight line base maps; magnetic contour maps; maps for uranium, thorium, potassium uranium/thorium, thorium/potassium, uranium/potassium; multi-variate analysis maps; geochemical analysis maps; multi-variate histograms and statistical summaries for uranium, thorium, uranium/potassium, uranium/thorium, and thorium/potassium

  13. INSISTÊNCIAS DEMOCRÁTICAS: ENTREVISTA COM MIGUEL ABENSOUR, JEAN-LUC NANCY & JACQUES RANCIÈRE

    Directory of Open Access Journals (Sweden)

    Vinícius Nicastro Honesko

    2015-07-01

    Full Text Available Realizada por Stany Grelet, Jérôme Lèbre & Sophie Wahnich. Traduzida do francês por Vinícius Nicastro Honesko.NB: A entrevista foi originalmente publicada na revista Vacarme (n. 48, verão de 2009 e está disponível no endereço: http://www.vacarme.org/article1772.html.

  14. INSISTÊNCIAS DEMOCRÁTICAS: ENTREVISTA COM MIGUEL ABENSOUR, JEAN-LUC NANCY & JACQUES RANCIÈRE

    Directory of Open Access Journals (Sweden)

    Vinícius Nicastro Honesko

    2015-07-01

    Full Text Available Realizada por Stany Grelet, Jérôme Lèbre & Sophie Wahnich. Traduzida do francês por Vinícius Nicastro Honesko. NB: A entrevista foi originalmente publicada na revista Vacarme (n. 48, verão de 2009 e está disponível no endereço: http://www.vacarme.org/article1772.html.

  15. One Million Climate Jobs or 528 Megatons of Greenhouse Gases? An interview with Jonathan Neale and Nancy Lindisfarne

    Directory of Open Access Journals (Sweden)

    Nikolai Jeffs

    2015-12-01

    Full Text Available An interview addresses one of the currently most important environmental and political iniciatives in the United Kingdom of Great Britain and Northern Ireland – the One million Climate Jobs Campaign. An extensive programme of change, which was prepared as part of this campaign, is discussed and with it many of the political and socio-economic areas that are affected by climate change and that thus directly alter human life. The interlocutors reveal how the barriers to solving the problem of pollution stem from our reality – capitalism and its corresponding organisation of the economy and society. Special attention is also given to the fact that some of the world’s crises are usually the consequence of interests of the fossil fuels elites and the profits inevitably connected to them. All this means that in order to achieve any real changes in the ways we treat our planet, what is needed is radical social transformation.

  16. The McKenzie method compared with manipulation when used adjunctive to information and advice in low back pain patients presenting with centralization or peripheralization. A randomized controlled trial

    DEFF Research Database (Denmark)

    Petersen, Tom; Larsen, Kristian; Nordsteen, Jan

    2011-01-01

    as a reduction of at least 5 points or an absolute score below 5 points on the Roland Morris Questionnaire. Secondary outcomes were reduction in disability and pain, global perceived effect, general health, mental health, lost work time, and medical care utilization.Results. Both treatment groups showed...

  17. NOAA TIFF Image - Backscatter - Lang Bank, St. Croix, USVI - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-1907-NF-14 (2014), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This geotiff represents a 1 meter resolution backscatter mosaic of the reef shelf and the steep slopes of the Lang Bank (H12639) of St. Croix, US Virgin Islands. The...

  18. NOAA TIFF Image - 10m Bathymetric Slope, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2009), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the slope (in degrees) of several deep coral priority areas off the South Atlantic...

  19. La comunidad en obra. Jean-Luc Nancy en diálogo con Maurice Blanchot: Un desacuerdo tácito

    NARCIS (Netherlands)

    van Rooden, A.

    2011-01-01

    From the nancyan notion of community as being-in-common, whose formation can not be determinate or realized neither from an essence nor as an origin, destiny or project, but as the simple being together of singularities, beyond their foundation, legitimation or desire of system, the text approaches

  20. NOAA TIFF Image - 30m Multibeam Bathymetry, Charleston Bump - Deep Coral Priority Areas - Nancy Foster - (2006), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 30x30 meter cell size representing the bathymetry of the Charleston Bump off of the South Atlantic Bight, derived from...

  1. Re-irradiation after salvage mastectomy for local recurrence after a conservative treatment: a retrospective analysis of twenty patients (Nancy: 1988-2001)

    International Nuclear Information System (INIS)

    Racadot, S.; Marchal, C.; Charra-Brunaud, C.; Peiffert, D.; Bey, P.; Verhaeghe, J.L.

    2003-01-01

    Purpose. - To retrospectively assess the efficacy of post-mastectomy re-irradiation for local relapse of breast cancer. Patients and methods. - Twenty patients, initially treated by conservative surgery and radiotherapy (50 Gy in 25 fractions over 5 weeks) were treated from 1998 to 2001 for a local relapse by salvage mastectomy and re-irradiation (either electron or photon beams). Mean age was 53 years (31-71). Reasons for re-irradiation were that the local relapses were inflammatory (4 pts), multifocal (5 pts), cutaneous (5 pts), involved the nipple (3 pts) or because the surgical margins (either muscle or skin) were involved (3 pts). The median dose of re-irradiation was 45 Gy (33-65) in 15 fractions over 33 days. Mean follow-up was 48 months (5-97). Results. - Fifteen patients remained free of a second local recurrence and 10 were still alive, without metastasis. Neither the dose of re-irradiation nor the irradiated surfaces were prognostic factors of local control (P = 0.877 and P = 0.424). Five patients developed radiation-induced pneumonitis without functional respiratory impairment. The incidence of pneumonitis seemed to be related to the biological dose of re-irradiation (P = 0.037). Other late complications occurred such as pigmentation changes (12 pts), telangiectasia (8 pts), chondritis (2 pts), parietal fibrosis (7 pts), rib fractures (4 pts), severe pain (11 pts) and lymphedema (2 pts). The increase in biological equivalent dose was highly statistically linked with the occurrence of disabling pain (P = 0.0123). Conclusion. - Parietal re-irradiation achieves good and lasting local control with an acceptable rate of acute complications but with a risk of disabling late sequelae such as severe pain. (author)

  2. NCCOS Caribbean Fishery Acoustic Assessment: Fish Density Data Collection from NOAA Ship Nancy Foster, from 2008-03-26 to 2014-05-31 (NCEI Accession 0156395)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data sets show acoustically detected fish densities throughout the Caribbean ocean. NOAA/NCCOS collected these data sets to help characterize broad-scale fish...

  3. NOAA TIFF Image - 10m Bathymetric Rugosity, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2007), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the rugosity of several deep coral priority areas off the South Atlantic Bight,...

  4. NOAA TIFF Image - 10m Multibeam Bathymetry, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2010), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the bathymetry of several deep coral priority areas off the South Atlantic Bight,...

  5. NOAA TIFF Image - 10m Backscatter Mosaic, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2009), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the backscatter (intensity) of several deep coral priority areas off the South...

  6. NOAA TIFF Image - 10m Multibeam Bathymetry, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2007), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the bathymetry of several deep coral priority areas off the South Atlantic Bight,...

  7. NOAA TIFF Image - 10m Backscatter Mosaic, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2010), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the backscatter (intensity) of several deep coral priority areas off the South...

  8. NOAA TIFF Image - 5m Backscatter Mosaic, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2007), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 5x5 meter cell size representing the backscatter (intensity) of several deep coral priority areas off the South Atlantic...

  9. On the Paradox of the Political/Transcendence and Eschatology: Transimmanence and the Promise of Love in Jean-Luc Nancy

    Directory of Open Access Journals (Sweden)

    Schalk Hendrik Gerber

    2017-02-01

    Full Text Available The debate on the possibility of re-thinking transcendence at the so-called end or closure of the metaphysical tradition and its relation to the political is situated at the heart of contemporary continental philosophy of religion. This article engages the debate by reviewing what is to be thought or anticipated at the closure. Firstly, the problem of engaging with transcendence at the closure of metaphysics is outlined as a discussion on what is possibly meant by the end of transcendence and onto-theology. Subsequently, the question concerning the political and its inseparable relation to transcendence is sketched and denoted by the phrase “the political/transcendence”. Secondly, Levinas’ and Nancy’s respective attempts at addressing the problem are explored in the form of a debate, with the outcome suggesting a possible gesture towards Nancy’s reconception of transcendence as transimmanence, found in his notion of “the promise of love”, on “how” to anticipate rather than “what” to anticipate in these end times.

  10. NOAA Shapefile - Drop Camera Transects Lines, USVI 2011 , Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile denotes the location of underwater video that was collected by NOAA scientists using a SeaViewer drop camera system. Video was collected between...

  11. Evaluation of the diagnostic performance of SPECT coupled to tomodensitometry (SPECT-CT) in the daily practice of bone scintigraphy at the Nuclear Medical station of Nancy

    International Nuclear Information System (INIS)

    Netter, F.; Journo, A.; Mayer, J.C.; Grandpierre, S.; Daragon, N.; Karcher, G.; Olivier, P.; Scigliano, S.

    2008-01-01

    Objective: The purpose of our study was to evaluate the diagnostic performance of SPECT coupled to computed axial tomography (SPECT- CT) in our daily practice of bone scintigraphy. Subjects and methods: SPECT- CT obtained as a complement to the planar bone scintigraphy in 39 patients were studied. Each type of image was retrospectively read by two different observers: a nuclear medicine physician who was unaware of SPECT- CT results analysed planar bone scintigraphy, a second one who was unaware of planar bone scintigraphy results analysed SPECT- CT images. In this population of patients, 17 patients were addressed in an oncologic setting. The 22 other patients were addressed for pain of indeterminate origin without neoplastic context. Results: In 13% of the cases, SPECT- CT specified the precise location of increased uptake foci seen on planar bone scintigraphy. In 38% of cases, SPECT- CT confirmed a diagnosis suspected by the planar bone scintigraphy. In 10% of cases, SPECT- CT established a diagnosis that was uncertain with planar bone scintigraphy. In 26% of cases, SPECT- CT brought no additional information. Finally in 3% of cases, SPECT- CT proved to be more sensitive than planar images. Conclusion: Our study demonstrates the utility of SPECT- CT in the daily practice of bone scintigraphy, this complementary imaging study benefited to 74% of our patients. (authors)

  12. NOAA TIFF Image - SouthWest Shelf, St. Croix, USVI - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-1907-NF-14 (2014), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution bathymetry of the reef shelf and the steep slopes of the Southwest Shelf (H12640) of St. Croix, US Virgin Islands. The...

  13. On the Paradox of the Political/Transcendence and Eschatology: Transimmanence and the Promise of Love in Jean-Luc Nancy

    NARCIS (Netherlands)

    Gerber, Schalk; van der Merwe, W.L.

    2017-01-01

    The debate on the possibility of re-thinking transcendence at the so-called end or closure of the metaphysical tradition, and its relation to the political, is situated at the heart of contemporary continental philosophy of religion. This article engages the debate by reviewing what is to be thought

  14. Multibeam collection for NF-13-09: Multibeam data collected aboard Nancy Foster from 2013-08-21 to 2013-08-28, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  15. NOAA TIFF Image - Bathymetry - Lang bank, St. Croix, USVI - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-1907-NF-14 (2014), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution bathymetry of the reef shelf and the steep slopes of Lang Bank (H12639) of St. Croix, US Virgin Islands. The M-I907-NF-14...

  16. NOAA TIFF Image - 10m Multibeam Bathymetry, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2009), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the bathymetry of several deep coral priority areas off the South Atlantic Bight,...

  17. NOAA TIFF Image - 10m Bathymetric Slope, South Atlantic Bight - Deep Coral Priority Areas - NOAA Ship Nancy Foster - (2007), UTM 17N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a unified GeoTiff with 10x10 meter cell size representing the slope (in degrees) of several deep coral priority areas off the South Atlantic...

  18. 76 FR 14393 - Notice of Receipt of Requests for Amendments To Delete Uses in Certain Pesticide Registrations

    Science.gov (United States)

    2011-03-16

    ... Aldicarb Aldicarb Use on Coffee. Pesticide. 352-604 DuPont Tanos Famoxadone & Cymoxanil.. Leaf Petioles...: Manager, U.S.-- Registration, DuPont Crop Protection, 1007 Market Street, Wilmington, DE 19898-0001. 8536...

  19. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available in C58, Dupont) ... Length = 112 ... Query: 205 IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEA...RRLM 264 ... IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEARRLM Sbjct: 1 ... IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEARRLM 60 ...

  20. 75 FR 51845 - Chrysler Group, LLC Manufacturing Division St. Louis North Plant Including On-Site Leased Workers...

    Science.gov (United States)

    2010-08-23

    ... produce performance coating solutions for vehicles. The company reports that workers leased from DuPont Performance Coatings, a wholly-owned subsidiary of E.I. DuPont de Nemours Company, OEM, were employed on-site..., C R Associates, Syncreon, Robinson Solutions and Dupont Performance Coatings Fenton, MO; Amended...

  1. Re-irradiation after salvage mastectomy for local recurrence after a conservative treatment: a retrospective analysis of twenty patients (Nancy: 1988-2001); Re-irradiation parietale apres mastectomie de rattrapage pour recidive d'un cancer du sein apres traitement conservateur: etude retrospective sur 20 patientes (Nancy: 1988-2001)

    Energy Technology Data Exchange (ETDEWEB)

    Racadot, S.; Marchal, C.; Charra-Brunaud, C.; Peiffert, D.; Bey, P. [Centre Alexis-Vautrin, Service de Radiotherapie, 54 - Vandoeuvre-les-Nancy (France); Verhaeghe, J.L. [Centre Alexis-Vautrin, Service de Chirurgie, 54 - Vandoeuvre-les-Nancy (France)

    2003-12-01

    Purpose. - To retrospectively assess the efficacy of post-mastectomy re-irradiation for local relapse of breast cancer. Patients and methods. - Twenty patients, initially treated by conservative surgery and radiotherapy (50 Gy in 25 fractions over 5 weeks) were treated from 1998 to 2001 for a local relapse by salvage mastectomy and re-irradiation (either electron or photon beams). Mean age was 53 years (31-71). Reasons for re-irradiation were that the local relapses were inflammatory (4 pts), multifocal (5 pts), cutaneous (5 pts), involved the nipple (3 pts) or because the surgical margins (either muscle or skin) were involved (3 pts). The median dose of re-irradiation was 45 Gy (33-65) in 15 fractions over 33 days. Mean follow-up was 48 months (5-97). Results. - Fifteen patients remained free of a second local recurrence and 10 were still alive, without metastasis. Neither the dose of re-irradiation nor the irradiated surfaces were prognostic factors of local control (P = 0.877 and P = 0.424). Five patients developed radiation-induced pneumonitis without functional respiratory impairment. The incidence of pneumonitis seemed to be related to the biological dose of re-irradiation (P = 0.037). Other late complications occurred such as pigmentation changes (12 pts), telangiectasia (8 pts), chondritis (2 pts), parietal fibrosis (7 pts), rib fractures (4 pts), severe pain (11 pts) and lymphedema (2 pts). The increase in biological equivalent dose was highly statistically linked with the occurrence of disabling pain (P = 0.0123). Conclusion. - Parietal re-irradiation achieves good and lasting local control with an acceptable rate of acute complications but with a risk of disabling late sequelae such as severe pain. (author)

  2. QDR 2001: Strategy-Driven Choices for America’s Security

    Science.gov (United States)

    2001-04-01

    McKenzie, Jr., USMC; Lieutenant Colonel Philip M. Ruhlman , USAF; Lieutenant Colonel John J. Spinelli, USA; and Captain Sam J. Tangredi, USN. Their...one chosen by their service: Lieutenant Colonel Frank McKenzie, USMC; Lieutenant Colonel Philip Ruhlman , USAF; Lieutenant Colonel John Spinelli, USA

  3. The Molecular Epidemiology of Malaria in Western Kenya

    Science.gov (United States)

    2002-09-01

    transcriptional activation. Proc Natl Acad Sci USA 1997 94(7): 3195-9. 27. Uglialoro AM, Turbay D, Pesavento PA, Delgado JC, McKenzie FE, Gribben JG, Hartl D...Uglialoro AM, Turbay D, Pesavento PA, Delgado JC, McKenzie FE, Gribben JG, Hartl D, Yunis EJ, Goldfeld AE. Identification of three new single nucleotide

  4. Hematological changes among Beninese motor-bike taxi drivers ...

    African Journals Online (AJOL)

    user

    2INSERM U954, Nutrition Genetic and Exposure to Environmental Risks, Nancy University, Medical Faculty of Nancy,. France. .... corpuscular hemoglobin concentration (MCHC) and mean ..... by the Ministry of Higher Education and Scientific.

  5. Kuu plaat : Galaktlan "Constance". Plaadid kauplusest Lasering

    Index Scriptorium Estoniae

    2005-01-01

    Heliplaatidest: Galaktlan "Constance", Bonnie "Prince" Billy & Matt Sweeney "Superwolf", Hinkus feat. Maarja "Look around", Noizmakaz "Valitud mõtted", Hedvig Hanson & Andre Maaker "You Bring Me Yoy", Nancy Sinatra "Nancy Sinatra"

  6. NOAA TIFF Image - 1m Backscatter Mosaic, Puerto Rico 2013, Vieques, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI, UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the bathymetry of a reef shelf/bank south of Vieques, Puerto Rico. NOAA's NOS/NCCOS/CCMA...

