Nancy Kassebaum: Education's New Voice.

Science.gov (United States)

Penning, Nick

1989-01-01

U.S. Senator Nancy Kassebaum has become the leading Republican advocate for education. She shares AASA's support for the Head Start program, but is skeptical about financing a federal day care program. She also supports latchkey, intergenerational, and vocational/technical programs, and favors community volunteering over a national youth service…

Rapid resolution of chronic shoulder pain classified as derangement using the McKenzie method: a case series

Science.gov (United States)

Aytona, Maria Corazon; Dudley, Karlene

2013-01-01

The McKenzie method, also known as Mechanical Diagnosis and Therapy (MDT), is primarily recognized as an evaluation and treatment method for the spine. However, McKenzie suggested that this method could also be applied to the extremities. Derangement is an MDT classification defined as an anatomical disturbance in the normal resting position of the joint, and McKenzie proposed that repeated movements could be applied to reduce internal joint displacement and rapidly reduce derangement symptoms. However, the current literature on MDT application to shoulder disorders is limited. Here, we present a case series involving four patients with chronic shoulder pain from a duration of 2–18 months classified as derangement and treated using MDT principles. Each patient underwent mechanical assessment and was treated with repeated movements based on their directional preference. All patients demonstrated rapid and clinically significant improvement in baseline measures and the disabilities of the arm, shoulder, and hand (QuickDASH) scores from an average of 38% at initial evaluation to 5% at discharge within 3–5 visits. Our findings suggest that MDT may be an effective treatment approach for shoulder pain. PMID:24421633

A Comparison of the Effects of Pilates and McKenzie Training on Pain and General Health in Men with Chronic Low Back Pain: A Randomized Trial.

Science.gov (United States)

Hasanpour-Dehkordi, Ali; Dehghani, Arman; Solati, Kamal

2017-01-01

Today, chronic low back pain is one of the special challenges in healthcare. There is no unique approach to treat chronic low back pain. A variety of methods are used for the treatment of low back pain, but the effects of these methods have not yet been investigated adequately. The aim of this study was to compare the effects of Pilates and McKenzie training on pain and general health of men with chronic low back pain. Thirty-six patients with chronic low back pain were chosen voluntarily and assigned to three groups of 12 each: McKenzie group, Pilates group, and control group. The Pilates group participated in 1-h exercise sessions, three sessions a week for 6 weeks. McKenzie group performed workouts 1 h a day for 20 days. The control group underwent no treatment. The general health of all participants was measured by the General Health Questionnaire 28 and pain by the McGill Pain Questionnaire. After therapeutic exercises, there was no significant difference between Pilates and McKenzie groups in pain relief ( P = 0.327). Neither of the two methods was superior over the other for pain relief. However, there was a significant difference in general health indexes between Pilates and McKenzie groups. Pilates and McKenzie training reduced pain in patients with chronic low back pain, but the Pilates training was more effective to improve general health.

Reconnaissance of land-use sources of pesticides in drinking water, McKenzie River, Oregon

Science.gov (United States)

Kelly, Valerie J.; Anderson, Chauncey W.; Morgenstern, Karl

2012-01-01

The Eugene Water and Electric Board (EWEB) provides water and electricity to the City of Eugene, Oregon, from the McKenzie River. In the spring of 2002, EWEB initiated a pesticide monitoring program in cooperation with the U.S. Geological Survey as part of their Drinking Water Source Protection Plan. Approximately twice yearly pesticide samples were collected from 2002 to 2010 at a suite of sampling sites representing varying land uses in the lower McKenzie River basin. A total of 117 ambient samples were collected from 28 tributary and mainstem sites, including those dominated by forestry, urban, and agricultural activities, as well as the mouths of major tributaries characterized by a mixture of upstream land use. Constituents tested included 175 compounds in filtered water (72 herbicides, 43 insecticides, 10 fungicides, and 36 of their degradation products, as well as 14 pharmaceutical compounds). No attempt was made to sample different site types equivalently; sampling was instead designed primarily to characterize representative storm events during spring and fall runoff conditions in order to assess or confirm the perceived importance of the different site types as sources for pesticides. Sampling was especially limited for agricultural sites, which were only sampled during two spring storm surveys. A total of 43 compounds were detected at least once, with many of these detected only at low concentrations (urban stormwater drains. Urban sites also were associated with the highest concentrations, occasionally exceeding 1 microgram per liter. Many of the compounds detected at urban sites were relatively hydrophobic (do not mix easily with water), persistent, and suspected of endocrine disruption. In contrast, forestry compounds were rarely detectable in the McKenzie River, even though forest land predominates in the basin and forestry pesticide use was detected in small tributaries draining forested lands following application. Agricultural pesticide runoff was

McKenzie Classification of Extremity Lesions - An audit of primary care patients in 3 clinics

DEFF Research Database (Denmark)

Melbye, Martin

2007-01-01

Syndrome classification based on mechanical testing guides clinical decision making in conservative musculoskeletal care. The aim of this audit was to investigate how many patients presenting with problems in the extremities could be classified into the mechanical syndromes described by Robin Mc...... ranged from 4,5 to 6 years. The mechanical classification  determined by the therapists,  and was recorded on the first three visits. Mechanical classification was based on strict operational definitions. Assessment sheets were collected from each therapist, to determine their adherence...... to the operational definitions. 135 consecutive patients were included over an 18 months period and 28 patients were excluded. Of  the 107 patients with extremity joint problems, 73% were classified into one of McKenzie's mechanical syndromes by therapists trained in the McKenzie method. 34% of patients were...

Investigating the effect of adjusted DuPont ratio and its components on investor's decisions in short and long term

Directory of Open Access Journals (Sweden)

Parvaneh Khaleghi Kasbi

2014-03-01

Full Text Available This paper investigates the effect of adjusted DuPont ratio and its components on investors’ decisions in short and long term. The primary objective of this study is to find the effect of adjusted DuPont ratio and its components on herding behavior of investors in one and several year period. Hence, 85 corporations as the member of Tehran stock exchange over the period 2006-2011 are selected. In order to recognize the herding, by market index consideration, the herded β and in order to hypothesis validity SPSS software and multivariable linear regression have been used. As the results of this study indicate, the adjusted DuPont ratio and its components have more effect on investors’ decisions in short term but in long the period, the effect of this ratio on herding investors’ behavior are reduced. Furthermore, from the two components of adjusted DuPont ratio, profit margin has more effect on investor's decisions.

THINKING ART, POETRY AND LITERATURE OF PERSPECTIVE BY JEAN-LUC NANCY

Directory of Open Access Journals (Sweden)

José Oleriano Monteiro Filho

2010-07-01

Full Text Available Jean-Luc Nancy, one of the most influential philosophers of today, is part of a group to some extent antagonistic. Marked by Heidegger's phenomenology, for a certain Hegelianism and the grounds of literary criticism of Maurice Blanchot, Nancy is coming from philosophers like Derrida and Philippe Lacoue-Labarthe. He teaches philosophy at the Faculty of Philosophy, Science of Language and Communication at the University of Strasbourg. Author of several works, his thoughts are evoked by quotations from scholarly works in many different areas. In this study, without attempting to exhaust the subject, we will discuss art, poetry and literature in light of the thought of Nancy, also featuring, when needed, the help of other established names.

The outside of phenomenology: Jean-Luc Nancy on world and sense

African Journals Online (AJOL)

In this essay, I examine Jean-Luc Nancy's notion of the sense of the world in relation to the phenomenological investigation of the life-world in Husserl and the worldhood of the world in Heidegger. My aim is to address the reasons why Nancy stresses the need for a different thinking that goes beyond the phenomenological ...

2016 Oregon Department of Geology and Mineral Industries (DOGAMI) Oregon Lidar DEM: McKenzie River

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Quantum Spatial collected Light Detection and Ranging (LiDAR) data for the Oregon LiDAR Consortium (OLC) McKenzie River study area. This study area is located near...

Marion duPont Scott Equine Medical Center offers new treatment for lameness

OpenAIRE

Musick, Marjorie

2006-01-01

The Virginia-Maryland Regional College of Veterinary Medicine's Marion duPont Scott Equine Medical Center has begun offering a new therapy for treating lameness associated with osteoarthritis and cartilage damage in horses, a problem that affects all segments of the equine industry.

A Randomized Controlled Trial Comparing the McKenzie Method to Motor Control Exercises in People With Chronic Low Back Pain and a Directional Preference.

Science.gov (United States)

Halliday, Mark H; Pappas, Evangelos; Hancock, Mark J; Clare, Helen A; Pinto, Rafael Z; Robertson, Gavin; Ferreira, Paulo H

2016-07-01

Study Design Randomized clinical trial. Background Motor control exercises are believed to improve coordination of the trunk muscles. It is unclear whether increases in trunk muscle thickness can be facilitated by approaches such as the McKenzie method. Furthermore, it is unclear which approach may have superior clinical outcomes. Objectives The primary aim was to compare the effects of the McKenzie method and motor control exercises on trunk muscle recruitment in people with chronic low back pain classified with a directional preference. The secondary aim was to conduct a between-group comparison of outcomes for pain, function, and global perceived effect. Methods Seventy people with chronic low back pain who demonstrated a directional preference using the McKenzie assessment were randomized to receive 12 treatments over 8 weeks with the McKenzie method or with motor control approaches. All outcomes were collected at baseline and at 8-week follow-up by blinded assessors. Results No significant between-group difference was found for trunk muscle thickness of the transversus abdominis (-5.8%; 95% confidence interval [CI]: -15.2%, 3.7%), obliquus internus (-0.7%; 95% CI: -6.6%, 5.2%), and obliquus externus (1.2%; 95% CI: -4.3%, 6.8%). Perceived recovery was slightly superior in the McKenzie group (-0.8; 95% CI: -1.5, -0.1) on a -5 to +5 scale. No significant between-group differences were found for pain or function (P = .99 and P = .26, respectively). Conclusion We found no significant effect of treatment group for trunk muscle thickness. Participants reported a slightly greater sense of perceived recovery with the McKenzie method than with the motor control approach. Level of Evidence Therapy, level 1b-. Registered September 7, 2011 at www.anzctr.org.au (ACTRN12611000971932). J Orthop Sports Phys Ther 2016;46(7):514-522. Epub 12 May 2016. doi:10.2519/jospt.2016.6379.

Nancy McCormick Rambusch: A Reflection

Science.gov (United States)

Povell, Phyllis

2005-01-01

Fall of 2005 marks the 12th anniversary of Nancy McCormick Rambusch's death. As the founder of the American Montessori Society and as its first president, Rambusch reintroduced Maria Montessori to America at a time--1960--when education for the young was floundering, and a second look at the Montessori method, which had changed the early childhood…

Nancy Rivard. The color of love.

Science.gov (United States)

2002-12-01

Nancy Rivard's personal journey to be a part of something bigger than herself resulted in the founding of Airline Ambassadors International (AAI). As a flight attendant for American Airlines, she enrolled the industry through a large-scale volunteer effort and established Airline Ambassadors, whose programs have delivered school supplies, food, medicine, and medical supplies to upwards of 100,000 children in 25 nations.

The Enunciation of the Subject: Sharing Jean-Luc Nancy's Singular Plural in the Classroom

Science.gov (United States)

Collins, Ashok

2015-01-01

This article seeks to explore the implications of Jean-Luc Nancy's reading of the subject for educational philosophy by connecting his re-interpretation of Descartes to his later thinking on what he names the ontological singular plural. Nancy's re-imagining of the Cogito coalesces around the figure of the mouth ("la bouche") through…

NOAA Ship Nancy Foster Underway Meteorological Data, Quality Controlled

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Nancy Foster Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic System...

A COMPARATIVE STUDY TO FIND OUT THE EFFECTIVENESS BETWEEN CORE STABILIZATION VS MCKENZIE EXERCISES IN THE TREATMENT OF PATIENTS WITH MECHANICAL LOW BACK PAIN

Directory of Open Access Journals (Sweden)

Abhijit Dutta

2015-10-01

Full Text Available Background: Mechanical Low back pain is a leading cause of disability. It occurs in similar proportions in all cultures, interferes with quality of life and work performance. Both male and female populations are affected; however, there is a tendency towards a higher incidence in male patients. Mechanical low back pain is associated with pain and clinical instability in lumbar motion segments. Exercises play an important part in the rehabilitation of low back pain. The aim of this study was to compare the effectiveness between Core stabilization vs McKenzie exercises in the treatment of patients with mechanical low back pain. Methods: 30 patients were selected between the age groups of 20 yrs to 50 yrs and having a past history of low back pain for one month. 15 patients were allotted to each group of experiment. Group I was given Core stabilization exercises and Group II with McKenzie exercises. Interferential therapy was a common treatment for both the groups. Evaluations of the subjects were done using the Revised Oswestry Disability Index and Dynamic Endurance tests. Results: Data analysis revealed statistically significant difference between both the groups (p<0.05 and proved that Core stabilization exercises is more effective than McKenzie exercises in mechanical low back pain. Conclusion: This study shows that core stabilization exercises possess a greater potential over McKenzie exercises in treating Mechanical Low back pain patients.

Comments on Nancy Snow, "Generativity and Flourishing"

Science.gov (United States)

Kamtekar, Rachana

2015-01-01

In her rich and wide-ranging paper, Nancy Snow argues that there is a virtue of generativity--an other-regarding desire to invest one's substance in forms of life and work that will outlive the self (p. 10). By "virtue" Snow means not just a desirable or praiseworthy quality of a person, but more precisely, as Aristotle defined it, a…

DIAGNÓSTICO E TRATAMENTO NA DOR LOMBAR INESPECÍFICA ATRAVÉS DO MÉTODO MCKENZIE: UMA REVISÃO BIBLIOGRÁFICA

Directory of Open Access Journals (Sweden)

Marilia de Souza Vieira Fabre

2017-02-01

Full Text Available Resumo – Introdução: O método Mckenzie consiste em um programa de movimentos prescritos por fisioterapeuta, sem o auxílio de equipamentos específicos, onde o paciente aprende a identificar os movimentos, posturas e atividades que aumentam e pioram a sua dor, podendo tratá-las restaurando os mecanismos funcionais. Objetivo: Verificar as publicações na área da fisioterapia relacionadas aos benefícios do método Mckenzie no tratamento da dor lombar inespecífica. Método: Revisão bibliográfica na base de dados PubMed e Lilacs utilizando as palavras-chave: “Method Mckenzie”, “treatment”, “low back pain”. Resultados: foram encontrados 101 artigos, sendo que apenas 22 encontravam- se nos critérios de inclusão, palavra-chave, pesquisas realizadas nos ultimos 10 anos e em seres humanos com textos completo em inglês. Conclusão: O método Mckenzie apesar de ainda mostrar poucas evidências específicas, possui características próprias de autocuidado e de tratamento que agem de forma positiva na gestão da dor, mostrando à sua importância fundamental na avaliação e na classificação das disfunções.

NOAA Ship Nancy Foster Underway Meteorological Data, Near Real Time

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Nancy Foster Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System (SAMOS)...

A Decomposition of Hospital Profitability: An Application of DuPont Analysis to the US Market.

Science.gov (United States)

Turner, Jason; Broom, Kevin; Elliott, Michael; Lee, Jen-Fu

2015-01-01

This paper evaluates the drivers of profitability for a large sample of U.S. hospitals. Following a methodology frequently used by financial analysts, we use a DuPont analysis as a framework to evaluate the quality of earnings. By decomposing returns on equity (ROE) into profit margin, total asset turnover, and capital structure, the DuPont analysis reveals what drives overall profitability. Profit margin, the efficiency with which services are rendered (total asset turnover), and capital structure is calculated for 3,255 U.S. hospitals between 2007 and 2012 using data from the Centers for Medicare & Medicaid Services' Healthcare Cost Report Information System (CMS Form 2552). The sample is then stratified by ownership, size, system affiliation, teaching status, critical access designation, and urban or non-urban location. Those hospital characteristics and interaction terms are then regressed (OLS) against the ROE and the respective DuPont components. Sensitivity to regression methodology is also investigated using a seemingly unrelated regression. When the sample is stratified by hospital characteristics, the results indicate investor-owned hospitals have higher profit margins, higher efficiency, and are substantially more leveraged. Hospitals in systems are found to have higher ROE, margins, and efficiency but are associated with less leverage. In addition, a number of important and significant interactions between teaching status, ownership, location, critical access designation, and inclusion in a system are documented. Many of the significant relationships, most notably not-for-profit ownership, lose significance or are predominately associated with one interaction effect when interaction terms are introduced as explanatory variables. Results are not sensitive to the alternative methodology. The results of the DuPont analysis suggest that although there appears to be convergence in the behavior of NFP and IO hospitals, significant financial differences remain

Application of DuPont photopolymer films to automotive holographic display

Science.gov (United States)

Nakazawa, Norihito; Ono, Motoshi; Takeuchi, Shoichi; Sakurai, Hiromi; Hirano, Masahiro

1998-03-01

Automotive holographic head-up display (HUD) systems employing DuPont holographic photopolymer films are presented. Holographic materials for automotive application are exposed to severe environmental conditions and are required high performance. This paper describes the improvement of DuPont photopolymer films for the automotive use, critical technical issues such as optical design, external color and stray light. The holographic HUD combiner embedded in a windshield of an automobile has peculiar problems called external color. Diffraction light from holographic combiner makes its external color tone stimulative. We have introduced RGB three color recording and color simulation in order to improve the external color. A moderate external color tone was realized by the optimization in terms of wavelengths and diffraction efficiencies of the combiner hologram. The stray light called flare arises from a reflection by glass surface of windshield. We have developed two techniques to avoid the flare. First is a diffuser type trap beam guard hologram which reduces the intensity of the flare. Second is the optimization of the design of hologram so that the incident direction of flare is lower than the horizon line. As an example of automotive display a stand-alone type holographic HUD system attached on the dashboard of an automobile is demonstrated, which provides useful driving information such as route guidance. The display has a very simple optical system that consists of only a holographic combiner and a vacuum fluorescent display. Its thin body is only 35 mm high and does not obstruct driver's view. The display gives high contrast and wide image.

A simple method to predict regional fish abundance: an example in the McKenzie River Basin, Oregon

Science.gov (United States)

D.J. McGarvey; J.M. Johnston

2011-01-01

Regional assessments of fisheries resources are increasingly called for, but tools with which to perform them are limited. We present a simple method that can be used to estimate regional carrying capacity and apply it to the McKenzie River Basin, Oregon. First, we use a macroecological model to predict trout densities within small, medium, and large streams in the...

Nancy Huston's Polyglot Texts: Linguistic Limits and Transgressions

Science.gov (United States)

Waite, Genevieve

2015-01-01

Throughout her career, Nancy Huston has both accepted and transgressed the limits of bilingualism. "Limbes"/"Limbo" (1998), "L'empreinte de l'ange" (1998), "The Mark of the Angel" (2000), "Danse noire" (2013), and "Black Dance" (2014) are five texts that demonstrate Huston's diverse use…

Award for Distinguished Scientific Applications of Psychology: Nancy E. Adler

Science.gov (United States)

American Psychologist, 2009

2009-01-01

Nancy E. Adler, winner of the Award for Distinguished Scientific Applications of Psychology, is cited for her research on reproductive health examining adolescent decision making with regard to contraception, conscious and preconscious motivations for pregnancy, and perception of risk for sexually transmitted diseases, and for her groundbreaking…

DuPont IsoTherming clean fuel technology

Energy Technology Data Exchange (ETDEWEB)

Levinski, E. [E.I. DuPont Co., Wilmington, DE (United States)

2009-07-01

This poster described a hydroprocessing technology that DuPont has acquired from Process Dynamics, Inc. The IsoTherming clean fuel technology significantly reduces sulphur in motor fuels. The technology provides petroleum refiners the solution for meeting ultra low sulphur diesel requirements, at much lower costs than conventional technologies. IsoTherming hydroprocessing operates in a kinetically limited mode, with no mass transfer limitation. Hydrogen is delivered to the reactor in the liquid phase as soluble hydrogen, allowing for much higher space velocities than conventional hydrotreating reactors. Treated diesel is recycled back to the inlet of the reactor, generating less heat and more hydrogen into the reactor. The process results in a more isothermal reactor operation that allows for better yields, fewer light ends and greater catalyst life. The technology reduces coking, because the process provides enough hydrogen in the solution when cracking reactions take place. As a result, the process yields longer catalyst life. Other advantages for refiners include lower total investment; reduced equipment delivery lead times; reduced maintenance and operating costs; and configuration flexibility. tabs., figs.

The resilient banality of catastrophes: about After Fukushima by Jean-Luc Nancy

International Nuclear Information System (INIS)

Tonaki, Yotetsu

2016-01-01

The author proposes some thoughts based on a book (The equivalence of catastrophes - After Fukushima) written by the French philosopher Jean-Luc Nancy for whom Fukushima cannot be reduced to technological dysfunctions, nor to a factor attributable to men in charge, but reveals a system of general equivalence which supports a whole civilisation. The author refers to the speech on safety engineering and on resilience in Japan, and outlines some surprising correspondences with Nancy's writings. With a reference to Heidegger, the author shows that what the catastrophe reveals is not only daunting or abnormal phenomena, but also and above all an almost ontological condition which command the normal operation of every day life. Based on Anders' works, he examines what is on in this techno-sphere which is finally similar to a 'self-transformation of the human being'

Landscape and Social Values in Popular Children's Literature: Nancy Drew Mysteries.

Science.gov (United States)

Brooker-Gross, Susan R.

1981-01-01

Examines the covert lessons in moral social geography found in a set of popular juvenile fiction published between 1924 and 1978--the Nancy Drew mystery stories. Topics discussed include landscape symbolism, urban environments, uses of geographical elements in the stories, rural settings, wilderness settings, social stereotypes, and landscape…

InSAR-based detection of McKenzie River Delta Permafrost loss

Science.gov (United States)

Oliver-Cabrera, T.; Wdowinski, S.

2017-12-01

Permafrost underlies most of the McKenzie River, North America's largest delta. The in the delta is catalogued as discontinuous permafrost due to the influence of shifting river channels on near-surface ground temperatures. The area is affected by climate change, studies show that ground temperature has increased by 1.5°C since 1970, due to rising annual mean air temperature. Flooding regimes within the delta are also affected by the changing climate due to melting of near surface ground ice together with sea-level rise increasing the potential of land subsidence. Observed consequences of changes occurring in the region are vegetation growth and northward migration of the tree line. The growing vegetation can affect physical properties of the accumulated snow, including depth, density and thermal conductivity. Thogether these variations affect permafrost stability. Permafrost changes can be measured throughout the impacts on river runoffs, ground water, drainages, carbon release, land subsidence and even infrastructure damages. Degradation of permafrost can also be measured by observing ecological changes in the area. In this study, we use InSAR observations to detect permafrost changes and their transition to wetland or vegetated land cover. Our data consist of four ALOS-PALSAR frames covering the entire McKenzie River Delta with temporal coverage spanning from January 2007 to March of 2011. Each frame has 20 to 24 acquisitions, in which half of the data acquired with HH polarization and the other half with HH+HV. We process the data using ROI_PAC and PYSAR software packages. Preliminary results have detected the following spatial patterns: (1) An overall good coherence of summer interferograms with 46-92 day interferograms, (2) Low coherence of winter interferograms (November to February), probably to the increase in snow coverage, (3) Phase jumps along the border of the river reflecting morphological differences between the region near to the river and other

Evaluating Banking Profit Performance in Ghana during and post Profit Decline: A five Step Du-Pont Approach

Directory of Open Access Journals (Sweden)

Baah Aye Kusi

2015-11-01

Full Text Available In this study we aimed at three objectives. First, identify and rank banks based on a composite score comprising of all five du-pont variables. Second, we identify variables in the five step du-pont set up that are most likely to influence bank ROE during and post profit declining periods. And third, we estimate a model to capture the variables that drive bank ROE during and post profit declining periods. We first establish from our rankings that, foreign banks in Ghana performed better during profit declining periods while the local banks performed better in post profit decline periods using the top ten banks as a benchmark in both periods. Employing Pearson correlation coefficients matrix, we recognized that operating profit margin, asset turnover and leverage were most likely to influence bank ROE in both time periods. We further employ OLS regression and find that bank ROE was impacted by operating profit margin and leverage during profit declining periods and post profit decline while tax effect added up in post profit declining periods.

ESCREVER ENTRE AS LÍNGUAS: TRADUÇÃO E GÊNERO EM NANCY HUSTON

OpenAIRE

WILHELM, Jane Elisabeth; COSTA, Pâmela Berton; DEÂNGELI, Maria Angélica

2017-01-01

O entre duas línguas da auto-tradução em Nancy Huston subverte as relações hierárquicas entre o original e a tradução, ou a oposição entre língua materna e língua estrangeira, e nos convida assim a nos interrogarmos sobre nossas práticas e representações de escrita e de tradução. Buscamos compreender em que medida a escrita entre o francês e o inglês de Nancy Huston questiona não somente as categorias tradicionais de tradução, mas também o gênero como construção social. A história da tradução...

Health assessment for E. I. Dupont Newport Plant Landfill, Newport, Delaware, Region 3. CERCLIS No. DED980555122. Preliminary report

International Nuclear Information System (INIS)

1988-01-01

The E.I. Dupont Newport Plant Landfill, a seven acre site located adjacent to the Dupont Pigment Plant in Newport, Delaware, was used to bury paint pigments (heavy metals and chlorinated solvents) and radioactive materials from 1902 to 1975. The site was closed in 1975, the surface covered, graded and vegetated, and groundwater monitoring wells installed on- and off-site. Heavy metals (cadmium, barium, lead, zinc), and chlorinated solvents (trichloroethylene, tetrachloroethylene) have been measured in groundwater on-site. Radiation levels appear to be close to background. The site is considered to be of potential public health concern because of the risk to human health caused by the possibility of exposure to hazardous substances via groundwater. More information is needed concerning levels of contamination in private wells and the Christina River, the direction of groundwater flow, the size and extent of the groundwater contamination plume, the location of the private wells and the public water supply wells, and the composition of the population down gradient of the site

Soil salinity data from Bayou Dupont and flanking marshes, New Orleans, LA, 2015-09-16 to 2016-03-30 (NCEI Accession 0151633)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The project restored both structural and habitat functions of Bayou Dupont and flanking marshes. The project created and nourished marsh and restored a ridge on the...

De dood staat op. Naar een seculier opstandingsverhaal − een onderzoek met Jean-Luc Nancy

NARCIS (Netherlands)

Kate, L. ten

2013-01-01

In his philosophical project of a ‘deconstruction of monotheism’, Jean-Luc Nancy explores the hypothesis that the historical roots of secularization should be traced back to the beginnings of the monotheistic traditions. The secular is not exclusively a feature of modern culture. The complex

The evidence of film and the presence of the world: Jean-Luc Nancy's cinematic ontology

NARCIS (Netherlands)

Früchtl, J.; Kavanaugh, L.