  7. NOAA TIFF Image - NF12_PR_1002_bathy_8m.tif - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution bathymetry of a reef shelf/bank and the steep canyons and slopes of the NE Reserve, offshore of Fajardo, Puerto Rico. The...

  8. NOAA TIFF Image - NF12_PR_7125_bathy_4m.tif - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83 (NCEI Accession 0131856)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution bathymetry of a reef shelf/bank and the steep canyons and slopes of the NE Reserve, offshore of Fajardo, Puerto Rico. The...

  9. Multibeam collection for NF-12-05-SBNMS: Multibeam data collected aboard Nancy Foster from 2012-06-11 to 2012-06-29, Savannah, GA to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. Multibeam collection for NF-09-05-GRNMS: Multibeam data collected aboard Nancy Foster from 2009-06-08 to 2009-06-19, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  11. Underway meteorological, navigational, physical and time series data collected aboard NOAA Ship Nancy Foster in the North Atlantic Ocean from 2014-05-19 to 2014-05-20 (NODC Accession 0118685)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0118685 contains raw underway meteorological, navigational, physical and time series data logged by the Scientific Computer System (SCS) aboard NOAA...

  12. Oceanographic data collected during the Atlantic Deep-Water Canyons: Pathways to the Abyss 2011 on NOAA Ship Nancy Foster in the North Atlantic Ocean from 2011-06-04 to 2011-06-17 (NODC Accession 0082240)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Submarine canyons are dominant features of the outer continental shelf and slope of the US East coast from Cape Hatteras to the Gulf of Maine. They are important...

  13. La Dimensión Medioambiental en el perfil profesional del estudiante de Cultura Física en la SUM Nancy Uranga Romagoza del Municipio Consolación Del Sur

    Directory of Open Access Journals (Sweden)

    Eduardo de Jesús de la Maza Sánchez

    2009-12-01

    Full Text Available La Educación Medioambiental es hoy unas de las prioridades del perfeccionamiento educacional, basada en la práctica, es la creación de valores que hagan que el comportamiento del hombre hacia el cuidado y protección del medio ambiente sean actitudes cotidianas. Para ello cada educación ha trazado sus estrategias y la Educación Superior no se ha quedado rezagada en este proceso, siendo las Facultades de Cultura Física un eslabón de esa Educación Superior, no puede pasar por alto tal empeño. La actividad deportiva en Cuba no esta alejada de este proceso por lo cual se hace necesario identificar, valorar y precisar aquellos aspectos históricos, teóricos y metodológicos que permitan incidir en la formación de los egresados desde una concepción biocéntrica medioambiental. Dado todo el panorama anteriormente planteado y con la realización de una revisión bibliográfica minuciosa a los programa de preparación para el profesional nos percatamos que aún no se concibe de forma práctica en la salida de determinados programas de estudio acciones coherentes que integren la dimensión medioambiental como parte de su egresado, lo que conspira con la meta social, de convertirnos en el país más culto de la historia. Dada dicha preocupación nos dimos a la tarea de realizar la investigación, la cuál esta encaminada a introducir la Educación Medioambiental en la preparación del estudiante de la Cultura Física, en aras de formar una Cultura General Integral. Para darle solución a la problemática se trazó el siguiente objetivo general: Elaborar un conjunto de acciones prácticas que incluya la dimensión medioambiental en el perfil del graduado de la Cultura Física contribuyendo con ello a una Cultura General Integral. Al considerar el deporte como una esfera de dilemas éticos que propicia el desarrollo y transmisión de valores estimamos necesario, identificar en la estructura del saber deportivo la connotación de la ética aplicada en la variante deportiva-ambiental, así como la necesidad de desarrollar la capacidad valorativa del profesional en sus esferas de actuación.

  14. NOAA TIFF Image - NF13_PR_7125_bathy_4m.tif - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution bathymetry of a reef shelf/bank and the steep canyons and slopes of the NE Reserve, offshore of Fajardo, Puerto Rico. The...

  15. NOAA TIFF Image - 8m Multibeam Bathymetry , W00216 USVI 2011 , Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a GeoTIFF with 8x8 meter cell size representing the bathymetry of a sharply sloping swath of the St. John Shelf, a selected portion of seafloor...

  16. NOAA TIFF Image - NF13_Vieques_400khz_Bathy_4m.tif , Puerto Rico 2013, Vieques, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 (2013), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution bathymetry of a reef shelf/bank south of Vieques, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration...

  17. NOAA TIFF Image - 2m Backscatter Mosaic, W00216 USVI 2011, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 2 meter resolution backscatter mosaic of the bathymetry of a sharply sloping swath of the St. John Shelf, St. John, USVI. NOAA's...

  18. NOAA TIFF Image - 8m Backscatter Mosaic, W00221-222 USVI 2012, Seafloor Characterization of the US Caribbean - Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 8 meter resolution backscatter mosaic of of a sharply sloping swath of the St. John Shelf, south of NE Reserve, offshore of Fajardo, Puerto...

  19. NOAA TIFF Image - 4m Multibeam Bathymetry , W00216 USVI 2011 , Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a GeoTIFF with 4x4 meter cell size representing the bathymetry of a sharply sloping swath of the St. John Shelf, a selected portion of seafloor...

  20. NOAA TIFF Image - 1m Backscatter Mosaic, W00221-222 USVI 2012, Seafloor Characterization of the US Caribbean - Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83 (NCEI Accession 0131856)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the bathymetry of a reef shelf/bank and the steep slopes and canyons of the NE Reserve, offshore of...

  1. Multibeam collection for NF-09-06-LF: Multibeam data collected aboard Nancy Foster from 2009-06-24 to 2009-07-01, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  2. NOAA TIFF Image - NF13_Vieques_400khz_Bathy_4m.tif , Puerto Rico 2013, Vieques, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 (2013), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution bathymetry of a reef shelf/bank south of Vieques, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration...

  3. NOAA TIFF Image - NF13_PR_7125_bathy_4m.tif - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution bathymetry of a reef shelf/bank and the steep canyons and slopes of the NE Reserve, offshore of Fajardo, Puerto Rico. The...

  4. NOAA TIFF Image - 2m Multibeam Bathymetry, W00216 USVI 2011, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a GeoTIFF with 2x2 meter cell size representing the bathymetry of a sharply sloping swath of the St. John Shelf, a selected portion of seafloor...

  5. NOAA TIFF Image - Bathymetry - Lang bank, St. Croix, USVI - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-1907-NF-14 (2014), UTM 20N NAD83 (NCEI Accession 0128255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution bathymetry of the reef shelf and the steep slopes of Lang Bank (H12639) of St. Croix, US Virgin Islands. The M-I907-NF-14...

  6. NOAA TIFF Image - NF13_PR_Vieques_95khz_Bathy_8m.tif , Puerto Rico 2013, Vieques, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 (2013), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 8 meter resolution bathymetry of a reef shelf/bank south of Vieques, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration...

  7. NOAA TIFF Image - 8m Backscatter Mosaic, Puerto Rico 2013, Northeast Reserve, Haystack Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution backscatter mosaic of a seamount/bank east of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  8. NOAA TIFF Image - 2m Multibeam Bathymetry, W00216 USVI 2011, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a GeoTIFF with 2x2 meter cell size representing the bathymetry of a sharply sloping swath of the St. John Shelf, a selected portion of seafloor...

  9. NOAA TIFF Image - SouthWest Shelf, St. Croix, USVI - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-1907-NF-14 (2014), UTM 20N NAD83 (NCEI Accession 0128255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution bathymetry of the reef shelf and the steep slopes of the Southwest Shelf (H12640) of St. Croix, US Virgin Islands. The...

  10. Archéologie et sociabilité: la délégation du Pérou au Premier Congrès international des Américanistes, Nancy, 1875

    Directory of Open Access Journals (Sweden)

    1989-01-01

    Full Text Available L'auteur tente de montrer comment l'analyse de la composition de la délégation péruvienne au premier Congrès International des Américanistes peut fournir une vision différente du mouvement anthropologique au XIXème siècle, dans la mesure où la plupart des membres de cette délégation étaient peut-être plus préoccupés de représentation que de l'avancement des sciences humaines. D'où l'idée d'un intérêt pour l'archéologie considéré alors comme un acte de sociabilité. El autor intenta demostrar que el análisis de la delegación peruana al primer Congreso Internacional de Americanistas puede dar otra visión del movimiento antropológico en el siglo XIX, en la medida en que la mayoría de los miembros de esta delegación estaban tal vez más preocupados por su imagen pública que por el progreso de las ciencias humanas. En este caso, el interés por la arqueología sería sobre todo un acto de sociabilidad. The author intends to show how the analysis of the social composition of the peruvian delegation at the first International Congress of Americanists, can offer a different view upon the anthropological movement in the XlXth century, as far as most of the delegates were more worried of their public image instead of the advancement of human sciences. In this particular case, their interest on archaeology would be seen as a social act.

  11. Library holdings for Lophelia II 2008: Deepwater Coral Expedition: Reefs, Rigs, and Wrecks on NOAA R/V Nancy Foster in the Gulf of Mexico between September 5, 2008 and October 2, 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Library Catalog may include: Data Management Plans, Cruise Plans, Cruise Summary Reports, Scientific "Quick Look Reports", Video Annotation Logs, Image Collections,...

  12. Mampuján, en el acto de partir: el duelo como levantamiento y la comunidad en transición. Reconciliación y representación en Jean-Luc Nancy

    Directory of Open Access Journals (Sweden)

    María Juliana Rojas Berrío

    2015-03-01

    Full Text Available The article analyzes Mampujan’s issue of redress [incidente de reparación] to show how the conception of damage that accompanies and justifies this space allows us to trace a particular configuration of being in common. Mampuján is a community that re-presents itself in and through that damage insofar as the latter intensifies the impossibility of fixing an identity for the community. This impossibility is discussed as a movement of withdrawal, always unrepairable and irredeemable. The text also shows how this movement echoes the way in which Nancy’s “Deconstruction of Christianity” calls on us to problematize the rigidity of our traditional conceptions of Justice. All of the above is done in the light of a question regarding the possibility of reconciliation in the context of the Colombian ‘Justice and Peace’ Law.

  13. Multibeam collection for NF-11-05-CSC: Multibeam data collected aboard Nancy Foster from 2011-07-20 to 2011-07-22, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  14. Multibeam collection for NF-08-16-CSC: Multibeam data collected aboard Nancy Foster from 2008-10-25 to 2008-10-28, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  15. Multibeam collection for NF-12-02-CSC: Multibeam data collected aboard Nancy Foster from 2012-05-07 to 2012-05-12, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  16. Multibeam collection for NF-07-03-CSC: Multibeam data collected aboard Nancy Foster from 2006-11-09 to 2006-11-11, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. Multibeam collection for NF-07-10-OE: Multibeam data collected aboard Nancy Foster from 2007-06-25 to 2007-07-18, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Multibeam collection for NF-09-10-TER: Multibeam data collected aboard Nancy Foster from 2009-09-22 to 2009-09-29, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Multibeam collection for NF-08-06-SEAS: Multibeam data collected aboard Nancy Foster from 2008-03-26 to 2008-04-05, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  20. Underway meteorological, navigational, optical, physical and time series data collected aboard NOAA Ship Nancy Foster in the Gulf of Mexico and North Atlantic Ocean from 2015-06-15 to 2015-06-28 (NCEI Accession 0129875)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0129875 contains raw underway meteorological, navigational, optical, physical and time series data logged by the Scientific Computer System (SCS)...

  1. -NOAA Shapefile - Drop Camera Transects Lines, USVI 2011 , Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile denotes the location of underwater video that was collected by NOAA scientists using a SeaViewer drop camera system. Video was collected between...

  2. NOAA TIFF Image - 2m Backscatter Mosaic, W00217 USVI 2011, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 2 meter resolution backscatter mosaic of a broad bank south of St. Thomas, US Virgin Islands. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  3. NOAA TIFF Image - 2m Backscatter Mosaic, W00217 USVI 2011, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 2 meter resolution backscatter mosaic of a broad bank south of St. Thomas, US Virgin Islands. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  4. Consensus report of the Working Group on: "Molecular and Biochemical Markers of Alzheimer's Disease". The Ronald and Nancy Reagan Research Institute of the Alzheimer's Association and the National Institute on Aging Working Group.

    Science.gov (United States)

    1998-01-01

    The ideal biomarker for Alzheimer's disease (AD) should detect a fundamental feature of neuropathology and be validated in neuropathologically-confirmed cases; it should have a sensitivity >80% for detecting AD and a specificity of >80% for distinguishing other dementias; it should be reliable, reproducible, non-invasive, simple to perform, and inexpensive. Recommended steps to establish a biomarker include confirmation by at least two independent studies conducted by qualified investigators with the results published in peer-reviewed journals. Our review of current candidate markers indicates that for suspected early-onset familial AD, it is appropriate to search for mutations in the presenilin 1, presenilin 2, and amyloid precursor protein genes. Individuals with these mutations typically have increased levels of the amyloid Abeta42 peptide in plasma and decreased levels of APPs in cerebrospinal fluid. In late-onset and sporadic AD, these measures are not useful, but detecting an apolipoprotein E e4 allele can add confidence to the clinical diagnosis. Among the other proposed molecular and biochemical markers for sporadic AD, cerebrospinal fluid assays showing low levels of Abeta42 and high levels of tau come closest to fulfilling criteria for a useful biomarker.

  5. Underway meteorological, navigational, optical, physical and time series data collected aboard NOAA Ship Nancy Foster in the North Atlantic Ocean from 2013-07-12 to 2013-07-21 (NODC Accession 0113448)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113448 contains raw underway meteorological, navigational, optical, physical and time series data logged by the Scientific Computer System (SCS)...

  6. Multibeam collection for NF-08-01-MPA: Multibeam data collected aboard Nancy Foster from 2007-10-09 to 2007-10-21, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  7. Multibeam collection for NF-09-09-FKNMS: Multibeam data collected aboard Nancy Foster from 2009-09-11 to 2009-09-18, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  8. NOAA TIFF Image - 4m Backscatter Mosaic, Puerto Rico 2013, Escollo Grappler Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution backscatter mosaic of a seamount/bank East of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  9. Propuesta de acciones para mejorar la calidad de la comunicación de los alumnos en las clases deportivas de la Sede Universitaria Municipal “Nancy Uranga Romagoza”

    Directory of Open Access Journals (Sweden)

    Abilio de Jesús Barreto García

    2007-06-01

    Full Text Available La necesidad de transitar del modelo comunicativo tradicional exógeno hacia uno endógeno en el encuentro presencial de las clases deportivas, para perfeccionar el proceso docente educativo en la SUM de la FCF es un reto para este colectivo de profesores que pretende mejorar la calidad de la comunicación en las clases deportivas a través de un grupo de acciones concretas aplicables operativamente por cualquier profesor deportivo. De ahí la novedad de este trabajo. Asumimos una investigación –acción donde nos implicamos los autores en un proceso donde el alumno participa de forma más activa en la toma de decisiones respecto a su aprendizaje; predominando las tareas significativas fundamentalmente mediante formas jugadas; y estilos de enseñanza que favorecen la socialización, la independencia y la creatividad; a su vez se le ofrece participación al alumno en los procesos de evaluación. Consideramos que “el alumno motivado por la actividad deportiva, se manifiesta en el grupo clase por diferentes conductas: es activo, se agota, atiende las explicaciones, e incluso las cuestiona, ayuda a los compañeros, quiere hacer más, adelantarse a su turno, está alegre, se interesa por su actuación, repite sus ejercicios y dedica horas extras a perfeccionar sus habilidades y fortalecer su cuerpo” (Barreto2005. En otras palabras siente placer en ejercitarse y deseos de comunicar lo aprendido, haciendo realidad las axiomáticas palabras de Da Vinci:”La ciencia más útil es aquella cuyo fruto es más comunicable”.

  10. Multibeam collection for NF-08-11-TER: Multibeam data collected aboard Nancy Foster from 2008-07-25 to 2008-08-05, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  11. Multibeam collection for NF-06-12-FGBNMS: Multibeam data collected aboard Nancy Foster from 2006-09-23 to 2006-09-30, Galveston, TX to Galveston, TX

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. Multibeam collection for NF-14-06: Multibeam data collected aboard Nancy Foster from 2014-09-03 to 2014-09-11, Fort Pierce, FL to Cape Canaveral, FL

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  13. Multibeam collection for NF-11-06-FKNMS: Multibeam data collected aboard Nancy Foster from 2011-07-25 to 2011-08-05, Charleston, SC to Pascagoula, MS

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  14. NOAA TIFF Image - 4m Backscatter Mosaic , W00216 USVI 2011 , Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution backscatter mosaic of of a sharply sloping swath of the St. John Shelf, south of St. John, US Virgin Islands. NOAA's...

  15. Underway meteorological, navigational, optical, physical and time series data collected aboard NOAA Ship Nancy Foster in the North Atlantic Ocean from 2013-08-31 to 2013-09-07 (NODC Accession 0113487)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113487 contains raw underway meteorological, navigational, optical, physical and time series data logged by the Scientific Computer System (SCS)...