2010-01-01

Following Deleuze's theory, the emergence of the "time-image" following the Second World War led to (our relationship to) the world disappearing from film. Following Jean-Luc Nancy, the Iranian film-maker Abbas Kiarostami is a privileged witness to a cinema that liberates itself from a "postmodern"

Analysis of DuPont and Kodak duplicating films and chemistries in a Fultron spray processor

Science.gov (United States)

Weinstein, M. S.

1972-01-01

A test program was conducted with duPont duplicating film type SR 112 and SCOLOR developer and Kodak duplicating film types 2430, 2422, and FE 2628 (SO-467) and MX-641 developer to determine sensitometric and image quality characteristics of these materials when used with a fultron spray processor. The test results show that the SCOLOR developer foams excessively in the fultron processor when used with or without the addition of an antifoaming agent. The Kodak type FE 2628 film with MX-641 chemistry had the longest linear Log E range at a 1.0 gamma. Sensitometric curves and granularity traces for all film process combinations tested are included.

Le contrôle de l’activité législative de la nation en 1789 : l’opinion de Dupont de Nemours

Directory of Open Access Journals (Sweden)

Anthony Mergey

2014-06-01

Full Text Available On the eve of the French Revolution, Dupont de Nemours became infatuated with constitutional issues that had hitherto been the exclusive domain of some of his fellow physiocrats, in particular Le Mercier de La Rivière. Endorsing the ideas of the time, he was convinced of the necessity of creating a new political regime that would take the features of a moderate monarchy. The prince would thus be submitted to constitutional rules, sovereignty transferred to the nation and the legislative power exercised by its representatives. However, even if sharing authority between the nation and the king was then claimed, the representatives of the nation should not exercise their prerogatives outside a clearly established, defined constitutional framework. Partly consistent with the original physiocratic theories, Dupont de Nemours identified constitutional norms that should be promoted and protected from abuses of the legislature. With this aim in mind, he didn’t plan to resort to a jurisdictional authority, because abuses of Ancien Régime parliaments were still live memories. He decided, in an original way, to entrust the heavy burden of controlling legislative activity to political instances, namely, successively, the people and the monarch. Quite naturally, these suggestions, expressed a few months apart, exposed various forms of control. The examination carried out by the nation appeared as a prerequisite and tended to verify the constitutionality of the law, while the one carried out by the monarch through his veto, as holder of the executive power, was more of a control of opportunity devoid of binding. Although the omnipotence of the revolutionary legicentrism seemed incompatible with such a system of verification of the norm, it remains that Dupont de Nemours was part of a current which considerably developed during the XVIIIth century and which found a certain resonance in the decade following the Revolution.

Business process management : 3rd international conference, BPM 2005, Nancy, France, September 5-8, 2005 : proceedings

NARCIS (Netherlands)

Aalst, van der W.M.P.; Benatallah, B.; Casati, F.; Curbera, F.

2005-01-01

This volume contains the proceedings of the 3rd International Conference on Business Process Management (BPM 2005), organized by LORIA in Nancy, France, September 5–8, 2005. This year, BPM included several innovations with respect to previous editions, most notably the addition of an industrial

Holocene volcanism of the upper McKenzie River catchment, central Oregon Cascades, USA

Science.gov (United States)

Deligne, Natalia I.; Conrey, Richard M.; Cashman, Katharine V.; Champion, Duane E.; Amidon, William H.

2016-01-01

To assess the complexity of eruptive activity within mafic volcanic fields, we present a detailed geologic investigation of Holocene volcanism in the upper McKenzie River catchment in the central Oregon Cascades, United States. We focus on the Sand Mountain volcanic field, which covers 76 km2 and consists of 23 vents, associated tephra deposits, and lava fields. We find that the Sand Mountain volcanic field was active for a few decades around 3 ka and involved at least 13 eruptive units. Despite the small total volume erupted (∼1 km3 dense rock equivalent [DRE]), Sand Mountain volcanic field lava geochemistry indicates that erupted magmas were derived from at least two, and likely three, different magma sources. Single units erupted from one or more vents, and field data provide evidence of both vent migration and reoccupation. Overall, our study shows that mafic volcanism was clustered in space and time, involved both explosive and effusive behavior, and tapped several magma sources. These observations provide important insights on possible future hazards from mafic volcanism in the central Oregon Cascades.

South Atlantic Bight Habitat Mapping on NOAA Ship Nancy Foster in North Atlantic Ocean between 20070626 and 20070702

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This expedition on the NOAA Ship Nancy Foster used the recently-developed National Undersea Research Center for the North Atlantic and Great Lakes (NURC-NAGL) ROV...

Marketingová strategie u vybraného produktu na příkladu společnosti DuPont

OpenAIRE

Wojnar, Michal

2009-01-01

The bachelor thesis "Marketing Strategy of a Chosen Product on The Example of DuPont" is aimed at analyzing the marketing strategy and marketing mix of the Elvaloy material which is used in paving segment. The main applied methodology is called situation analysis through which the author compares individual key markets, reviews internal and external conditions of the company and studies the competition. The main objective of the thesis is also to present diminishing differences between indust...

« Nancy Spero. Autour d’Antonin Artaud »

Directory of Open Access Journals (Sweden)

Kamila Benayada

2008-01-01

Full Text Available Le FRAC Haute Normandie montrait cet été des œuvres sur papier de l’artiste américaine Nancy Spero (1926-, en association avec la galerie Lelong, Paris, qui présentait de son côté les Paris Black Paintings, série de toiles peintes à Paris de 1959 à 1964. Ces expositions précédaient l’installation de Spero au Pavillon international de la Biennale de Venise 2007 et coïncidaient avec le réaccrochage de Azur (2000 au Musée national d’art moderne. Parmi les œuvres accrochées au FRAC figuraient n...

Charting shifts and moving forward in abnormal times: An interview with Nancy Fraser

Directory of Open Access Journals (Sweden)

Julia Sichieri Moura

2016-09-01

Full Text Available http://dx.doi.org/10.5007/1677-2954.2016v15n1p1 In this interview Nancy Fraser elucidates important conceptual topics of her theory, she also shares her analysis of the global financial crisis and how it has changed the setting for theorists of justice. Her account reminds us of critical theory’s important role in helping us think - and act – differently in difficult times.

From Nancy to Copenhagen to the World: The internationalization of Laurent Schwartz and his theory of distributions

DEFF Research Database (Denmark)

Barany, Michael J.; Paumier, Anne-Sandrine; Lützen, Jesper

2017-01-01

Nancy, via Copenhagen, to the world stage, culminating in his 1950 Fields Medal awarded in Cambridge, Massachusetts. We identify, based on new archival findings, the pivotal role of Danish mathematician Harald Bohr along this trajectory. Our analysis reveals the emerging dynamics of early postwar...

Effectiveness of McKenzie Method-Based Self-Management Approach for the Secondary Prevention of a Recurrence of Low Back Pain (SAFE Trial): Protocol for a Pragmatic Randomized Controlled Trial.

Science.gov (United States)

de Campos, Tarcisio F; Maher, Chris G; Clare, Helen A; da Silva, Tatiane M; Hancock, Mark J

2017-08-01

Although many people recover quickly from an episode of low back pain (LBP), recurrence is very common. There is limited evidence on effective prevention strategies for recurrences of LBP. The purpose of this study was to determine the effectiveness of a McKenzie method-based self-management approach in the secondary prevention of LBP. This will be a pragmatic randomized controlled trial. Participants will be recruited from the community and primary care, with the intervention delivered in a number of physical therapist practices in Sydney, Australia. The study will have 396 participants, all of whom are at least 18 years old. Participants will be randomly assigned to either the McKenzie method-based self-management approach group or a minimal intervention control group. The primary outcome will be days to first self-reported recurrence of an episode of activity-limiting LBP. The secondary outcomes will include: days to first self-reported recurrence of an episode of LBP, days to first self-reported recurrence of an episode of LBP leading to care seeking, and the impact of LBP over a 12-month period. All participants will be followed up monthly for a minimum of 12 months or until they have a recurrence of activity-limiting LBP. All participants will also be followed-up at 3, 6, 9, and 12 months to assess the impact of back pain, physical activity levels, study program adherence, credibility, and adverse events. Participants and therapists will not be masked to the interventions. To our knowledge, this will be the first large, high-quality randomized controlled trial investigating the effectiveness of a McKenzie method-based self-management approach for preventing recurrences of LBP. If this approach is found to be effective, it will offer a low-cost, simple method for reducing the personal and societal burdens of LBP. © 2017 American Physical Therapy Association

Nancy Huston, Self-Translation and a Transnational Poetics

Directory of Open Access Journals (Sweden)

Giorgia Falceri

2014-10-01

Full Text Available Nancy Huston (Calgary, 1953 is one of the francophone authors who contributed – with an essay entitled Traduttore non è traditore – to the theo- retical volume Pour une littérature-monde (Michel Le Bris and Jean Rouaud, 2007, which inscribes as an important step in the ongoing theoretical definition of world literature. With reference to a selection of Huston’s non-fiction publications, I am going to outline her poetics of self-translation and how the latter intimately relates to what she regards as the very task of Literature. Finally, I am going to briefly sketch the content of three of her novels: L’empreinte de l’ange/The Mark of the Angel (1998- 9, Lignes de faille/Fault Lines (2006-7 and Danse Noire/Black Dance (2013-14, which epitomize Huston’s transnational/translational poetics. The peculiar nature of the experience as a bilingual writer and self-translator opens to new possible prospects on the theorization of world literature, by question- ing the boundaries of linguistic and cultural identity and by defining an ethical aspiration for both literature and translation. Nancy Huston (Calgary, 1953 ha contribuito con il saggio Traduttore non è traditore alla raccolta Pour une littérature-monde (Michel Le Bris e Jean Rouaud, 2007, volume che costituisce una tappa significativa nella teorizzazione contemporanea sulla letteratura-mondo. Attraverso l’analisi di questa e di altre pubblicazioni, il presente articolo si propone di indagare la poetica di auto-traduzione della Huston, per mostrare come essa sia intimamente connessa a quella che l’autrice ritiene essere la funzione fonda- mentale della Letteratura. Vengono inoltre presi in considerazione tre dei suoi romanzi – L’empreinte de l’ange/The Mark of the Angel (1998-9, Lignes de faille/Fault Lines (2006-7 e Danse Noire/Black Dance (2013-14 – che incarnano, a livello di conte- nuti, tale poetica traduttiva e transnazionale. Riflettendo sulla particolarit

Jean Luc Nancy and the community: trascendence and immanence, ecstasy and death

Directory of Open Access Journals (Sweden)

Edgar Straehle Porras

2012-01-01

Full Text Available The community is one of the recurring themes of political philosophy today, especially by streams as communitarianism. Jean Luc Nancy has problematized this notion and tried to free it from any trace of what might be a thought or identity politics. The community is not the affirmation of a being of us but the breakdown of any form of essentialism which entails the need to recognize the role of otherness and difference. Hence, linking the community to a finitude that relates to concepts such as death, “clinamen”, transcendence and especially the absence of Oeuvre

The effects of cervical traction, cranial rhythmic impulse, and Mckenzie exercise on headache and cervical muscle stiffness in episodic tension-type headache patients.

Science.gov (United States)

Choi, Sung-Yong; Choi, Jung-Hyun

2016-03-01

[Purpose] The purpose of this study was to examine the effects of cervical traction treatment, cranial rhythmic impulse treatment, a manual therapy, and McKenzie exercise, a dynamic strengthening exercise, on patients who have the neck muscle stiffness of the infrequent episodic tension-type (IETTH) headache and frequent episodic tension-type headache(FETTH), as well as to provide the basic materials for clinical interventions. [Subjects] Twenty-seven subjects (males: 15, females: 12) who were diagnosed with IETTH and FETTH after treatment by a neurologist were divided into three groups: (a cervical traction group (CTG, n=9), a cranial rhythmic contractiongroup (CRIG, n=9), and a McKenzie exercise group (MEG, n=9). An intervention was conducted for each group and the differences in their degrees of neck pain and changes in muscle tone were observed. [Results] In the within-group comparison of each group, headache significantly decreased in CTG. According to the results of the analysis of the muscle tone of the upper trapezius, there was a statistically significant difference in MEG on the right side and in CRIG on the left side. According to the results of the analysis of the muscle tone of the sternocleidomastoid muscle, there was a statistically significant difference in MEG on the right side and in CRIG on the left side. [Conclusion] In the comparison of the splenius capitis muscle between the groups, there was a statistically significant difference on the right side. Hence, compared to the other methods, cervical traction is concluded to be more effective at reducing headaches in IETTH and FETTH patients.

A Comparison of the Effects of Pilates and McKenzie Training on Pain and General Health in Men with Chronic Low Back Pain: A Randomized Trial

OpenAIRE

Hasanpour-Dehkordi, Ali; Dehghani, Arman; Solati, Kamal

2017-01-01

Background: Today, chronic low back pain is one of the special challenges in healthcare. There is no unique approach to treat chronic low back pain. A variety of methods are used for the treatment of low back pain, but the effects of these methods have not yet been investigated adequately. Aim: The aim of this study was to compare the effects of Pilates and McKenzie training on pain and general health of men with chronic low back pain. Materials and Methods: Thirty-six patients with chronic l...

Filosofía del cuerpo de Jean-Luc Nancy y Bioética de la trasplantología

Directory of Open Access Journals (Sweden)

Francisco Quesada Rodríguez

2012-01-01

Full Text Available El artículo presenta un análisis ético de la donación y trasplante de órganos a partir de la filosofía del cuerpo de Jean-Luc Nancy comprendida como ontología narrativa, considerando la noción antropológica que subyace en la historia de la trasplantología.

The Mysterious Case of the Detective as Child Hero: Sherlock Holmes, Encyclopedia Brown and Nancy Drew as Role Models?

Science.gov (United States)

Sugarman, Sally

In the mystery genre, the one characteristic that the enduring figures of Sherlock Holmes, Nancy Drew, and Encyclopedia Brown have in common is a rational mind. The source of their strength is their ability to think and think well. A study examined some typical examples of the mystery genre in young adult literature and surveyed children and…

Hull-Mounted Acoustic Doppler Current Profiler Data (SADCP) collected aboard the NOAA Ship NANCY FOSTER during cruise NF-10-01 and NF-10-02

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Upper ocean current velocity measurements collected with NOAA Ship NANCY FOSTER's Teledyne RD Instruments 150 kHz hull-mounted acoustic Doppler current profiler...

The DuPont, Monsanto, General Electric open-quotes Lasagnaclose quotes Remediation Project - joint R ampersand D and financing

International Nuclear Information System (INIS)

Palmer, P.A.

1995-01-01

The Lasagna project is the first of what we expect will be several large cooperative projects between industry consortia and government to develop improved remediation technologies. In 1992, Monsanto Company began contacting other major corporations to see if they were experiencing similar difficulties in applying cost-effective, or even workable technologies for industrial site remediation. Both General Electric and DuPont were early participants in the effort to develop a meeting with the EPA to discuss technical problems faced in cleanup, research needs, and ways to accelerate development of more cost-effective techniques. This paper provides some background on how this cooperative process came to reality, what the Lasagna process is and how the cooperative arrangements and financing are structured

“Some of the Best Movement People Are Political Ecologists at Heart”: An Interview About Political Ecology With Nancy Peluso

Directory of Open Access Journals (Sweden)

Melanie Pichler

2016-06-01

Full Text Available Nancy Peluso pioneered political ecology research in Southeast Asia with her book on Rich Forest, Poor People (1992 that untangles peasant resistance and state control in Indonesian forest politics. Since then, the professor of political ecology at UC Berkeley, California, has done extensive ethnographic research on the effects of social difference (ethnic identity, class, gender on resource access and control, dealing with forests, land, mining, and water conflicts in Indonesia and Malaysia. Her recent work investigates the relationships between migration and environmental change. Melanie Pichler spoke with her during the International Conference of the European Network of Political Ecology (ENTITLE from 20 to 24 March in Stockholm where she delivered a keynote lecture on the unexpected impacts of women’s migration on the environment in a forest village in East Java. During the interview, Nancy reflected on current trends in political ecology research, the potential pitfalls of indigenous peoples’ rights, the contradictory role of NGOs in socio-ecological conflicts, and the potential of political ecology research beyond academia.

Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, from 2015-03-18 to 2015-04-07 (NCEI Accession 0131859)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration with NOAA vessel NOAA Ship Nancy Foster and territory, federal, and private sector partners, conducted the...

[The transfer from Strasbourg, and the primary ten years (1872-1882) of the "Ecole supérieure de pharmacie" of Nancy. An example of the difficulty of creating an university structure almost from nothing and in urgency].

Science.gov (United States)

Labrude, Pierre; Strohl, Stéphanie

2007-05-01

The conclusion of the war conducted by France in 1870 was the annexation of Alsace and Moselle to the German Empire. The question of the becoming of the University of Strasbourg was put a long time before the Francfort treaty.... After many discussions, the transfer of the Faculty of medicine and of the School of pharmacy to Nancy was decided on October 1st 1872. First bound to the faculty, the school became independent in 1876. It suffered some difficult years because of the terms of the transfer decree, of the retirement of two of its four professors, of the ministerial decision to keep free the chairs for some time in order to save money, and of the difficulties of the recruitment of new professors. The paper describes successively the difficulties of the choice of Nancy for the transfer, the situation of the schools of Strasbourg and Nancy in the year 1870, the text of the decree, the beginning of the teachings and the difficulties encountered with the chairs of pharmacy and natural history, and finally the pharmacy students come in Nancy during the early years. Some thoughts on this transfer and on the difficulties occured during these years precede the conclusion.

Award for Distinguished Career Contributions to Education and Training in Psychology: Nancy S. Elman.

Science.gov (United States)

2017-12-01

The Award for Distinguished Career Contributions to Education and Training in Psychology is given in recognition of the efforts of psychologists who have made distinguished contributions to education and training, who have produced imaginative innovations, or who have been involved in the developmental phases of programs in education and training in psychology. The Career designation is added to the award at the discretion of the Education and Training Awards Committee to recognize continuous significant contributions made over a lifelong career in psychology. The 2017 recipient of this award is Nancy S. Elman, whose leadership roles have brought significant advancements for the education and training of psychologists. Her award citation, biography, and a selected bibliography are presented here. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

“Some of the Best Movement People Are Political Ecologists at Heart”: An Interview About Political Ecology With Nancy Peluso

OpenAIRE

Melanie Pichler

2016-01-01

Nancy Peluso pioneered political ecology research in Southeast Asia with her book on Rich Forest, Poor People (1992) that untangles peasant resistance and state control in Indonesian forest politics. Since then, the professor of political ecology at UC Berkeley, California, has done extensive ethnographic research on the effects of social difference (ethnic identity, class, gender) on resource access and control, dealing with forests, land, mining, and water conflicts in Indonesia and Malays...

The Third Turn toward the Social: Nancy Welch's "Living Room," Tony Scott's "Dangerous Writing," and Rhetoric and Composition's Turn toward Grassroots Political Activism

Science.gov (United States)

Kinney, Kelly; Girshin, Thomas; Bowlin, Barrett

2013-01-01

This review essay examines recent texts by Nancy Welch and Tony Scott, both of which use embodied activism as a starting point for their inquiries. Taken together, these works point to a distinct shift in composition studies' turn toward the social, one that calls on workers both within and outside the academy to actively engage in grassroots…

Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, Northeast Grand Reserve, Puerto Rico from 2013-03-05 to 2013-03-29 (NCEI Accession 0131855)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the tenth year of an ongoing scientific research mission onboard NOAA Ship Nancy Foster. The...

Anthropocene Knowledge Practices in McKenzie Wark’s Molecular Red and Kim Stanley Robinson’s Aurora

Directory of Open Access Journals (Sweden)

Gib Prettyman

2018-02-01

Full Text Available Through a close reading of McKenzie Wark’s theoretical treatise 'Molecular Red' (2015 and Kim Stanley Robinson’s novel 'Aurora' (2015, this essay examines how Anthropocene knowledge practices challenge our conceptions of human agency in provocative and potentially productive ways. For example, our knowledge of climate science arises through global material infrastructures. As material components of Anthropocene knowledge practices, these infrastructures reveal the material labors and cyborg structures by means of which our knowledge is produced. Wark sees the heterogenous materiality of Anthropocene knowledge practices as evidence for the value of ‘low theories’ based on a ‘labor point of view.’ At the same time, Anthropocene knowledge practices reveal ‘eco-logical’ complexities and fundamental recognitions of the ‘intra-action’ of entangled matter. These complexities produce very estranged views of human agency. Robinson’s novel highlights the eco-logical implications of contemporary knowledge practices by imagining an interstellar ship that must function as a completely artificial ecosystem for a 170-year voyage to another solar system. The significance of knowledge practices and eco-logical complexity is most evident when failures or crises arise, and 'Aurora' tells the story of many such failures. However, I argue that Robinson’s novel and Wark’s ‘low theory’ ultimately function as hopeful accounts of Anthropocene knowledge practices. Among other things, these practices show the material importance of storytelling and point the way toward more complexly realist theories of human agency.

Water Depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in the US Caribbean/ Puerto Rico and St. Thomas from 2016-04-07 to 2016-04-26 (NCEI Accession 0157612)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's NOS/NCCOS/CCMA Biogeography Team, in collaboration with NOAA Ship Nancy Foster, federal, academic, and private sector partners conducted the 2016 Seafloor...

Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, offshore of Cabo San Juan from 2012-04-03 to 2012-04-20 (NCEI Accession 0131856)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the ninth year of an ongoing scientific research mission on board NOAA Ship Nancy Foster from April...

Grupo residencial «Le Haut du Lièvre». Nancy

Directory of Open Access Journals (Sweden)

Hereng, J. M.

1964-07-01

Full Text Available The site occupied by this residential group has an area of 35 hectares, and its main axis runs East-West. The view of the city of Nancy is to the South-Southeast. This article describes blocks A and B. Block A is 400 m long, 43 m high, has 15 storeys and 920 dwellings. Block B is 300 m long, 50 m high, has 17 storeys and 800 dwellings. The ground floor has entrances to the lifts, room for storing perambulators, motorbikes, and other available space. Each apartment of the first floor has either 4 or 5 rooms, and apartments on all higher floors have either 3 or 4 rooms. A feature of the construction is that the foundations have been made in the traditional manner, but the structure and enclosing walls have been carried out using a special type of heavy prefabrication technique. In addition to the blocks of flats, the amenities of the residential project have also been completed. Two commercial centres, a cinema, a cultural centre, three schools, a church, a sports ground, garages, and parking sites are already available. In the near future apartment towers will be built, in the shape of a three armed star. These will accommodate 786 further dwellings.El terreno sobre el que se ha construido este núcleo residencial ocupa una extensión de 35 Ha, goza de orieníación axil este-oeste, y sus vistas sobre la ciudad de Nancy se desarrollan en sentido sur-sureste. Las dos unidades que presentamos aquí son los bloques A y B: el A, de 400 m de longitud, 43 m de altura y 15 plantas, contiene 920 viviendas; el B, de 300 m de longitud, 50 m de altura y 17 p lantas, aloja 800 viviendas. En las plantas bajas están: los zaguanes, arranque de comunicaciones verticales y locales para guardar los caches de niños, motos, e tc. Ocupan la primera planta—en cada elemento unitario— dos viviendas, con cuatro y cinco habitaciones, respectivamente; y las restantes plantas, otras dos viviendas con tres y cuatro habitaciones. Como características constructivas se

Causes of death of thoroughbred racehorses at Octavio Dupont Veterinary Hospital, Brazilian Jockey Club, Rio de Janeiro

Directory of Open Access Journals (Sweden)

Marsel C. Pereira

2012-03-01

Full Text Available There are few studies that approach the epidemiology of deaths in racehorses in a broad manner. The majority focus on a specific affection or procedure. Brazil does not have a program instituted for the monitoring of deaths of horses. By means of a descriptive study in association with a multivariate analysis method, an epidemiologic profile was determined for deaths related to musculoskeletal (MS, gastrointestinal (GI, respiratory (RES systems, neurologic origin (NEU and sudden death (SD for the years of 2002 to 2008, at the Octavio Dupont Veterinary Hospital-Rio de Janeiro (ODVH. Males comprised the majority of deaths and that deaths were related to, decreasing order, MS>GI>SD>NEU>RES, with respect to general mortality rate per large group of determined causes (TSPMr. The majority of deaths registered included horses aged four to five years (ID4-ID5. We observed the following correspondence relations: (3-year period = SM - ID>5 - SD; ID>5 - GI; ID4-5 - MS; SF - ID5 - GI; SF - ID5. The present study points out the importance and necessity of epidemiologic studies of lesions in horses, based on diagnosis for the recognition of predisposing factors and prevention.

Justicia como redistribución, reconocimiento y representación: las reconciliaciones de Nancy Fraser

Directory of Open Access Journals (Sweden)

Clara Iglesias

2013-01-01

Full Text Available Si nos preguntamos por el desarrollo de la Teoría Crítica y sus marcos conceptuales, es imprescindible tener en cuenta el pensamiento de Nancy Fraser. Con el presente artículo se pretende desglosar el entramado conceptual del que se vale Fraser, tomando para ello principalmente dos de sus obras: ¿Redistribución o reconocimiento? y Escalas de justicia. Con ello el artículo se centra en la consideración de conceptos clave para la elaboración de una teoría crítica capaz de integrar las reivindicaciones actuales presentes en los movimientos sociales, y con ello la puesta de manifiesto de la injusticia y su posible reparación, sin perder de vista en ningún momento el correlato social fáctico de la teoría.

Habitat Evaluation Procedures (HEP) Report; Big Island - The McKenzie River, Technical Report 1998-2001.

Energy Technology Data Exchange (ETDEWEB)

Sieglitz, Greg

2001-03-01

The Big Island site is located in the McKenzie River flood plain, containing remnant habitats of what was once more common in this area. A diverse array of flora and fauna, representing significant wildlife habitats, is present on the site. Stands of undisturbed forested wetlands, along with riparian shrub habitats and numerous streams and ponds, support a diversity of wildlife species, including neotropical migratory songbirds, raptors, mammals, reptiles, and amphibians (including two State-listed Sensitive Critical species). The project is located in eastern Springfield, Oregon (Figure 1). The project area encompasses 187 acres under several ownerships in Section 27 of Township 17S, Range 2W. Despite some invasion of non-native species, the site contains large areas of relatively undisturbed wildlife habitat. Over several site visits, a variety of wildlife and signs of wildlife were observed, including an active great blue heron rookery, red-Legged frog egg masses, signs of beaver, and a bald eagle, Wildlife habitat values resulting from the purchase of this site will contribute toward the goal of mitigating for habitat lost as outlined in the Bonneville Power Administration's (BPA) Mitigation and Enhancement Plan for the Willamette River Basin. Under this Plan, mitigation goals and objectives were developed as a result of the loss of wildlife habitat due to the construction of Federal hydroelectric facilities in the Willamette River Basin. Results of the Habitat Evaluation Procedures (HEP) will be used to: (1) determine the current habitat status of the study area and habitat enhancement potential of the site consistent with wildlife mitigation goals and objectives; and (2) develop a management plan for the area.