  16. Oceanographic temperature and salinity measurements collected using CTD and XBT from NOAA Ship Nancy Foster/Ronald H Brown in the North Atlantic from 1998 to 2007 (NODC Accession 0043165)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity and other measurements found in datasets XBT and CTD taken from NOAA Ship RONALD H. BROWN (NOAA SHIP - Call Sign WTEC)(formerly NOAA Ship...

  17. Multibeam collection for NF-10-11-LF: Multibeam data collected aboard Nancy Foster from 2010-09-02 to 2010-09-10, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Multibeam collection for NF-09-13-DSC: Multibeam data collected aboard Nancy Foster from 2009-08-30 to 2009-09-02, Unknown Port to Unknown Port

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Multibeam collection for NF-11-04-NC: Multibeam data collected aboard Nancy Foster from 2011-06-04 to 2011-06-17, Charleston, SC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  20. Underway meteorological, navigational, physical and time series data collected aboard NOAA Ship Nancy Foster in the North Atlantic Ocean from 2014-04-20 to 2014-04-30 (NODC Accession 0118187)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0118187 contains raw underway meteorological, navigational, physical and time series data logged by the Scientific Computer System (SCS) aboard NOAA...

  1. Underway meteorological, navigational, physical and time series data collected aboard NOAA Ship Nancy Foster in the Gulf of Mexico and North Atlantic Ocean from 2014-09-01 to 2014-09-14 (NODC Accession 0123337)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0123337 contains raw underway meteorological, navigational, physical and time series data logged by the Scientific Computer System (SCS) aboard NOAA...

  2. Multibeam collection for NF-09-14-GOMDC: Multibeam data collected aboard Nancy Foster from 2009-10-03 to 2009-10-28, Key West, FL to Key West, FL

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  3. NOAA TIFF Image - 8m Multibeam Bathymetry , W00216 USVI 2011 , Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a GeoTIFF with 8x8 meter cell size representing the bathymetry of a sharply sloping swath of the St. John Shelf, a selected portion of seafloor...

  4. NOAA TIFF Image - 4m Backscatter Mosaic, Puerto Rico 2013, Escollo Grappler Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution backscatter mosaic of a seamount/bank East of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  5. NOAA TIFF Image - 8m Backscatter Mosaic, Puerto Rico 2013, Vieques, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This geotiff represents an 8 meter resolution backscatter mosaic of a reef shelf/bank south of Vieques, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  6. NOAA TIFF Image - NF12_PR_1002_bathy_8m.tif - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 8 meter resolution bathymetry of a reef shelf/bank and the steep canyons and slopes of the NE Reserve, offshore of Fajardo, Puerto Rico. The...

  7. NOAA TIFF Image - NF13_PR_EscolloGrappler_95khz_bathy.tiff, Puerto Rico 2013, Escollo Grappler Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter interpolated bathymetric grid of a bank East of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration with...

  8. NOAA TIFF Image - NF12_PR_1002_bathy_8m.tif - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 8 meter resolution bathymetry of a reef shelf/bank and the steep canyons and slopes of the NE Reserve, offshore of Fajardo, Puerto Rico. The...

  9. Underway meteorological, navigational, physical and time series data collected aboard NOAA Ship Nancy Foster in the North Atlantic Ocean from 2014-11-12 to 2014-11-21 (NODC Accession 0125582)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0125582 contains raw underway meteorological, navigational, physical and time series data logged by the Scientific Computer System (SCS) aboard NOAA...

  10. NOAA TIFF Image - 2m Multibeam Bathymetry, W00217 USVI 2011, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a GeoTIFF with 2x2 meter cell size representing the bathymetry of a broad portion of seafloor south of St. Thomas, USVI, derived from data...

  11. NOAA TIFF Image - 1m Backscatter Mosaic, Puerto Rico 2012-2013, Northeast Reserve, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI, UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the bathymetry of a reef shelf/bank and the steep slopes and canyons of the NE Reserve, offshore of...

  12. NOAA TIFF Image - 1m Backscatter Mosaic, Puerto Rico 2013, Northeast Reserve, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI, UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the bathymetry of a reef shelf/bank and the steep slopes and canyons of the NE Reserve, offshore of...

  13. NOAA TIFF Image - 1m Backscatter Mosaic, Puerto Rico 2013, Vieques, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI, UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the bathymetry of a reef shelf/bank south of Vieques, Puerto Rico. NOAA's NOS/NCCOS/CCMA...

  14. NOAA TIFF Image - 1m Backscatter Mosaic, Puerto Rico 2013, Northeast Reserve, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI, UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the bathymetry of a reef shelf/bank and the steep slopes and canyons of the NE Reserve, offshore of...

  15. NOAA TIFF Image - 2m Multibeam Bathymetry, W00217 USVI 2011, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains a GeoTIFF with 2x2 meter cell size representing the bathymetry of a broad portion of seafloor south of St. Thomas, USVI, derived from data...

  16. Underway meteorological, navigational, optical, physical and time series data collected aboard NOAA Ship Nancy Foster in the Gulf of Mexico and North Atlantic Ocean from 2013-09-10 to 2013-09-20 (NODC Accession 0113488)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113488 contains raw underway meteorological, navigational, optical, physical and time series data logged by the Scientific Computer System (SCS)...

  17. Multibeam collection for NF-07-02-MPA: Multibeam data collected aboard Nancy Foster from 2006-10-25 to 2006-11-07, Morehead City, NC to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. NOAA TIFF Image - 8m Backscatter Mosaic, Puerto Rico 2013, Vieques, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution backscatter mosaic of a reef shelf/bank south of Vieques, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  19. NOAA TIFF Image - 4m Backscatter Mosaic , W00216 USVI 2011 , Seafloor Characterization of the US Caribbean - Nancy Foster - NF-11-1 (2011), UTM 20N NAD83 (NCEI Accession 0131858)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution backscatter mosaic of of a sharply sloping swath of the St. John Shelf, south of St. John, US Virgin Islands. NOAA's...

  20. NOAA TIFF Image - Backscatter - Lang Bank, St. Croix, USVI - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-1907-NF-14 (2014), UTM 20N NAD83 (NCEI Accession 0128255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This geotiff represents a 1 meter resolution backscatter mosaic of the reef shelf and the steep slopes of the Lang Bank (H12639) of St. Croix, US Virgin Islands. The...

  1. NOAA TIFF Image - 8m Backscatter Mosaic, Puerto Rico 2013, Northeast Reserve, Haystack Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution backscatter mosaic of a seamount/bank east of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  2. NOAA TIFF Image - NF12_PR_7125_bathy_4m.tif - Benthic Habitat Characterization - NOAA Ship Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution bathymetry of a reef shelf/bank and the steep canyons and slopes of the NE Reserve, offshore of Fajardo, Puerto Rico. The...

  3. NOAA TIFF Image - 8m Backscatter Mosaic, W00221-222 USVI 2012, Seafloor Characterization of the US Caribbean - Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83 (NCEI Accession 0131856)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 8 meter resolution backscatter mosaic of of a sharply sloping swath of the St. John Shelf, south of NE Reserve, offshore of Fajardo, Puerto...

  4. NOAA TIFF Image - 1m Backscatter Mosaic, W00221-222 USVI 2012, Seafloor Characterization of the US Caribbean - Nancy Foster - M-I907-NF-12 (2012), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 1 meter resolution backscatter mosaic of the bathymetry of a reef shelf/bank and the steep slopes and canyons of the NE Reserve, offshore of...

  5. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available C58, Dupont) plasmid AT ... Length = 247 ... Query: 28 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMA...KDLNAELEIVPLTGASRIPS 87 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTG...ASRIPS Sbjct: 21 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 80 ... Query: 148 STLDTWLTDNAPEV

  6. Ocean acidification increases the accumulation of toxic phenolic compounds across trophic levels, supplement to: Jin, Peng; Wang, Tifeng; Liu, Nana; Dupont, Sam; Beardall, John; Boyd, Philip W; Riebesell, Ulf; Gao, Kunshan (2015): Ocean acidification increases the accumulation of toxic phenolic compounds across trophic levels. Nature Communications, 6, 8714

    KAUST Repository

    Jin, Peng; Wang, Tifeng; Liu, Nana; Dupont, Sam; Beardall, John; Boyd, Philip W; Riebesell, Ulf; Gao, Kunshan

    2016-01-01

    Increasing atmospheric CO2 concentrations are causing ocean acidification (OA), altering carbonate chemistry with consequences for marine organisms. Here we show that OA increases by 46-212% the production of phenolic compounds in phytoplankton grown under the elevated CO2 concentrations projected for the end of this century, compared with the ambient CO2 level. At the same time, mitochondrial respiration rate is enhanced under elevated CO2 concentrations by 130-160% in a single species or mixed phytoplankton assemblage. When fed with phytoplankton cells grown under OA, zooplankton assemblages have significantly higher phenolic compound content, by about 28-48%. The functional consequences of the increased accumulation of toxic phenolic compounds in primary and secondary producers have the potential to have profound consequences for marine ecosystem and seafood quality, with the possibility that fishery industries could be influenced as a result of progressive ocean changes.

  7. Determination of hydrogen content in mixed oxide fuels (U,Pu)02 by three different methods: occluded gas, carrier gas at 9000C (apparatus Dupont de Nemours) and carrier gas at 17000C (apparatus Ithac 2000 Adamel). Operation, performance comparison of the three methods

    International Nuclear Information System (INIS)

    Lepetit; Lebrun; Haour; Dellasta; Vannier.

    1989-01-01

    Test conditions and performance are described. Results obtained allow a comparison and give the important parameters sampling conditions, sample storage and transfer, radiolysis and pyrohydrolysis. After a few hundred analysis fuels can be divided in two types: hydrogen content between 0.1 and 1 ppm corresponding to water fixation at the pellet surface, homogeneous content, not or slightly porous and with a perfect metallographic structure. Hydrogen content over 1 ppm, heterogeneous content from one sample to one another because of porosity and metallographic structure with cracks and cavities [fr

  8. Managerial Techniques in Educational Administration.

    Science.gov (United States)

    Lane, John J.

    1983-01-01

    Management techniques developed during the past 20 years assume the rational bureaucratic model. School administration requires contingent techniques. Quality Circle, Theory Z, and the McKenzie 7-Framework are discussed as techniques to increase school productivity. (MD)

  9. 75 FR 38603 - Qualification of Drivers; Exemption Renewals; Vision

    Science.gov (United States)

    2010-07-02

    ... James C. Askin, Paul J. Bannon, Ernie E. Black, Ronnie F. Bowman, Gary O. Brady, Stephen H. Goldcamp, Steven F. Grass, Wai F. King, Dennis E. Krone, Richard J. McKenzie, Jr., Christopher J. Meerten, Craig W...

  10. 75 FR 27623 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2010-05-17

    .... Askin, Paul J. Bannon, Ernie E. Black, Ronnie F. Bowman, Gary O. Brady, Stephen H. Goldcamp, Steven F. Grass, Wai F. King, Dennis E. Krone, Richard J. McKenzie, Jr., Christopher J. Meerten, Craig W. Miller...

  11. Ka kalal võivad olla tunded / Priit Ennet

    Index Scriptorium Estoniae

    Ennet, Priit

    2016-01-01

    Simon McKenzie ja Sonia Ray katsest sebrakaladega, mida nad tõlgendavad nii, et stressiseisundis kalad kutsusid selle leevendamiseks meelega esile palaviku seisundi eelistades ujuda harjumuspärasest kõrgema temperatuuriga vees

  12. 76 FR 69746 - Eunice Kennedy Shriver National Institute of Child Health & Human Development; Notice of Closed...

    Science.gov (United States)

    2011-11-09

    ...) of the Federal Advisory Committee Act, as amended (5 U.S.C. App.), notice is hereby given of the..., 2011. Time: 8 a.m. to 5 p.m. Agenda: To review and evaluate grant applications. Place: The Dupont Hotel.... Agenda: To review and evaluate grant applications. Place: The Dupont Hotel, 1500 New Hampshire Avenue NW...

  13. Factorial Analysis of Profitability

    OpenAIRE

    Georgeta VINTILA; Ilie GHEORGHE; Ioana Mihaela POCAN; Madalina Gabriela ANGHEL

    2012-01-01

    The DuPont analysis system is based on decomposing the profitability ratio in factors of influence. This paper describes the factorial analysis of profitability based on the DuPont system. Significant importance is given to the impact on various indicators on the shares value and profitability.

  14. 76 FR 10584 - Notice of Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or...

    Science.gov (United States)

    2011-02-25

    ... dimethylcyclopropanecarboxylate and its inactive R-isomers, in or on avocado; papaya; star apple; black sapote; mango; sapodilla... 0F7763. (EPA-HQ-OPP-2010-0888). E. I. DuPont de Nemours and Company, DuPont Crop Protection, 1700 Market...

  15. Rethinking Social Justice and Adult Education for Welcoming, Inclusive Communities: Synthesis of Themes

    Science.gov (United States)

    Lange, Elizabeth; Baillie Abidi, Catherine

    2015-01-01

    This chapter summarizes the key themes across the articles on transnational migration, social inclusion, and adult education, using Nancy Fraser's framework of redistributive, recognitive, and representational justice.

  16. (HTLV1) in different patients in the north of Iran

    African Journals Online (AJOL)

    Administrator

    2011-09-12

    Sep 12, 2011 ... disorders including neurologic (such as multiple sclerosis, paralysis and tumor), gastrointestinal disorders (ulcer, inflammatory bowel diseases and tumors), hematology and oncology disorders (chronic anemia and malig- nancies), urologic disorders (renal stone, malig-nancies and urinary tract infection), ...

  17. NJP VOLUME 40 No 4 Corrected

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2013-05-04

    May 4, 2013 ... births and only 4% of cases are products of twin preg- nancies. The first documented case occurring in ... ily history of congenital malformations, the index preg- nancy was preceded by three successive ... Both babies were discharged home at the age of 24 days to be followed up in the clinic. However, the ...

  18. Containment technology and the success of a joint initiative

    International Nuclear Information System (INIS)

    Campbell, H.J. Jr.

    1997-01-01

    This paper describes the efforts of the DuPont Company and DOE on containment of pollution. A test program at the Groundwater Remediation Field Laboratory National Test Site at Dover Air Force Base is discussed

  19. 78 FR 5774 - Materials Technical Advisory Committee; Notice of Partially Closed Meeting

    Science.gov (United States)

    2013-01-28

    .... Remarks from BIS senior management. 3. Presentation by DuPont on the impact of Australia Group and.... 5. Report on regime-based activities. 6. Public comments and new business. 7. Request for volunteers...

  20. Dynawave froth scrubbing technology

    International Nuclear Information System (INIS)

    McLean, J.E.

    1989-01-01

    The DynaWave family of scrubbers was developed and patented by DuPont in the 1970's and is used extensively within the company. Because the technology was treated as confidential, information about the scrubbers was not published outside of DuPont. In 1986 Monsanto Enviro-Chem was asked to install a Reverse Jet scrubber at DuPont's Burnside spent acid recovery pant to replace an aging spray humidifying tower. Enviro-Chem was impressed with the technology and entered into a licensing agreement with DuPont in late 1987. This paper addresses the application of DynaWave froth scrubbing technology to metallurgical plant process and effluent gas streams. Froth scrubber design principles an sampling results from pilot plant trails on fluid bed roaster off-gas are presented

  1. Development of High Temperature Superconducting Josephson Junction Device Technology

    National Research Council Canada - National Science Library

    Myers, Kirsten

    1998-01-01

    The DuPont program was successful in generating useful knowledge about thallium cuprate materials, photoresist reflow processing, and radiant heater technology though it did not lead to a new junction technology...

  2. Smear of duodenal fluid aspirate

    Science.gov (United States)

    ... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. Dupont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Fritsche TR, Pritt BS. ...

  3. Fecal smear

    Science.gov (United States)

    ... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... AI, eds. Goldman's Cecil Medicine . 25thed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

  4. Culture - colonic tissue

    Science.gov (United States)

    ... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Hall GS, Woods GL. ...

  5. Shigellosis

    Science.gov (United States)

    ... Nelson Textbook of Pediatrics . 20th ed. Philadelphia, PA: Elsevier; 2016:chap 340. DuPont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

  6. Fecal culture

    Science.gov (United States)

    ... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... AI, eds. Goldman's Cecil Medicine . 25thed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

  7. Testing Consent Order for Sodium Cyanide

    Science.gov (United States)

    This document announces that EPA has signed an enforceable testing Consent Order with E.I. du Pont de Nemours and Company (DuPont), FMC Corporation (FMC), Degussa Corporation (Degussa), ICI Americas Incorporated (ICI), and Cyanco Company (Cyanco).

  8. 77 FR 51739 - Approval and Promulgation of Implementation Plans; Tennessee; Regional Haze State Implementation...

    Science.gov (United States)

    2012-08-27

    ... Tennessee: (1) Aluminum Company of America (Alcoa)--South Plant; (2) DuPont White Pigment and Mineral... reductions than BART (i.e., dispersion modeling is not required to evaluate the differences in visibility...

  9. Presidential Green Chemistry Challenge: 2003 Greener Reaction Conditions Award

    Science.gov (United States)

    Presidential Green Chemistry Challenge 2003 award winner, DuPont, developed a genetically engineered microorganism jointly with Genencor International to manufacture 1,3-propanediol, a building block for Sorona polyester.