The Stone and its Images: The Poetry of Nancy Morejón

Directory of Open Access Journals (Sweden)

Alan West

1996-01-01

Full Text Available The essay explores the roots of Nancy Morejón's poetry within the context of a transculturated afro-Cuban identity. Beginning by an examination of the poems that directly deal with the orishas of santería, the essay moves on to some of her more lyric poetry. Morejón's relationship to Dulce María Loynaz provides particular interest in how both writers treat the metaphor of the house in two important poems. This is followed by a discussion of some of Morejón's overtly feminist poetry, placed both within a Cuban context of the history of its revolution, and the displacement of exile (in dialogue with Cuban women outside the island. Morejón's aesthetic scope is wide and her affinities with Poe, the French symbolists, the Cuban poetic tradition, and the plastic arts (Mendive, Brueghel, as well as the essays of Bachelard, are drawn upon to understand the multiple sources of her work. Throughout the essay different critical methods are brought to bear on how Morejón weaves together nature, politics, myth, aesthetic insight, and personal testimony in a poetry with enormous historical resonance.

The McKenzie method compared with manipulation when used adjunctive to information and advice in low back pain patients presenting with centralization or peripheralization. A randomized controlled trial

DEFF Research Database (Denmark)

Petersen, Tom; Larsen, Kristian; Nordsteen, Jan

2011-01-01

.Methods. A total of 350 patients suffering from low back pain with a duration of more than 6 weeks who presented with centralization or peripheralization of symptoms with or without signs of nerve root involvement, were enrolled in the trial. Main outcome was number of patients with treatment success defined...... a structured exercise programme tailored to the individual patient as well as manual therapy for the treatment of persistent low back pain. There is presently insufficient evidence to recommend the use of specific decision methods tailoring specific therapies to clinical subgroups of patients in primary care...... for more than six weeks presenting with centralization or peripheralization of symptoms, we found the McKenzie method to be slightly more effective than manipulation when used adjunctive to information and advice....

[The "conclusions of Pharmacy" in Nancy, at the end of the 18th century: between "synthèses" and "thèses"].

Science.gov (United States)

Julien, P; Martin, J

1995-01-01

A special requirement of the law for apothecaries in Nancy in 1764 imposed on the candidates for a master's degree was the written response to four questions following their practical examinations. Two documents heretofore unpublished show the results of this obligation: the Conclusions de Pharmacie by Joseph Pierson (1765) and the Conclusions de Pharmacie et de Chimie by François Mandel (1771). The authors of the present article comment on these documents and make an attempt to place them in the confused history of "synthèses" and "thèses".

Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, southern coast of Isla de Mona, western coast of Puerto Rico from 2007-04-14 to 2007-04-24 (NCEI Accession 0131853)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the fourth year of an ongoing scientific research mission on board NOAA Ship NANCY FOSTER. The...

Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, Western coast of Puerto Rico, Mona Island, Southern coast of Vieques Island from 2008-02-25 to 2008-03-08 (NCEI Accession 0131852)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) completed the fifth year of an ongoing scientific research mission on board NOAA Ship NANCY FOSTER. The...

Water depth, acoustic backscatter, and other data collected from NOAA Ship Nancy Foster and Fugro LADS Mark II Airborne System in Caribbean Sea and US Virgin Islands - Shoals from 2011-03-29 to 2011-04-16 (NCEI Accession 0131858)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) completed its eighth year of an ongoing scientific research mission on board NOAA Ship Nancy Foster from...

Water depth and acoustic backscatter data collected from NOAA Ship Nancy Foster in Caribbean Sea, Buck Island Reef and Virgin Islands National Coral Reef Monuments, U.S. Virgin Islands from 2006-03-21 to 2006-04-02 (NCEI Accession 0131851)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) conducted the third year of an ongoing scientific research mission on board NOAA Ship NANCY FOSTER. The...

THE IMPACT OF THE CONVERSION OF HISTORICAL COST TO CORRECTED CURRENT COST ON RETURN ON ASSETS AND EQUITY: ANALYSIS FROM DUPONT SYSTEM.

Directory of Open Access Journals (Sweden)

Roberto Silva da Penha

2013-12-01

Full Text Available Historical cost is the most used form of accounting valuation, but it does not reflect the effect of currency in time. The Theory of Corrected Current Cost, albeit with limitations, may show evidence of real and relevant accounting information of the entity. In this context, a question can be formulated: What is the impact of the conversion of historical cost to corrected current cost in return on assets and equity? In order to answer this question, the DuPont system was applied in a model company as a tool for analysis. The results showed that the return of assets at historical cost and corrected current cost were 12.11% and 3.14%, respectively, a decrease of 74.07%, and the result of the return on equity, the historical cost and corrected current cost were 20.59% and 4.96%, respectively, decreased 75.91%. Based on these variations it is observed that the impacts of the conversion of the corrected current cost were significant,confirming the importance of the adoption of this practice, whenever possible.

Rezension von: Nancy E. Riley: Gender, Work, and Family in a Chinese Economic Zone. Laboring in Paradise. Wiesbaden: Springer VS 2013.

Directory of Open Access Journals (Sweden)

Yvonne Berger

2015-03-01

Full Text Available Das Buch eignet sich vor allem für Wissenschaftler/-innen, die sich mit den Lebenswirklichkeiten von Arbeitsmigrantinnen in China aus geschlechtertheoretischer Sicht beschäftigen. Nancy E. Riley interessiert sich ethnographisch für den Zusammenhang von Geschlecht, Arbeit und Familie. Konkret geht die Autorin dabei der Frage nach, inwiefern die in der Dalian Economic Zone (DEZ arbeitenden Frauen Erwerbsarbeit als eine Ressource der sozialen Mobilität und der Verhandlung innerfamilialer Machtpositionen nutzbar machen können. Mit Fokus auf dieser (Sonder-Wirtschaftszone und den familialen Lebenswirklichkeiten der Frauen erschließen sich spannende Einsichten in das wirtschaftlich aufstrebende China und den damit einhergehenden sozialen Wandel von Geschlechterverhältnissen.

[Remy Willemet (1735-1807), naturalist, professor of natural history and chairman of the botanical garden of Nancy].

Science.gov (United States)

Labrude, Pierre

2015-03-01

Rémy Willemet is above all a local botanist whose first work was selected by the academy of Nancy in 1766. His notoriety began when another work with Jean-François Coste was chosen by the academy of Lyon ten years later. He published then in many papers and was elected in numerous academies and scientific societies. During the Revolution, he was a professor of the Ecole centrale de la Meurthe and of the Société de santé, and he became the chairman of the botanical garden. Willemet wrote some botanical books. Today, what is the memory of his researchs and papers? Fairly few things because he never undertook botanical travels in order to discover and compare pharmaceutical plants. However, Willemetia was the name used to denominate some species and honour his family. His name was also engraved on the wall of some university buidings and it was chosen some years ago to entitle a botanical paper in Lorraine.

Chemical and physical oceanographic profile data collected from CTD casts aboard NOAA Ship NANCY FOSTER in the Gulf of Mexico from 2010-08-13 to 2010-08-21 in response to the Deepwater Horizon oil spill event (NODC Accession 0069614)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Chemical and physical oceanographic profile data were collected aboard NOAA Ship NANCY FOSTER in the Gulf of Mexico from 2010-08-13 to 2010-08-21 in response to the...

Les Offices du cinéma éducateur et l’émergence du parlant : l’exemple de l’Office de Nancy

OpenAIRE

Laborderie, Pascal

2014-01-01

Quelle fut la politique des Offices du cinéma scolaire et éducateur durant la période de généralisation du cinéma parlant ? Une première présentation du dispositif de l’Union française des offices du cinéma éducateur laïque permet de décrire les usages du cinéma par les instituteurs, soit dans leurs enseigne­ments (le cinéma scolaire), soit dans l’éducation des adolescents et des adultes (le cinéma éducateur). Puis une étude de l’Office régional d’enseignement cinématographique de Nancy, à pa...

Biological data collected aboard the NOAA Ship NANCY FOSTER during cruise #NF0805, March 11th - March 24th, 2008. Biological data collected during larval collections in St. Thomas April 1- 8th, 2008. Gear used was light traps and beach seine.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Biological data collected from plankton collecting gear aboard the NOAA Ship NANCY FOSTER during cruise #NF0805, March 11th - March 24th, 2008 as part of the Coral...

Homo sacer w świecie chaosu. Szkic o związkach Agambena z Nancym i Serres’em (Homo Sacer in the World of Chaos. Essay about Agamben’s Associations with Nancy and Serres

Directory of Open Access Journals (Sweden)

Marcin M. Bogusławski

2010-12-01

Full Text Available This paper concerns political philosophy of Agamben, which I consider as variety of philosophy of relations.The important point of reference for Agamben are concepts of Jean-Luc Nancy and Michel Serres. According to this, as I show in my sketch, this associations are only superficial. In my opinion consequent philosophy of relations undermines main theses of Agamben’s philosophical project.

Colonial reason, de-colonial imaginary and feminisms: Nancy Morejón, Jamaica Kincaid and the construction of cultural identity in Caribbean poetics

Directory of Open Access Journals (Sweden)

Esther Sánchez-Pardo González

2015-12-01

Full Text Available This paper raises the crucial question as to whether non-Western feminisms have reached a postcolonial historical moment in which new proposals and alternatives may open up a horizon of expectations to counter the development of colonial history and its patriarchal legacy. Engaged writers like Nancy Morejón (La Habana 1944– and Jamaica Kincaid (St John’s Antigua, 1949– set themselves up to make room for black women in history, a counternarrative to patriarchal History. An analysis of representative pieces of poetry and fiction by both writers in a dialogue with ideas such as the decolonial imaginary, border thinking and rewriting History shed light on alternatives for emancipatory feminist projects for the 21st century.

Pod znakiem serca. „Ja” czujące późnej nowoczesności (Leśmian, Joyce, Derrida, Nancy

Directory of Open Access Journals (Sweden)

Aldona Kopkiewicz

2016-06-01

Full Text Available In this article I try to show the changing paradigm of romantic expressionism in late modernity. I concentrate on the category of text, which I describe using literature: Bolesław Leśmian’s tale The Adventures of Sindbad the Sailor and a fragment of James Joyce’s Ulysses, as well as theoretical discourses by Jacques Derrida and Jean-Luc Nancy. I am interested first and foremost in the problem of the arbitrary nature of the bond between heart and word, affect and language. I find this problem to be the core of the possibility of thinking about literary creativity, especially its inventive, poetical potention. I try to explain how affect and language meet in the category of textuality and how modern subjectivity can cope with its basic conflict, which lies in the demand of opening and closing itself to the affective experience of otherness.

Radio-contaminated patients intake at the Nancy teaching hospital: study of the resources and implication possibilities of radiation protection referent personnel

International Nuclear Information System (INIS)

Guionnet, Christophe

2011-01-01

In the events implying radioactive materials, the organization of care in the health facilities requires both the implementation of some skills, which go beyond the usual trade and professional duties of each of the partners, and the identification of the departments and referent staff that are likely to be most affected by these risks. This study, which was conducted within the Radiologie and Medecine Nucleaire Departments of the Centre Hospitalier Universitaire de Nancy, highlights the existence of reference material as means of detecting radiation, the conditions under which they will be developed remain to be defined. Human means can be called for for missions of information, detection, patient screening and decontamination. Volunteering persons, with competences in radiation protection (Personnes Competentes en Radioprotection), and radiographers can lead to the realization of their missions, after an practical training. (author) [fr

Identity, recognition and redistribution: a critical analysis of Charles Taylor, Axel Honneth and Nancy Fraser’s theories

Directory of Open Access Journals (Sweden)

Javier Amadeo

2017-06-01

Full Text Available http://dx.doi.org/10.5007/2175-7984.2017v16n35p242 The politics of identity and the idea of recognition have become dominant issues in contemporary political theory. Recognition, as a concept, means that an individual or a social group claims the right to have their identity recognized, directly or throw the mediation of set of institutions. The theories that have evaluated these questions address both important theoretical issues and central political subjects, as the definition of minority rights, national self-determination claims or the challenges posed of our increasingly multicultural societies. The main objective of this paper is to discuss the central arguments presents by Charles Taylor, Axel Honneth and Nancy Fraser emphasizing the discussion around the relationship between recognition and redistribution. A more specific purpose is to analyze the relation between the question of injustice based on the demand of identity and the problem of economic inequality. Finally, we try to understand some of the theoretical and political implications of the idea of difference and the recognition theory in a broader conceptual perspective.

[The ephemeral historical museum of the École Supérieure de Pharmacie de Nancy (1913-1937) Its collections today].

Science.gov (United States)

Labrude, Pierre

2014-01-01

In april 1913, the director of the École supérieure de pharmacie, professor Bruntz, undertook the realization of a historical museum and of a gallery of photographies of professors. A society, the Société lorraine du musée historique de la pharmacie, was found in 1.914 and the collections increased rapidly. After First World War, no activity occured until 1926 and space and hands were missing. In 1937, collections, except books, were transfered to the Musée historique lorrain de Nancy and the most interesting objects and documents were exposed. Books were finally deposited and stored in the university library. Today, the renovation undertaken in the Musée lorrain and the approaching transfer of the faculty are the ocasion of a new discovery of these historical collections. Many years after the disparition of the museum, it appears that its collections have been fairly well preserved.

Debates feministas sobre direito, justiça e reconhecimento: uma reflexão a partir do modelo teórico de Nancy Fraser

Directory of Open Access Journals (Sweden)

Silvana Mariano

2009-12-01

Full Text Available O feminismo pós-estruturalista é a escolha teórica que, em grande parte, orienta aqui nossa perspectiva. Os debates em torno das noções de “direito”, “justiça” e “reconhecimento” ilustram essa discussão. Propomo-nos a fazer uma reflexão sociológica conceitual, de orientação feminista, de forma a constituir um suporte teórico para análises sobre políticas sociais, com o objetivo de investigar as condições de cidadania das mulheres pobres e apreender os determinantes de gênero presentes nos programas estatais. Ao tratar das categorias apontadas, adotamos o modelo proposto por Nancy Fraser, a qual combina a luta pela justiça redistributiva com a luta por justiça de reconhecimento.

“I Stand Out Like a Raven”: Depicting the Female Detective and Tudor History in Nancy Bilyeau’s The Crown

Directory of Open Access Journals (Sweden)

Beyer Charlotte

2017-06-01

Full Text Available This article examines the portrayal of female identity and crime in the Tudor period in Nancy Bilyeau’s contemporary historical crime fiction novel, The Crown (2012. Featuring a female detective figure, Joanna Stafford, Bilyeau’s novel forms part of the wealth of contemporary fiction using Tudor history as context, reflecting a continued interest in and fascination with this period and its prominent figures. This article examines Bilyeau’s representation of the Tudor period in The Crown through the depiction of English society and culture from a contemporary perspective, employing genre fiction in order to highlight issues of criminality. My investigation of The Crown as crime fiction specifically involves analysing gender-political questions and their portrayal within the novel and its tumultuous historical context. This investigation furthermore explores the depiction of agency, individuality, religion, and politics. The article concludes that Bilyeau’s suspense-filled novel provides an imaginative representation of Tudor history through the prism of the crime fiction genre. Central to this project is its employment of a resourceful and complex female detective figure at the heart of the narrative.

[The opening lesson in the course on history and geography given by Paul Vidal de la Blache at the Faculty of Nancy: reflections of a historian newly turned geographer].

Science.gov (United States)

Lira, Larissa Alves de

2013-11-30

The aim of this presentation is to divulge the translation into Portuguese of the inaugural lesson given by French geographer Paul Vidal de la Blache at the Faculty of Nancy, given and published in 1873. This inaugural lesson already reveals the general principles proposed by the undisputed master of the French school of geography, which oriented French geography for many decades. A description is also given of the political and institutional context involving the institutionalization of modern geography in the last nineteenth century and the web of alliances and exchanges with historians, configuring an inheritance that Vidal de la Blache readily incorporated and transformed.

Secure of the bi-site radiotherapy activity as part of the resumption of treatments in the Hospital of Epinal by the team of Alexis Vautrin Nancy Cancer Center;Securisation de l'activite de radiotherapie bi-site dans le cadre de la reprise des traitements au centre hospitalier d'Epinal par l'equipe du centre Alexis-Vautrin de Nancy

Energy Technology Data Exchange (ETDEWEB)

Marchesi, V.; Aigle, D.; Peiffert, D.; Noel, A. [Centre Alexis-Vautrin, 54 - Vandoeuvre-les-Nancy (France); Noel, A. [Institut national Polytechnique de Lorraine, CNRS UMR7039, laboratoire CRAN, 54 - Nancy (France); Simon, J.M. [Groupe hospitalier Pitie-Salpetriere, 75 - Paris (France)

2009-12-15

In February 2007, the radiation therapy department of the Jean Monnet Hospital in Epinal (France) has stopped the radiotherapy treatments after the discovery of a radiotherapy accident and bad practices leading to overexposure of patients between 1987 and 2006. The Regional Cancer Center 'Centre Alexis Vautrin' in Nancy (France) was given the task of the new start of treatment activity. From February 2007 to January 2008, actions of training, updates of equipment and practices have been performed in the Epinal Hospital, guided by the quality approach, allowing the treatment of new patients in February 2008, with the radiation oncologists and the medical physicists of the Centre Alexis Vautrin, with the highest conditions of security and confidence

‘Speaking to Others' in Nancy Huston’s The Goldberg Variations and Slow Emergencies

Directory of Open Access Journals (Sweden)

Polly Galis

2016-04-01

Full Text Available Nancy Huston has previously claimed that her lack of any clear-cut national identity, or of any strong affiliation to her original cultural heritage, enables her to take on multiple identities within her literature. Huston’s claim, however, can be deemed problematic if it presupposes a right to speak on the behalf of minority or ‘subaltern’ figures. This is particularly problematic in view of Huston’s position as a white middle-class writer. In other words, the representation of others in literature can entail imperial repercussions. I will begin this article by postulating that literature can constitute a means of representing ourselves as other, or others tout-court (in keeping with Huston’s transnational approach to(self-representation, before turning to the work of Gayatri Spivak to illustrate how literary representations of others can betray a neo-colonial or imperial character. I will then establish the ways in which Huston avoids an imperial representation of others in The Goldberg Variations and Slow Emergencies by speaking to rather than for others. This article will also explore how this process is underpinned by an intersectional reading of otherness, in keeping with the critical work of Kimberlé Crenshaw and Elisabeth Spelman, and reminiscent of Gilles Deleuze and Félix Guattari’s concept of ‘becoming-minoritarian’ and Rosi Braidotti’s of ‘becoming-woman’ which, in the case of Huston’s literature, are key to distinguishing between minority and ‘subaltern’ figures. In both cases, I will demonstrate how Huston speaks to not for others in both of the studied novels, and how, in so doing, she challenges monolithic and binary categories of being.

When Art Meets Gardens: Does It Enhance the Benefits? The Nancy Hypothesis of Care for Persons with Alzheimer's Disease.

Science.gov (United States)

Jonveaux, Thérèse Rivasseau; Fescharek, Reinhard

2018-01-01

The creation of healing gardens for persons with Alzheimer's disease and related diseases (ADRD) offers vast potential. They can play a role in the scaffolding of cognitive disorders, emotional stress, sensory processing, sense of harmony, and appeasement. These effects are achieved through a distributed interplay of psychological functions with the immediate environment and local culture on the one hand, and dialogue on the other. The garden, a natural canvas created by man, shares with art the ability to foster an esthetic sense for which the perception can be measured by functional neurological imaging exploration. Art represents a mediator for the collaborative realization of distributed psychological functions between different individuals. Based on the hypothesis of an optimization of the therapeutic potential of a garden by a design adapted to the neuro-psycho-social and cultural specificities of its users combined with the thoughtful introduction of an artistic dimension, the "art, memory and life" healing garden was created at the University Hospital of Nancy as a prototype for persons with ADRD. The design concept was based on two hypotheses that we formulate herein, discuss their theoretical foundation, and suggest enhanced design for therapeutic gardens based upon our experience.

Secure of the bi-site radiotherapy activity as part of the resumption of treatments in the Hospital of Epinal by the team of Alexis Vautrin Nancy Cancer Center

International Nuclear Information System (INIS)

Marchesi, V.; Aigle, D.; Peiffert, D.; Noel, A.; Noel, A.; Simon, J.M.

2009-01-01

In February 2007, the radiation therapy department of the Jean Monnet Hospital in Epinal (France) has stopped the radiotherapy treatments after the discovery of a radiotherapy accident and bad practices leading to overexposure of patients between 1987 and 2006. The Regional Cancer Center 'Centre Alexis Vautrin' in Nancy (France) was given the task of the new start of treatment activity. From February 2007 to January 2008, actions of training, updates of equipment and practices have been performed in the Epinal Hospital, guided by the quality approach, allowing the treatment of new patients in February 2008, with the radiation oncologists and the medical physicists of the Centre Alexis Vautrin, with the highest conditions of security and confidence

O IMPACTO DA CONVERSÃO DO CUSTO HISTÓRICO AO CUSTO CORRENTE CORRIGIDO NO RETORNO SOBRE ATIVOS E PATRIMÔNIO LÍQUIDO: ANÁLISE A PARTIR DO SISTEMA DUPONT.

Directory of Open Access Journals (Sweden)

Roberto Silva da Penha

2013-07-01

Full Text Available Historical cost is the most used form of accounting valuation, but it does not reflect the effect of currency in time. The Theory of Corrected Current Cost, albeit with limitations, may show evidence of real and relevant accounting information of the entity. In this context, a question can be formulated: What is the impact of the conversion of historical cost to corrected current cost in return on assets and equity? In order to answer this question, the DuPont system was applied in a model company as a tool for analysis. The results showed that the return of assets at historical cost and corrected current cost were 12.11% and 3.14%, respectively, a decrease of 74.07%, and the result of the return on equity, the historical cost and corrected current cost were 20.59% and 4.96%, respectively, decreased 75.91%. Based on these variations it is observed that the impacts of the conversion of the corrected current cost were significant, confirming the importance of the adoption of this practice, whenever possible.

Two attempts at grounding social critique in „ordinary“ actors’ perspectives: The critical theories of Nancy Fraser and Axel Honneth

Directory of Open Access Journals (Sweden)

Ivković Marjan

2014-01-01

Full Text Available This paper analyzes two contemporary, „third-generation“ perspectives within critical theory - Nancy Fraser’s and Axel Honneth’s - with the aim of examining the degree to which the two authors succeed in grounding the normative criteria of social critique in the perspectives of ’ordinary’ social actors, as opposed to speculative social theory. To that end, the author focuses on the influential debate between Fraser and Honneth Redistribution or Recognition? which concerns the appropriate normative foundations of a „post-metaphysical“ critical theory, and attempts to reconstruct the fundamental 29 disagreements between Fraser and Honneth over the meaning and tasks of critical theory. The author concludes that both critical theorists ultimately secure the normative foundations of critique through substantive theorizations of the social, which frame the two authors’ „reconstructions“ of the normativity of everyday social action, but argues that post-metaphysical critical theory does not have to abandon comprehensive social theory in order to be epistmologically „non-authoritarian“. [Projekat Ministarstva nauke Republike Srbije, br. 43007: Ethics and Politics of Environment: Institutions, Techniques and Norms Facing the Challenge of Environmental Change

Nancy B and Nancy F.

Science.gov (United States)

Burkholder, L

2001-01-01

In this article I provide a virtuous slippery slope argument which shows that there is no morally significant difference between passive and active euthanasia. At the top of the slope is an example of passive euthanasia; at the bottom, an example of active euthanasia. For each pair of cases down the slope there is nothing that sensibly makes a morally significant difference between the pair of cases. Thus, there is no morally significant difference between passive euthanasia and active euthanasia.

75 FR 51845 - Chrysler Group, LLC Manufacturing Division St. Louis North Plant Including On-Site Leased Workers...

Science.gov (United States)

2010-08-23

... produce performance coating solutions for vehicles. The company reports that workers leased from DuPont Performance Coatings, a wholly-owned subsidiary of E.I. DuPont de Nemours Company, OEM, were employed on-site..., C R Associates, Syncreon, Robinson Solutions and Dupont Performance Coatings Fenton, MO; Amended...

QDR 2001: Strategy-Driven Choices for America’s Security

Science.gov (United States)

2001-04-01

McKenzie, Jr., USMC; Lieutenant Colonel Philip M. Ruhlman , USAF; Lieutenant Colonel John J. Spinelli, USA; and Captain Sam J. Tangredi, USN. Their...one chosen by their service: Lieutenant Colonel Frank McKenzie, USMC; Lieutenant Colonel Philip Ruhlman , USAF; Lieutenant Colonel John Spinelli, USA

Kirit C. Shah, M.D. v. Stan Harris and Nancy Harris. "Construction of Legal Arguments, Statutes of Limitations, and Medical Malpractice." Lesson Plans for Secondary Teachers on How Lawyers Prepare Their Arguments. Courts in the Classroom: Curriculum Concepts and Other Information on Indiana's Courts for the K-12 Educator.

Science.gov (United States)

Osborn, Elizabeth

Stan and Nancy Harris filed a complaint against Kirit C. Shah, M.D., for misdiagnosing Mr. Harris's illness, charging Dr. Shah with negligence and asking for damages. A medical malpractice action in Indiana is governed by a two year statute of limitations. Because the Harrises failed to bring their action against Dr. Shah within this two year…

The Molecular Epidemiology of Malaria in Western Kenya

Science.gov (United States)

2002-09-01

transcriptional activation. Proc Natl Acad Sci USA 1997 94(7): 3195-9. 27. Uglialoro AM, Turbay D, Pesavento PA, Delgado JC, McKenzie FE, Gribben JG, Hartl D...Uglialoro AM, Turbay D, Pesavento PA, Delgado JC, McKenzie FE, Gribben JG, Hartl D, Yunis EJ, Goldfeld AE. Identification of three new single nucleotide

Quantifying Contaminant Mass for the Feasibility Study of the DuPont Chambers Works FUSRAP Site - 13510

Energy Technology Data Exchange (ETDEWEB)

Young, Carl; Rahman, Mahmudur; Johnson, Ann; Owe, Stephan [Cabrera Services Inc., 1106 N. Charles St., Ste. 300, Baltimore, MD 21201 (United States)

2013-07-01

The U.S. Army Corps of Engineers (USACE) - Philadelphia District is conducting an environmental restoration at the DuPont Chambers Works in Deepwater, New Jersey under the Formerly Utilized Sites Remedial Action Program (FUSRAP). Discrete locations are contaminated with natural uranium, thorium-230 and radium-226. The USACE is proposing a preferred remedial alternative consisting of excavation and offsite disposal to address soil contamination followed by monitored natural attenuation to address residual groundwater contamination. Methods were developed to quantify the error associated with contaminant volume estimates and use mass balance calculations of the uranium plume to estimate the removal efficiency of the proposed alternative. During the remedial investigation, the USACE collected approximately 500 soil samples at various depths. As the first step of contaminant mass estimation, soil analytical data was segmented into several depth intervals. Second, using contouring software, analytical data for each depth interval was contoured to determine lateral extent of contamination. Six different contouring algorithms were used to generate alternative interpretations of the lateral extent of the soil contamination. Finally, geographical information system software was used to produce a three dimensional model in order to present both lateral and vertical extent of the soil contamination and to estimate the volume of impacted soil for each depth interval. The average soil volume from all six contouring methods was used to determine the estimated volume of impacted soil. This method also allowed an estimate of a standard deviation of the waste volume estimate. It was determined that the margin of error for the method was plus or minus 17% of the waste volume, which is within the acceptable construction contingency for cost estimation. USACE collected approximately 190 groundwater samples from 40 monitor wells. It is expected that excavation and disposal of

As fronteiras da pesquisa antropológica: Ética, Autonomia e Tráfico de Órgãos. Um comentário a The Global Traffic in Human Organs, de Nancy Scheper-Hughes

Directory of Open Access Journals (Sweden)

Debora Diniz

2001-02-01

Full Text Available O debate sobre os fundamentos éticos da comercialização de partes do corpo humano cresce a cada dia na bioética. Este artigo discute os princípios da ética e da autonomia contidos no mais importante estudo etnográfico sobre o tráfico internacional de órgãos, trabalho coordenado pela antropóloga Nancy Scheper-Hughes. O artigo mostra que a defesa da ética da não-comercialização exige o reconhecimento de fundamentos absolutos e inalienáveis para o ser humano, um pressuposto político cuja legitimidade os antropólogos relativistas resistem em reconhecer.

Dynawave froth scrubbing technology

International Nuclear Information System (INIS)

McLean, J.E.

1989-01-01

The DynaWave family of scrubbers was developed and patented by DuPont in the 1970's and is used extensively within the company. Because the technology was treated as confidential, information about the scrubbers was not published outside of DuPont. In 1986 Monsanto Enviro-Chem was asked to install a Reverse Jet scrubber at DuPont's Burnside spent acid recovery pant to replace an aging spray humidifying tower. Enviro-Chem was impressed with the technology and entered into a licensing agreement with DuPont in late 1987. This paper addresses the application of DynaWave froth scrubbing technology to metallurgical plant process and effluent gas streams. Froth scrubber design principles an sampling results from pilot plant trails on fluid bed roaster off-gas are presented

Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río

OpenAIRE

Isabel Pérez Hernández

2009-01-01

El trabajo titulado "Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río”, constituye una extensión del Proyecto Investigativo Medio Ambiente y Deportes; el mismo tiene como finalidad contribuir al mejoramiento de la formación ambiental de los jóvenes y profesores, a través de la puesta en práctica de un sistema de actividades. Este proyecto ha de l...

76 FR 14393 - Notice of Receipt of Requests for Amendments To Delete Uses in Certain Pesticide Registrations

Science.gov (United States)

2011-03-16

... Aldicarb Aldicarb Use on Coffee. Pesticide. 352-604 DuPont Tanos Famoxadone & Cymoxanil.. Leaf Petioles...: Manager, U.S.-- Registration, DuPont Crop Protection, 1007 Market Street, Wilmington, DE 19898-0001. 8536...

In-house validation study of the DuPont Qualicon BAX system Q7 instrument with the BAX system PCR Assay for Salmonella (modification of AOAC Official Method 2003.09 and AOAC Research Institute Performance-Tested Method 100201).

Science.gov (United States)

Tice, George; Andaloro, Bridget; White, H Kirk; Bolton, Lance; Wang, Siqun; Davis, Eugene; Wallace, Morgan

2009-01-01

In 2006, DuPont Qualicon introduced the BAX system Q7 instrument for use with its assays. To demonstrate the equivalence of the new and old instruments, a validation study was conducted using the BAX system PCR Assay for Salmonella, AOAC Official Method 2003.09, on three food types. The foods were simultaneously analyzed with the BAX system Q7 instrument and either the U.S. Food and Drug Administration Bacteriological Analytical Manual or the U.S. Department of Agriculture-Food Safety and Inspection Service Microbiology Laboratory Guidebook reference method for detecting Salmonella. Comparable performance between the BAX system and the reference methods was observed. Of the 75 paired samples analyzed, 39 samples were positive by both the BAX system and reference methods, and 36 samples were negative by both the BAX system and reference methods, demonstrating 100% correlation. Inclusivity and exclusivity for the BAX system Q7 instrument were also established by testing 50 Salmonella strains and 20 non-Salmonella isolates. All Salmonella strains returned positive results, and all non-Salmonella isolates returned a negative response.

76 FR 10584 - Notice of Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or...

Science.gov (United States)

2011-02-25

... dimethylcyclopropanecarboxylate and its inactive R-isomers, in or on avocado; papaya; star apple; black sapote; mango; sapodilla... 0F7763. (EPA-HQ-OPP-2010-0888). E. I. DuPont de Nemours and Company, DuPont Crop Protection, 1700 Market...

EFFECTIVENESS OF MC KENZIE EXERCISES IN REDUCING NECK AND BACK PAIN AMONG MADRASSA STUDENTS

Directory of Open Access Journals (Sweden)

Saima Aziz

2016-02-01

Full Text Available Background: In this advanced era, neck and back pain has become a common musculoskeletal problem. These symptoms have a high prevalence in the community and now they are affecting even our adolescents leaving a major impact on youth’s functional and educational activities. Nevertheless, the burden of these musculoskeletal pains, which relates not only to its prevalence but also to increase in physiological and psychological stress among them, distressing their creativity. Madrassa students have a daily exposure to neck and back pain due to poor posture. The McKenzie method is a popular treatment for back and neck pain among physical therapists. So, the intention of this study is to test the effectiveness of McKenzie exercises in neck and back pain, because hardly any data is available on McKenzie technique and its outcome in Pakistan. The objective of the study is to determine the effectiveness of McKenzie exercises in reducing neck and back pain among madrassa students. Methods: The students were recruited from Madrassa Darul Akram (Baldia town and Jamia Ashraf-ul-madrassa (Gulshan-e-Iqbal Karachi. One sixty three students aged between 12–18 years of both genders who were fulfilling the inclusion criteria were selected from Madrassa Darul Akram (Baldia town and Jamia Ashraf-ul-madrassa (Gulshane-Iqbal. The participants received McKenzie exercises programs intervention for three consecutive weeks. Outcome Measure: Neck Disability Index (NDI, Modified Oswestry Low Back Pain Disability Index (ODI and Numeric Pain Rating Scale (NPRS Results: The present study showed significant results in all three scales in both genders (p<0.001.Among sections, the Hafiz students revealed greater score in all 3 scales before treatment as compared to ‘Alim/Alima’ and ‘Nazra’ students and after treatment showed significant results in all 3 domains (p<0.001. Conclusion: Findings of this study revealed that madrassa students were more prone to develop neck

Manual Correction of an Acute Lumbar Lateral Shift: Maintenance of Correction and Rehabilitation: A Case Report with Video

OpenAIRE

Laslett, Mark

2009-01-01

The acute onset lumbar lateral shift, otherwise known as a list or acute scoliosis, is a common clinical observation associated with low back pain. In general orthopaedics, the presence of a lateral shift is associated with a poor prognosis; however, a manual correction method devised by McKenzie is claimed to produce rapid reversal of the deformity and reduction in pain. This single-case report presents the details of the McKenzie Mechanical Diagnosis and Treatment (MDT) management of a majo...

Factorial Analysis of Profitability

OpenAIRE

Georgeta VINTILA; Ilie GHEORGHE; Ioana Mihaela POCAN; Madalina Gabriela ANGHEL

2012-01-01

The DuPont analysis system is based on decomposing the profitability ratio in factors of influence. This paper describes the factorial analysis of profitability based on the DuPont system. Significant importance is given to the impact on various indicators on the shares value and profitability.

Scientific Opinion related to a notification from DuPont Nutrition Biosciences Aps on behenic acid from mustard seeds to be used in the manufacturing of certain emulsifiers pursuant to Article 21(2) of Regulation (EU) No 1169/2011 – for permanent exemption from labelling

DEFF Research Database (Denmark)

Sjödin, Anders Mikael

2016-01-01

Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion related to a notification from DuPont Nutrition Biosciences Aps on behenic acid from mustard seeds to be used in the manufacturing of certain...... and peptides may not be carried over into behenic acid after the two distillation steps reported in the manufacturing process in amounts beyond 1 mg/kg. The Panel notes that the maximum amount of mustard protein that could be consumed from emulsifiers manufactured from behenic acid (E 470a, E 471 and E 477......) on a single occasion by an adult under the proposed conditions of use would be around 0.00119 mg, which is about 1,000 times lower than the protein doses reported to trigger allergic reactions in mustard-allergic individuals (around 1 mg). On the basis of the data presented, the Panel concludes that oral...

76 FR 69746 - Eunice Kennedy Shriver National Institute of Child Health & Human Development; Notice of Closed...

Science.gov (United States)

2011-11-09

...) of the Federal Advisory Committee Act, as amended (5 U.S.C. App.), notice is hereby given of the..., 2011. Time: 8 a.m. to 5 p.m. Agenda: To review and evaluate grant applications. Place: The Dupont Hotel.... Agenda: To review and evaluate grant applications. Place: The Dupont Hotel, 1500 New Hampshire Avenue NW...

Kuu plaat : Galaktlan "Constance". Plaadid kauplusest Lasering

Index Scriptorium Estoniae

2005-01-01

Heliplaatidest: Galaktlan "Constance", Bonnie "Prince" Billy & Matt Sweeney "Superwolf", Hinkus feat. Maarja "Look around", Noizmakaz "Valitud mõtted", Hedvig Hanson & Andre Maaker "You Bring Me Yoy", Nancy Sinatra "Nancy Sinatra"

76 FR 77768 - Information Collection; Flathead and McKenzie Rivers and McKenzie National Recreational Trail...

Science.gov (United States)

2011-12-14

... completed and validated, the hardcopy questionnaires will be discarded. Data will be imported into SPSS (Statistical Package for the Social Sciences) for analysis. The database will be maintained at the respective...

Hematological changes among Beninese motor-bike taxi drivers ...

African Journals Online (AJOL)

user

2INSERM U954, Nutrition Genetic and Exposure to Environmental Risks, Nancy University, Medical Faculty of Nancy,. France. .... corpuscular hemoglobin concentration (MCHC) and mean ..... by the Ministry of Higher Education and Scientific.

Validation of the detection of STEC (O26, O45, O103, O111, O121, O145 and O157 in raw burgers using real-time PCR (BAX® System Q7, DuPont in “WET POOLS”

Directory of Open Access Journals (Sweden)

Paula Mussio

2014-12-01

Full Text Available Shiga toxin-producing Escherichia coli (STEC O157:H7 and no-O157:H7 have been identified as emerging foodborne pathogens responsible for an increasing number of outbreaks worldwide. Many foods have been associated to these outbreaks, mainly undercooked beef burgers. Due to the increasing production and consumption of burgers in our country, it is important to have a rapid technique to identify and isolate the most important STEC strains in foods matrixes.The objective of these investigation was to assess the sensitivity, specificity and limit detection for the screening of the most prevalent STEC in frozen raw beef burgers, using the "STEC Screening stx/eae " kit to detect the stx/eae genes and the "Panel 1 STEC E. coli O26, O111, O121" and "Panel 2 STEC E. coli O45, O103, O145" and "E. coli O157: H7 MP” (DuPont kits for the detection of the different serogroups. The use of composed samples (wet pools, the recovery of each strain from the positives samples on selective media after specified inmunoconcentration and the detection of stx/eae virulence genes in isolates by PCR were also evaluated. We validated a technique that allows the detection of the mentioned STEC strains with limits of detection between 1-5 CFU in 65 grams of raw frozen hamburgers, using wet pools. 

The Effects of Mass Media Advertising on U.S. Army Recruiting.

Science.gov (United States)

1982-03-16

the analysis of the product, markets desired to be entered, mo- tives of the advertiser , messages to be presented, media to r -------- 12 be used to... market its products. Sales is a major DuPont advertising objective, but not the only objective. DuPont used selected panels of individuals to expose to its...center, objectives could be formed and operationalized for each advertising program. Overall re- search strategy could be planned, and specific

Vegetation - McKenzie Preserve [ds703

Data.gov (United States)

California Natural Resource Agency — The California Native Plant Society (CNPS) Vegetation Program produced a vegetation map and classification for approximately 11,600 acres primarily within Millerton...

Nancy Dowe | NREL

Science.gov (United States)

Bench scale integration and scale up of biological processes to produce fuels and chemicals from Zymomonas mobilis strain 8b through continuous adaptation on dilute acid pretreated corn stover hydrolysate development and integration. Please do NOT contact me directly for jobs-see instead information on NREL's

A Poetics at the Limit of the Subject: Nancy’s Philosophy of Singular Being in Conrad’s “The Secret Sharer”

Directory of Open Access Journals (Sweden)

Brenda MACHOSKY

2004-10-01

Full Text Available In concluding the Preface to La communauté désoeuvrée, Jean-Luc Nancy laments the possibility (or likelihood that as human beings we will soon be deprived of our finite existence, the experience of the finitude at the essence of our being. The myth of much contemporary discourse, the myth Nancy hopes to interrupt with “literary communism,” is the sublation or overcoming of finitude. In articulating a discourse of “singularity” Nancy disrupts the narrative flow of subjectivity. He does not pr...

(HTLV1) in different patients in the north of Iran

African Journals Online (AJOL)

Administrator

2011-09-12

Sep 12, 2011 ... disorders including neurologic (such as multiple sclerosis, paralysis and tumor), gastrointestinal disorders (ulcer, inflammatory bowel diseases and tumors), hematology and oncology disorders (chronic anemia and malig- nancies), urologic disorders (renal stone, malig-nancies and urinary tract infection), ...

Diatom community response to climate variability over the past 37,000 years in the sub-tropics of the Southern Hemisphere

Energy Technology Data Exchange (ETDEWEB)

Hembrow, Sarah C., E-mail: sarah.hembrow@scu.edu.au [School of Environment, Science and Engineering, Southern Cross University, Lismore, NSW 2480 (Australia); Taffs, Kathryn H. [School of Environment, Science and Engineering, Southern Cross University, Lismore, NSW 2480 (Australia); Atahan, Pia [Institute for Environmental Research, Australian Nuclear Science and Technology Organisation, Kirrawee, NSW 2232 (Australia); Parr, Jeff [School of Environment, Science and Engineering, Southern Cross University, Lismore, NSW 2480 (Australia); Zawadzki, Atun; Heijnis, Henk [Institute for Environmental Research, Australian Nuclear Science and Technology Organisation, Kirrawee, NSW 2232 (Australia)

2014-01-01

Climate change is impacting global surface water resources, increasing the need for a deeper understanding of the interaction between climate and biological diversity. This is particularly the case in the Southern Hemisphere sub-tropics, where little information exists on the aquatic biota response to climate variations. Palaeolimnological techniques, in particular the use of diatoms, are well established and can significantly contribute to the understanding of climatic variability and the impacts that change in climate have on aquatic ecosystems. A sediment core from Lake McKenzie, Fraser Island (Australia), was used to investigate interactions between climate influences and aquatic ecosystems. This study utilises a combination of proxies including biological (diatom), geochemical and chronological techniques to investigate long-term aquatic changes within the perched-dune lake. A combination of {sup 210}Pb and AMS {sup 14}C dates showed that the retrieved sediment represented a history of ca. 37,000 cal. yBP. The sedimentation rate in Lake McKenzie is very low, ranging on average from 0.11 mm to 0.26 mm per year. A sediment hiatus was observed between ca. 18,300 and 14,000 cal. yBP suggesting a period of dry conditions at the site. The diatom record shows little variability over the period of record, with benthic, freshwater acidic tolerant species dominating. Relative abundance of planktonic species and geochemical results indicates a period of increased water depth and lake productivity in the early Holocene and a gradual decrease in effective precipitation throughout the Holocene. Results from this study not only support earlier work conducted on Fraser Island using pollen reconstructions but also demonstrate that diatom community diversity has been relatively consistent throughout the Holocene and late Pleistocene with only minor cyclical fluctuation evident. This record is consistent with the few other aquatic palaeoecological records from the Southern

Diatom community response to climate variability over the past 37,000 years in the sub-tropics of the Southern Hemisphere

International Nuclear Information System (INIS)

Hembrow, Sarah C.; Taffs, Kathryn H.; Atahan, Pia; Parr, Jeff; Zawadzki, Atun; Heijnis, Henk

2014-01-01

Climate change is impacting global surface water resources, increasing the need for a deeper understanding of the interaction between climate and biological diversity. This is particularly the case in the Southern Hemisphere sub-tropics, where little information exists on the aquatic biota response to climate variations. Palaeolimnological techniques, in particular the use of diatoms, are well established and can significantly contribute to the understanding of climatic variability and the impacts that change in climate have on aquatic ecosystems. A sediment core from Lake McKenzie, Fraser Island (Australia), was used to investigate interactions between climate influences and aquatic ecosystems. This study utilises a combination of proxies including biological (diatom), geochemical and chronological techniques to investigate long-term aquatic changes within the perched-dune lake. A combination of 210 Pb and AMS 14 C dates showed that the retrieved sediment represented a history of ca. 37,000 cal. yBP. The sedimentation rate in Lake McKenzie is very low, ranging on average from 0.11 mm to 0.26 mm per year. A sediment hiatus was observed between ca. 18,300 and 14,000 cal. yBP suggesting a period of dry conditions at the site. The diatom record shows little variability over the period of record, with benthic, freshwater acidic tolerant species dominating. Relative abundance of planktonic species and geochemical results indicates a period of increased water depth and lake productivity in the early Holocene and a gradual decrease in effective precipitation throughout the Holocene. Results from this study not only support earlier work conducted on Fraser Island using pollen reconstructions but also demonstrate that diatom community diversity has been relatively consistent throughout the Holocene and late Pleistocene with only minor cyclical fluctuation evident. This record is consistent with the few other aquatic palaeoecological records from the Southern Hemisphere sub

Ka kalal võivad olla tunded / Priit Ennet

Index Scriptorium Estoniae

Ennet, Priit

2016-01-01

Simon McKenzie ja Sonia Ray katsest sebrakaladega, mida nad tõlgendavad nii, et stressiseisundis kalad kutsusid selle leevendamiseks meelega esile palaviku seisundi eelistades ujuda harjumuspärasest kõrgema temperatuuriga vees

Ekspert: poerohkus ajab Eesti hinnad kõrgeks / Katre Pilvinski ; kommenteerinud Raul Puusepp

Index Scriptorium Estoniae

Pilvinski, Katre

2010-01-01

Kanada Guelphi ülikooli turundus- ja kaubandusprofessor Brent McKenzie leiab, et Eesti jaekaubandusturul on liiga palju erinevaid super- ja hüpermarketeid ning seetõttu pole jaemüüjatel suurt mõju varustajatele

NJP VOLUME 40 No 4 Corrected

African Journals Online (AJOL)

PROF. EZECHUKWU

2013-05-04

May 4, 2013 ... births and only 4% of cases are products of twin preg- nancies. The first documented case occurring in ... ily history of congenital malformations, the index preg- nancy was preceded by three successive ... Both babies were discharged home at the age of 24 days to be followed up in the clinic. However, the ...

75 FR 27623 - Qualification of Drivers; Exemption Applications; Vision

Science.gov (United States)

2010-05-17

.... Askin, Paul J. Bannon, Ernie E. Black, Ronnie F. Bowman, Gary O. Brady, Stephen H. Goldcamp, Steven F. Grass, Wai F. King, Dennis E. Krone, Richard J. McKenzie, Jr., Christopher J. Meerten, Craig W. Miller...

Soorituskeskne hindamine on värbamises töökindel meetod

Index Scriptorium Estoniae

2007-01-01

Personalivärbamise firma Ferguson McKenzie uurimusest, milles selgitati soorituse hindamisele põhinevate valikumeetodite tõhusust, vaadeldes, kuidas eelnev töösooritus ja saavutused võimaldavad ennustada töötaja edukust ka tulevikus

Managerial Techniques in Educational Administration.

Science.gov (United States)

Lane, John J.

1983-01-01

Management techniques developed during the past 20 years assume the rational bureaucratic model. School administration requires contingent techniques. Quality Circle, Theory Z, and the McKenzie 7-Framework are discussed as techniques to increase school productivity. (MD)

75 FR 38603 - Qualification of Drivers; Exemption Renewals; Vision

Science.gov (United States)

2010-07-02

... James C. Askin, Paul J. Bannon, Ernie E. Black, Ronnie F. Bowman, Gary O. Brady, Stephen H. Goldcamp, Steven F. Grass, Wai F. King, Dennis E. Krone, Richard J. McKenzie, Jr., Christopher J. Meerten, Craig W...

Is nuclear energy safe for workers and the public. III

International Nuclear Information System (INIS)

McKenzie, J.J. Jr.

1976-01-01

Dr. McKenzie says a national energy policy does exist, being based on synthetic fuels from coal and nuclear energy to meet future demands, and based on a complete lack of attention to conservation. In meeting energy demands for the future, he feels the opportunity still exists to create the scenario that will require meaningful jobs in the process, jobs requiring less capital and less energy. On the risks of nuclear energy, Dr. McKenzie discusses the funding, research, and results of the Atomic Energy Commission's safety program. He airs his views on WASH-1400, the study by Professor Norman Rasmussen, dealing with the possibilities of reactor core meltdowns. He thinks a worse problem resulting from nuclear power plants is that of waste disposal and cites AEC's poor record of managing these wastes in Kansas and elsewhere. In concluding, Dr. McKenzie says: (1) nuclear power may not be the best thing in the world, maybe we should look at other alternatives; (2) conservation is most important, and creates jobs at the same time if handled correctly; (3) AFL-C10 should sponsor a study on energy systems investigating its employment potential, net energy, economic factors, and capital requirements; and (4) construction of nuclear and coal plants will create jobs, but building solar plants will create jobs with fewer restraints on the environment. A panel discussion follows this, the third paper, on nuclear safety for workers and the public

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available in C58, Dupont) ... Length = 112 ... Query: 205 IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEA...RRLM 264 ... IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEARRLM Sbjct: 1 ... IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEARRLM 60 ...

Disease: H00753 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available Aydogdu O, Derbent M, Garcia-Minaur S, Reardon W, Gener B, Shalev S, Smith R, Wo... SB, Urquhart JE, Hilton E, McKenzie EA, Kammerer RA, Lewis M, Kerr B, Stuart H, Donnai D, Long DA, Burgu B,

Combating the Enemy Within: Building Trust, Leading Change and Defeating the Mental Health Stigma

Science.gov (United States)

2013-12-16

3D1229% 26context%3Dgladnetcollect%22 (accessed on 13 September 2013), vi. 27 Nancy Skopp, Nigel Bush, David Vogel, Nathaniel Wade, Anton...Corporation, 2008, 275-276. 31 Charles R. Figley and R. Blaine Everson, Families Under Fire (New York: Taylor and Francis Group, 2011), 44...and Cognitive Injuries (Arlington, VA: Rand Corporation, 2008), 14. 62 Nancy Skopp, Nigel Bush, David Vogel, Nathaniel Wade, Anton Sirotin

Overview of an energy management process

International Nuclear Information System (INIS)

Chantraine, P.

2004-01-01

Invista is a global and vertically integrated fiber, resin and intermediates business which belonged to Dupont but is now a subsidiary of Koch Industries. A background of Invista and its former relationship with Dupont was presented. This presentation was based on goals and work done as Dupont Canada Inc., up to the end of 2003. Details of Invista's approach to climate change in Canada were provided along with the company's relationship with Natural Resources Canada. The historical position of Dupont Canada was reviewed in detail, including their commitment to voluntary approach; participation in the national process; their goal of 85 per cent reduction in greenhouse gas (GHG) by 2000; 93 per cent reduction in nitrous oxide emissions; energy efficiency goals; and continuing growth of the company. An outline and mission of the energy management team established in 1974 was presented, with details of the 1974 oil shortage, stabilization in the 1980s through to rises in electricity prices in the 1990s and concerns over climate change in recent years. Details of the team's operational procedures were presented. Results were presented in graph form and include: total energy use from 1972 to 2003 as well as cumulative energy conservation projects and resulting energy savings. Examples of activities and projects were provided, including details of energy performance contracting. It was concluded that in order to conserve energy, top management support was necessary, as well as passion and dedication in both leaders and teams. A broad scope for creativity in finding solutions within evolving constraints was also important, as was the nurturing of capability, capacity and recognition for results achieved. tabs., figs

X-Ray Characterization of Resistor/Dielectric Material for Low Temperature Co-Fired Ceramic Packages

International Nuclear Information System (INIS)

DIMOS, DUANE B.; KOTULA, PAUL G.; RODRIGUEZ, MARK A.; YANG, PIN

1999-01-01

High temperature XRD has been employed to monitor the devitrification of Dupont 951 low temperature co-fired ceramic (LTCC) and Dupont E84005 resistor ink. The LTCC underwent devitrification to an anorthite phase in the range of 835-875 C with activation energy of 180 kJ/mol as calculated from kinetic data. The resistor paste underwent devitrification in the 835-875 C range forming monoclinic and hexagonal celcian phases plus a phase believed to be a zinc-silicate. RuO(sub 2) appeared to be stable within this devitrified resistor matrix. X-ray radiography of a co-fired circuit indicated good structural/chemical compatibility between the resistor and LTCC

ORF Alignment: NC_003306 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available C58, Dupont) plasmid AT ... Length = 247 ... Query: 28 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMA...KDLNAELEIVPLTGASRIPS 87 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTG...ASRIPS Sbjct: 21 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 80 ... Query: 148 STLDTWLTDNAPEV

Turism rikastab : rahvusvaheline turismikonverents

Index Scriptorium Estoniae

2006-01-01

28. septembril toimus Tallinnas Rahvusraamatukogus rahvusvaheline turismikonverents"Turism rikastab". Ülevaade majandus- ja kommunikatsiooniministeeriumi majandusarengu asekantsleri Maria Värtoni, Graham Mckenzie, Linnar Viigi, Nick Skelloni, Mario Ascencao (Haagi ülikool), David Carsoni (Ulsteri ülikool), Vesa Heikkineni ja Imre Sooääre ettekannetest

Rhizobium as a crop enhancer and biofertilizer for increased cereal ...