  10. The Effects of Mass Media Advertising on U.S. Army Recruiting.

    Science.gov (United States)

    1982-03-16

    the analysis of the product, markets desired to be entered, mo- tives of the advertiser , messages to be presented, media to r -------- 12 be used to... market its products. Sales is a major DuPont advertising objective, but not the only objective. DuPont used selected panels of individuals to expose to its...center, objectives could be formed and operationalized for each advertising program. Overall re- search strategy could be planned, and specific

  11. NOAA TIFF Image - NF13_PR_Haystack_95khz_bathy_4m.tif, Puerto Rico 2013, Northeast Reserve, Haystack Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution interpolated bathymetric grid of a seamount East of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  12. Chemical, physical, profile and other oceanographic data collected aboard NOAA Ship NANCY FOSTER in the Gulf of Mexico and North Atlantic Ocean from 2010-06-30 to 2010-07-18 in response to the Deepwater Horizon Oil Spill event (NODC Accession 0069077)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, physical, profile, biological, laboratory analysis, meteorological, navigational, tows and underway oceanographic data were collected aboard NOAA Ship...

  13. Modelling of Molecular Structures and Properties. Proceedings of the International Meeting of Physical Chemistry on Modeling of Molecular Structures and Properties in Physical Chemistry and Biophysics Organized by the Division de Chimie Physique of the Societe Francaise de Chimie Held in Nancy, France on 11-15 September 1989

    Science.gov (United States)

    1990-01-01

    vibrations for both anomers.Then this set of parameters has been used for others monosaccharides , i.e. both anomers of galactose, methyl- C-D-glucose and N...will be used to perform dynamics simulation of polysaccharides . CONCLUSION The vibrational spectroscopy (frequencies and intensities of vibrational

  14. NOAA TIFF Image - NF13_PR_EscolloGrappler_95khz_bathy.tiff, Puerto Rico 2013, Escollo Grappler Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter interpolated bathymetric grid of a bank East of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration with...

  15. NOAA TIFF Image - NF13_PR_Haystack_95khz_bathy_4m.tif, Puerto Rico 2013, Northeast Reserve, Haystack Seamount, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents a 4 meter resolution interpolated bathymetric grid of a seamount East of Fajardo, Puerto Rico. NOAA's NOS/NCCOS/CCMA Biogeography Team, in...

  16. NOAA TIFF Image - 8m Backscatter Mosaic, Puerto Rico 2012-2013, Northeast Reserve, Seafloor Characterization of the US Caribbean - Nancy Foster - NF-13-2 USVI (2013) and M-I907-NF-12 (2012), UTM 20N NAD83 (NCEI Accession 0131855)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This image represents an 8 meter resolution backscatter mosaic of a reef shelf/bank and the steep slopes and canyons of the NE Reserve, offshore of Fajardo, Puerto...

  17. Near-realtime oceanographic profile data collected by CTD's and XBT's aboard NOAA Ship Nancy Foster from 2010-07-01 to 2010-07-18 as part of the GTSPP in response to the 20100420 Deepwater Horizon oil spill event (NODC Accession 0065729)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data products and in situ oceanographic data collected in response to the Deepwater Horizon Event in the Gulf of Mexico (May 2010). The Global Temperature and...

  18. Manual Correction of an Acute Lumbar Lateral Shift: Maintenance of Correction and Rehabilitation: A Case Report with Video

    OpenAIRE

    Laslett, Mark

    2009-01-01

    The acute onset lumbar lateral shift, otherwise known as a list or acute scoliosis, is a common clinical observation associated with low back pain. In general orthopaedics, the presence of a lateral shift is associated with a poor prognosis; however, a manual correction method devised by McKenzie is claimed to produce rapid reversal of the deformity and reduction in pain. This single-case report presents the details of the McKenzie Mechanical Diagnosis and Treatment (MDT) management of a majo...

  19. A Poetics at the Limit of the Subject: Nancy’s Philosophy of Singular Being in Conrad’s “The Secret Sharer”

    Directory of Open Access Journals (Sweden)

    Brenda MACHOSKY

    2004-10-01

    Full Text Available In concluding the Preface to La communauté désoeuvrée, Jean-Luc Nancy laments the possibility (or likelihood that as human beings we will soon be deprived of our finite existence, the experience of the finitude at the essence of our being. The myth of much contemporary discourse, the myth Nancy hopes to interrupt with “literary communism,” is the sublation or overcoming of finitude. In articulating a discourse of “singularity” Nancy disrupts the narrative flow of subjectivity. He does not pr...

  20. Disease: H00753 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Aydogdu O, Derbent M, Garcia-Minaur S, Reardon W, Gener B, Shalev S, Smith R, Wo... SB, Urquhart JE, Hilton E, McKenzie EA, Kammerer RA, Lewis M, Kerr B, Stuart H, Donnai D, Long DA, Burgu B,

  1. International Students' Attitudes Towards Malaysian English Ethnolects

    Science.gov (United States)

    Khojastehrad, Shadi; Rafik-Galea, Shameem; Abdullah, Ain Nadzimah

    2015-01-01

    Language attitudes are learned and formed in our social environment through hearing others referring to certain groups or people's languages and cultures, and also by exposure to particular varieties spoken in the context. This might lead to stereotyping English and its native speakers (McKenzie, 2008). In this sense, it is pedagogically…

  2. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1934 Section: Engineering & Technology. Taylor, Edward McKenzie 1940-43. Date of birth: 1889. Specialization: Agriculture. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the ...

  3. Rhizobium as a crop enhancer and biofertilizer for increased cereal ...

    African Journals Online (AJOL)

    OHWESIRI IBUJE

    2010-09-13

    Sep 13, 2010 ... INTRODUCTION. The United Nations Food and Agriculture Organization ... new insights into recent development of rhizobia-cereal interaction. .... which caused changes in root morphology and physiology that resulted in .... Andrews M, James EK, Cummings SP, Zavalin AA, Vinogradova LV,. McKenzie BA ...

  4. Turism rikastab : rahvusvaheline turismikonverents

    Index Scriptorium Estoniae

    2006-01-01

    28. septembril toimus Tallinnas Rahvusraamatukogus rahvusvaheline turismikonverents"Turism rikastab". Ülevaade majandus- ja kommunikatsiooniministeeriumi majandusarengu asekantsleri Maria Värtoni, Graham Mckenzie, Linnar Viigi, Nick Skelloni, Mario Ascencao (Haagi ülikool), David Carsoni (Ulsteri ülikool), Vesa Heikkineni ja Imre Sooääre ettekannetest

  5. Public Affairs Training for the Army’s Officer Corps: Need or Neglect?

    Science.gov (United States)

    1983-06-06

    Individual Research Project, No. AD-783-802. Carlisle Barracks, Pennsylvania, 1974. McKenzie, Colin . "A Look at the News Media." US Army War College Mono...SAID IN 1978 Cronkite, Walter. "On Value of Newspaper Training for TV Reporters." San Francisco Examiner and Chronicle. March 5, 1978, p. 38. Drury

  6. 78 FR 36508 - Notice of Sugar Purchase and Exchange for Re-Export Program Credits; and Notice of Re-Export...

    Science.gov (United States)

    2013-06-18

    ...; telephone (202) 690-0734. For sugar purchase and general exchange information contact Pamela McKenzie... license balance within certain limits. Sugar exported or transferred is subtracted from the license balance, resulting in a license ``credit;'' sugar imported is added to the balance, resulting in a license...

  7. Genesis of a Joint Gallery of Sport Art.

    Science.gov (United States)

    Kozar, Andrew J.

    1989-01-01

    The University of Pennsylvania's dual sport art gallery showcases the work of R. Taft McKenzie and Joe Brown, two of the premier sport artists of our time. This article briefly outlines the artists' careers and describes the planning which led to establishment of the gallery. (IAH)

  8. Microeconomic determinants of skilled migration: The case of Suriname

    NARCIS (Netherlands)

    T.W. Dulam (Tina); Ph.H.B.F. Franses (Philip Hans)

    2014-01-01

    markdownabstract__Abstract__ Suriname witnesses a brain drain, in particular to the Netherlands. We study the determinants of this brain drain for skilled individuals, where we rely on an adaptation of the survey proposed in Gibson and McKenzie (2011). We managed to interview a unique set of 286

  9. Appendix 2: Risk-based framework and risk case studies. Risk assessment for wildfire in the Western United States.

    Science.gov (United States)

    David L. Peterson; Jeremy S. Littell

    2012-01-01

    Wildfire is one of the two most significant disturbance agents (the other being insects) in forest ecosystems of the Western United States, and in a warmer climate, will drive changes in forest composition, structure, and function (Dale et al. 2001, McKenzie et al. 2004). Although wildfire is highly stochastic in space and time, sufficient data exist to establish clear...

  10. Managers’ perspectives: practical experience and challenges associated with variable-density operations and uneven-aged management

    Science.gov (United States)

    Kurtis E. Steele

    2013-01-01

    Variable-density thinning has received a lot of public attention in recent years and has subsequently become standard language in most of the Willamette National Forest’s timber management projects. Many techniques have been tried, with varying on-the-ground successes. To accomplish variable-density thinning, the McKenzie River Ranger District currently uses...

  11. Vulnerability of water supply from the Oregon Cascades to changing climate: linking science to users and policy

    Science.gov (United States)

    Kathleen A. Farley; Christina Tague; Gordon E. Grant

    2011-01-01

    Despite improvements in understanding biophysical response to climate change, a better understanding of how such changes will affect societies is still needed. We evaluated effects of climate change on the coupled human-environmental system of the McKenzie River watershed in the Oregon Cascades in order to assess its vulnerability. Published empirical and modeling...

  12. Teekonnad tajutunnelites / Aita Kivi

    Index Scriptorium Estoniae

    Kivi, Aita, 1954-

    2001-01-01

    Sisu : Siri Hustvedt. Pimesi; Boris Vian. Päevade vaht; Christian Lore Weber. Altarimuusika; Kurt Vonnegut. Kassikangas; Jean Sasson. Printsess Sultana tütred; Karen Robards. Senaatori naine; Matthias Johann Eisen. Näkid, kratid, luupainajad; Mats Traat. Harala elulood; Steven L. McKenzie. Kuningas Taavet; Sally Ward. Terane laps; Ted Hughes. Luuletused

  13. ORIGINAL ARTICLE

    African Journals Online (AJOL)

    User

    Keywords: Asymptomatic bacteriuria, pregnancy, urine, Prevalence, Parity. INTRODUCTION. Urinary Tract Infections (UTIs) is an infection caused by the presence and growth of microorganisms anywhere in the urinary tract. It is perhaps the single most common bacterial infection of mankind (Morgan and McKenzie,. 1993 ...

  14. Eluohtlik töö: globaalne üleskutse ajakirjanike turvalisuse kaitseks

    Index Scriptorium Estoniae

    Spindelegger, Michael

    2012-01-01

    Austria Vabariigi asekantsleri ja välisministri Michael Spindeleggeri ning Rahvusvahelise Pressiinstituudi (IPI) tegevdirektori Alison Bethel McKenzie ühine kommentaar selle aasta septembris ÜRO Inimõiguste Nõukogu poolt vastu võetud resolutsioonile ajakirjanike turvalisuse kohta ning ÜRO agentuuride juhtide koordinatsiooninõukogu poolt vastu võetud ajakirjanike turvalisust puudutavast tegevusplaanist

  15. Factors influencing academic success or failure of first-year and ...

    African Journals Online (AJOL)

    Erna Kinsey

    countries, such as Australia and the USA, where there is strong com- petition for university entrance. There is some research support for this practice (e.g. McKenzie & Schweitzer, 2001) but, in general, the ability of these techniques to predict student success has been quite limited (Riggs & Riggs, 1990-91; Graham, 1991).

  16. Copper-promoted methylene C-H oxidation to a ketone derivative by O2

    DEFF Research Database (Denmark)

    Deville, Claire; McKee, Vickie; McKenzie, Christine J.

    2017-01-01

    stoichiometric dpeo C-H oxidation is reminiscent of the previously observed catalysis of dpeo oxidation by Mn(ii) [C. Deville, S. K. Padamati, J. Sundberg, V. McKee, W. R. Browne, C. J. McKenzie, Angew. Chem., Int. Ed., 2016, 55, 545-549]. By contrast dpeo oxidation is not observed during complexation reactions...

  17. Ekspert: poerohkus ajab Eesti hinnad kõrgeks / Katre Pilvinski ; kommenteerinud Raul Puusepp

    Index Scriptorium Estoniae

    Pilvinski, Katre

    2010-01-01

    Kanada Guelphi ülikooli turundus- ja kaubandusprofessor Brent McKenzie leiab, et Eesti jaekaubandusturul on liiga palju erinevaid super- ja hüpermarketeid ning seetõttu pole jaemüüjatel suurt mõju varustajatele

  18. Soorituskeskne hindamine on värbamises töökindel meetod

    Index Scriptorium Estoniae

    2007-01-01

    Personalivärbamise firma Ferguson McKenzie uurimusest, milles selgitati soorituse hindamisele põhinevate valikumeetodite tõhusust, vaadeldes, kuidas eelnev töösooritus ja saavutused võimaldavad ennustada töötaja edukust ka tulevikus

  19. NOAA Point Shapefile - 100m2 Fish Density of El Seco, Puerto Rico, Project NF-09-01-USVI, 2009, WGS84

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

  20. Jackpot Malle Leisilt

    Index Scriptorium Estoniae

    1998-01-01

    6. jaanuarist Kastellaanimaja galeriis Malle Leisi suureformaadiliste maalide näitus "Jackpot". M. Leisi töid on mainekates kunstikogudes, s. h. New Jerseys Zimmerli kunstimuuseumis asuvas Nancy ja Norton Dodge'i kogus

  1. Editorial

    African Journals Online (AJOL)

    lescents with unplanned pregnancies in Mexico.4 Preg- nancy outcomes: are they ... in the diagnosis and treatment of children's respirato- ry diseases in Tunisia;7 iron ... in Nigeria8 and asymptomatic bacteriuria in Egyptian school children.9.

  2. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

  3. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

  4. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

  5. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

  6. African Zoology - Vol 27, No 3 (1992)

    African Journals Online (AJOL)

    A new record of Craspedacusta sowerbii (Cnidaria: Limnomedusae) from southern Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Nancy A. Rayner, C.C. Appleton, 143-145 ...

  7. THE OCCURRENCE OF FOETAL DWARFIST{ IN THE ANGORA ...

    African Journals Online (AJOL)

    Foetal dwarfism following heat stress during preg- nancy has been .... with a low heat tolerance coefficient. lt has also been surmised that ... system by abnormal levels of maternal hormones. Star- ... and hence growth suppressing actions.

  8. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

  9. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

  10. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

  11. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

  12. Vie-Nouvelle

    African Journals Online (AJOL)

    Chrystelle ATINKPAHOUN

    influent of wastewater treatment plant, greywater, etc. (Kafi et al. ... pollutant loadings related to suspended solids, bound metal ... treatment system for the domestic wastewater. (greywater and ...... thesis, Polytechnic Institute of Lorraine,. Nancy ...

  13. Vaidlused või monoloogid? / Redi Koobak, Raili Põldsaar

    Index Scriptorium Estoniae

    Koobak, Redi

    2006-01-01

    Arvustus: Feministlikud vaidlused : filosoofiline mõttevahetus / [Seyla Benhabib, Judith Butler, Nancy Freiser, Drucilla Cornell] ; inglise keelest tõlkinud Merilin Sikk ; [koostaja Linda Nicholson]. Tallinn : Tallinna Ülikooli Kirjastus, 2006

  14. Christina ütleb : pidutse raskelt! / Märt Milter

    Index Scriptorium Estoniae

    Milter, Märt

    2002-01-01

    Näitlejanna Christina Applegate ja tema roll mängufilmis "Ropult magus" ("The Sweetest Thing"), režissöör Roger Kumble. Lühidalt ka filmile stsenaariumi kirjutanud stand-up koomikust Nancy M. Pimentalist

  15. Reshaping Health Care in Latin America

    International Development Research Centre (IDRC) Digital Library (Canada)

    Reform In Mexico — Silvia Tamez and Nancy Molina ... This book assesses the health care reforms of the past decade in Argentina, Brazil and Mexico. ...... prevention and control of pulmonary tuberculosis; prevention and control of high blood ...

  16. 78 FR 17403 - No FEAR Act Notice

    Science.gov (United States)

    2013-03-21

    ... INFORMATION CONTACT: Nancy Burnett, Acting Associate Director of the Office of Minority and Women Inclusion, [email protected] , (202) 649-3017; Brian Guy, Manager of EEO Services, [email protected] , (202...

  17. Eesti kinnas Ameerikas

    Index Scriptorium Estoniae

    2007-01-01

    Eestit külastanud Salt Lake City kudumisringi juhendaja Nancy Bush on agar eesti soki- ja kindakudumistehnika tutvustaja Ameerikas. Ta on avaldanud selleteemalise raamatu, ajakirjas "Piecework" ilmus artikkel Aino Praaklist, juures tema kinnaste mustreid ja skeeme

  18. Ameriklanna tutvustab Eestit

    Index Scriptorium Estoniae

    2006-01-01

    Eestis oli 12. korda ameerika kunstiteadlane ja tekstiilikunstnik Nancy Bush, kes on kirjutanud ingliskeelse raamatu eesti kinnastest ja sokkidest (Folk knitting in Estonia. Loveland [USA], 1999) ning kelle kaudu on jõudnud Ameerikasse ka Aino Praakli kirikindad

  19. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

  20. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

  1. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

  2. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

  3. NOAA Point Shapefile - 100m2 Fish Density for Virgin Passage, United States Virgin Islands, Project NF-10-03-USVI, 2010, WGS84

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

  4. Volunteering in the Elementary Outreach Program Could Make You Happier | Poster

    Science.gov (United States)

    By Marsha Nelson-Duncan, Guest Writer, and Nancy Parrish, Staff Writer Did you know that volunteers in the Elementary Outreach Program (EOP) just might be happier than their coworkers who don’t volunteer?

  5. Review of 'Education in Parapsychology: Student and Instructor Perspectives' by Harvey Irwin

    OpenAIRE

    Roe, Chris A

    2014-01-01

    Book review of Education in Parapsychology: Student and Instructor Perspectives by Harvey Irwin. Foreword by Nancy\\ud Zingrone. Gladesville, NSW, Australia: AIPR Mongraphs, 2013. Pp xv + 106. (paperback). ISBN 9780987077219.

  6. NOAA Point Shapefile - 100m2 Fish Density of Grand Northeast Ecological Corridor, Puerto Rico, Project NF-12-01-PR, 2012, WGS84

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

  7. NOAA Point Shapefile - 100m2 Fish Density of Grand Northeast Ecological Corridor, Puerto Rico, Project NF-13-02-PR, 2013, WGS84

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

  8. Fish Density of El Seco, Puerto Rico from 2009-03-31 to 2009-04-02, Project NF-09-01-USVI, 2009, WGS84 (NCEI Accession 0137091)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

  9. NF -10-03-USVI Characterization of Seafloor Habitats of the U.S. Caribbean (EK60)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) will be conducting the eighth year of an ongoing scientific research mission onboard NOAA Ship Nancy Foster...

  10. Police Killings and Police Deaths Are Public Health Data and Can Be Counted.

    Directory of Open Access Journals (Sweden)

    Nancy Krieger

    2015-12-01

    Full Text Available Nancy Krieger and colleagues argue that law-enforcement-related deaths in the United States should be treated as notifiable conditions, which would allow public health departments to report these data in real-time.

  11. Police Killings and Police Deaths Are Public Health Data and Can Be Counted.

    Science.gov (United States)

    Krieger, Nancy; Chen, Jarvis T; Waterman, Pamela D; Kiang, Mathew V; Feldman, Justin

    2015-12-01

    Nancy Krieger and colleagues argue that law-enforcement-related deaths in the United States should be treated as notifiable conditions, which would allow public health departments to report these data in real-time.

  12. 77 FR 9687 - Endangered Species; Receipt of Applications for Permit

    Science.gov (United States)

    2012-02-17

    ... Comment Procedures A. How do I request copies of applications or comment on submitted applications? Send...: James Whipple & Nancy Nunke, Romona, CA; PRT-053952 The applicant requests amendment and renewal of his...

  13. About Nation, Race, and Ethnicity in Latin America in the 19th and 20th centuries

    Directory of Open Access Journals (Sweden)

    Hanni Jalil Paier

    2013-12-01

    Full Text Available Bibliographic outline of the following book:APPELBAUM, Nancy P., Anne S. Macpherson and Karin A. Rosemblatt (Eds. (2003. Race and Nation in Modern Latin America. Chapel Hill: University of North Carolina Press, 329 pp.

  14. 78 FR 76815 - Non-Oriented Electrical Steel From the People's Republic of China, the Republic of Korea, and...

    Science.gov (United States)

    2013-12-19

    ... FURTHER INFORMATION CONTACT: Austin Redington at (202) 482-1664 or Nancy Decker at (202) 482-0196, AD/CVD... determinations is now March 17, 2014, the next business day. This notice is issued and published pursuant to...

  15. Combating the Enemy Within: Building Trust, Leading Change and Defeating the Mental Health Stigma

    Science.gov (United States)

    2013-12-16

    3D1229% 26context%3Dgladnetcollect%22 (accessed on 13 September 2013), vi. 27 Nancy Skopp, Nigel Bush, David Vogel, Nathaniel Wade, Anton...Corporation, 2008, 275-276. 31 Charles R. Figley and R. Blaine Everson, Families Under Fire (New York: Taylor and Francis Group, 2011), 44...and Cognitive Injuries (Arlington, VA: Rand Corporation, 2008), 14. 62 Nancy Skopp, Nigel Bush, David Vogel, Nathaniel Wade, Anton Sirotin

  16. Wind speed, wind direction, air temperature, wave energy spectra, significant wave height, dominant wave period and direction, peak wave period and direction, currents, temperature, conductivity, pressure, sigma-theta, river level, sonar readings, and backscatter data collected at Myrtle Beach in the North Atlantic Ocean from instruments deployed on MOORINGS using platforms NOAA Ship NANCY FOSTER and RV DAN MOORE from 2003-10-01 to 2004-05-01 (NODC Accession 0066109)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These bottom current, wave and associated observations were collected as part of a larger study to understand the physical processes that control the transport of...

  17. In situ optical and meteorological data including spectral radiance, remote sensing reflectance, absorption and backscattering, chlorophyll and other phytoplankton pigments, variable fluorescence, phytoplankton identification, chromophoric dissolved organic matter, particulate and dissolved carbon and other oceanographic data collected aboard NOAA Ship Nancy Foster in the US Coastal mid-Atlantic and Western Atlantic Ocean for the JPSS dedicated VIIRS Calibration/Validation cruise from 2014-11-11 to 2014-11-20 (NCEI Accession 0156310)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains oceanographic and meteorological data collected during the Dedicated JPSS VIIRS Ocean Color Calibration/Validation Cruise (NF-14-09). The...

  18. New Search Strategies Successfully Optimize Retrieval of Clinically Sound Treatment Studies in EMBASE. A review of: Wong, Sharon S‐L, Nancy L. Wilczynski, and R. Brian Haynes. “Developing Optimal Search Strategies for Detecting Clinically Sound Treatment Studies in EMBASE.” Journal of the Medical Library Association 94.1 (Jan. 2006: 41‐47. 14 May 2007 http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=1324770.

    Directory of Open Access Journals (Sweden)

    John Loy

    2007-06-01

    Full Text Available Objective – To develop and test the sensitivity and specificity, precision andaccuracy of search strategies to retrieve clinically sound treatment studies in the EMBASE database.Design – Analytical study.Setting – Methodologically sound studies of treatment from 55 journals indexed in EMBASE for the year 2000.Subjects – EMBASE and hand searches performed at the Health Information Research Unit of McMaster University, Ontario, Canada.Methods – The authors compare the results of EMBASE searches using their search strategies with the “gold standard” of articles retrieved by hand search. Research assistants initially hand searched each issue of 55 selected journals published in 2000 to identify articles detailing studies on healthcare treatment of humans. Subject coverage of the journals was wide ranging and included obstetrics and gynaecology, psychiatry, oncology, neurology, surgery and general practice. Studies were then assessed to ensure they met the qualifying criteria: random allocation of participants to groups, outcome assessment of at least 80% of participants who began the study, and analysis consistent with study design. Initially, 3850 articles on treatment were identified, of which 1256 (32.6% were methodologically sound. To construct a comprehensive set of search terms, input was sought from librarians and researchers in the US and Canada. This initially produced a list of 5385 terms, of which 4843 were unique and 3524 produced hits. Individual search terms with sensitivity greater then 25% and specificity greater then 75% were incorporated into search strategies for use within the OVID interface for the EMBASE database to retrieve articles meeting the same criteria. These strategies were developed using all 27,769 articles published in the 55 journals in 2000. This all inclusive approach was used to test the search strategies’ ability to identify high quality treatment articles from a larger pool of material.Main results – The single term which achieved best sensitivity was “random:mp,”with a sensitivity of 95.1%. This same term achieved a high specificity of 92.5%. The best‐performing single term for specificity was “randomized:tw” at 96.7%, but this did reduce sensitivity to 63.2%. The single term to achieve the best balance between the two was “clinical trial:mp,” with a sensitivity of 88.3% and specificity of 88.0%. Combining terms produced varied results, and Table 3 within the article details terms used to give the best combinations for sensitivity, specificity and optimisation of both. The best three‐term search strategies for sensitivity achieved a rate just shy of 99% with a specificity of 72.0%, while the optimum three‐term strategy for specificity achieved 96.7% but with a trade off of lowering the rate of sensitivity to 51.7%. The best‐performing combination of search terms to optimise sensitivity and specificity produced values exceeding 92% for both.Conclusion – The authors present search strategies which can successfully be used to retrieve methodologically sound studies on the prevention and treatment of disease and health complications indexed on the EMBASE database. A clear outline of the trade‐off between sensitivity and specificity of the strategies is included.

  19. EFFECTIVENESS OF MC KENZIE EXERCISES IN REDUCING NECK AND BACK PAIN AMONG MADRASSA STUDENTS

    Directory of Open Access Journals (Sweden)

    Saima Aziz

    2016-02-01

    Full Text Available Background: In this advanced era, neck and back pain has become a common musculoskeletal problem. These symptoms have a high prevalence in the community and now they are affecting even our adolescents leaving a major impact on youth’s functional and educational activities. Nevertheless, the burden of these musculoskeletal pains, which relates not only to its prevalence but also to increase in physiological and psychological stress among them, distressing their creativity. Madrassa students have a daily exposure to neck and back pain due to poor posture. The McKenzie method is a popular treatment for back and neck pain among physical therapists. So, the intention of this study is to test the effectiveness of McKenzie exercises in neck and back pain, because hardly any data is available on McKenzie technique and its outcome in Pakistan. The objective of the study is to determine the effectiveness of McKenzie exercises in reducing neck and back pain among madrassa students. Methods: The students were recruited from Madrassa Darul Akram (Baldia town and Jamia Ashraf-ul-madrassa (Gulshan-e-Iqbal Karachi. One sixty three students aged between 12–18 years of both genders who were fulfilling the inclusion criteria were selected from Madrassa Darul Akram (Baldia town and Jamia Ashraf-ul-madrassa (Gulshane-Iqbal. The participants received McKenzie exercises programs intervention for three consecutive weeks. Outcome Measure: Neck Disability Index (NDI, Modified Oswestry Low Back Pain Disability Index (ODI and Numeric Pain Rating Scale (NPRS Results: The present study showed significant results in all three scales in both genders (p<0.001.Among sections, the Hafiz students revealed greater score in all 3 scales before treatment as compared to ‘Alim/Alima’ and ‘Nazra’ students and after treatment showed significant results in all 3 domains (p<0.001. Conclusion: Findings of this study revealed that madrassa students were more prone to develop neck

  20. The moral challenge of green technology / Aarne P Vesilind, Lauren Heine, Jamie Hendry

    Index Scriptorium Estoniae

    Vesilind, Aarne P

    2006-01-01

    Autorid leiavad, et rohelise tehnoloogia kasutuselevõtu ja ettevõtete kasumi teenimise vastuseisu korral võidab kasumlikkus ning reguleerimata vaba turu süsteem ei toeta jätkusuutlikku arengut. Käsitletakse ettevõtte DuPont tegevdirektori Chad Holliday otsust jätkata tulutoova toote Teflon tootmist

  1. Elastomeric Materials for Acoustical Applications

    Science.gov (United States)

    1989-09-15

    fluorine . The classes of materials marketed as Fluorel and Viton by 3M and DuPont, respectively, are copolymers of vinylidene fluoride and...Street Sullivan Varnish Co. Chicago, IL 60632 420 N. Hiart Street- (312) 523-1412 Chicago, IL 60622 (312) 666-8080 Testworth Laboratories, Inc. 139

  2. Circumventing Therapeutic Resistance and the Emergence of Disseminated Breast Cancer Cells Through Non-Invasive Optical Imaging

    Science.gov (United States)

    2015-06-01

    Investigator (1992-1994); National Science Foundation Young Investigator (1993-1998); E. I. DuPont de Nemours Young Faculty Award (1995-1997); Alfred P. Sloan...address of the Funding Agency’s Procuring Contracting/Grants Officer: Amber Stilh·ich U.S . Almy Medical Resem·ch Acquisition Activity, 820 Chandler

  3. 77 FR 3774 - Formations of, Acquisitions by, and Mergers of Bank Holding Companies

    Science.gov (United States)

    2012-01-25

    ..., Dupont, Indiana. River Valley Financial Bank, Madison, Indiana, the existing thrift subsidiary of... FEDERAL RESERVE SYSTEM Formations of, Acquisitions by, and Mergers of Bank Holding Companies The companies listed in this notice have applied to the Board for approval, pursuant to the Bank Holding Company...

  4. Cobordism Obstructions to Vector Fields and a Generalization of Lin's Theorem

    DEFF Research Database (Denmark)

    Svane, Anne Marie

    Atiyah and Dupont have studied the existence of linearly independent vector fields on manifolds by means of K-theory. They obtained the complete conditions for up to three independent vector fields. In the thesis, we try to copy their approach using certain spectra related to cobordism theory. We...

  5. The Coast Artillery Journal. Volume 65, Number 4, October 1926

    Science.gov (United States)

    1926-10-01

    THE PURITAN CONFECTIONERY PURE HOME MADE CANDIES AND ICE CREAM Home Made A/ter.Dinner Mints, Salted Almonds, and Whipping Cream a Specialty PHONE 856...fish hook, which device is shown on the coat of arms and portrays this event. In the battle of New Market , May 15, 1864, in which Captain DuPont (later

  6. Local Strain Measurement of Kevlar Strand with Fiber Optic Bragg Grating

    Science.gov (United States)

    Banks, Curtis E.; Grant, Joseph; Russell, Sam; Arnett, Shawn

    2008-01-01

    1987 DuPont manufactured 4560 denier Kevlar/Epoxy Strands were instrumented with nine and three sensors each. Stress tests were performed at 30,45,60,70 and 80% of ultimate strength with dwell times of 10,000 seconds. FBG showed uneven stress levels which is contrary to conventional observation.

  7. 76 FR 81496 - Product Cancellation Order for Certain Pesticide Registrations

    Science.gov (United States)

    2011-12-28

    .... ID990017 Starane Fluroxypyr. IL080001 Tree-Age Emamectin benzoate. IN080001 Tree-Age Emamectin benzoate.... KY090029 Tree-Age Emamectin benzoate. MD090001 Tree-Age Emamectin benzoate. ME080002 Dupont Coragen... Pirimiphos-methyl. Insecticide. MI080001 Tree-Age Emamectin benzoate. MI980002 Transline 3,6-Dichloro-2...

  8. RESONANCE----I--Ju-ne

    Indian Academy of Sciences (India)

    work there emerged the concepts of functionality ... Copyright 19S0 American Chemi- ... hired by DuPont, and assigned to work in Carothers' group. .... In the Flory model, the application of stress, e.g., ... research institute, and academic activity.

  9. Evaluation ofrapid enzyme immunobinding assays for the detection ...

    African Journals Online (AJOL)

    Abbott. Clonatec. DuPont. No. tests/kit. 40. 30. 200r100. Neg. control. Yes. Yes. Yes. Weak pos. control. No. Yes. Yes. Pos. control. Yes. Yes. Yes. Internal quality control indicator. Yes'. Yes'. No. HIV-1/HIV-2 detection. Yes. Yest. Yes. Reconstitution of reagents required. No. Yes. Yes. Stability of. Equal to. 1 moo for. 6 moo for ...

  10. 75 FR 17929 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

    Science.gov (United States)

    2010-04-08

    ...: Renaissance Washington, DC Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status...: The meeting will include: (1) A presentation of the External Review Workgroup's final report on the... of the meeting. Those individuals who want to make a comment are requested to register online by...

  11. 76 FR 17140 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

    Science.gov (United States)

    2011-03-28

    ...: Renaissance Washington, DC, Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status... Act of 2008. Agenda: The meeting will include: (1) A presentation of the External Review Workgroup's... individuals who want to make oral comments are requested to register online by Tuesday, May 3, 2011 at http...

  12. 75 FR 68802 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

    Science.gov (United States)

    2010-11-09

    ...: Renaissance Washington, DC Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status... workgroups: Communications, Health Information Technology, and Evidence Review; (2) a report from a National... make a comment are requested to register online by Tuesday, January 25, 2011, at http://altarum.cvent...

  13. Taking Care of Business: Walter Carpenter and the Management of American Enterprise.

    Science.gov (United States)

    Cheape, Charles W.