African Journals Online (AJOL)

OHWESIRI IBUJE

2010-09-13

Sep 13, 2010 ... INTRODUCTION. The United Nations Food and Agriculture Organization ... new insights into recent development of rhizobia-cereal interaction. .... which caused changes in root morphology and physiology that resulted in .... Andrews M, James EK, Cummings SP, Zavalin AA, Vinogradova LV,. McKenzie BA ...

ORIGINAL ARTICLE

African Journals Online (AJOL)

User

Keywords: Asymptomatic bacteriuria, pregnancy, urine, Prevalence, Parity. INTRODUCTION. Urinary Tract Infections (UTIs) is an infection caused by the presence and growth of microorganisms anywhere in the urinary tract. It is perhaps the single most common bacterial infection of mankind (Morgan and McKenzie,. 1993 ...

78 FR 36508 - Notice of Sugar Purchase and Exchange for Re-Export Program Credits; and Notice of Re-Export...

Science.gov (United States)

2013-06-18

...; telephone (202) 690-0734. For sugar purchase and general exchange information contact Pamela McKenzie... license balance within certain limits. Sugar exported or transferred is subtracted from the license balance, resulting in a license ``credit;'' sugar imported is added to the balance, resulting in a license...

Genesis of a Joint Gallery of Sport Art.

Science.gov (United States)

Kozar, Andrew J.

1989-01-01

The University of Pennsylvania's dual sport art gallery showcases the work of R. Taft McKenzie and Joe Brown, two of the premier sport artists of our time. This article briefly outlines the artists' careers and describes the planning which led to establishment of the gallery. (IAH)

Improvement of decision-making criteria for the care of elderly cancer patients by general practitioners (Lorraine, France

Directory of Open Access Journals (Sweden)

Niemier JY

2018-05-01

Full Text Available Jean-Yves Niemier,1,2 Frédérique Claudot,3,4 Phi Linh Nguyen-Thi,4 Jean-Marie Hubert,5 Hubert Rousselot,2,6 Athanase Benetos,1 Christine Perret-Guillaume1,3 1Department of Geriatric Medicine, CHRU de Nancy, Nancy, France; 2UCOG Lorraine, Nancy, France; 3EA 4360 APEMAC, Faculté de Médecine, Université de Lorraine, Nancy, France; 4PARC, CHRU de Nancy, Nancy, France; 5Spincourt Multidisciplinary MSP, Spincourt, France; 6SISSPO Department, Institut de Cancérologie de Lorraine, Vandœuvre-lès-Nancy, France Objective: The objective of this study was to identify changes in the decision-making criteria of general practitioners (GPs concerning the care of elderly cancer patients after 1 year of corrective measures for care practices in the Lorraine region, France. Materials and methods: In 2014, a postal mail questionnaire was sent to all GPs in the Lorraine region. This questionnaire was designed to identify GPs’ decision-making criteria. It was based on the results of a literature review and on existing guidelines. During 1 year, corrective measures were implemented to improve practices, especially training sessions for physicians and production of specific tools, including a guide to the accepted ideas in geriatric oncology. In 2015, the same questionnaire was resent to all GPs to compare the answers. Results: In 2014, 430 questionnaires were returned out of 2,048 sent, and in 2015, 378 questionnaires were returned out of 2,066 sent. Our results show for the first time that there exists a significant difference in the overall decision criteria between the two survey periods. This difference mainly concerns criteria related to the cancerous diseases. Physicians tend to consider the principal decision criteria to be less important after the training period. GPs express the importance of accessibility to specialists for additional advice in both 2014 and 2015; the distance between the patient’s home and an adapted care facility and the

New Fellows and Honorary Fellow

Indian Academy of Sciences (India)

Home; Fellowship. Fellow Profile. Elected: 1934 Section: Engineering & Technology. Taylor, Edward McKenzie 1940-43. Date of birth: 1889. Specialization: Agriculture. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the ...

Microeconomic determinants of skilled migration: The case of Suriname

NARCIS (Netherlands)

T.W. Dulam (Tina); Ph.H.B.F. Franses (Philip Hans)

2014-01-01

markdownabstract__Abstract__ Suriname witnesses a brain drain, in particular to the Netherlands. We study the determinants of this brain drain for skilled individuals, where we rely on an adaptation of the survey proposed in Gibson and McKenzie (2011). We managed to interview a unique set of 286

Presidential Green Chemistry Challenge: 2003 Greener Reaction Conditions Award

Science.gov (United States)

Presidential Green Chemistry Challenge 2003 award winner, DuPont, developed a genetically engineered microorganism jointly with Genencor International to manufacture 1,3-propanediol, a building block for Sorona polyester.

Teekonnad tajutunnelites / Aita Kivi

Index Scriptorium Estoniae

Kivi, Aita, 1954-

2001-01-01

Sisu : Siri Hustvedt. Pimesi; Boris Vian. Päevade vaht; Christian Lore Weber. Altarimuusika; Kurt Vonnegut. Kassikangas; Jean Sasson. Printsess Sultana tütred; Karen Robards. Senaatori naine; Matthias Johann Eisen. Näkid, kratid, luupainajad; Mats Traat. Harala elulood; Steven L. McKenzie. Kuningas Taavet; Sally Ward. Terane laps; Ted Hughes. Luuletused

International Water Center

Science.gov (United States)

The urban district of Nancy and the Town of Nancy, France, have taken the initiative of creating an International Center of Water (Centre International de l'Eau à Nancy—NAN.C.I.E.) in association with two universities, six engineering colleges, the Research Centers of Nancy, the Rhine-Meuse Basin Agency, and the Chamber of Commerce and Industry. The aim of this center is to promote research and technology transfer in the areas of water and sanitation. In 1985 it will initiate a research program drawing on the experience of 350 researchers and engineers of various disciplines who have already been assigned to research in these fields. The research themes, the majority of which will be multidisciplinary, concern aspects of hygiene and health, the engineering of industrial processes, water resources, and the environment and agriculture. A specialist training program offering five types of training aimed at university graduates, graduates of engineering colleges, or experts, will start in October 1984.

Bringing the DuPont Profitability Model to Extension

Science.gov (United States)

Roucan-Kane, Maud; Wolfskill, L. A.; Boehlje, Michael D.; Gray, Allan W.

2013-01-01

This article discusses a financial training program used by Deere and Company for almost 10 years. The objective is to describe the program and to discuss a pre-test/post-test methodology to test the effectiveness of a program for possible duplication by Extension. Results show that participants significantly improved from the pre-test to the…

Development of High Temperature Superconducting Josephson Junction Device Technology

National Research Council Canada - National Science Library

Myers, Kirsten

1998-01-01

The DuPont program was successful in generating useful knowledge about thallium cuprate materials, photoresist reflow processing, and radiant heater technology though it did not lead to a new junction technology...

International Students' Attitudes Towards Malaysian English Ethnolects

Science.gov (United States)

Khojastehrad, Shadi; Rafik-Galea, Shameem; Abdullah, Ain Nadzimah

2015-01-01

Language attitudes are learned and formed in our social environment through hearing others referring to certain groups or people's languages and cultures, and also by exposure to particular varieties spoken in the context. This might lead to stereotyping English and its native speakers (McKenzie, 2008). In this sense, it is pedagogically…

Public Affairs Training for the Army’s Officer Corps: Need or Neglect?

Science.gov (United States)

1983-06-06

Individual Research Project, No. AD-783-802. Carlisle Barracks, Pennsylvania, 1974. McKenzie, Colin . "A Look at the News Media." US Army War College Mono...SAID IN 1978 Cronkite, Walter. "On Value of Newspaper Training for TV Reporters." San Francisco Examiner and Chronicle. March 5, 1978, p. 38. Drury

Copper-promoted methylene C-H oxidation to a ketone derivative by O₂

DEFF Research Database (Denmark)

Deville, Claire; McKee, Vickie; McKenzie, Christine J.

2017-01-01

stoichiometric dpeo C-H oxidation is reminiscent of the previously observed catalysis of dpeo oxidation by Mn(ii) [C. Deville, S. K. Padamati, J. Sundberg, V. McKee, W. R. Browne, C. J. McKenzie, Angew. Chem., Int. Ed., 2016, 55, 545-549]. By contrast dpeo oxidation is not observed during complexation reactions...

Eluohtlik töö: globaalne üleskutse ajakirjanike turvalisuse kaitseks

Index Scriptorium Estoniae

Spindelegger, Michael

2012-01-01

Austria Vabariigi asekantsleri ja välisministri Michael Spindeleggeri ning Rahvusvahelise Pressiinstituudi (IPI) tegevdirektori Alison Bethel McKenzie ühine kommentaar selle aasta septembris ÜRO Inimõiguste Nõukogu poolt vastu võetud resolutsioonile ajakirjanike turvalisuse kohta ning ÜRO agentuuride juhtide koordinatsiooninõukogu poolt vastu võetud ajakirjanike turvalisust puudutavast tegevusplaanist

Factors influencing academic success or failure of first-year and ...

African Journals Online (AJOL)

Erna Kinsey

countries, such as Australia and the USA, where there is strong com- petition for university entrance. There is some research support for this practice (e.g. McKenzie & Schweitzer, 2001) but, in general, the ability of these techniques to predict student success has been quite limited (Riggs & Riggs, 1990-91; Graham, 1991).

77 FR 51739 - Approval and Promulgation of Implementation Plans; Tennessee; Regional Haze State Implementation...

Science.gov (United States)

2012-08-27

... Tennessee: (1) Aluminum Company of America (Alcoa)--South Plant; (2) DuPont White Pigment and Mineral... reductions than BART (i.e., dispersion modeling is not required to evaluate the differences in visibility...

Singularity and medicine: is there a place for heteronomy in medical ethics?

Science.gov (United States)

Devisch, Ignaas; Vanheule, Stijn

2014-12-01

In medicine and in clinical practice, autonomy is opposed to heteronomy or paternalism. While autonomy comes down to free choice, independence or self-fulfillment, heteronomy or paternalism are associated with restraints from outside, lack of free choice or dependence. Despite several mediating concepts such as relational autonomy, this opposition stands firm in medical discourse. Reflecting upon his own heart transplantation but also falling back upon the whole of his oeuvre, we want to analyze what the impact of Nancy's thought can be on the concept of autonomy in medicine. As in Nancy's theory, autonomy and heteronomy are intertwined, how then to understand the autonomous individual in a clinical context? Nancy developed in his book Corpus, the untranslatable French word 'expeausition' to express the exposure of surfaces to one another - playing on the term 'exposition': 'peau', in French, means skin. Skin is literally exposed to contact with another skin or surface. Such exposure and such contact is 'world' he argues, in the same way that a product exchange between two people is. Heteronomy therefore is constitutive for autonomy, not a restraint of it. Analyzed from the work of French philosopher Jean-Luc Nancy, there is no such thing as autonomy because every 'self' or 'I' is always already intruded by something from outside. There is no autonomy without heteronomy, he argues and he therefore prefers to speak of an individual as being exposed to the outer world. © 2014 John Wiley & Sons, Ltd.

Field to fuel: developing sustainable biorefineries.

Science.gov (United States)

Jenkins, Robin; Alles, Carina

2011-06-01

Life-cycle assessment (LCA) can be used as a scientific decision support technique to quantify the environmental implications of various biorefinery process, feedstock, and integration options. The goal of DuPont's integrated corn biorefinery (ICBR) project, a cost-share project with the United States Department of Energy, was to demonstrate the feasibility of a cellulosic ethanol biorefinery concept. DuPont used LCA to guide research and development to the most sustainable cellulosic ethanol biorefinery design in its ICBR project and will continue to apply LCA in support of its ongoing effort with joint venture partners. Cellulosic ethanol is a biofuel which has the potential to provide a sustainable solution to the nation's growing concerns around energy supply and climate change. A successful biorefinery begins with sustainable removal of biomass from the field. Michigan State University (MSU) used LCA to estimate the environmental performance of corn grain, corn stover, and the corn cob portion of the stover, grown under various farming practices for several corn growing locations in the United States Corn Belt. In order to benchmark the future technology options for producing cellulosic ethanol with existing technologies, LCA results for fossil energy consumption and greenhouse gas (GHG) emissions are compared to alternative ethanol processes and conventional gasoline. Preliminary results show that the DuPont ICBR outperforms gasoline and other ethanol technologies in the life-cycle impact categories considered here.

78 FR 5774 - Materials Technical Advisory Committee; Notice of Partially Closed Meeting

Science.gov (United States)

2013-01-28

.... Remarks from BIS senior management. 3. Presentation by DuPont on the impact of Australia Group and.... 5. Report on regime-based activities. 6. Public comments and new business. 7. Request for volunteers...

Integrating evidence into practice: use of McKenzie-based treatment for mechanical low back pain

Directory of Open Access Journals (Sweden)

Clarke S

2011-11-01

Full Text Available Angela Dunsford1, Saravana Kumar1,2, Sarah Clarke1 1International Centre for Allied Health Evidence, 2School of Health Sciences, University of South Australia, Adelaide, South Australia, Australia Abstract: Low back pain (LBP is a major health issue with significant socioeconomic implications in most Western countries. Many forms of treatment have been proposed and investigated in the past, with exercise being a commonly prescribed intervention. Within allied health, in particular physiotherapy, there has been a growing movement that recognizes the role of the McKenzie method in treating LBP. Within the McKenzie framework, directional preference (DP exercises are one such intervention, with preliminary data demonstrating its effectiveness in the management of LBP. In this paper, we aim to integrate the evidence from current research, identified using a systematic review, and utilize a practical real-life case scenario to outline how evidence from the literature can be implemented in clinical practice. The findings from the systematic review indicate that DP exercises may have positive effects in the management of LBP. While the body of evidence to support this is limited (only four studies and therefore modest at best, it does provide some emerging evidence to support the use of DP exercises in clinical practice. Despite this, gaps also persist in the literature on DP exercises, and this relates to the exercise parameters and the compliance rates. Recognizing this dichotomy (modest evidence in some areas and evidence gaps in other areas, which is likely to confront health practitioners, using a practical approach with a real-life clinical scenario, we outline how the evidence from the systematic review can be implemented in clinical practice. This approach builds on the philosophy of evidence-based practice of integrating research evidence with clinical expertise and patient values. Keywords: low back pain, McKenzie method, directional

La comunidad del naciente : por una biopolítica afirmativa del exceso

OpenAIRE

Gómez Montañez, César Mario

2010-01-01

Quisiéramos, en respuesta a Jean-Luc Nancy, arriesgar un desarrollo de la cuestión de la comunidad que, a su vez, nos permita resignificar la individualidad y la inmanencia. En otras palabras, se trata de rearticular individuo y comunidad desde nuevos supuestos. La cuestión es retomar el tono extático que demanda Nancy, esa figura del exceso propuesta por Bataille, y evidenciarlo en el modelo que propone Gilbert Simondon para la individuación, y Roberto Esposito para la communitas. El trabajo...

Vulnerability of water supply from the Oregon Cascades to changing climate: linking science to users and policy

Science.gov (United States)

Kathleen A. Farley; Christina Tague; Gordon E. Grant

2011-01-01

Despite improvements in understanding biophysical response to climate change, a better understanding of how such changes will affect societies is still needed. We evaluated effects of climate change on the coupled human-environmental system of the McKenzie River watershed in the Oregon Cascades in order to assess its vulnerability. Published empirical and modeling...

Containment technology and the success of a joint initiative

International Nuclear Information System (INIS)

Campbell, H.J. Jr.

1997-01-01

This paper describes the efforts of the DuPont Company and DOE on containment of pollution. A test program at the Groundwater Remediation Field Laboratory National Test Site at Dover Air Force Base is discussed

Managers’ perspectives: practical experience and challenges associated with variable-density operations and uneven-aged management

Science.gov (United States)

Kurtis E. Steele

2013-01-01

Variable-density thinning has received a lot of public attention in recent years and has subsequently become standard language in most of the Willamette National Forest’s timber management projects. Many techniques have been tried, with varying on-the-ground successes. To accomplish variable-density thinning, the McKenzie River Ranger District currently uses...

Kaubakategooriate juhtimine annab konkurentide ees eelise / Marika Merilai

Index Scriptorium Estoniae

Merilai, Marika

2008-01-01

Tootekategooriate või ka kaubakategooriate juhtimine on ettevõtte äristrateegia, mis võimaldab jaekaubandusettevõttel saavutada konkurentidest paremaid tulemusi. Kanada turundusprofessori Brent McKenzie sõnul on kaubakategooriate juhtimine keeruline, kuna pole olemas ühte standardset lahendust, kuidas ettevõttes kategooriate juhtimist teostada. Skeem: Kaubakategooriate juhtimise eesmärgid. Kommenteerib ASi A-Selver sortimendijuht Agi Metsandi

[The alpine garden of Monthabey in Vosges (1903-1914) and his creator, professor Camille Brunotte (1860-1910)].

Science.gov (United States)

Labrude, Pierre

2002-01-01

At the beginning of the XXth century, professor Brunotte, of the school of pharmacy of Nancy, and the section vosgienne de Nancy du Club alpin français, undertook the creation of an alpine garden, in the Vosges, near the col de la Schlucht and le Hohneck, near also with the frontier with Germany. After the death of professor Brunotte, in 1910, the garden was given to the University of Nancy and completed until 1914, but the 1st World War destroyed it completely and it was impossible to recreate it. 1966 was the year of the creation of a new garden, not far from Monthabey, along the route des Crêtes, with a monument devoted to Monthabey garden and its promoter. The paper describes the creation of the first garden, the personality and career of professor Brunotte, its garden after his death and after the war, the precursors in botany of the Vosges Kirschleger and Bleicher, the new garden at Haut-Chietlet, finally the memories of professor Brunotte.

Smear of duodenal fluid aspirate

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. Dupont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Fritsche TR, Pritt BS. ...

On-line retailing : a Canadian perspective / Brent McKenzie

Index Scriptorium Estoniae

McKenzie, Brent

2001-01-01

Kaanel ajak. ilmumisaeg Winter 2001/2002. Kanadas on interneti teel ostjaid alla 2% neist, kes vastavaid interneti-lehekülgi külastavad. Konservatiivset suhtumist saab aga muuta, kui pakkuda head ja turvalist teenust ning kaupa hea hinnaga

On-line retailing : a Canadian perspective / Brent McKenzie

Index Scriptorium Estoniae

McKenzie, Brent

2002-01-01

Kaanel ajak. ilmumisaeg 2001/2002. Kanadas on interneti teel ostjaid alla 2% neist, kes vastavaid interneti-lehekülgi külastavad. Konservatiivset suhtumist saab aga muuta, kui pakkuda head ja turvalist teenust ning kaupa hea hinnaga

Testing Consent Order for Sodium Cyanide

Science.gov (United States)

This document announces that EPA has signed an enforceable testing Consent Order with E.I. du Pont de Nemours and Company (DuPont), FMC Corporation (FMC), Degussa Corporation (Degussa), ICI Americas Incorporated (ICI), and Cyanco Company (Cyanco).

Fecal smear

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... AI, eds. Goldman's Cecil Medicine . 25thed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

Culture - colonic tissue

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Hall GS, Woods GL. ...

Shigellosis

Science.gov (United States)

... Nelson Textbook of Pediatrics . 20th ed. Philadelphia, PA: Elsevier; 2016:chap 340. DuPont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

Fecal culture

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... AI, eds. Goldman's Cecil Medicine . 25thed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... has been rented. This feature is not available right now. Please try again later. Published on Jan ... duPont Hospital for Children - Duration: 3:34. Nemours 1,093 views 3:34 Portraits of Life, Love & ...

Process waste assessment for the Radiography Laboratory

International Nuclear Information System (INIS)

Phillips, N.M.

1994-07-01

This Process Waste Assessment was conducted to evaluate the Radiography Laboratory, located in Building 923. It documents the processes, identifies the hazardous chemical waste streams generated by these processes, recommends possible ways to minimize waste, and serves as a reference for future assessments of this facility. The Radiography Laboratory provides film radiography or radioscopy (electronic imaging) of weapon and nonweapon components. The Radiography Laboratory has six x-ray machines and one gamma ray source. It also has several other sealed beta- and gamma-ray isotope sources of low microcurie (μCi) activity. The photochemical processes generate most of the Radiography Laboratory's routinely generated hazardous waste, and most of that is generated by the DuPont film processor. Because the DuPont film processor generates the most photochemical waste, it was selected for an estimated material balance

Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río

Directory of Open Access Journals (Sweden)

Isabel Pérez Hernández

2009-12-01

Full Text Available El trabajo titulado "Propuesta de un sistema actividades didáctico medio ambientales que contribuya a la formación ambiental en los alumnos de primer año de la EPEF “Nancy Uranga Romagoza” de la provincia Pinar del Río”, constituye una extensión del Proyecto Investigativo Medio Ambiente y Deportes; el mismo tiene como finalidad contribuir al mejoramiento de la formación ambiental de los jóvenes y profesores, a través de la puesta en práctica de un sistema de actividades. Este proyecto ha de lograr que los jóvenes participen como agentes transformadores de cambio al modificar roles, actuaciones y conductas hacia el medio ambiente, lográndose una mejoría en la calidad de vida en los mismos y que se irradie al resto de la comunidad. Este conjunto de acciones sustentadas en vías formales, no formales e informales con un enfoque teórico metodológico, posibilitan el reconocimiento de prácticas ambientales sostenibles, desde una concepción dialéctica La formación ambiental en los estudiantes tendrá una repercusión significativa a partir de que los futuros egresados incidirán favorablemente en la actuación de las comunidades propiciando elementos de base para la ejecución de proyectos sostenibles ecológicamente y económicamente viables.

RESONANCE----I--Ju-ne

Indian Academy of Sciences (India)

work there emerged the concepts of functionality ... Copyright 19S0 American Chemi- ... hired by DuPont, and assigned to work in Carothers' group. .... In the Flory model, the application of stress, e.g., ... research institute, and academic activity.

Appendix 2: Risk-based framework and risk case studies. Risk assessment for wildfire in the Western United States.

Science.gov (United States)

David L. Peterson; Jeremy S. Littell

2012-01-01

Wildfire is one of the two most significant disturbance agents (the other being insects) in forest ecosystems of the Western United States, and in a warmer climate, will drive changes in forest composition, structure, and function (Dale et al. 2001, McKenzie et al. 2004). Although wildfire is highly stochastic in space and time, sufficient data exist to establish clear...

End of project report on degradation processes in hydrogen fuel cells.

Science.gov (United States)

2008-01-01

Proton exchange membrane (PEM) fuel cells are one of the most popular types of fuel cells. They operate similarly to others with the electrolyte material inbetween the electrodes being a patented polymer called Nafion, made by DuPont. This polyelec...

Dupont Analysis of An Information Technology Enabled Competitive Advantage

OpenAIRE

Nustini, Yuni

2009-01-01

The transformation of business caused by e-business and e-commerce applications of the internet and related technologies demonstrates that information systems and information technologies are essential ingredients for business survival and success. The most often cited benefit of IT are integrating business process, increasing efficiency, sales, productivity, and competitiveness. This study is designed for determining where managers considering investment in information technology (IT) projec...

Dupont Analysis of an Information Technology Enabled Competitive Advantage

OpenAIRE

Nustini, Yuni

2003-01-01

The transformation of business caused by e-business and e-commerce applications of the internet and related technologies demonstrates that information systems and information technologies are essential ingredients for business survival and success. The most often cited benefit of IT are integrating business process, increasing efficiency, sales, productivity, and competitiveness. This study is designed for determining where managers considering investment in information technology (IT) projec...

A Decomposition of Hospital Profitability

Directory of Open Access Journals (Sweden)

Jason Turner

2015-06-01

Full Text Available Objectives: This paper evaluates the drivers of profitability for a large sample of U.S. hospitals. Following a methodology frequently used by financial analysts, we use a DuPont analysis as a framework to evaluate the quality of earnings. By decomposing returns on equity (ROE into profit margin, total asset turnover, and capital structure, the DuPont analysis reveals what drives overall profitability. Methods: Profit margin, the efficiency with which services are rendered (total asset turnover, and capital structure is calculated for 3,255 U.S. hospitals between 2007 and 2012 using data from the Centers for Medicare & Medicaid Services’ Healthcare Cost Report Information System (CMS Form 2552. The sample is then stratified by ownership, size, system affiliation, teaching status, critical access designation, and urban or non-urban location. Those hospital characteristics and interaction terms are then regressed (OLS against the ROE and the respective DuPont components. Sensitivity to regression methodology is also investigated using a seemingly unrelated regression. Results: When the sample is stratified by hospital characteristics, the results indicate investor-owned hospitals have higher profit margins, higher efficiency, and are substantially more leveraged. Hospitals in systems are found to have higher ROE, margins, and efficiency but are associated with less leverage. In addition, a number of important and significant interactions between teaching status, ownership, location, critical access designation, and inclusion in a system are documented. Many of the significant relationships, most notably not-for-profit ownership, lose significance or are predominately associated with one interaction effect when interaction terms are introduced as explanatory variables. Results are not sensitive to the alternative methodology. Conclusion: The results of the DuPont analysis suggest that although there appears to be convergence in the behavior of

A Decomposition of Hospital Profitability

Science.gov (United States)

Broom, Kevin; Elliott, Michael; Lee, Jen-Fu

2015-01-01

Objectives: This paper evaluates the drivers of profitability for a large sample of U.S. hospitals. Following a methodology frequently used by financial analysts, we use a DuPont analysis as a framework to evaluate the quality of earnings. By decomposing returns on equity (ROE) into profit margin, total asset turnover, and capital structure, the DuPont analysis reveals what drives overall profitability. Methods: Profit margin, the efficiency with which services are rendered (total asset turnover), and capital structure is calculated for 3,255 U.S. hospitals between 2007 and 2012 using data from the Centers for Medicare & Medicaid Services’ Healthcare Cost Report Information System (CMS Form 2552). The sample is then stratified by ownership, size, system affiliation, teaching status, critical access designation, and urban or non-urban location. Those hospital characteristics and interaction terms are then regressed (OLS) against the ROE and the respective DuPont components. Sensitivity to regression methodology is also investigated using a seemingly unrelated regression. Results: When the sample is stratified by hospital characteristics, the results indicate investor-owned hospitals have higher profit margins, higher efficiency, and are substantially more leveraged. Hospitals in systems are found to have higher ROE, margins, and efficiency but are associated with less leverage. In addition, a number of important and significant interactions between teaching status, ownership, location, critical access designation, and inclusion in a system are documented. Many of the significant relationships, most notably not-for-profit ownership, lose significance or are predominately associated with one interaction effect when interaction terms are introduced as explanatory variables. Results are not sensitive to the alternative methodology. Conclusion: The results of the DuPont analysis suggest that although there appears to be convergence in the behavior of NFP and IO

Natural Phenomena Hazards Design Criteria and Other Characterization Information for the MFFF at SRS

Energy Technology Data Exchange (ETDEWEB)

Wyatt, D.E.

2000-12-01

This report is a comprehensive complication applicable to the general Savannah River Site area, developed by both the original contractor, the DuPont Company, and by the current plant operator, Westinghouse Savannah River Company, over the full plant lifetime period (1950 - 2000).

Translating DWPF design criteria into an engineered facility design

International Nuclear Information System (INIS)

Kemp, J.B.

1986-01-01

The Defense Waste Processing Facility (DWPF) takes radioactive defense waste sludge and the radioactive nuclides, cesium and strontium, from the salt solution, and incorporates them in borosilicate glass in stainless steel canisters, for subsequent disposal in a deep geologic repository. The facility was designed by Bechtel National, Inc. under a subcontract from E.I. DuPont de Nemurs and Co., the prime contractor for the Department of Energy, for the design, construction and commissioning of the plant. The design criteria were specified by the DuPont Company, based upon their extensive experience as designer, and operator since the early 1950's, of the existing Savannah River Plant facilities. Some of the design criteria imposed unusual or new requirements on the detailed design of the facilities. This paper describes some of these criteria, encompassing several engineering disciplines, and discusses the solutions and designs which were developed for the DWPF

Materialidad del texto, textualidad del libro

Directory of Open Access Journals (Sweden)

Roger Chartier

2005-11-01

Full Text Available This text wishes to show, through the case of Quixote, that the study of the conditions around text publishing and its sense understanding cannot be separated. The intercrossing between the history of the book (and printing and the sociology of texts as defined by D. F. McKenzie, seeks the possibility of overcoming the long-lasting and mutilating division between hermeneutics and bibliography.

Interaction of Microbial and Abiotic Processes in Soil Leading to the (Bio)Conversion and Ultimate Attenuation of New Insensitive Munitions Compounds

Science.gov (United States)

2016-12-30

adenine dinucleotide (phosphate) NC Camp Butner soil (alternative abbreviation, soil is from North Carolina) NCBI National Center for Biotechnology ...knowledge and perspectives of bioelimination of xenobiotic compounds. Journal of Biotechnology 51, 287-295, doi:http://dx.doi.org/10.1016/S0168...McKenzie, R. M. The synthesis of birnessite, cryptomelane, and some other oxides and hydroxides of manganese. Mineralogical Magazine 38, 493-502

77 FR 3774 - Formations of, Acquisitions by, and Mergers of Bank Holding Companies

Science.gov (United States)

2012-01-25

..., Dupont, Indiana. River Valley Financial Bank, Madison, Indiana, the existing thrift subsidiary of... FEDERAL RESERVE SYSTEM Formations of, Acquisitions by, and Mergers of Bank Holding Companies The companies listed in this notice have applied to the Board for approval, pursuant to the Bank Holding Company...

The moral challenge of green technology / Aarne P Vesilind, Lauren Heine, Jamie Hendry

Index Scriptorium Estoniae

Vesilind, Aarne P

2006-01-01

Autorid leiavad, et rohelise tehnoloogia kasutuselevõtu ja ettevõtete kasumi teenimise vastuseisu korral võidab kasumlikkus ning reguleerimata vaba turu süsteem ei toeta jätkusuutlikku arengut. Käsitletakse ettevõtte DuPont tegevdirektori Chad Holliday otsust jätkata tulutoova toote Teflon tootmist

Elastomeric Materials for Acoustical Applications

Science.gov (United States)

1989-09-15

fluorine . The classes of materials marketed as Fluorel and Viton by 3M and DuPont, respectively, are copolymers of vinylidene fluoride and...Street Sullivan Varnish Co. Chicago, IL 60632 420 N. Hiart Street- (312) 523-1412 Chicago, IL 60622 (312) 666-8080 Testworth Laboratories, Inc. 139

Taking Care of Business: Walter Carpenter and the Management of American Enterprise.

Science.gov (United States)

Cheape, Charles W.

1996-01-01

Evaluates the life and career of DuPont corporate executive, Walter Carpenter, and uses it to illustrate the rise of the managerial class. Neither owners nor entrepreneurs, managers like Carpenter used their intelligence and skill to reorganize and expand the companies the companies where they worked. (MJP)

75 FR 68802 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

Science.gov (United States)

2010-11-09

...: Renaissance Washington, DC Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status... workgroups: Communications, Health Information Technology, and Evidence Review; (2) a report from a National... make a comment are requested to register online by Tuesday, January 25, 2011, at http://altarum.cvent...

Henri Poincaré: Death centenary (1854-1912)

Science.gov (United States)

Heinzmann, Gerhard; Villani, Cédric

2014-08-01

The year 2012 marked the centenary of the death of Henri Poincaré (Nancy, 1854-Paris, 1912), and through the agency of the Henri-Poincaré Institute in Paris, the Henri-Poincaré Archives in Nancy and The London Mathematical Society, brought with it several exhibitions and meetings commemorating one of the greatest minds in contemporary times. Often referred to as the last polymath, Poincaré embraced multiple branches of mathematics, theoretical physics and celestial mechanics, and made significant contributions to philosophy of science (Heinzmann & Stump, Henri Poincaré, 2013). He wrote 25 textbooks and monographs, 500-plus articles, and was deeply involved in the organization and administration of science at both the national and international levels.1

A Stretchable Radio-Frequency Strain Sensor Using Screen Printing Technology.

Science.gov (United States)

Jeong, Heijun; Lim, Sungjoon

2016-11-02

In this paper, we propose a stretchable radio-frequency (RF) strain sensor fabricated with screen printing technology. The RF sensor is designed using a half-wavelength patch that resonates at 3.7 GHz. The resonant frequency is determined by the length of the patch, and it therefore changes when the patch is stretched. Polydimethylsiloxane (PDMS) is used to create the substrate, because of its stretchable and screen-printable surface. In addition, Dupont PE872 (Dupont, NC, American) silver conductive ink is used to create the stretchable conductive patterns. The sensor performance is demonstrated both with full-wave simulations and with measurements carried out on a fabricated sample. When the length of the patch sensor is increased by a 7.8% stretch, the resonant frequency decreases from 3.7 GHz to 3.43 GHz, evidencing a sensitivity of 3.43 × 10⁷ Hz/%. Stretching the patch along its width does not change the resonant frequency.

Hot topic - fire resistant clothing for electrical workers has no Canadian standard

Energy Technology Data Exchange (ETDEWEB)

Douglas, R

1996-07-01

Fabrics which could be used for protective clothing for electrical workers was discussed. In Canada there are no stringent clothing rules for the electrical industry, but in the United States, the Federal Occupational Safety and Health Administration (OSHA) have made protective clothing an issue within the industry. Dupont`s Nomex, Westex`s Indura, and Hoechst Celanese`s PBI fibres are among the materials which have been through a series of thermal protection tests and are based on proven materials which are now being applied to work wear. The testing standards cover the ignition of the basic materials, untreated cottons, wools, and the thermal protection of flame resistant materials. The final tests are based on high current arc tests conducted on the fabrics used in the industry. These tests are now being conducted at Ontario Hydro`s High Current Test Facility preliminary to a Canadian standard being formulated and proposed in the very near future. 2 figs.

Mach-6 Receptivity Measurements of Laser-Generated Perturbations on a Flared Cone

Science.gov (United States)

2014-08-01

Shann Rufer, thank you for the guidance, the support, the living space, and of course, the wine and cheese! My fellow co-ops at NASA Langley...vorticity wave is given by McKenzie et al. [26] as tan θt = c M2n M1n tan θi (6.1) where c = a2/a1 and a indicates the speed of sound in the region

Rethinking Social Justice and Adult Education for Welcoming, Inclusive Communities: Synthesis of Themes

Science.gov (United States)

Lange, Elizabeth; Baillie Abidi, Catherine

2015-01-01

This chapter summarizes the key themes across the articles on transnational migration, social inclusion, and adult education, using Nancy Fraser's framework of redistributive, recognitive, and representational justice.

Comparison of survival and toxicities of concurrent radiotherapy with Carboplatin/Paclitaxel or Cisplatin/Etoposide in unresectable stage III non-small cell lung cancers: retrospective analysis in the Department of Pneumology of CHU Nancy between 2008 and 2014

International Nuclear Information System (INIS)

Huet, Dimitri

2015-01-01

In concomitant chemo-radiotherapy treatment for inoperable stage III NSCLC, different combinations of chemotherapies have been recommended. The objective of this study was to compare progression-free survival, overall survival, and tolerability of two treatment regimens: Cisplatin-etoposide concomitant radio-chemotherapy versus concomitant carboplatin-Paclitaxel based radio-chemotherapy in these patients. A retrospective analysis of 62 patients treated with concomitant radio-chemotherapy for inoperable stage III NSCLC has been carried out in the Department of Pneumology (University Hospital of Nancy). The patients were divided into 2 groups according to the chemotherapy protocol, group 1: Cisplatin-etoposide (27 patients) and group 2: Carboplatin-Paclitaxel (35 patients). The two groups were comparable in terms of age and gender (mean age 58 in group 1 versus age 61 in group 2, and 85 pc of men in group 1 versus 80 pc in group 2). The median overall survival was 19 months in group 1 versus 15.3 months in group 2 (p = 0.22). The median progression-free survival was higher in group 1, 9 months versus 3.3 months in group 2 (p = 0.01). Hematologic toxicity was higher in group 1 than in group 2 (neutropenia 85.2 pc versus 54.3 pc, p = 0.01, anemia 92.3 pc versus 54.3 pc, p = 0.001). Radiation esophagitis and radiation pneumonitis rates were higher in group 1 than in group 2: 44.4 pc versus 11.4 pc (p = 0.01), and 44.4 pc versus 11.4 pc (p = 0.001) respectively. In this mono-centric and retrospective study, the Cisplatin-etoposide - thoracic radiotherapy combination to treat inoperable stage III NSCLC was associated with a significantly higher progression-free survival than the Carboplatin-Paclitaxel-radiotherapy combination. This increase in survival was accompanied by a significantly higher hematological and organ toxicity [fr

Local Strain Measurement of Kevlar Strand with Fiber Optic Bragg Grating

Science.gov (United States)

Banks, Curtis E.; Grant, Joseph; Russell, Sam; Arnett, Shawn

2008-01-01

1987 DuPont manufactured 4560 denier Kevlar/Epoxy Strands were instrumented with nine and three sensors each. Stress tests were performed at 30,45,60,70 and 80% of ultimate strength with dwell times of 10,000 seconds. FBG showed uneven stress levels which is contrary to conventional observation.

75 FR 17929 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

Science.gov (United States)

2010-04-08

...: Renaissance Washington, DC Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status...: The meeting will include: (1) A presentation of the External Review Workgroup's final report on the... of the meeting. Those individuals who want to make a comment are requested to register online by...

76 FR 81496 - Product Cancellation Order for Certain Pesticide Registrations

Science.gov (United States)

2011-12-28

.... ID990017 Starane Fluroxypyr. IL080001 Tree-Age Emamectin benzoate. IN080001 Tree-Age Emamectin benzoate.... KY090029 Tree-Age Emamectin benzoate. MD090001 Tree-Age Emamectin benzoate. ME080002 Dupont Coragen... Pirimiphos-methyl. Insecticide. MI080001 Tree-Age Emamectin benzoate. MI980002 Transline 3,6-Dichloro-2...

Cobordism Obstructions to Vector Fields and a Generalization of Lin's Theorem

DEFF Research Database (Denmark)

Svane, Anne Marie

Atiyah and Dupont have studied the existence of linearly independent vector fields on manifolds by means of K-theory. They obtained the complete conditions for up to three independent vector fields. In the thesis, we try to copy their approach using certain spectra related to cobordism theory. We...

Fungos anamorfos (hyphomycetes da Floresta Nacional de Caxiuanã, Pará, Brasil: novos registros para o Neotrópico Anamorphic fungi (hyphomycetes from Caxiuanã National Forest, Pará, Brazil: new records for the Neotropics

Directory of Open Access Journals (Sweden)

Josiane Santana Monteiro

2010-09-01

Full Text Available Os hifomicetos são importantes decompositores e recicladores da matéria orgânica morta no ambiente e podem ser importantes patógenos de plantas e animais. Como parte do inventário da diversidade dos fungos sobre palmeiras da Amazônia Oriental, no sítio do Programa de Biodiversidade da Amazônia (PPBIO, na Floresta Nacional de Caxiuanã, Pará, foram identificados cinco novos registros de hifomicetos para o Neotrópico: Camposporium fusisporum Whitton, McKenzie & Hyde; Cylindrocarpon curtum Bugnicourt; Minimidochium microsporum Matsush.; Sporidesmiella aspera Kuthub. & Nawawi; Sporidesmium ghanaense M.B. Ellis. Stachybotrys theobromae Hansf. é citado pela primeira vez para o Brasil.The hyphomycetes are important decomposers and recyclers of dead organic matter in the environment and may be important pathogens of plants and animals. As part of the diversity inventory of palm-tree fungi from Eastern Amazonia, in Caxiuanã National Forest, Pará, five new records of hyphomycetes for the Neotropics were found: Camposporium fusisporum Whitton, McKenzie & Hyde; Cylindrocarpon curtum Bugnicourt; Minimidochium microsporum Matsush.; Sporidesmiella aspera Kuthub. & Nawawi; Sporidesmium ghanaense M.B. Ellis. Stachybotrys theobromae Hansf. is cited for the first time for Brazil.

Vaidlused või monoloogid? / Redi Koobak, Raili Põldsaar

Index Scriptorium Estoniae

Koobak, Redi

2006-01-01

Arvustus: Feministlikud vaidlused : filosoofiline mõttevahetus / [Seyla Benhabib, Judith Butler, Nancy Freiser, Drucilla Cornell] ; inglise keelest tõlkinud Merilin Sikk ; [koostaja Linda Nicholson]. Tallinn : Tallinna Ülikooli Kirjastus, 2006

Circumventing Therapeutic Resistance and the Emergence of Disseminated Breast Cancer Cells Through Non-Invasive Optical Imaging

Science.gov (United States)

2015-06-01

Investigator (1992-1994); National Science Foundation Young Investigator (1993-1998); E. I. DuPont de Nemours Young Faculty Award (1995-1997); Alfred P. Sloan...address of the Funding Agency’s Procuring Contracting/Grants Officer: Amber Stilh·ich U.S . Almy Medical Resem·ch Acquisition Activity, 820 Chandler

77 FR 47047 - Biomass Research and Development Technical Advisory Committee

Science.gov (United States)

2012-08-07

... Committee Act (Public Law No. 92-463, 86 Stat. 770) requires that agencies publish these notices in the.... ADDRESSES: Renaissance DuPont Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. FOR FURTHER...: In keeping with procedures, members of the public are welcome to observe the business of the Biomass...

76 FR 17140 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

Science.gov (United States)

2011-03-28

...: Renaissance Washington, DC, Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status... Act of 2008. Agenda: The meeting will include: (1) A presentation of the External Review Workgroup's... individuals who want to make oral comments are requested to register online by Tuesday, May 3, 2011 at http...

Tumedad tungid pilkases öös / Andres Maimik

Index Scriptorium Estoniae

Maimik, Andres, 1970-

1999-01-01

Pimedate Ööde III filmifestivalil Tallinnas näidatavast kolmest mängufilmist :"Püssirohutünn": režissöör Goran Paskaljevic : Jugoslaavia ; "Inimlikkus" : režissöör Bruno Dupont : Prantsusmaa : "eXistenZ" : režissöör David Cronenberg : Kanada - Suurbritannia

Mechanistic insights into the hydrocyanation reaction

NARCIS (Netherlands)

Bini, L.

2009-01-01

The hydrocyanation of an alkene is a catalytic carbon-carbon bond formation reaction and the obtained nitriles can be converted into a variety of valuable products. The investigation of this reaction has mainly focused on the DuPont adiponitrile (AdN) process. This process is so far the only example

Integrated Multidisciplinary Design of High Pressure Multistage Compressor Systems (la Conception integree des compresseurs multi-etage a haute performance)

Science.gov (United States)

1998-09-01

development ONERA and SNECMA and is described in [Nicoud, 91]. This methodology [ Karadimas , 1997]. The aim of all efforts method solves the Quasi-3D...computer power, 1994 2-11 BERTHILLIER, M., DUPONT, C., MONDAL, R., KARADIMAS , G. : New Ways for the Design the BARRAU, J.J. : Blade Forced Response

Review of 'Education in Parapsychology: Student and Instructor Perspectives' by Harvey Irwin

OpenAIRE

Roe, Chris A

2014-01-01

Book review of Education in Parapsychology: Student and Instructor Perspectives by Harvey Irwin. Foreword by Nancy\\ud Zingrone. Gladesville, NSW, Australia: AIPR Mongraphs, 2013. Pp xv + 106. (paperback). ISBN 9780987077219.

New evidence for the asthenospheric origin of the Cameroon Volcanic Line from 1D shear wave velocities

CSIR Research Space (South Africa)

Tokam, AP

2013-10-01

Full Text Available the mantle composition beneath Ethiopia and southern Brazil (Keranen et al., 2009; Julia et al., 2008). Many petrological studies of ultramafic orogenic massifs and ultramafic xenoliths along the CVL (mainly around Mount Cameroon and the Adamawa....N. and Oya, M. 2010. Petrological and chemical variability of peridotite xenoliths from the Cameroon Volcanic Line, West Africa: an evidence from Plume emplacement. Journal of Mineralogical and Petrological Sciences, 107, 57-69. McKenzie, D...

Critical appraisal of the Spanner™ prostatic stent in the treatment of prostatic obstruction

OpenAIRE

McKenzie, Patrick; Badlani, Gopal

2011-01-01

Patrick McKenzie1, Gopal Badlani11Department of Urology, Wake Forest University School of Medicine, Winston-Salem NC, USAAbstract: The Spanner™ stent was first used in patients to relieve bladder outlet obstruction (BOO), and has recently been used in patients following transurethral microwave thermotherapy and men unfit for surgical intervention. We review the current literature on the role of the Spanner stent in treating prostatic obstruction compared to previously reported cases...

A century of Pharmaceutical and professorial presidency at the Societe lorraine de mycologie> (1911-2011).

Science.gov (United States)

Labrude, Pierre

2016-06-01

The society was created in 1911 at the Ecole supirieure de pharmacie of Nancy by professor Julien Godfrin wno was the chairman of the school and wno becamed its first president. But Godfrin died in 1913. The second president was Auguste Sartory who was extremely active in spite of the war but who leaved Nancy at its end to be named as a professor at the new school of pharmacy in Strasbourg. Four presidents followed each other during these years after Sartory: Pierre Seyot, Emile Steimetz, Pierre Lectard and Frangois Mortier. All of them were pharmacists and professors. During this century, the society was always associated to the school and to the faculty for the teaching of mycology to pharmacy students and other lovers.

78 FR 17403 - No FEAR Act Notice

Science.gov (United States)

2013-03-21

... INFORMATION CONTACT: Nancy Burnett, Acting Associate Director of the Office of Minority and Women Inclusion, [email protected] , (202) 649-3017; Brian Guy, Manager of EEO Services, [email protected] , (202...

Application of photopolymer holograms for the anticounterfeit protection of banknotes

Science.gov (United States)

Markova, Nina V.; Yamnikov, Leonid S.; Turkina, Elena S.; Semenov, Erick G.; Bulygin, Theodor V.; Levin, Gennady G.

1998-04-01

The article analyses holograms counterfeiting techniques and presents grounds for the choice of the optimum type of holograms best protected against counterfeiting -- volume holograms. There is a description of these holograms registration process on DuPont OmniDex photopolymer film and the analysis of the perspective of their use during banknotes production.

Energy policies and politics for sustainable world-system development

DEFF Research Database (Denmark)

Czeskleba-Dupont, Rolf

politics, put into perspective by (b) R.C.-Dupont 1993 as the movement of the US in a field of tension between eco- and geopolitics; and (c) a 2006 declaration of ten former environmental ministers to end the nuclear age and to reform the UN mandate of the International Atomic Energy Agency....

78 FR 65344 - Center for Scientific Review Amended Notice of Meeting

Science.gov (United States)

2013-10-31

... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Center for Scientific Review Amended Notice of Meeting Notice is hereby given of a change in the meeting of the Molecular Neuropharmacology and Signaling Study Section, October 7, 2013, 8:00 a.m. to October 8, 2013, 12:00 p.m., The Dupont...

78 FR 60296 - Center for Scientific Review; Notice of Closed Meetings

Science.gov (United States)

2013-10-01

... Review Group; Prokaryotic Cell and Molecular Biology Study Section. Date: October 25, 2013. Time: 8:00 a... for Scientific Review Special Emphasis Panel; Eye Diseases 6. Date: October 25, 2013. Time: 9:00 a.m..., Dupont Circle, 1143 New Hampshire Avenue NW., Washington, DC 20037. Contact Person: James P. Harwood Ph.D...

Systematic Characterization of the Immune Response to Gluten and Casein in Autism Spectrum Disorders. Revision

Science.gov (United States)

2013-08-01

tremendous effort on our part, we were unable to acquire enough serum volume for these assays. The price offered by AGRE at the time of acquisition (50 μL...1. Dupont FM, Vensel WH, Tanaka CK, Hurkman WJ, Altenbach SB (2011) Deciphering the complexities of the wheat flour proteome using quantitative two

78 FR 66752 - Center for Scientific Review; Amended Notice of Meeting

Science.gov (United States)

2013-11-06

... and Imaging Technologies Study Section, October 10, 2013, 07:45 a.m. to October 11, 2013, 06:00 p.m., Sheraton Delfina Santa Monica Hotel, 530 West Pico Boulevard, Santa Monica, CA 90405 which was published in... Renaissance Washington Dupont Circle Hotel, 1143 New Hampshire Ave. NW., Washington, DC 20037. The meeting...

77 FR 9687 - Endangered Species; Receipt of Applications for Permit

Science.gov (United States)

2012-02-17

... Comment Procedures A. How do I request copies of applications or comment on submitted applications? Send...: James Whipple & Nancy Nunke, Romona, CA; PRT-053952 The applicant requests amendment and renewal of his...

Vie-Nouvelle

African Journals Online (AJOL)

Chrystelle ATINKPAHOUN

influent of wastewater treatment plant, greywater, etc. (Kafi et al. ... pollutant loadings related to suspended solids, bound metal ... treatment system for the domestic wastewater. (greywater and ...... thesis, Polytechnic Institute of Lorraine,. Nancy ...

Jackpot Malle Leisilt

Index Scriptorium Estoniae

1998-01-01

6. jaanuarist Kastellaanimaja galeriis Malle Leisi suureformaadiliste maalide näitus "Jackpot". M. Leisi töid on mainekates kunstikogudes, s. h. New Jerseys Zimmerli kunstimuuseumis asuvas Nancy ja Norton Dodge'i kogus

Volunteering in the Elementary Outreach Program Could Make You Happier | Poster

Science.gov (United States)

By Marsha Nelson-Duncan, Guest Writer, and Nancy Parrish, Staff Writer Did you know that volunteers in the Elementary Outreach Program (EOP) just might be happier than their coworkers who don’t volunteer?

Police Killings and Police Deaths Are Public Health Data and Can Be Counted.

Science.gov (United States)

Krieger, Nancy; Chen, Jarvis T; Waterman, Pamela D; Kiang, Mathew V; Feldman, Justin

2015-12-01

Nancy Krieger and colleagues argue that law-enforcement-related deaths in the United States should be treated as notifiable conditions, which would allow public health departments to report these data in real-time.

Morphology and slip rate of the Hurunui section of the Hope Fault, South Island, New Zealand

International Nuclear Information System (INIS)

Langridge, R.M.; Berryman, K.R.

2005-01-01

The Hurunui section of the Hope Fault is a newly defined, 42 km long geomorphic fault section which extends from Harper Pass to the Hope-Boyle River confluence. Reconnaissance mapping along the Hurunui section from Hope Shelter to Harper Pass provided new data on its location, geomorphology, displacement, and slip rate. More than 200 previously published field observations of dextrally and vertically displaced landforms along the fault provide data on the distribution of displacement along the fault trace. Five radiocarbon dates found in association with offset geomorphic features are presented and two new measures of dextral slip rate are calculated. At McKenzie Stream, a late Holocene fan complex is cut by the Hope Fault. Young abandoned and active channels on this surface show dextral offsets of up to 22 ± 2 m along a south-facing scarp with a height of up to 5 m. Woody litter from a unit in this complex has yielded a radiocarbon age of 2331 ± 55 yr BP and a corresponding minimum horizontal slip rate of 8.1-11.0 mm/yr. At Macs Knob, large dextral deflections of stream catchments are linked to episodes of glacial resetting of the landscape. Correlation of the offset of 'Macs stream' (166 ± 17 m) with a post-Aranuian age peat (10,782 ± 60 yr BP) yields a maximum horizontal slip rate of 13.0 ± 1.5 mm/yr. The single-event dextral displacement, based on offset stream channels at McKenzie fan, is 3.2-3.8 m (av. c. 3.4 m). The ratio of dextral to vertical slip is c. 7 ± 2:1, indicating that the Hope Fault has a dominantly strike-slip sense of motion. The average recurrence interval for the last 5-7 events (i.e., to produce 19-24 m slip at McKenzie fan) is 310-490 yr. The age of the most recent surface-rupturing earthquake at this site is not known, though felt effects, fault scaling, and landscape arguments indicate it was not the AD 1888 North Canterbury earthquake. (author). 48 refs., 10 figs., 2 tabs

The Coast Artillery Journal. Volume 65, Number 4, October 1926

Science.gov (United States)

1926-10-01

THE PURITAN CONFECTIONERY PURE HOME MADE CANDIES AND ICE CREAM Home Made A/ter.Dinner Mints, Salted Almonds, and Whipping Cream a Specialty PHONE 856...fish hook, which device is shown on the coat of arms and portrays this event. In the battle of New Market , May 15, 1864, in which Captain DuPont (later

76 FR 12939 - Granular Polytetrafluoroethylene Resin From Italy: Final Results of Expedited Sunset Review of...

Science.gov (United States)

2011-03-09

... participate was filed by DuPont within the deadline specified in 19 CFR 351.218(d)(1)(i), as extended due to... producer of PTFE resin in the United States. On February 11, 2011, the Department received a substantive... extended due to the Correction Notice. We received no substantive responses from any respondent interested...

Veřejná podpora výzkumu a vývoje poskytovaná nepřímou formou v podmínkách malých a středních podniků s důrazem na informační zajištění

OpenAIRE

Filipová, Vladimíra

2011-01-01

Innovation is a critical factor of the economical development as it is the key source of a competitive advantage and brings an addend value of a concerete company (Zhang, 2O13); Technological innovation could be defined as an endogenous factor responding to economic challenges (McKenzie, 2OO8). Research and development provides innovations, whereas the production of research and development brings externalities. Externalities reduce the private return on investment as such, therefore research...