    1996-01-01

    Evaluates the life and career of DuPont corporate executive, Walter Carpenter, and uses it to illustrate the rise of the managerial class. Neither owners nor entrepreneurs, managers like Carpenter used their intelligence and skill to reorganize and expand the companies the companies where they worked. (MJP)

  14. The Coast Guard Proceedings of the Marine Safety and Security Council: Spring 2016

    Science.gov (United States)

    2016-04-01

    management system designed to manage safety elements in the workplace . In practice, an operational...winning DuPont family of workplace safety training offerings. Management Buy-In Even if an organization embraces nonconformities as a call to improved...PROCEEDINGS Spring 2016 Vol. 73, Number 1 Safety Management System Objectives 6 Safety Management Facilitates Safe Vessel Operation Vessel

  15. Energy policies and politics for sustainable world-system development

    DEFF Research Database (Denmark)

    Czeskleba-Dupont, Rolf

    politics, put into perspective by (b) R.C.-Dupont 1993 as the movement of the US in a field of tension between eco- and geopolitics; and (c) a 2006 declaration of ten former environmental ministers to end the nuclear age and to reform the UN mandate of the International Atomic Energy Agency....

  16. Natural Phenomena Hazards Design Criteria and Other Characterization Information for the MFFF at SRS

    Energy Technology Data Exchange (ETDEWEB)

    Wyatt, D.E.

    2000-12-01

    This report is a comprehensive complication applicable to the general Savannah River Site area, developed by both the original contractor, the DuPont Company, and by the current plant operator, Westinghouse Savannah River Company, over the full plant lifetime period (1950 - 2000).

  17. 77 FR 47047 - Biomass Research and Development Technical Advisory Committee

    Science.gov (United States)

    2012-08-07

    ... Committee Act (Public Law No. 92-463, 86 Stat. 770) requires that agencies publish these notices in the.... ADDRESSES: Renaissance DuPont Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. FOR FURTHER...: In keeping with procedures, members of the public are welcome to observe the business of the Biomass...

  18. Application of photopolymer holograms for the anticounterfeit protection of banknotes

    Science.gov (United States)

    Markova, Nina V.; Yamnikov, Leonid S.; Turkina, Elena S.; Semenov, Erick G.; Bulygin, Theodor V.; Levin, Gennady G.

    1998-04-01

    The article analyses holograms counterfeiting techniques and presents grounds for the choice of the optimum type of holograms best protected against counterfeiting -- volume holograms. There is a description of these holograms registration process on DuPont OmniDex photopolymer film and the analysis of the perspective of their use during banknotes production.

  19. The Manufacture, Properties, and Testing of Napalm Soaps

    Science.gov (United States)

    1943-11-17

    prrcltio’n. Tests at 1000C. a.nd 100 p.s,,i. %Inhibitor Induction Addod Pcriod, mins. N one 0 20 Eydroquinone 1 5 duPont #19 1 150 Lecithin 1 SF0 1 45...acetone tends to hydrolyze the soap, liberating more free acid which in turn is removed by the solvent. Table XXIV shows results obtained with a

  20. End of project report on degradation processes in hydrogen fuel cells.

    Science.gov (United States)

    2008-01-01

    Proton exchange membrane (PEM) fuel cells are one of the most popular types of fuel cells. They operate similarly to others with the electrolyte material inbetween the electrodes being a patented polymer called Nafion, made by DuPont. This polyelec...

  1. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... has been rented. This feature is not available right now. Please try again later. Published on Jan ... duPont Hospital for Children - Duration: 3:34. Nemours 1,093 views 3:34 Portraits of Life, Love & ...

  2. Mechanistic insights into the hydrocyanation reaction

    NARCIS (Netherlands)

    Bini, L.

    2009-01-01

    The hydrocyanation of an alkene is a catalytic carbon-carbon bond formation reaction and the obtained nitriles can be converted into a variety of valuable products. The investigation of this reaction has mainly focused on the DuPont adiponitrile (AdN) process. This process is so far the only example

  3. 78 FR 65344 - Center for Scientific Review Amended Notice of Meeting

    Science.gov (United States)

    2013-10-31

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Center for Scientific Review Amended Notice of Meeting Notice is hereby given of a change in the meeting of the Molecular Neuropharmacology and Signaling Study Section, October 7, 2013, 8:00 a.m. to October 8, 2013, 12:00 p.m., The Dupont...

  4. 76 FR 12939 - Granular Polytetrafluoroethylene Resin From Italy: Final Results of Expedited Sunset Review of...

    Science.gov (United States)

    2011-03-09

    ... participate was filed by DuPont within the deadline specified in 19 CFR 351.218(d)(1)(i), as extended due to... producer of PTFE resin in the United States. On February 11, 2011, the Department received a substantive... extended due to the Correction Notice. We received no substantive responses from any respondent interested...

  5. Systematic Characterization of the Immune Response to Gluten and Casein in Autism Spectrum Disorders. Revision

    Science.gov (United States)

    2013-08-01

    tremendous effort on our part, we were unable to acquire enough serum volume for these assays. The price offered by AGRE at the time of acquisition (50 μL...1. Dupont FM, Vensel WH, Tanaka CK, Hurkman WJ, Altenbach SB (2011) Deciphering the complexities of the wheat flour proteome using quantitative two

  6. Integrated Multidisciplinary Design of High Pressure Multistage Compressor Systems (la Conception integree des compresseurs multi-etage a haute performance)

    Science.gov (United States)

    1998-09-01

    development ONERA and SNECMA and is described in [Nicoud, 91]. This methodology [ Karadimas , 1997]. The aim of all efforts method solves the Quasi-3D...computer power, 1994 2-11 BERTHILLIER, M., DUPONT, C., MONDAL, R., KARADIMAS , G. : New Ways for the Design the BARRAU, J.J. : Blade Forced Response

  7. 78 FR 60296 - Center for Scientific Review; Notice of Closed Meetings

    Science.gov (United States)

    2013-10-01

    ... Review Group; Prokaryotic Cell and Molecular Biology Study Section. Date: October 25, 2013. Time: 8:00 a... for Scientific Review Special Emphasis Panel; Eye Diseases 6. Date: October 25, 2013. Time: 9:00 a.m..., Dupont Circle, 1143 New Hampshire Avenue NW., Washington, DC 20037. Contact Person: James P. Harwood Ph.D...

  8. Tumedad tungid pilkases öös / Andres Maimik

    Index Scriptorium Estoniae

    Maimik, Andres, 1970-

    1999-01-01

    Pimedate Ööde III filmifestivalil Tallinnas näidatavast kolmest mängufilmist :"Püssirohutünn": režissöör Goran Paskaljevic : Jugoslaavia ; "Inimlikkus" : režissöör Bruno Dupont : Prantsusmaa : "eXistenZ" : režissöör David Cronenberg : Kanada - Suurbritannia

  9. 78 FR 66752 - Center for Scientific Review; Amended Notice of Meeting

    Science.gov (United States)

    2013-11-06

    ... and Imaging Technologies Study Section, October 10, 2013, 07:45 a.m. to October 11, 2013, 06:00 p.m., Sheraton Delfina Santa Monica Hotel, 530 West Pico Boulevard, Santa Monica, CA 90405 which was published in... Renaissance Washington Dupont Circle Hotel, 1143 New Hampshire Ave. NW., Washington, DC 20037. The meeting...

  10. Veřejná podpora výzkumu a vývoje poskytovaná nepřímou formou v podmínkách malých a středních podniků s důrazem na informační zajištění

    OpenAIRE

    Filipová, Vladimíra

    2011-01-01

    Innovation is a critical factor of the economical development as it is the key source of a competitive advantage and brings an addend value of a concerete company (Zhang, 2O13); Technological innovation could be defined as an endogenous factor responding to economic challenges (McKenzie, 2OO8). Research and development provides innovations, whereas the production of research and development brings externalities. Externalities reduce the private return on investment as such, therefore research...

  11. Interaction of Microbial and Abiotic Processes in Soil Leading to the (Bio)Conversion and Ultimate Attenuation of New Insensitive Munitions Compounds

    Science.gov (United States)

    2016-12-30

    adenine dinucleotide (phosphate) NC Camp Butner soil (alternative abbreviation, soil is from North Carolina) NCBI National Center for Biotechnology ...knowledge and perspectives of bioelimination of xenobiotic compounds. Journal of Biotechnology 51, 287-295, doi:http://dx.doi.org/10.1016/S0168...McKenzie, R. M. The synthesis of birnessite, cryptomelane, and some other oxides and hydroxides of manganese. Mineralogical Magazine 38, 493-502

  12. Mach-6 Receptivity Measurements of Laser-Generated Perturbations on a Flared Cone

    Science.gov (United States)

    2014-08-01

    Shann Rufer, thank you for the guidance, the support, the living space, and of course, the wine and cheese! My fellow co-ops at NASA Langley...vorticity wave is given by McKenzie et al. [26] as tan θt = c M2n M1n tan θi (6.1) where c = a2/a1 and a indicates the speed of sound in the region

  13. Materialidad del texto, textualidad del libro

    Directory of Open Access Journals (Sweden)

    Roger Chartier

    2005-11-01

    Full Text Available This text wishes to show, through the case of Quixote, that the study of the conditions around text publishing and its sense understanding cannot be separated. The intercrossing between the history of the book (and printing and the sociology of texts as defined by D. F. McKenzie, seeks the possibility of overcoming the long-lasting and mutilating division between hermeneutics and bibliography.

  14. New evidence for the asthenospheric origin of the Cameroon Volcanic Line from 1D shear wave velocities

    CSIR Research Space (South Africa)

    Tokam, AP

    2013-10-01

    Full Text Available the mantle composition beneath Ethiopia and southern Brazil (Keranen et al., 2009; Julia et al., 2008). Many petrological studies of ultramafic orogenic massifs and ultramafic xenoliths along the CVL (mainly around Mount Cameroon and the Adamawa....N. and Oya, M. 2010. Petrological and chemical variability of peridotite xenoliths from the Cameroon Volcanic Line, West Africa: an evidence from Plume emplacement. Journal of Mineralogical and Petrological Sciences, 107, 57-69. McKenzie, D...

  15. Critical appraisal of the Spanner™ prostatic stent in the treatment of prostatic obstruction

    OpenAIRE

    McKenzie, Patrick; Badlani, Gopal

    2011-01-01

    Patrick McKenzie1, Gopal Badlani11Department of Urology, Wake Forest University School of Medicine, Winston-Salem NC, USAAbstract: The Spanner™ stent was first used in patients to relieve bladder outlet obstruction (BOO), and has recently been used in patients following transurethral microwave thermotherapy and men unfit for surgical intervention. We review the current literature on the role of the Spanner stent in treating prostatic obstruction compared to previously reported cases...

  16. Proceedings of a Workshop on the Physical Properties of Volcanic Seafloor, Held at Woods Hole, Massachusetts on April 24-26, 1990

    Science.gov (United States)

    1990-04-26

    sediment coring and heat flow survey (-* regional variation at srafloor) (suggest corridor north of Clipperton to - far enough to miss equatorial high...SAMPLE FROM SCAMOUNTS " PLATEAUS AND ASEIMIC RIDGES o OSOP SAMPLE FROM BEHIND 40 ISLAND ARCS 0 + OSOP SAMPLE OF SILL OR o MASSIVE FLOW Z 30 SOSCP SAMPLE...M. and McKenzie, D., 1987, Simple 2-D models of melt extraction at mid- ocean ridges and island arcs, Earth Planet. Sci. Lent., 83, 137-152. Verhoogen

  17. Kaubakategooriate juhtimine annab konkurentide ees eelise / Marika Merilai

    Index Scriptorium Estoniae

    Merilai, Marika

    2008-01-01

    Tootekategooriate või ka kaubakategooriate juhtimine on ettevõtte äristrateegia, mis võimaldab jaekaubandusettevõttel saavutada konkurentidest paremaid tulemusi. Kanada turundusprofessori Brent McKenzie sõnul on kaubakategooriate juhtimine keeruline, kuna pole olemas ühte standardset lahendust, kuidas ettevõttes kategooriate juhtimist teostada. Skeem: Kaubakategooriate juhtimise eesmärgid. Kommenteerib ASi A-Selver sortimendijuht Agi Metsandi

  18. Is nuclear energy safe for workers and the public. III

    International Nuclear Information System (INIS)

    McKenzie, J.J. Jr.

    1976-01-01

    Dr. McKenzie says a national energy policy does exist, being based on synthetic fuels from coal and nuclear energy to meet future demands, and based on a complete lack of attention to conservation. In meeting energy demands for the future, he feels the opportunity still exists to create the scenario that will require meaningful jobs in the process, jobs requiring less capital and less energy. On the risks of nuclear energy, Dr. McKenzie discusses the funding, research, and results of the Atomic Energy Commission's safety program. He airs his views on WASH-1400, the study by Professor Norman Rasmussen, dealing with the possibilities of reactor core meltdowns. He thinks a worse problem resulting from nuclear power plants is that of waste disposal and cites AEC's poor record of managing these wastes in Kansas and elsewhere. In concluding, Dr. McKenzie says: (1) nuclear power may not be the best thing in the world, maybe we should look at other alternatives; (2) conservation is most important, and creates jobs at the same time if handled correctly; (3) AFL-C10 should sponsor a study on energy systems investigating its employment potential, net energy, economic factors, and capital requirements; and (4) construction of nuclear and coal plants will create jobs, but building solar plants will create jobs with fewer restraints on the environment. A panel discussion follows this, the third paper, on nuclear safety for workers and the public

  19. International Water Center

    Science.gov (United States)

    The urban district of Nancy and the Town of Nancy, France, have taken the initiative of creating an International Center of Water (Centre International de l'Eau à Nancy—NAN.C.I.E.) in association with two universities, six engineering colleges, the Research Centers of Nancy, the Rhine-Meuse Basin Agency, and the Chamber of Commerce and Industry. The aim of this center is to promote research and technology transfer in the areas of water and sanitation. In 1985 it will initiate a research program drawing on the experience of 350 researchers and engineers of various disciplines who have already been assigned to research in these fields. The research themes, the majority of which will be multidisciplinary, concern aspects of hygiene and health, the engineering of industrial processes, water resources, and the environment and agriculture. A specialist training program offering five types of training aimed at university graduates, graduates of engineering colleges, or experts, will start in October 1984.

  20. Diatom community response to climate variability over the past 37,000 years in the sub-tropics of the Southern Hemisphere

    Energy Technology Data Exchange (ETDEWEB)

    Hembrow, Sarah C., E-mail: sarah.hembrow@scu.edu.au [School of Environment, Science and Engineering, Southern Cross University, Lismore, NSW 2480 (Australia); Taffs, Kathryn H. [School of Environment, Science and Engineering, Southern Cross University, Lismore, NSW 2480 (Australia); Atahan, Pia [Institute for Environmental Research, Australian Nuclear Science and Technology Organisation, Kirrawee, NSW 2232 (Australia); Parr, Jeff [School of Environment, Science and Engineering, Southern Cross University, Lismore, NSW 2480 (Australia); Zawadzki, Atun; Heijnis, Henk [Institute for Environmental Research, Australian Nuclear Science and Technology Organisation, Kirrawee, NSW 2232 (Australia)

    2014-01-01

    Climate change is impacting global surface water resources, increasing the need for a deeper understanding of the interaction between climate and biological diversity. This is particularly the case in the Southern Hemisphere sub-tropics, where little information exists on the aquatic biota response to climate variations. Palaeolimnological techniques, in particular the use of diatoms, are well established and can significantly contribute to the understanding of climatic variability and the impacts that change in climate have on aquatic ecosystems. A sediment core from Lake McKenzie, Fraser Island (Australia), was used to investigate interactions between climate influences and aquatic ecosystems. This study utilises a combination of proxies including biological (diatom), geochemical and chronological techniques to investigate long-term aquatic changes within the perched-dune lake. A combination of {sup 210}Pb and AMS {sup 14}C dates showed that the retrieved sediment represented a history of ca. 37,000 cal. yBP. The sedimentation rate in Lake McKenzie is very low, ranging on average from 0.11 mm to 0.26 mm per year. A sediment hiatus was observed between ca. 18,300 and 14,000 cal. yBP suggesting a period of dry conditions at the site. The diatom record shows little variability over the period of record, with benthic, freshwater acidic tolerant species dominating. Relative abundance of planktonic species and geochemical results indicates a period of increased water depth and lake productivity in the early Holocene and a gradual decrease in effective precipitation throughout the Holocene. Results from this study not only support earlier work conducted on Fraser Island using pollen reconstructions but also demonstrate that diatom community diversity has been relatively consistent throughout the Holocene and late Pleistocene with only minor cyclical fluctuation evident. This record is consistent with the few other aquatic palaeoecological records from the Southern

  1. Diatom community response to climate variability over the past 37,000 years in the sub-tropics of the Southern Hemisphere

    International Nuclear Information System (INIS)

    Hembrow, Sarah C.; Taffs, Kathryn H.; Atahan, Pia; Parr, Jeff; Zawadzki, Atun; Heijnis, Henk

    2014-01-01

    Climate change is impacting global surface water resources, increasing the need for a deeper understanding of the interaction between climate and biological diversity. This is particularly the case in the Southern Hemisphere sub-tropics, where little information exists on the aquatic biota response to climate variations. Palaeolimnological techniques, in particular the use of diatoms, are well established and can significantly contribute to the understanding of climatic variability and the impacts that change in climate have on aquatic ecosystems. A sediment core from Lake McKenzie, Fraser Island (Australia), was used to investigate interactions between climate influences and aquatic ecosystems. This study utilises a combination of proxies including biological (diatom), geochemical and chronological techniques to investigate long-term aquatic changes within the perched-dune lake. A combination of 210 Pb and AMS 14 C dates showed that the retrieved sediment represented a history of ca. 37,000 cal. yBP. The sedimentation rate in Lake McKenzie is very low, ranging on average from 0.11 mm to 0.26 mm per year. A sediment hiatus was observed between ca. 18,300 and 14,000 cal. yBP suggesting a period of dry conditions at the site. The diatom record shows little variability over the period of record, with benthic, freshwater acidic tolerant species dominating. Relative abundance of planktonic species and geochemical results indicates a period of increased water depth and lake productivity in the early Holocene and a gradual decrease in effective precipitation throughout the Holocene. Results from this study not only support earlier work conducted on Fraser Island using pollen reconstructions but also demonstrate that diatom community diversity has been relatively consistent throughout the Holocene and late Pleistocene with only minor cyclical fluctuation evident. This record is consistent with the few other aquatic palaeoecological records from the Southern Hemisphere sub

  2. La comunidad del naciente : por una biopolítica afirmativa del exceso

    OpenAIRE

    Gómez Montañez, César Mario

    2010-01-01

    Quisiéramos, en respuesta a Jean-Luc Nancy, arriesgar un desarrollo de la cuestión de la comunidad que, a su vez, nos permita resignificar la individualidad y la inmanencia. En otras palabras, se trata de rearticular individuo y comunidad desde nuevos supuestos. La cuestión es retomar el tono extático que demanda Nancy, esa figura del exceso propuesta por Bataille, y evidenciarlo en el modelo que propone Gilbert Simondon para la individuación, y Roberto Esposito para la communitas. El trabajo...