Proceedings of a Workshop on the Physical Properties of Volcanic Seafloor, Held at Woods Hole, Massachusetts on April 24-26, 1990

Science.gov (United States)

1990-04-26

sediment coring and heat flow survey (-* regional variation at srafloor) (suggest corridor north of Clipperton to - far enough to miss equatorial high...SAMPLE FROM SCAMOUNTS " PLATEAUS AND ASEIMIC RIDGES o OSOP SAMPLE FROM BEHIND 40 ISLAND ARCS 0 + OSOP SAMPLE OF SILL OR o MASSIVE FLOW Z 30 SOSCP SAMPLE...M. and McKenzie, D., 1987, Simple 2-D models of melt extraction at mid- ocean ridges and island arcs, Earth Planet. Sci. Lent., 83, 137-152. Verhoogen

NF -10-03-USVI Characterization of Seafloor Habitats of the U.S. Caribbean (EK60)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Center for Coastal Monitoring and Assessment (CCMA) will be conducting the eighth year of an ongoing scientific research mission onboard NOAA Ship Nancy Foster...

Does Capital Structure Influence Company Profitability?

Directory of Open Access Journals (Sweden)

Herciu Mihaela

2017-12-01

Full Text Available Every company has a different structure of balance sheet. Some of the companies have more liabilities than equity. Considering the industry or debt-to-equity ratio, the balance sheet structure affects the company profitability measured by DuPont system. The main objective of the paper is to analyze the structure of balance sheet and to identify some optimal levels in order to increase company profitability. The DuPont returns like ROA (return on assets and ROE (return on equity will be used to measure the company profitability, while the debt-to-equity ratio will be used as a measure (reflection of capital structure. The samples consist on the most profitable non-financial companies ranked in Fortune Global 500. The companies will be grouped in clusters (based on industry or debt-to-equity ratio in order to identify the signification of the correlation between the profit and the balance sheet structure. The main results of the paper refer to the company profitability that can be increased by using an optimal structure of liabilities and equity.

Sequential accelerated tests: Improving the correlation of accelerated tests to module performance in the field

Science.gov (United States)

Felder, Thomas; Gambogi, William; Stika, Katherine; Yu, Bao-Ling; Bradley, Alex; Hu, Hongjie; Garreau-Iles, Lucie; Trout, T. John

2016-09-01

DuPont has been working steadily to develop accelerated backsheet tests that correlate with solar panels observations in the field. This report updates efforts in sequential testing. Single exposure tests are more commonly used and can be completed more quickly, and certain tests provide helpful predictions of certain backsheet failure modes. DuPont recommendations for single exposure tests are based on 25-year exposure levels for UV and humidity/temperature, and form a good basis for sequential test development. We recommend a sequential exposure of damp heat followed by UV then repetitions of thermal cycling and UVA. This sequence preserves 25-year exposure levels for humidity/temperature and UV, and correlates well with a large body of field observations. Measurements can be taken at intervals in the test, although the full test runs 10 months. A second, shorter sequential test based on damp heat and thermal cycling tests mechanical durability and correlates with loss of mechanical properties seen in the field. Ongoing work is directed toward shorter sequential tests that preserve good correlation to field data.

Christina ütleb : pidutse raskelt! / Märt Milter

Index Scriptorium Estoniae

Milter, Märt

2002-01-01

Näitlejanna Christina Applegate ja tema roll mängufilmis "Ropult magus" ("The Sweetest Thing"), režissöör Roger Kumble. Lühidalt ka filmile stsenaariumi kirjutanud stand-up koomikust Nancy M. Pimentalist

THE OCCURRENCE OF FOETAL DWARFIST{ IN THE ANGORA ...

African Journals Online (AJOL)

Foetal dwarfism following heat stress during preg- nancy has been .... with a low heat tolerance coefficient. lt has also been surmised that ... system by abnormal levels of maternal hormones. Star- ... and hence growth suppressing actions.

African Zoology - Vol 27, No 3 (1992)

African Journals Online (AJOL)

A new record of Craspedacusta sowerbii (Cnidaria: Limnomedusae) from southern Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Nancy A. Rayner, C.C. Appleton, 143-145 ...

Fish Density of El Seco, Puerto Rico from 2009-03-31 to 2009-04-02, Project NF-09-01-USVI, 2009, WGS84 (NCEI Accession 0137091)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

The Coast Guard Proceedings of the Marine Safety and Security Council: Spring 2016

Science.gov (United States)

2016-04-01

management system designed to manage safety elements in the workplace . In practice, an operational...winning DuPont family of workplace safety training offerings. Management Buy-In Even if an organization embraces nonconformities as a call to improved...PROCEEDINGS Spring 2016 Vol. 73, Number 1 Safety Management System Objectives 6 Safety Management Facilitates Safe Vessel Operation Vessel

Migration et commerce de distribution dans les villes ouest-africaines

African Journals Online (AJOL)

La migration et le commerce de distribution agissent en synergie sur la structuration de l'espace urbain. Ils apparaissent comme des instruments privilégiés d'analyse des questions relevant de l'économie spatiale (Dupont, 1986). Leur impact sur la dynamique urbaine participe à la création d'activités et d'investissements ...

Nature and the public: Urban ecology and the politics of transportation in Progressive - Era Chicago. / La naturaleza y el público: La ecología urbana y la política de transporte en la progresista - Era Chicago

Directory of Open Access Journals (Sweden)

Gurovich W. Alberto (Presentador

2000-08-01

Full Text Available This article argues that the model of urban ecology, as was formulated by Burgess, and McKenzie Park, comes from a uniquely local political context, in a city that had been the site of years of intense political agitation for reform. It shows how the specific model development will, in turn, used to intervene in this kind of "social laboratory of the nation ", to the extent that its principles will help identify priorities and dynamics of public policy Chicago in the decades following its publication. / Este artículo sostiene que el modelo de la ecología urbana, tal y como fuera formulado por Burgess, Park y McKenzie, surge de un contexto político específicamente local, en una ciudad que había sido el lugar de años de intensa agitación política de reforma. Se muestra cómo el específico desarrollo del modelo será, a su vez, utilizado para intervenir en esa suerte de "laboratorio social de la nación", en la medida en que sus postulados van a contribuir a determinar las prioridades y dinámicas de la política pública de Chicago en las décadas siguientes a su publicación.

Vastaliste kunst Eestis

Index Scriptorium Estoniae

1998-01-01

Tallinnas Rotermanni soolalaos veebruari keskpaigani Ameerikast saabunud näitus "Nonkonformistlik kunst Venemaal Norton ja Nancy Dodge'i kogust", mis hõlmab töid aastaist 1956-1986 ning sisaldab ka eesti kunstnike töid.

NOAA Point Shapefile - 100m2 Fish Density of El Seco, Puerto Rico, Project NF-09-01-USVI, 2009, WGS84

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

NOAA Point Shapefile - 100m2 Fish Density for Virgin Passage, United States Virgin Islands, Project NF-10-03-USVI, 2010, WGS84

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

Eesti kinnas Ameerikas

Index Scriptorium Estoniae

2007-01-01

Eestit külastanud Salt Lake City kudumisringi juhendaja Nancy Bush on agar eesti soki- ja kindakudumistehnika tutvustaja Ameerikas. Ta on avaldanud selleteemalise raamatu, ajakirjas "Piecework" ilmus artikkel Aino Praaklist, juures tema kinnaste mustreid ja skeeme

NOAA Point Shapefile - 100m2 Fish Density of Grand Northeast Ecological Corridor, Puerto Rico, Project NF-12-01-PR, 2012, WGS84

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

NOAA Point Shapefile - 100m2 Fish Density of Grand Northeast Ecological Corridor, Puerto Rico, Project NF-13-02-PR, 2013, WGS84

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This data contains densities of fishes detected using mobile fisheries sonar on board the NOAA Ship Nancy Foster. The data were acquired in concert with a multibeam...

Police Killings and Police Deaths Are Public Health Data and Can Be Counted.

Directory of Open Access Journals (Sweden)

Nancy Krieger

2015-12-01

Full Text Available Nancy Krieger and colleagues argue that law-enforcement-related deaths in the United States should be treated as notifiable conditions, which would allow public health departments to report these data in real-time.

78 FR 76815 - Non-Oriented Electrical Steel From the People's Republic of China, the Republic of Korea, and...

Science.gov (United States)

2013-12-19

... FURTHER INFORMATION CONTACT: Austin Redington at (202) 482-1664 or Nancy Decker at (202) 482-0196, AD/CVD... determinations is now March 17, 2014, the next business day. This notice is issued and published pursuant to...

Basics of SCI Rehabilitation

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Spinal Cord Injury 101

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Preventing Pressure Sores

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Sex and Fertility After SCI

Medline Plus

Full Text Available ... Cord Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, ... Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW ...

Editorial

African Journals Online (AJOL)

lescents with unplanned pregnancies in Mexico.4 Preg- nancy outcomes: are they ... in the diagnosis and treatment of children's respirato- ry diseases in Tunisia;7 iron ... in Nigeria8 and asymptomatic bacteriuria in Egyptian school children.9.

Ameriklanna tutvustab Eestit

Index Scriptorium Estoniae

2006-01-01

Eestis oli 12. korda ameerika kunstiteadlane ja tekstiilikunstnik Nancy Bush, kes on kirjutanud ingliskeelse raamatu eesti kinnastest ja sokkidest (Folk knitting in Estonia. Loveland [USA], 1999) ning kelle kaudu on jõudnud Ameerikasse ka Aino Praakli kirikindad

About Nation, Race, and Ethnicity in Latin America in the 19th and 20th centuries

Directory of Open Access Journals (Sweden)

Hanni Jalil Paier

2013-12-01

Full Text Available Bibliographic outline of the following book:APPELBAUM, Nancy P., Anne S. Macpherson and Karin A. Rosemblatt (Eds. (2003. Race and Nation in Modern Latin America. Chapel Hill: University of North Carolina Press, 329 pp.

Interns reflect: the effect of formative assessment with feedback during pre-internship

OpenAIRE

McKenzie, Susan; Burgess, Annette; Mellis, Craig

2017-01-01

Susan McKenzie,1 Annette Burgess,2 Craig Mellis1 1Central Clinical School, 2Education Office, Sydney Medical School, The University of Sydney, Sydney, NSW, Australia Background: It is widely known that the opportunity for medical students to be observed and to receive feedback on their procedural skills performance is variable in the senior years. To address this problem, we provided our Pre-Intern (PrInt) students with “one-to-one” formative feedback on their ability to p...

Long-term impact after fulminant Guillain-Barré syndrome, case report and literature review

Directory of Open Access Journals (Sweden)

Rougé A

2016-11-01

Full Text Available Alain Rougé,1,2 Jérémie Lemarié,1,2 Sébastien Gibot,1,2 Pierre Edouard Bollaert1,2 1Medical Intensive Care Unit, Hôpital Central, University Hospital of Nancy, Nancy, France; 2INSERM UMRS-1116, Faculty of Medicine, University of Lorraine, Nancy, France Abstract: A 47-year-old man was admitted to the intensive care unit a few hours after ­presenting to emergency department with acute diplopia and dysphonia. Swallowing disorders and respiratory muscular weakness quickly required invasive ventilation. On day 3, the patient was in a “brain-death”-like state with deep coma and absent brainstem reflexes. Electroencephalogram ruled out brain death diagnosis as a paradoxical sleep trace was recorded. Cerebrospinal fluid analysis, electrophysiologic studies, and a recent history of diarrhea led to the diagnosis of Campylobacter jejuni-related fulminant Guillain-Barré syndrome (GBS mimicking brain death. The outcome was favorable after long Intensive Care Unit and inpatient rehabilitation stays, despite persistent disability at 9 years follow-up. This case and the associated literature review of 34 previously reported fulminant GBS patients emphasize the importance of electrophysiological investigations during clinical brain-death states with no definite cause. Fulminant GBS has a worse outcome than “standard” GBS with higher rates of severe disability (about 50%. Long-term physiotherapy and specific rehabilitation programs appear essential to improve recovery. Keywords: fulminant Guillain-Barré syndrome, brain death, electroencephalogram, C. jejuni, long-term follow 

Reshaping Health Care in Latin America

International Development Research Centre (IDRC) Digital Library (Canada)

Reform In Mexico — Silvia Tamez and Nancy Molina ... This book assesses the health care reforms of the past decade in Argentina, Brazil and Mexico. ...... prevention and control of pulmonary tuberculosis; prevention and control of high blood ...

Sex and Fertility After SCI

Medline Plus

Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

Basics of SCI Rehabilitation

Medline Plus

Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

Spinal Cord Injury 101

Medline Plus

Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

Preventing Pressure Sores

Medline Plus

Full Text Available ... Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD Understanding SCI Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, ...

Preventing Pressure Sores

Medline Plus

Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

Spinal Cord Injury 101

Medline Plus

Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

Sex and Fertility After SCI

Medline Plus

Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

Basics of SCI Rehabilitation

Medline Plus

Full Text Available ... Injury Diane M. Rowles, MS, NP How Family Life Changes After Spinal Cord Injury Nancy Rosenberg, PsyD ... Rehabilitation Donald Peck Leslie, MD Adjusting to Social Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical ...

Mass spectrometry. Environment, biology, oenology, medicine, geology, chemistry, archaeology, mechanisms; Spectrometrie de masse. Environnement, biologie, oenologie, medecine, geologie, chimie, archeologie, mecanismes

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-07-01

This document provides the papers (communications and posters) presented at the 16. French days of mass spectrometry, held September 6-9, 1999 in Nancy, France. 7 papers are interesting for the ETDE database and are analyzed separately. (O.M.)

Mass spectrometry. Environment, biology, oenology, medicine, geology, chemistry, archaeology, mechanisms

International Nuclear Information System (INIS)

1999-01-01

This document provides the papers (communications and posters) presented at the 16. French days of mass spectrometry, held September 6-9, 1999 in Nancy, France. 5 papers are interesting for the INIS database and are analyzed separately. (O.M.)

Building and Evaluating Research Capacity in Healthcare Systems ...

International Development Research Centre (IDRC) Digital Library (Canada)

2016-06-29

Jun 29, 2016 ... Research capacity is considered an essential foundation for a ... of the world, including Sub-Saharan Africa, the Caribbean, Latin America, and Asia. ... Nancy Edwards is a nurse epidemiologist and a professor in the School of ...

Mass spectrometry. Environment, biology, oenology, medicine, geology, chemistry, archaeology, mechanisms; Spectrometrie de masse. Environnement, biologie, oenologie, medecine, geologie, chimie, archeologie, mecanismes

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-07-01

This document provides the papers (communications and posters) presented at the 16. French days of mass spectrometry, held September 6-9, 1999 in Nancy, France. 5 papers are interesting for the INIS database and are analyzed separately. (O.M.)

President Ilves met with leaders of the United States Congress

Index Scriptorium Estoniae

2007-01-01

President Toomas Hendrik Ilves kohtus Washingtonis USA Kongressi esindajatekoja spiikri Nancy Pelosi ja kongresmenidega. Kõne all oli viisavabadus, võitlus küberkuritegevuse vastu, suhted Venemaaga. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

Motivational Interviewing in the Prevention of Alcohol Abuse

Science.gov (United States)

2007-08-01

Nova Moyers, Muller, Ruben Palmer, Freeman Phillips, Nancy Pietsch, Stephen Quam, Gail Stephanie Roberson, Adriana Roberts, Cody S Sarosy...Christopher, P., Manuel, J. K., Martin, T., & Moyers, T.B. (2005). Myers Briggs Personality Type and Competency in Motivational Interviewing

Evaluation ofrapid enzyme immunobinding assays for the detection ...

African Journals Online (AJOL)

Abbott. Clonatec. DuPont. No. tests/kit. 40. 30. 200r100. Neg. control. Yes. Yes. Yes. Weak pos. control. No. Yes. Yes. Pos. control. Yes. Yes. Yes. Internal quality control indicator. Yes'. Yes'. No. HIV-1/HIV-2 detection. Yes. Yest. Yes. Reconstitution of reagents required. No. Yes. Yes. Stability of. Equal to. 1 moo for. 6 moo for ...

Reducing the Use of Force: De-Escalation Training for Police Officers

Science.gov (United States)

2016-09-01

73 APPENDIX B. SURVEY RESPONSES .............................................................. 75 APPENDIX C. SURVEY STATISTICS ...That Influence the Use of Force,” Crime & Delinquency (January 2012): 59, http://cad.sagepub.com/content/58/1/57.full.pdf+html. 17 Figure 2...Influence the Use of Force,” Crime & Delinquency (January 2012): 59, http://cad.sagepub.com/content/58/1/57.full.pdf+html. 69 Ibid. 70 Randolph Dupont

The Manufacture, Properties, and Testing of Napalm Soaps

Science.gov (United States)

1943-11-17

prrcltio’n. Tests at 1000C. a.nd 100 p.s,,i. %Inhibitor Induction Addod Pcriod, mins. N one 0 20 Eydroquinone 1 5 duPont #19 1 150 Lecithin 1 SF0 1 45...acetone tends to hydrolyze the soap, liberating more free acid which in turn is removed by the solvent. Table XXIV shows results obtained with a

75 FR 57440 - Performance Review Board Membership

Science.gov (United States)

2010-09-21

... DEPARTMENT OF COMMERCE Performance Review Board Membership AGENCY: Economics and Statistics... the Performance Review Board in accordance with the Economics and Statistics Administration's Senior... Callahan, Nancy M. Gordon, Howard R. Hogan, Arnold A. Jackson, Theodore A. Johnson, Steven J. Jost, J...

Tourism researcher wins Best Paper Award at international conference

OpenAIRE

Ho, Sookhan

2010-01-01

Nancy McGehee, associate professor of hospitality and tourism management research at the Pamplin College of Business at Virginia Tech, received a 2010 Best Paper Award at the recent ATLAS (Association for Tourism and Leisure Education) International Conference on Sustainable Tourism.

Investigating Shigella sonnei Infections

Centers for Disease Control (CDC) Podcasts

2011-11-17

Dr. Nancy Strockbine, Chief of the Escherichia and Shigella Reference Unit at CDC, discusses Shigella sonnei infections.  Created: 11/17/2011 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 11/21/2011.

African Journal of Biotechnology - Vol 2, No 11 (2003)

African Journals Online (AJOL)

Segenet Kelemu, George Mahuku, Martin Fregene, Douglas Pachino, Nancy Johnson, Lee Calvert, Idupulapati Rao, Robin Buruchara, Tilahun Amede, Paul Kimani, ... Festus Doyin Adu, Jane Iber, Tekena Harry, Cara Burns, Oluseyi Oyedele, Johnson Adekunle Adeniji, Mubarak Ossei-Kwasi, David Kilpatrick, Oyewale ...

Holger Loodus / Holger Loodus

Index Scriptorium Estoniae

Loodus, Holger

2000-01-01

Ansambli "Dallas" kitarrist Holger Loodus kirjutab oma olulisematest plaatidest:Blondie "The Best Of Blondie", Peter Sarstedt "Peter Sarstedt", Collage "Kadriko", Kraftwerk "Man Machine", Nansy Sinatra ja Lee Hazlewood "The Hits Of Nancy & Lee", The Modern Jazz Quarte "Third Stream Music"

77 FR 20887 - Proposed Information Collection (Educational/Vocational Counseling Application) Activity: Comment...

Science.gov (United States)

2012-04-06

... (Educational/Vocational Counseling Application) Activity: Comment Request AGENCY: Veterans Benefits... information needed to determine an applicant's entitlement to counseling services. DATES: Written comments and... may be viewed online through FDMS. FOR FURTHER INFORMATION CONTACT: Nancy J. Kessinger at (202) 461...

Nigerian Journal of Paediatrics 2013;40(2)

African Journals Online (AJOL)

owner

2012-08-08

Aug 8, 2012 ... mothers of SGA babies had signifi- cantly lower values ... (teenage and mothers older than 35 years),2 primiparity .... 1.7%) and sickle cell anaemia (9; 1.1%). Mothers of ..... nancy, as well as improve utilization of antenatal ser-.

Tělo vlastní a nevlastní

Czech Academy of Sciences Publication Activity Database

Kouba, Petr

2011-01-01

Roč. 59, č. 1 (2011), s. 61-73 ISSN 0015-1831 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional research plan: CEZ:AV0Z90090514 Keywords : Nancy * Merleau-Ponty * Agamben Subject RIV: AA - Philosophy ; Religion

Weyerhaeuser Export Facility at DuPont. Volume III. Appendices R - T.

Science.gov (United States)

1982-05-01

0 a 0 lo Ř 4 - * a . 4a 44 -1~ a1 .. . 4 4 00. * 4 14 P 14 4 0~~0 6 4 44 14 a 1 4 w 4 Id . - ’U A U44 44 0 U C ’U 4 4 A U4 4 443 4444 %A 4 .41 F6 A...W.4) C) C. 0 -C4JC CCC),)."U! CCA ISC-a~ C" 0 , U 3 C - 4. 0A 00. L .UA.C L O L U CL- C0 .=0 0 0) .-C V C, a 2 0 ) ACCa LC1 LCC0C S C.0 a-. UU~~~ A Cz

Accounting for Framing-Effects - an informational approach to intensionality in the Bolker-Jeffrey decision model

OpenAIRE

Bourgeois-Gironde , Sacha; Giraud , Raphaël

2005-01-01

We suscribe to an account of framing-effects in decision theory in terms of an inference to a background informationa by the hearer when a speaker uses a certain frame while other equivalent frames were also available. This account was sketched by Craig McKenzie. We embed it in Bolker-Jeffrey decision model (or logic of action) - one main reason of this is that this latter model makes preferences bear on propositions. We can deduce a given anomaly or cognitive bias (namely framing-effects) in...

A Stretchable Electromagnetic Absorber Fabricated Using Screen Printing Technology.

Science.gov (United States)

Jeong, Heijun; Lim, Sungjoon

2017-05-21

A stretchable electromagnetic absorber fabricated using screen printing technology is proposed in this paper. We used a polydimethylsiloxane (PDMS) substrate to fabricate the stretchable absorber since PDMS exhibits good dielectric properties, flexibility, and restoring capabilities. DuPont PE872 (DuPont, Wilmington, CT, USA), a stretchable silver conductive ink, was used for the screen printing technique. The reflection coefficient of the absorber was measured using a vector network analyzer and a waveguide. The proposed absorber was designed as a rectangular patch unit cell, wherein the top of the unit cell acted as the patch and the bottom formed the ground. The size of the patch was 8 mm × 7 mm. The prototype of the absorber consisted of two unit cells such that it fits into the WR-90 waveguide (dimensions: 22.86 mm × 10.16 mm) for experimental measurement. Before stretching the absorber, the resonant frequency was 11 GHz. When stretched along the x -direction, the resonant frequency shifted by 0.1 GHz, from 11 to 10.9 GHz, demonstrating 99% absorption. Furthermore, when stretched along the y -direction, the resonant frequency shifted by 0.6 GHz, from 11 to 10.4 GHz, demonstrating 99% absorption.

The effects of patient and physician characteristics on early outpatient satisfaction with substance dependence care: results of the SUBUSQOL study

Directory of Open Access Journals (Sweden)

Bourion-Bédès S

2017-05-01

Full Text Available Stéphanie Bourion-Bédès,1–3 Raymund Schwan,2 Paolo Di Patrizio,2 Guillaume Vlamynck,2 Sarah Viennet,2 Maxime Schvartz,2 Anne Gaunard,2 Alex Bédès,4 Isabelle Clerc-Urmès,5 Cédric Baumann3,5 1Regional Medical and Psychological Service (SMPR, 2CSAPA (Healthcare Center of Accompaniment and Prevention in Addictology, University Hospital of Nancy, 3EA4360 APEMAC, University of Lorraine, Nancy, 4ANPAA 15-CSAPA (Healthcare Center of Accompaniment and Prevention in Addictology, Saint-Flour, Cantal, 5Platform of Clinical Research Facility PARC, Unit MDS, University Hospital of Nancy, Nancy, France Background: Although patient perceptions of health care have increasingly been explored in the literature, little is known about care satisfaction among individuals with substance dependence. This exploratory study assessed the relationships between patient and physician characteristics and early outpatient satisfaction with care for alcohol and opioid dependence. Methods: Satisfaction was assessed using a multidimensional, self-administered and validated questionnaire during the early care process among a prospective outpatient cohort. In addition to measuring satisfaction and obtaining sociodemographic and clinical data, this study collected data on the self-reported health status and physician characteristics at inclusion. Cross-sectional analysis with multiple linear regression was performed to identify the variables associated with satisfaction level. Results: A total of 249 outpatients were included, and 63.8% completed the satisfaction questionnaire. Patients without a history of previous care for substance dependence were more satisfied with the appointment-making process (β=7.2; P=0.029 and with the doctor consultation (β=10.3; P=0.003 than those who had received care previously. Neither sociodemographic characteristics nor self-reported health status was associated with outpatient satisfaction. Conclusion: The factors that affect patients�

Th,e Radiological Appearance and Incidence of Lymphoma*

African Journals Online (AJOL)

1971-12-11

Dec 11, 1971 ... stinal glands and this event may be terminal. It is as well to remember ... from carcinoma in which it is relatively more frequent.; ... In lymphomas at this stage the glandular ... These comprise 2'10 of total gastric malig- nancy.

EXPRESSION PROFILING OF ESTROGENIC COMPOUNDS USING A SHEEPSHEAD MINNOW CDNA MACROARRAY

Science.gov (United States)

Larkin, Patrick, Leroy C. Folmar, Michael J. Hemmer, Arianna J. Poston and Nancy D. Denslow. 2003. Expression Profiling of Estrogenic Compounds Using a Sheepshead Minnow cDNA Macroarray. Environ. Health Perspect. 111(6):839-846. (ERL,GB 1171). A variety of anthropogenic c...

78 FR 4871 - Notice of Public Meeting: Northwest California Resource Advisory Council

Science.gov (United States)

2013-01-23

.... They must provide their own transportation, food and beverages. FOR FURTHER INFORMATION CONTACT: Nancy... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLCAN01000.L18200000.XZ0000] Notice of Public Meeting: Northwest California Resource Advisory Council AGENCY: Bureau of Land Management...

Browse Title Index

African Journals Online (AJOL)

Items 501 - 550 of 3286 ... C Opoku-Okrah, BKS Acquah, EE Dogbe ... Nancy Weathers, Jenna Ladd, Iretiola Fajolu, Christopher Esezobor, Christian Makwe, Bukola Odusanya, Rose Anorlu, Wasiu Adeyemo, Edna Iroha, Mathias Egri-Okwaji, Prisca Adejumo, Lawal Oyeneyin, Moses Abiodun, Bolaji Badejoko, Kelli Ryckman.