  3. De duurzame controller neemt leiding in een traditie naar maatschappelijk verantwoord ondernemen

    NARCIS (Netherlands)

    Boersma-de Jong, Margreet F.

    2015-01-01

    Steeds meer dringt het besef door dat er geen andere weg meer is dan duurzaam ondernemen. Organisaties die dit inzien streven naar meer dan al- leen nanciële winstmaximalisatie: er moet ook winst worden gecreëerd voor de mens, samenleving en milieu. Als de MVO-ambities meer zijn dan window-dressing,

  4. Vastaliste kunst Eestis

    Index Scriptorium Estoniae

    1998-01-01

    Tallinnas Rotermanni soolalaos veebruari keskpaigani Ameerikast saabunud näitus "Nonkonformistlik kunst Venemaal Norton ja Nancy Dodge'i kogust", mis hõlmab töid aastaist 1956-1986 ning sisaldab ka eesti kunstnike töid.

  5. USAs avati suurim Balti kunsti näitus / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2002-01-01

    New Jerseys Rutgersi ülikooli kunstimuuseumis on väljas 190 Eesti, Läti ja Leedu kunstniku tööd Norton ja Nancy Dodge'i mitte-konformistliku nõukogude kunsti kollektsioonist, mille omanikud ülikoolile kinkisid. Näitusekataloogi artiklid on kirjutanud Juta Kivimäe, Eha Komissarov, Sirje Helme ja kanadalane Eha Sepp

  6. From Redistribution to Recognition: How School Principals Perceive Social Justice

    Science.gov (United States)

    Wang, Fei

    2016-01-01

    Where there are people, there is social in/justice. Using Nancy Fraser's framework, this qualitative research examines how school principals perceive social justice in schools. Twenty-one elementary and secondary school principals were interviewed in the Greater Toronto Area. The study provides some empirical evidence on the ways social…

  7. Harry Potter ja Scarlett käivad kohut / Ilona Martson

    Index Scriptorium Estoniae

    Martson, Ilona, 1970-

    2001-01-01

    Alice Randalli romaan "Tuul on läinud" - samad sündmused kui Margaret Mitchelli romaanis "Tuulest viidud", ainult neegerorjade vaatevinklist. Nancy Stofferi raamatud "Larry Potter ja tema parim sõber Lilly" ja "Legend Rah'ist ja Mugudest" ilmusid 1984. a. Joanne Kathleen Rowlingi "Harry Potter" lood aga valmisid hiljem

  8. Serving the Community: A Small, Liberal Arts College Writing Center.

    Science.gov (United States)

    Rossini, Carol

    The word "service" certainly conjures some undesirable connotations, and theorists such as Nancy Grimm propose that writing centers need to shed their service labels to attain respectability. In this paper, the writing center director of a small liberal arts college shares her perspective and juxtaposes that with Grimm's position that…

  9. "Putting on Band-Aids": The Contradictory Roles and "Small Wins" of Tempered Campus Radicals

    Science.gov (United States)

    Westerman, Marni; Huey, Laura

    2012-01-01

    Nancy Fraser's propositions regarding the nature of "boundary" work carried out by experts within organizations suggests that individuals who work within bureaucratic structures are so constrained by the institutional context that they become detached, depoliticizing arbitrators of politicized claims. The purpose of the research reported…

  10. Investigating Shigella sonnei Infections

    Centers for Disease Control (CDC) Podcasts

    2011-11-17

    Dr. Nancy Strockbine, Chief of the Escherichia and Shigella Reference Unit at CDC, discusses Shigella sonnei infections.  Created: 11/17/2011 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 11/21/2011.

  11. African Journal of Biotechnology - Vol 2, No 11 (2003)

    African Journals Online (AJOL)

    Segenet Kelemu, George Mahuku, Martin Fregene, Douglas Pachino, Nancy Johnson, Lee Calvert, Idupulapati Rao, Robin Buruchara, Tilahun Amede, Paul Kimani, ... Festus Doyin Adu, Jane Iber, Tekena Harry, Cara Burns, Oluseyi Oyedele, Johnson Adekunle Adeniji, Mubarak Ossei-Kwasi, David Kilpatrick, Oyewale ...

  12. FIELD VALIDATION OF A SHEEPSHEAD MINNOW ESTROGEN-RESPONSIVE CDNA MACROARRAY

    Science.gov (United States)

    Hemmer, Michael J., Iris Knoebl, Becky L. Hemmer, Patrick Larkin, Peggy S. Harris and Nancy D. Denslow. In press. Field Validation of a Sheepshead Minnow Estrogen-Responsive cDNA Macroarray (Abstract). To be presented at the SETAC Fourth World Congress, 14-18 November 2004, Portl...

  13. EXPRESSION PROFILING OF ESTROGENIC COMPOUNDS USING A SHEEPSHEAD MINNOW CDNA MACROARRAY

    Science.gov (United States)

    Larkin, Patrick, Leroy C. Folmar, Michael J. Hemmer, Arianna J. Poston and Nancy D. Denslow. 2003. Expression Profiling of Estrogenic Compounds Using a Sheepshead Minnow cDNA Macroarray. Environ. Health Perspect. 111(6):839-846. (ERL,GB 1171). A variety of anthropogenic c...

  14. The Denaturation of Environmental Education: Exploring the Role of Ecotechnologies

    Science.gov (United States)

    Gough, Annette; Gough, Noel

    2016-01-01

    This article explores the changing ways "environment" has been represented in the discourses of environmental education and education for sustainable development (ESD) in United Nations (and related) publications since the 1970s. It draws on the writings of Jean-Luc Nancy and discusses the increasingly dominant view of the environment as…

  15. Uvidet zad Dzheka Nikolsona i ne umeret! / Jevgeni Levik

    Index Scriptorium Estoniae

    Levik, Jevgeni

    2004-01-01

    Komöödiafilm "Parem hilja kui mitte kunagi" ("Something's Gotta Give") : režissöör Nancy Meyers : Ameerika Ühendriigid 2003 ja mängufilm "Tõlkes kaduma läinud" ("Lost In Translation") : režissöör Sofia Coppola : Ameerika Ühendriigid 2003

  16. The Modern First Lady and Public Policy: From Edith Wilson through Hillary Rodham Clinton.

    Science.gov (United States)

    Black, Allida M.

    2001-01-01

    Discusses the role in and influence on public policy of twentieth century First Ladies including Edith Roosevelt, Helen Taft, Ellen Wilson, Edith Wilson, Florence Harding, Lou Henry Hoover, Eleanor Roosevelt, Jacqueline Kennedy, Lady Bird Johnson, Rosalynn Carter, Nancy Reagan, Barbara Bush, and Hillary Rodham Clinton. (CMK)

  17. 75 FR 39618 - Proposed Information Collection (Request for Identifying Information Re: Veteran's Loan Records...

    Science.gov (United States)

    2010-07-09

    ..., benefits will not be paid or furnished by reason of an incomplete application. Affected Public: Individuals... Benefits Administration, Department of Veterans Affairs. ACTION: Notice. SUMMARY: The Veterans Benefits....Regulations.gov or to Nancy J. Kessinger, Veterans Benefits Administration (20M35), Department of Veterans...

  18. Development of the isotopic analysis of individual macroparticles: a study of desert dust and interplanetary dust

    International Nuclear Information System (INIS)

    Aleon, Jerome

    2001-01-01

    During this thesis a new analytical technique has been developed to allow the determination of isotopic ratios in microparticles. This technique is based on the imaging properties of the IMS 1270 ion microprobe in CRPG in Nancy. The development of quantitative isotopic imaging allows the determination of the "1"8O/"1"6O ratio of individual macroparticles having a size [fr

  19. Pop / Mart Juur

    Index Scriptorium Estoniae

    Juur, Mart, 1964-

    2002-01-01

    Heliplaatidest Nancy Sinatra "The Very Best Of". A-ha "Lifelines". Danny Krivit "Grass Roots". Frank Sinatra "Romance". Armand Van Helden "Gandhi Khan". Elvis Costello "When I Was Cruel". Erinevad esinejad "Audiolounge". Michael Bolton "Only A Woman Like You". Sheryl Crow "C'mon, C'mon"

  20. Pursuing the Depths of Knowledge

    Science.gov (United States)

    Boyles, Nancy

    2016-01-01

    Today's state literacy standards and assessments demand deeper levels of knowledge from students. But many teachers ask, "What does depth of knowledge look like on these new, more rigorous assessments? How do we prepare students for this kind of thinking?" In this article, Nancy Boyles uses a sampling of questions from the PARCC and SBAC…

  1. Civic Fragmentation or Voluntary Association? Habermas, Fraser, and Charter School Segregation

    Science.gov (United States)

    Wilson, Terri S.

    2010-01-01

    In this essay, Terri Wilson puts the argument developed by Kathleen Knight Abowitz that charter schools could be considered as counterpublic spaces into interaction with empirical research that explores patterns of voluntary self-segregation in charter schools. Wilson returns to the theoretical tension between Jurgen Habermas and Nancy Fraser over…

  2. Tetanus: Questions and Answers

    Science.gov (United States)

    ... given to adolescents and adults, usually as a single dose; the exception is pregnant women who should receive Tdap during each pregnancy. • Td: ... catch-up vaccinations. All adults should receive a single dose of Tdap as soon as ... women should receive Tdap during each preg- nancy. Adolescents ...

  3. Between Efficiency, Capability and Recognition: Competing Epistemes in Global Governance Reforms

    Science.gov (United States)

    Chan, Jennifer

    2007-01-01

    This article examines global governance reforms as a site of contestation between three different "truths"/epistemes (the market, human rights principles, and cultural identity) in terms of the competing principles of efficiency, capability, and recognition. Nancy Fraser's conceptions of participation parity and a dialogical approach of…

  4. Intellekt ja selle areng imiku- ja väikelapseeas / Marika Veisson

    Index Scriptorium Estoniae

    Veisson, Marika, 1949-

    1998-01-01

    Kolm ajaloolist lähenemist intellekti uurimisele. Nancy Bayley poolt 1969.a. välja töötatud esimene põhjalikum väikelaste ja imikute intellekti uurimismetoodika - Bayley Imikute Arengu Skaala; psühhomeetriline lähenemine, J. Piaget kognitiivse arengu teooria

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 76 - 100 of 1853 ... Vol 27, No 3 (1992), A new record of Craspedacusta sowerbii (Cnidaria: Limnomedusae) from southern Africa, Abstract PDF. Nancy A. Rayner, C.C. Appleton. Vol 5, No 2 (1970), A new record of a moerisiid hydroid from South Africa, Abstract PDF. NAH Millard. Vol 27, No 4 (1992), A new sandperch, ...

  6. 77 FR 20887 - Proposed Information Collection (Educational/Vocational Counseling Application) Activity: Comment...

    Science.gov (United States)

    2012-04-06

    ... (Educational/Vocational Counseling Application) Activity: Comment Request AGENCY: Veterans Benefits... information needed to determine an applicant's entitlement to counseling services. DATES: Written comments and... may be viewed online through FDMS. FOR FURTHER INFORMATION CONTACT: Nancy J. Kessinger at (202) 461...

  7. New Location Improves Efficiency | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer The physical proximity of the SAIC-Frederick Intellectual Property (IP) Office to the NCI Technology Transfer Center (NCI-TTC) is one of the many benefits of being at the Advanced Technology Research Facility (ATRF), according to Courtney Silverthorn, Ph.D. Being in one location “has increased the effectiveness of both informal communication and

  8. Rhetoric and Gender in Jane Austen's "Persuasion."

    Science.gov (United States)

    Walzer, Arthur E.

    1995-01-01

    Argues for a reading of Jane Austen's "Persuasion" that undermines Joseph Duffy's reading of the novel as a commentary on shifting social class structures, and which bolsters Nancy Armstrong's reading as a commentary on female voice and the values of the domestic household. Interprets the novel in the light of 18th-century rhetorical…

  9. Participating Unequally: Student Experiences at UWC

    Science.gov (United States)

    Clowes, Lindsay; Shefer, Tamara; Ngabaza, Sisa

    2017-01-01

    This paper uses Nancy Fraser's concept of participatory parity to reflect on data gathered by and from third year students in a final year research module in the Women's and Gender Studies Department at the University of the Western Cape in 2015. During the course students developed a research proposal, collected and shared data with other…

  10. Voices of Authority: Education and Linguistic Difference. Contemporary Studies in Linguistics and Education, Volume 1.

    Science.gov (United States)

    Heller, Monica, Ed.; Martin-Jones, Marilyn, Ed.

    Chapters in this volume include the following: "Co-Constructing School Safetime: Safetalk Practices in Peruvian and South African Classrooms" (Nancy H. Hornberger, J. Keith Chick); "Codeswitching and Collusion: Classroom Interaction in Botswana Primary Schools" (Jo Arthur); "Language and Educational Inequality in Primary…

  11. Effects of Trade Restrictions on Imports of Steel.

    Science.gov (United States)

    1980-11-01

    unfortunate that the report has little or demand for steel eqialion Yet results using the noingto say about steel esports . which have been sgnitiant...Sprull. Nancy. (Repinted from Economic Inquiry. Vol. XIV. No 94th annual convention of the American Psycho "Pubic Drug Treatment and Addict Crim," Jose 1

  12. CD review: Giving voice to hope: music of Liberian refugees | Thorn ...

    African Journals Online (AJOL)

    Title: Giving voice to hope: music of Liberian refugees (2009). One compact disk and booklet. Production supervision by Barry Tonge, Michael Frishkopf, Nancy Hanneman, Ellis Pourbaix and Jennifer Woronuk. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  13. Best Collaborative Publication Announced during Spring Research Festival Week | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer The winner of the 2012 competition for the best collaborative publication was announced on May 7, as part of the lead-up to the Spring Research Festival sponsored by the National Interagency Confederation for Biological Research (NICBR) and the National Cancer Institute at Frederick on May 8 and 9.

  14. Methodological Pluralism and Narrative Inquiry

    Science.gov (United States)

    Michie, Michael

    2013-01-01

    This paper considers how the integral theory model of Nancy Davis and Laurie Callihan might be enacted using a different qualitative methodology, in this case the narrative methodology. The focus of narrative research is shown to be on "what meaning is being made" rather than "what is happening here" (quadrant 2 rather than…

  15. Loss muinasjuturaamatust / Agu Veetamm

    Index Scriptorium Estoniae

    Veetamm, Agu, 1953-

    2004-01-01

    Ballindaloch on üks väheseid Shoti losse, kus omanikud aastaringselt elavad. 450 aastat on loss kuulunud Macpherson-Grantide suguvõsale. Praegu on lossi omanikuks Clare Nancy Macpherson-Grant Russell, kelle kujundatud on kiviktaimla ja rosaarium. Lossi ajaloost, omanikest, ümberehitustest, ringkäigust lossis, pargist. 14 ill

  16. Reviewing Policy: Starting the Wrong Conversations--The Public School Crisis and "Waiting for Superman"

    Science.gov (United States)

    Swalwell, Katy; Apple, Michael W.

    2011-01-01

    The documentary "Waiting for Superman" has become one of those rare things, a (supposed) documentary that generates a wider audience. It also is one of the more recent embodiments of what Nancy Fraser (1989) labels as the "politics of needs and needs discourses." Dominant groups listen carefully to the language and issues that…

  17. The Millennium Cohort Family Study: A Prospective Evaluation of the Health and Well-Being of Military Service Members and Their Families

    Science.gov (United States)

    2014-06-10

    psychology , family, military, epidemiology, mental health, deployments Correspondence Nancy Crum-Cianflone, Deployment Health Research Department...American Psychological Association, 2007; Siegel et al., 2013; US Army Medical Research and Materiel Command, 2013). Although studies on military...functional health Modules on common types of mental disorders: depression, anxiety, panic syndrome, somatoform symptoms, alcohol abuse, bulimia nervosa

  18. Type 1 diabetes mellitus and atopic diseases in children.

    African Journals Online (AJOL)

    Ehab

    Nancy S. Elbarbary. Assistant Professor of Pediatrics, Faculty of Medicine, Ain Shams University, Cairo, Egypt. Background. Diabetes mellitus type 1 (T1DM) is a complex disease resulting from the interplay of genetic, epigenetic, and environmental factors.1 Worldwide,. T1DM epidemic represents an increasing global.

  19. The Relationship between School Climate, Trust, Enabling Structures, and Perceived School Effectiveness

    Science.gov (United States)

    Mayerson, Deborah R.

    2010-01-01

    The purpose of Deborah R. Mayerson was to assess the relative impact of climate, trust, and bureaucratic structure upon teachers' perceptions of organizational effectiveness. An existing data set compiled by Nancy Casella (2006) for her dissertation was analyzed. The data consisted of questionnaire responses of a random sample of 220 public school…

  20. The baby has not come: obstructed labour | MacKeith | South Sudan ...

    African Journals Online (AJOL)

    The baby has not come: obstructed labour. Nancy MacKeith, Wal Bichiok Wur. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's ...

  1. A Comparison of HAART Outcomes between the US Military HIV Natural History Study (NHS) and HIV Atlanta Veterans Affairs Cohort Study (HAVACS)

    Science.gov (United States)

    2013-05-01

    Acknowledgments The IDCRP HIV Working Group includes: Susan Banks, RN, CAPT Mary Bavaro, MD, Ionut Bebu, PhD, Helen Chun, MD, Nancy Crum- Cianflone, MD, MPH...Cathy Decker, MD, Conner Eggleston, LTC Tomas Ferguson, MD, COL Susan Fraser, MD, MAJ Joshua Hartzell, MD, MAJ Joshua Hawley, MD, LTC Gunther Hsue, MD

  2. Th,e Radiological Appearance and Incidence of Lymphoma*

    African Journals Online (AJOL)

    1971-12-11

    Dec 11, 1971 ... stinal glands and this event may be terminal. It is as well to remember ... from carcinoma in which it is relatively more frequent.; ... In lymphomas at this stage the glandular ... These comprise 2'10 of total gastric malig- nancy.

  3. Tourism researcher wins Best Paper Award at international conference

    OpenAIRE

    Ho, Sookhan

    2010-01-01

    Nancy McGehee, associate professor of hospitality and tourism management research at the Pamplin College of Business at Virginia Tech, received a 2010 Best Paper Award at the recent ATLAS (Association for Tourism and Leisure Education) International Conference on Sustainable Tourism.

  4. Judging children's participatory parity from social justice and the ...

    African Journals Online (AJOL)

    This article proposes a model for judging children's participatory parity in different social spaces. The notion of participatory parity originates in Nancy Fraser's normative theory for social justice, where it concerns the participatory status of adults. What, then, constitutes participatory parity for children? How should we judge ...

  5. Building and Evaluating Research Capacity in Healthcare Systems ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-06-29

    Jun 29, 2016 ... Research capacity is considered an essential foundation for a ... of the world, including Sub-Saharan Africa, the Caribbean, Latin America, and Asia. ... Nancy Edwards is a nurse epidemiologist and a professor in the School of ...

  6. Harvard Education Letter. Volume 26, Number 3, May-June 2010

    Science.gov (United States)

    Chauncey, Caroline T., Ed.

    2010-01-01

    "Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Unleashing the "Brain Power" of Groups in the Classroom: The Neuroscience behind Collaborative Work (Nancy Walser); (2) Putting AP to the Test: New Research Assesses the…

  7. Harvard Education Letter. Volume 23, Number 1, January-February 2007

    Science.gov (United States)

    Chauncey, Caroline, Ed.

    2007-01-01

    "Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Response to Intervention: A New Approach to Reading Instruction Aims to Catch Struggling Readers Early (Nancy Walser); (2) Getting Advisory Right: Focus and…

  8. Harvard Education Letter. Volume 24, Number 5, September-October 2008

    Science.gov (United States)

    Chauncey, Caroline, Ed.

    2008-01-01

    "Harvard Education Letter" is published bimonthly by the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Teaching 21st Century Skills: What Does It Look Like in Practice? (Nancy Walser); (2) Getting and Spending: Schools and Districts Share Lessons on the Effective Uses of…

  9. The OSS Model and the Future of the SOF Warrior

    Science.gov (United States)

    2011-11-01

    historians served as academic advisors to the project: Dr. Nancy W. Collins, Columbia University; Dr. Troy Sacquety, USASOC historian; and Mr. Rob Townley ...December 2010. 23 Rob Townley , Conversation with OSS historian and descendant of OSS veteran, November 2010. 24 Careers, CIA, available at https...Operations Group (OG) officers. 32 29 Rob Townley , 2010. 30 Although this quote is commonly

  10. 78 FR 4871 - Notice of Public Meeting: Northwest California Resource Advisory Council

    Science.gov (United States)

    2013-01-23

    .... They must provide their own transportation, food and beverages. FOR FURTHER INFORMATION CONTACT: Nancy... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLCAN01000.L18200000.XZ0000] Notice of Public Meeting: Northwest California Resource Advisory Council AGENCY: Bureau of Land Management...

  11. Correction to: Comparing the UK EQ-5D-3L and English EQ-5D-5L Value Sets

    NARCIS (Netherlands)

    B. Mulhern (Brendan); Feng, Y. (Yan); K.K. Shah (Koonal); M.F. Janssen (Bas); M. Herdman (Michael); van Hout, B. (Ben); N. Devlin (Nancy)

    2018-01-01

    textabstractThe article Comparing the UK EQ-5D-3L and English EQ-5D-5L Value Sets, written by Brendan Mulhern, Yan Feng, Koonal Shah, Mathieu F. Janssen, Michael Herdman, Ben van Hout, Nancy Devlin was originally published electronically on the publisher’s internet portal (currently SpringerLink) on

  12. From Poetry to Music: "Northern Lullaby"

    Science.gov (United States)

    Cardany, Audrey Berger

    2011-01-01

    Nancy White Carlstrom's children's book, "Northern Lullaby," conjures through poetry the beauty of the Alaskan landscape in the evening. The book provides an opportunity for music teachers to help their students transform text and visual images to music. The author describes connections for reading comprehension in the general music…

  13. 75 FR 57440 - Performance Review Board Membership

    Science.gov (United States)

    2010-09-21

    ... DEPARTMENT OF COMMERCE Performance Review Board Membership AGENCY: Economics and Statistics... the Performance Review Board in accordance with the Economics and Statistics Administration's Senior... Callahan, Nancy M. Gordon, Howard R. Hogan, Arnold A. Jackson, Theodore A. Johnson, Steven J. Jost, J...

  14. Recycle Runway

    Science.gov (United States)

    Stephens, Pam

    2009-01-01

    Nancy Judd has been called a folk artist, an outsider artist, and a designer--all characterizations that she tends to shirk. Perhaps if labels are needed, environmental artist educator is more appropriate. Judd lives and works in Santa Fe, New Mexico. She dedicates much of her time to creating art that raises public awareness of environmental…

  15. Mass spectrometry. Environment, biology, oenology, medicine, geology, chemistry, archaeology, mechanisms; Spectrometrie de masse. Environnement, biologie, oenologie, medecine, geologie, chimie, archeologie, mecanismes

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    This document provides the papers (communications and posters) presented at the 16. French days of mass spectrometry, held September 6-9, 1999 in Nancy, France. 7 papers are interesting for the ETDE database and are analyzed separately. (O.M.)

  16. 2007 Preserve America Presidential Awards

    Science.gov (United States)

    aviation history museum that emphasizes people and culture as well as technology and events. With a the Private Preservation category, the two winners are: The History Channel, Save Our History Save Our History were Abbe Raven, president and CEO, A&E Television Networks; and Nancy Dubuc

  17. A Novel Ras Effector Pathway Found to Play Significant Role in Tumor Suppression | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer; photo by Richard Frederickson, Staff Photographer Normal cells have mechanisms to prevent the development of cancer. Among these is a type of tumor suppressor mechanism known as oncogene-induced senescence, or OIS, which halts the uncontrolled growth of cells caused by mutations in oncogenes. The oncogene Ras plays a crucial role in inducing OIS

  18. IL-27 Found to Play Significant Role in Conferring HIV Resistance | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer The human immunodeficiency virus (HIV) targets specific immune cells in the body known as macrophages because these are the cells that eliminate foreign material such as bacteria or viruses. HIV is able to reproduce and spread throughout the body if it can avoid destruction by macrophages. A recent study by Lue Dai, Ph.D., and colleagues revealed

  19. Affective telepathy, or the intuition of the heart: 'Persona' with 'Mulholland Drive'

    NARCIS (Netherlands)

    Laine, T.

    2009-01-01

    This paper investigates the affective dynamism of the cinematic experience in terms of the so-called intuition of the heart. Inspired by the writings of Jean-Luc Nancy, it shows how the affective circulation between the film and the spectator can be a matter of sharing rather than a consequence of

  20. Smoking Cessation and Improvement in Physical Performance Among Young Men

    Science.gov (United States)

    2015-03-01

    Program support team at the Naval Health Research Center, especially Dr. Christopher Phillips, Dr. Nancy Crum-Cianflone, Lauren Kipp, Dennis...4): CD003289. 42. Branstetter SA, Blosnich J, Dino G, Nolan J, Horn K: Gender differ­ ences in cigarette smoking, social correlates and cessation

  1. Nigerian Journal of Paediatrics 2013;40(2)

    African Journals Online (AJOL)

    owner

    2012-08-08

    Aug 8, 2012 ... mothers of SGA babies had signifi- cantly lower values ... (teenage and mothers older than 35 years),2 primiparity .... 1.7%) and sickle cell anaemia (9; 1.1%). Mothers of ..... nancy, as well as improve utilization of antenatal ser-.

  2. Light Noble Gases and a Cosmic Ray Exposure Age for the Bunburra Rockhole Meteorite

    Czech Academy of Sciences Publication Activity Database

    Meier, M.M.M.; Bland, P.A.; Welten, K.C.; Spurný, Pavel; Baur, H.; Wieler, R.

    2009-01-01

    Roč. 44, Supplement (2009), A138-A138 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * light noble gas * concentration Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

  3. [Video games, a therapeutic mediator for teens].

    Science.gov (United States)

    Nickler, Christophe

    2015-10-01

    Teenagers love video games and other multimedia tools. Sometimes they love them too much, leading to addictive use. A child psychiatry team in Nancy has developed a therapeutic multimedia workshop to contribute to treating teens. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  4. Holger Loodus / Holger Loodus

    Index Scriptorium Estoniae

    Loodus, Holger

    2000-01-01

    Ansambli "Dallas" kitarrist Holger Loodus kirjutab oma olulisematest plaatidest:Blondie "The Best Of Blondie", Peter Sarstedt "Peter Sarstedt", Collage "Kadriko", Kraftwerk "Man Machine", Nansy Sinatra ja Lee Hazlewood "The Hits Of Nancy & Lee", The Modern Jazz Quarte "Third Stream Music"

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 399 ... Geoffrey R. Atelu, Nancy Duah, Michael D Wilson. Vol 44, No 3 (2010), Case control study to determine the factors associated with leprosy in the Sene ... A.I Gidwani, S.A Gidwani, A Khan, J.G Carson. Vol 44, No 2 (2010), Congenital malaria in newborn twins, Abstract PDF. DA Opare. Vol 38, No 1 ...

  6. Untitled

    African Journals Online (AJOL)

    PTT. l. Immobilisation: Any form of pro- v _ i longed immobilisation, especially A tailor-made post surgery ' aspin'n'tablet for. 2. Chronic congestive heart failure. cardiovascular protectiont. 3. Patients with atherosclerotic vascular disease, eg coronary artery disease. 4. Patients with underlying malig- nancy. 5. Pregnancy.

  7. 77 FR 14419 - Notice of Meeting, National Capital Memorial Advisory Commission

    Science.gov (United States)

    2012-03-09

    ... (the Commission) will meet at the National Building Museum, Room 312, 401 F Street NW., Washington, DC..., Room 312, 401 F Street NW., Washington, DC 20001. FOR FURTHER INFORMATION CONTACT: Ms. Nancy Young... Commission. Chairman, Commission of Fine Arts. Mayor of the District of Columbia. Architect of the Capitol...

  8. The Intelligence Revolution: A Historical Perspective

    Science.gov (United States)

    1988-10-01

    dimension. Orbis 24:771-86, Winter 1981. Gray, Colin S. Moscow is cheating. Foreign Polic No.56:141-152, 1984. Knight, Amy W. The KGB’s special... Bamford , James. The puzzle palace: a report on America’s most secret agency. Boston, MA: Houghton Mifflin, 1982. (UB 251 .U5 B35 1982) Braswell, Nancy S

  9. Mass spectrometry. Environment, biology, oenology, medicine, geology, chemistry, archaeology, mechanisms

    International Nuclear Information System (INIS)

    1999-01-01

    This document provides the papers (communications and posters) presented at the 16. French days of mass spectrometry, held September 6-9, 1999 in Nancy, France. 5 papers are interesting for the INIS database and are analyzed separately. (O.M.)

  10. Gut Microorganisms Found Necessary for Successful Cancer Therapy | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer Humans play host to trillions of microorganisms that help our bodies perform basic functions, like digestion, growth, and fighting disease. In fact, bacterial cells outnumber the human cells in our bodies by 10 to 1.1 The tens of trillions of microorganisms thriving in our intestines are known as gut microbiota, and those that are not harmful to

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 501 - 550 of 3286 ... C Opoku-Okrah, BKS Acquah, EE Dogbe ... Nancy Weathers, Jenna Ladd, Iretiola Fajolu, Christopher Esezobor, Christian Makwe, Bukola Odusanya, Rose Anorlu, Wasiu Adeyemo, Edna Iroha, Mathias Egri-Okwaji, Prisca Adejumo, Lawal Oyeneyin, Moses Abiodun, Bolaji Badejoko, Kelli Ryckman.

  12. A utilização das imagens de radar meteorológico em Climatologia

    Directory of Open Access Journals (Sweden)

    Marcelo Fragoso

    1996-05-01

    Full Text Available WEATHER RADAR IMAGE IN CLIMATOLOGY - After a brief overview about weather radar as a remote sensing instrument, some problems concerning the use of radar images are discussed. The great interest of radar images as a tool in Climatology is pointed out. Finally, a case study about two rainfall events in Nancy (France in April 1995 is presented.

  13. 75 FR 68598 - Notice of Appointment of Members to the National Agricultural Research, Extension, Education, and...

    Science.gov (United States)

    2010-11-08

    ... Secretary of Agriculture to a specific category on the Board, including farming or ranching, food production... follows: Category F. ``National Food Animal Science Society,'' Nancy M. Cox, Director, Kentucky... composed of 25 members, each representing a specific category related to agriculture. The Board was first...

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 351 - 400 of 412 ... Vol 28, No 3 (2009), Tony Yengeni's ritual slaughter: Animal anti-cruelty vs. Culture, Abstract. K Behrens. Vol 25, No 1 (2006), Torturers and the tortured, Abstract. Nancy Sherman. Vol 28, No 4 (2009), Touched by genius: on animal and madmen, Abstract. R ten Bos. Vol 31, No 3 (2012), Towards ...

  15. Software Training Classes Now Open | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer                                            Data Management Services, Inc. (DMS), has announced the opening of its spring session of software training classes, available to all employees at NCI at Frederick. Classes begin on March 31 and run through June 30.

  16. Social justice and disability policy in Southern Africa | Mugumbate ...

    African Journals Online (AJOL)

    Social justice means different things to different people. This has resulted in diverse meanings and interpretations despite some commonalities, such as a focus on marginalised groups including women, people living in rural areas, persons with disabilities, children, racial minorities, and refugees, among others. In Nancy ...

  17. 75 FR 61252 - Proposed Information Collection (Create Payment Request for the VA Funding Fee Payment System (VA...

    Science.gov (United States)

    2010-10-04

    ... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... information through the Federal Docket Management System (FDMS) at http://www.Regulations.gov or to Nancy J...

  18. 78 FR 59771 - Proposed Information Collection (Create Payment Request for the VA Funding Fee Payment System (VA...

    Science.gov (United States)

    2013-09-27

    ... Payment Request for the VA Funding Fee Payment System (VA FFPS); a Computer Generated Funding Fee Receipt.... Title: Create Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated... through the Federal Docket Management System (FDMS) at www.Regulations.gov or to Nancy J. Kessinger...

  19. 75 FR 61859 - Proposed Information Collection (Create Payment Request for the VA Funding Fee Payment System (VA...

    Science.gov (United States)

    2010-10-06

    ... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... information through the Federal Docket Management System (FDMS) at http://www.Regulations.gov or to Nancy J...

  20. Mean Girls (and Boys): Cyberbullying and What Can Be Done about It

    Science.gov (United States)

    Fredrick, Kathy

    2009-01-01

    A basic definition of "cyberbullying" is provided by Nancy Willard, director of the Center for Safe and Responsible Internet Use. She has defined cyberbullying as using the Internet or other mobile devices to send or post harmful or cruel text or images to bully others. The advent of social networking has highlighted cyberbullying. Library media…