Voices of Authority: Education and Linguistic Difference. Contemporary Studies in Linguistics and Education, Volume 1.

Science.gov (United States)

Heller, Monica, Ed.; Martin-Jones, Marilyn, Ed.

Chapters in this volume include the following: "Co-Constructing School Safetime: Safetalk Practices in Peruvian and South African Classrooms" (Nancy H. Hornberger, J. Keith Chick); "Codeswitching and Collusion: Classroom Interaction in Botswana Primary Schools" (Jo Arthur); "Language and Educational Inequality in Primary…

Is TQM Right for Schools?

Science.gov (United States)

Blankstein, Alan M.; Swain, Heather

1994-01-01

Examines eight reasons why Total Quality Management cannot succeed in education and shows how one Florida elementary school surmounted these obstacles and implemented Deming's quality principles. Principal Nancy Duden overcame resistance to change, leadership misconceptions, reliance on external motivators (promotions and grades), increased…

CPM (Critical Path Method) as a Curriculum Tool.

Science.gov (United States)

Mongerson, M. Duane

This document discusses and illustrates the use of the Critical Path Method (CPM) as a tool for developing curriculum. In so doing a brief review of the evolution of CPM as a management tool developed by E. I. duPont de Nemours Company is presented. It is also noted that CPM is only a method of sequencing learning activities and not an end unto…

Dickens's Dichotomous Formula for Social Reform In Oliver Twist

Directory of Open Access Journals (Sweden)

Taher Badinjki

2016-11-01

Full Text Available Oliver Twist was a direct appeal to society to take action against poverty, exploitation of children, oppression of women, and was meant to be a picture of the "dregs of life” in all their deformity and wretchedness. Among the most miserable inhabitants of the world of Oliver Twist, Nancy appears as a key figure.  Dickens was anxious to expose the truth about such a woman because he believed it would be a service to society. Dickens's portrayal of Nancy illustrates the power of the dual conception of womanhood  held at the time. On the one hand, a woman might be conceived as someone refined and somewhat remote from ordinary life like Rose Maylie. On the other hand, there was a certain fascination in a woman's degradation, even though that could be shown only indirectly.  Nancy is a demonstration of the two elements combined together. Dickens took the ideal nature of womanhood  and the depravity of the prostitute, and combined them in a remarkable dramatization which he had some right to claim was also true to life. The book is an astounding rebuttal of contemporary prejudice, and a call for more humane and liberal attitudes. These attitudes  are based on the concepts that there is now a radically different way of looking at human nature, that everything ought to depend on what one is in oneself, and that it is only in love that humans can live purposefully and happily with each other.

Review of Psychoanalytic Psychotherapy: A Practitioner's Guide.

Science.gov (United States)

Papouchis, Nicholas

2006-01-01

Reviews the book, Psychoanalytic Psychotherapy: A Practitioner's Guide by Nancy McWilliams (see record 2004-16060-000). Nancy McWilliams' book on analytic therapy is her latest contribution to the training needs of young clinicians. The book is organized into chapters that address fundamental issues clinical trainees typically face as they work with patients. To establish the context for describing psychoanalytic work, the first chapter defines what she means by psychoanalytic therapy. The three chapters that follow address what McWilliams means by a psychoanalytic sensibility: how the therapist may be prepared for doing therapy and how the client may be prepared for the experience of psychoanalytic psychotherapy. The next three chapters address the maintenance of boundaries and basic therapy processes. Two case examples follow in chapters eight and nine, and each example is a richly evocative description of the complexity of psychoanalytic psychotherapy. The last three chapters of the book deal with the ancillary lessons of psychoanalytic therapy, the occupational hazards and gratifications of the work, and a final chapter on self-care. This is an excellent book, but it should be read together with other texts on psychoanalytic psychotherapy that describe the treatment process systematically in more technical terms. This is a book written for clinicians in training or for experienced clinicians to use in working with clinical trainees. In this sense, Nancy McWilliams has more than achieved her goal of writing a book that will introduce clinical trainees to the psychoanalytic sensibility of doing psychoanalytic psychotherapy. (PsycINFO Database Record (c) 2010 APA, all rights reserved).

"Putting on Band-Aids": The Contradictory Roles and "Small Wins" of Tempered Campus Radicals

Science.gov (United States)

Westerman, Marni; Huey, Laura

2012-01-01

Nancy Fraser's propositions regarding the nature of "boundary" work carried out by experts within organizations suggests that individuals who work within bureaucratic structures are so constrained by the institutional context that they become detached, depoliticizing arbitrators of politicized claims. The purpose of the research reported…

Intellekt ja selle areng imiku- ja väikelapseeas / Marika Veisson

Index Scriptorium Estoniae

Veisson, Marika, 1949-

1998-01-01

Kolm ajaloolist lähenemist intellekti uurimisele. Nancy Bayley poolt 1969.a. välja töötatud esimene põhjalikum väikelaste ja imikute intellekti uurimismetoodika - Bayley Imikute Arengu Skaala; psühhomeetriline lähenemine, J. Piaget kognitiivse arengu teooria

[Video games, a therapeutic mediator for teens].

Science.gov (United States)

Nickler, Christophe

2015-10-01

Teenagers love video games and other multimedia tools. Sometimes they love them too much, leading to addictive use. A child psychiatry team in Nancy has developed a therapeutic multimedia workshop to contribute to treating teens. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

FIELD VALIDATION OF A SHEEPSHEAD MINNOW ESTROGEN-RESPONSIVE CDNA MACROARRAY

Science.gov (United States)

Hemmer, Michael J., Iris Knoebl, Becky L. Hemmer, Patrick Larkin, Peggy S. Harris and Nancy D. Denslow. In press. Field Validation of a Sheepshead Minnow Estrogen-Responsive cDNA Macroarray (Abstract). To be presented at the SETAC Fourth World Congress, 14-18 November 2004, Portl...

Pop / Mart Juur

Index Scriptorium Estoniae

Juur, Mart, 1964-

2002-01-01

Heliplaatidest Nancy Sinatra "The Very Best Of". A-ha "Lifelines". Danny Krivit "Grass Roots". Frank Sinatra "Romance". Armand Van Helden "Gandhi Khan". Elvis Costello "When I Was Cruel". Erinevad esinejad "Audiolounge". Michael Bolton "Only A Woman Like You". Sheryl Crow "C'mon, C'mon"

75 FR 39618 - Proposed Information Collection (Request for Identifying Information Re: Veteran's Loan Records...

Science.gov (United States)

2010-07-09

..., benefits will not be paid or furnished by reason of an incomplete application. Affected Public: Individuals... Benefits Administration, Department of Veterans Affairs. ACTION: Notice. SUMMARY: The Veterans Benefits....Regulations.gov or to Nancy J. Kessinger, Veterans Benefits Administration (20M35), Department of Veterans...

75 FR 68598 - Notice of Appointment of Members to the National Agricultural Research, Extension, Education, and...

Science.gov (United States)

2010-11-08

... Secretary of Agriculture to a specific category on the Board, including farming or ranching, food production... follows: Category F. ``National Food Animal Science Society,'' Nancy M. Cox, Director, Kentucky... composed of 25 members, each representing a specific category related to agriculture. The Board was first...

76 FR 7623 - Department of State Performance Review Board Members

Science.gov (United States)

2011-02-10

...: February 2, 2011. Nancy J. Powell, Director General of the Foreign Service and Director of Human Resources... following individuals to the Department of State Performance Review Board for Non-Career Senior Executive Service members: Jeanne-Marie Smith, Chairperson, Senior Advisor, Deputy Secretary for Management and...

76 FR 17927 - Withdrawal of Approval of New Animal Drug Applications; Chorionic Gonadotropin; Cuprimyxin...

Science.gov (United States)

2011-03-31

... Drug) Labeler Code) Roche Vitamins, Inc., 45 Waterview NADA 093-029 524.520 Blvd., Parsippany, NJ 07054... phosphate/ sulfamethazine). Pegasus Laboratories, Inc., 8809 Ely NADA 102-824 520.1720a Rd., Pensacola, FL 32514. Phenylbutazone Tablets........ (055246) (phenylbutazone) Wendt Laboratories, Inc., 100 Nancy NADA...

CD review: Giving voice to hope: music of Liberian refugees | Thorn ...

African Journals Online (AJOL)

Title: Giving voice to hope: music of Liberian refugees (2009). One compact disk and booklet. Production supervision by Barry Tonge, Michael Frishkopf, Nancy Hanneman, Ellis Pourbaix and Jennifer Woronuk. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

Smoking Cessation and Improvement in Physical Performance Among Young Men

Science.gov (United States)

2015-03-01

Program support team at the Naval Health Research Center, especially Dr. Christopher Phillips, Dr. Nancy Crum-Cianflone, Lauren Kipp, Dennis...4): CD003289. 42. Branstetter SA, Blosnich J, Dino G, Nolan J, Horn K: Gender differ­ ences in cigarette smoking, social correlates and cessation

Folk Linguistics and Language Teaching Education. A Case Study in an Italian Secondary School

Science.gov (United States)

Santipolo, Matteo

2016-01-01

This paper, after shortly introducing "Folk Linguistics" by defining its domain of competence [cf. Preston, Dennis R., ed. 1999. "Handbook of Perceptual Dialectology." Amsterdam: John Benjamins; Niedzielski, Nancy A., and Dennis R. Preston. 2003. "Folk Linguistics." Berlin: Mouton de Gruyter], attempts to draw an…

78 FR 53196 - Agency Information Collection (Principles of Excellence Complaint System Intake); Comment Request

Science.gov (United States)

2013-08-28

... (Principles of Excellence Complaint System Intake); Comment Request AGENCY: Veterans Benefits Administration... published an emergency notice the Principles of Excellence Complaint System Intake on April 30, 2013, that... information through Federal Docket Management System (FDMS) at www.Regulations.gov ; or to Nancy J. Kessinger...

78 FR 48417 - Proposed Information Collection; Comment Request; Educational Partnership Program (EPP), Ernest F...

Science.gov (United States)

2013-08-08

... alumni student data collection are the Dr. Nancy Foster Scholarship Program and the Recruiting, Training.... Method of Collection Electronic applications and electronic forms are required from participants, and the primary methods of submittal are email and Internet transmission of electronic forms. Approximately 1% of...

The Cauchy Problem for Ut = Delta u(m) When 0 m 1.

Science.gov (United States)

1985-01-01

Ecuaciones Funcionales, Facultad de Matematicas, Universidad Complutense, Madrid 3, Spain. • * Department of Mathematics, University of Nancy I, B. P. 239...required on u° to provide even a local solution in time, namely * Dpto Ecuaciones Funcionales, Facultad de Matematicas, Universidad Complutense, Madrid 3

International Journal of Arts and Humanities(IJAH) Bahir Dar- Ethiopia

African Journals Online (AJOL)

Nneka Umera-Okeke

have assimilated in the course of learning their language. These norms .... Nancy cannot have or give birth to children. The problem with ... Film or movies started in Nigeria in the 1960s, but what could be termed the birth of film production in ...

Redistribution, Recognition and Representation: Working against Pedagogies of Indifference

Science.gov (United States)

Lingard, Bob; Keddie, Amanda

2013-01-01

This paper reports on an Australian government-commissioned research study that documented classroom pedagogies in 24 Queensland schools. The research created the model of "productive pedagogies", which conjoined what Nancy Fraser calls a politics of redistribution, recognition and representation. In this model pedagogies are…

Seafloor spreading magnetic anomalies in the southeastern Arabian Sea

Digital Repository Service at National Institute of Oceanography (India)

Chaubey, A.K.; Bhattacharya, G.C; Rao, D.G.

. A new geomagnetic polarity time scale for the Late Cretaceous and Cenozoic. J. Geophys. Res., 97: 13,917-13,951. Cande, S.C., La Brecque, J.L., Larson, R.L., Pitman, W.C., Golovchenko, X. and Haxby, W.F., 1989. Magnetic linea- tions of the world....O., Herron, E.M., Pitman, W.C. and Le Pichon, X., 1968. Marine magnetic anomalies, geomagnetic field reversals, and motions of the ocean floor and continents. J. Geophys. Res., 73: 2119-2136. McKenzie, D.P. and Sclater, J.G., 1971. The evolution...

PROBLEMAS METODOLÓGICOS EN LAS INVESTIGACIONES SOBRE LAS CAPACIDADES INTELECTUALES EN EL ESPECTRO AUTISTA: EL CASO DE LA PERFECCIÓN DEL CONDICIONAL Methodological problems in research on intellectual abilities on the autism spectrum: the case of conditional perfection

OpenAIRE

Miguel López Astorga

2012-01-01

Recientemente, son muchos los trabajos que han aparecido en el área de la psicología y de la ciencia cognitiva con el propósito de analizar las maneras de razonar y las capacidades intelectuales de sujetos diagnosticados como autistas. Tal es el caso de una investigación de McKenzie, Evans y Handley. Nosotros revisamos en este trabajo su investigación y sostenemos que contiene problemas metodológicos. Así, tratamos de mostrar cuáles son dichos problemas y proponemos la estructura que, a nuest...

PROBLEMAS METODOLÓGICOS EN LAS INVESTIGACIONES SOBRE LAS CAPACIDADES INTELECTUALES EN EL ESPECTRO AUTISTA: EL CASO DE LA PERFECCIÓN DEL CONDICIONAL

OpenAIRE

López Astorga,Miguel

2012-01-01

Recientemente, son muchos los trabajos que han aparecido en el área de la psicología y de la ciencia cognitiva con el propósito de analizar las maneras de razonar y las capacidades intelectuales de sujetos diagnosticados como autistas. Tal es el caso de una investigación de McKenzie, Evans y Handley. Nosotros revisamos en este trabajo su investigación y sostenemos que contiene problemas metodológicos. Así, tratamos de mostrar cuáles son dichos problemas y proponemos la estructura que, a nuest...

"All Our Relations": Respecting People and Scholarship

DEFF Research Database (Denmark)

Lysgaard, Jonas Greve; Neilson, Alison; Spannring, Reingaard

and politics in research as well as communications about research (McKenzie, 2005). Philip Payne (2005) challenges the limitations of textual discourse as a way of knowing; he focuses on “being, doing and becoming a relational, social and ecological ‘self’” (p. 415) and suggests that strong cultural production....... (2012). An environmental ethical conceptual framework for research on sustainability and environmental education. Environmental Education Research, ifirst article, 1-24. Kulnieks, A., Longboat, D. R. & Young, K. (2013). Contemporary Studies in Environmental and Indigenous Pedagogies. A Curricula...

Harvard Education Letter. Volume 23, Number 1, January-February 2007

Science.gov (United States)

Chauncey, Caroline, Ed.

2007-01-01

"Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Response to Intervention: A New Approach to Reading Instruction Aims to Catch Struggling Readers Early (Nancy Walser); (2) Getting Advisory Right: Focus and…

Type 1 diabetes mellitus and atopic diseases in children.

African Journals Online (AJOL)

Ehab

Nancy S. Elbarbary. Assistant Professor of Pediatrics, Faculty of Medicine, Ain Shams University, Cairo, Egypt. Background. Diabetes mellitus type 1 (T1DM) is a complex disease resulting from the interplay of genetic, epigenetic, and environmental factors.1 Worldwide,. T1DM epidemic represents an increasing global.

Between Efficiency, Capability and Recognition: Competing Epistemes in Global Governance Reforms

Science.gov (United States)

Chan, Jennifer

2007-01-01

This article examines global governance reforms as a site of contestation between three different "truths"/epistemes (the market, human rights principles, and cultural identity) in terms of the competing principles of efficiency, capability, and recognition. Nancy Fraser's conceptions of participation parity and a dialogical approach of…

The Modern First Lady and Public Policy: From Edith Wilson through Hillary Rodham Clinton.

Science.gov (United States)

Black, Allida M.

2001-01-01

Discusses the role in and influence on public policy of twentieth century First Ladies including Edith Roosevelt, Helen Taft, Ellen Wilson, Edith Wilson, Florence Harding, Lou Henry Hoover, Eleanor Roosevelt, Jacqueline Kennedy, Lady Bird Johnson, Rosalynn Carter, Nancy Reagan, Barbara Bush, and Hillary Rodham Clinton. (CMK)

Social justice and disability policy in Southern Africa | Mugumbate ...

African Journals Online (AJOL)

Social justice means different things to different people. This has resulted in diverse meanings and interpretations despite some commonalities, such as a focus on marginalised groups including women, people living in rural areas, persons with disabilities, children, racial minorities, and refugees, among others. In Nancy ...

76 FR 39879 - Clinical Laboratory Improvement Advisory Committee (CLIAC)

Science.gov (United States)

2011-07-07

... the standards to accommodate technological advances. Matters to be Discussed: The agenda will include... the meeting online at least 14 days in advance at http://www.cdc.gov/cliac/default.aspx by clicking... Information: Nancy Anderson, Chief, Laboratory Practice Standards Branch, Division of Laboratory Science and...

Untitled

African Journals Online (AJOL)

PTT. l. Immobilisation: Any form of pro- v _ i longed immobilisation, especially A tailor-made post surgery ' aspin'n'tablet for. 2. Chronic congestive heart failure. cardiovascular protectiont. 3. Patients with atherosclerotic vascular disease, eg coronary artery disease. 4. Patients with underlying malig- nancy. 5. Pregnancy.

International Journal of Development and Management Review ...

African Journals Online (AJOL)

Customer relationship management and performance in the paint industry: a study of selected paint manufacturing firms in Lagos State, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Kenneth C. Nwekpa, Ewans Chukwuma, Nancy Agha, 184-192 ...

76 FR 17776 - Animal Drugs, Feeds, and Related Products; Withdrawal of Approval of New Animal Drug Applications...

Science.gov (United States)

2011-03-31

...'s Sponsor (established name of drug) drug labeler code) Roche Vitamins, Inc., 45 Waterview Blvd.... Medicator TS-40 Premix (tylosin phosphate/ sulfamethazine). Pegasus Laboratories, Inc., 8809 Ely Rd., NADA... Laboratories, Inc., 100 Nancy Dr., NADA 108-487, DEC Tabs 520.622a (015579). Belle Plaine, MN 56011...

2007 Preserve America Presidential Awards

Science.gov (United States)

aviation history museum that emphasizes people and culture as well as technology and events. With a the Private Preservation category, the two winners are: The History Channel, Save Our History Save Our History were Abbe Raven, president and CEO, A&E Television Networks; and Nancy Dubuc

"Feminist" Teaching/Teaching "Feminism"

Science.gov (United States)

Carillo, Ellen C.

2007-01-01

The stakes are high for feminist teachers. Susan A. Basow, Nancy T. Silberg, Kathryn Duncan, Michael Stasio, and others have reported disturbing findings regarding the discrepancy between student evaluations of male professors and female professors. Professors who have identified themselves as feminists or committed to practicing feminist…

Distribution of HLA-A,B alleles in 13 panels of blood donors in France.

Science.gov (United States)

Prevost, P; Busson, M; Marcelli-Barge, A

1984-05-01

In this study, we analysed 13 samples of the French population--4147 non-related individuals living in Bordeaux, Brest, Caen, Dijon, Limoges, Lyon, Marseille, Nancy, Paris, Poitiers, Rennes, Strasbourg and Toulouse--all of whom were typed for 10 alleles of the HLA-A locus and 16 alleles of the HLA-B locus. The results showed a strong heterogeneity (chi 2 = 675.13 for 324 df, p less than 10(5)). A diagram has been drawn up, showing the matrix of genetic distances obtained thanks to the B2 of Balkrishnan & Sanghvi (1968). This diagram enables us to envisage the hypothesis of 6 homogeneous clusters. A partition of chi 2 was used to test this 6 luster hypothesis: Paris and Caen (p = 0.98); Nancy, Strasbourg (p less than 5%); Rennes, Brest (p less than 1%); Dijon, Lyon, Marseille (p = 0.89); Limoges, Poitiers (p = 0.18); Toulouse, Bordeaux (p less than 10(-5)). The heterogeneity within these clusters represents only 1/43 of the total heterogeneity.

An European pupil project linked to the scientific aims of the experiment AQUARIUS-XENOPUS on the taxi Soyuz flight Andromede to ISS.

Science.gov (United States)

Dournon, Christian; Membre, Herve; Brohm, Pierre-Eric; Coince, Aurore; Cornu, Nathalie; Dreyer, Laura; Florentin, Jonathan; Jeanneau, Lydie; Henniquin, Camille; Houbre, Marie; Guerard, Marine; Lecomte, Nathalie; Maxant, Lorie; Schluraff, Marion; Venandet, Anne-Sophie; Jusyte, Aiste; Simmet, Dana; Bocking, Dominique; Flaig, Dorothee; Santak, Leo; Bolek, Steffen; Goppel, Verena; Rossignon, Jean-Paul; Trossat, Marie-Alice; Raux, Martine; Forster, Susanne; Staudenmaier, Gerd; Boser, Sybille; Horn, Eberhard

2002-07-01

The German-French biological experiment AQUARIUS-XENOPUS which flew on the Soyuz flight Andromede to the International Space Station ISS (launched October 21, 2001 in Baikonour/Kazakhstan) was extended by an outreach project. Pupils of class 10 to 12 from Ulm/D and Nancy-Tomblaine/F studied swimming behavior of Xenopus tadpoles on ground. They were instructed to perform all experimental steps following the protocol of similar video recordings on ISS. After the flight, they evaluated the kinetics of swimming of both ground controls and space animals. The pupil project included theoretical components to introduce them to the field of gravitational biology. One feature of the project was the exchange of ideas between pupils by meetings which took place in Ulm (June 2001), Nancy (February 2002) and Paris (May 2002). We consider our approach as a successful way to include young people in space experiments on a cheap cost level and to bring ideas of gravitational biology into the curricula of European schools.

The Effect of Switch-Loading Fuels on Fuel-Wetted Elastomers

Science.gov (United States)

2007-01-10

material and age of the material”. In summing up past experience, the bulletin stated that “the common denominator is expected to be nitrile rubber ...The expert also noted that “most, if not all manufacturers, responded by eliminating nitrile rubber seals and replacing them with fluorocarbon...materials identified as from the Acrylonitrile- 4 Viton is a name trademarked by DuPont Performance Elastomers L.L.C. Butadiene family (nitrile, NBR

A summary of the test procedures and operational details of a Delaware River and an ocean dumping pollution monitoring experiment conducted 28 August 1975

Science.gov (United States)

Hypes, W. D.; Ohlhorst, C. W.

1977-01-01

Two remote sensor evaluation experiments are discussed. One experiment was conducted at the DuPont acid-dump site off the Delaware coast. The second was conducted at an organic waste outfall in the Delaware River. The operational objective of obtaining simultaneous sea truth sampling with remote sensors overpasses was met. Descriptions of the test sites, sensors, sensor platforms, flight lines, sea truth data collected, and operational chronology are presented.

Enhancing Trilateral Disaster Preparedness and Relief Cooperation between Japan, U.S. and Australia: Approaches from Various Civil-Military Perspectives

Science.gov (United States)

2013-07-01

Strategic Dialogue UN United Nations UNHRD United Nations Humanitarian Response Depot (in Malaysia ) UNISDR United Nations International Strategy for...large-scale radioactive contamination , we focus our analysis on the former type of disaster, as it offers a better lens through with which to assess...to Security, Alan Dupont predicts that a failure to reverse the trends of the decline in energy, food and water sufficiency, and the increase in

A case of parathyroid carcinoma visualized on Tc-99m-sestamibi scintigraphy

International Nuclear Information System (INIS)

Aigner, R.M.; Fueger, G.F.; Lax, S.

1997-01-01

Recent studies indicate that Tc-99m-Sestamibi (MIBI, DuPont Pharma) is a useful tracer for detecting parathyroid adenomas. We present a patient with focal Tc-99m-MIBI uptake in parathyroid carcinoma which has only been described once before (1). Tc-99m-MIBI scintigraphy may be considered for diagnosing pathological parathyroid tissue. But presently the histopathological examination only allows the differentiation between adenoma and carcinoma. (orig.) [de

European Science Notes Information Bulletin: Reports on Current European/Middle Eastern Science

Science.gov (United States)

1992-06-01

collaboration with DuPont, The researchers, Dr. C. Galiotis and Dr. C. Vlattas is exploiting the biodegradability of poly(lactides)! This (Queen Mary...state properties and crystal structures of Poly growth; novel morphology in ny’-n 46 leading to en- (L-lactides). This is an interesting biodegradable ...include ing of some spectacular movies illustrating the motion single crystals (B. Susla, Poznan Technical University of individual atoms on surfaces

Comparison of lysis-centrifugation with lysis-filtration and a conventional unvented bottle for blood cultures.

OpenAIRE

Gill, V J; Zierdt, C H; Wu, T C; Stock, F; Pizzo, P A; MacLowry, J D

1984-01-01

Evaluation of a commercially available lysis-centrifugation blood culture system (Isolator, DuPont Co., Wilmington, Del.) and a lysis-filtration blood culture system for 3,111 cultures showed that both methods had comparable recoveries (73 and 68%, respectively) of significant aerobic and facultatively anaerobic isolates. The unvented conventional blood culture bottle had a recovery rate of 59%. Although the lysis-centrifugation and lysis-filtration systems had comparable recoveries of pathog...

Factors That Are Associated With Physical Activity Among Visitors To Urban National Parks: Are There Group Differences

Science.gov (United States)

2015-05-15

1 = Baseball/ Softball 2 = Basketball 3 = Biking 4 = Bird Watching 5 = Boating (sailing, kayaking, canoeing) 6 = Fishing 7 = Flying a Kite 8...visit to Fort Dupont Park today: Select all that apply. 1 = Baseball/ Softball 2 = Basketball 3 = Biking 4 = Bird Watching 5 = Boating (sailing...select which of the following activities you did during your visit to Rock Creek Park today: Select all that apply. 1 = Baseball/ Softball 2

Loss muinasjuturaamatust / Agu Veetamm

Index Scriptorium Estoniae

Veetamm, Agu, 1953-

2004-01-01

Ballindaloch on üks väheseid Shoti losse, kus omanikud aastaringselt elavad. 450 aastat on loss kuulunud Macpherson-Grantide suguvõsale. Praegu on lossi omanikuks Clare Nancy Macpherson-Grant Russell, kelle kujundatud on kiviktaimla ja rosaarium. Lossi ajaloost, omanikest, ümberehitustest, ringkäigust lossis, pargist. 14 ill

From Redistribution to Recognition: How School Principals Perceive Social Justice

Science.gov (United States)

Wang, Fei

2016-01-01

Where there are people, there is social in/justice. Using Nancy Fraser's framework, this qualitative research examines how school principals perceive social justice in schools. Twenty-one elementary and secondary school principals were interviewed in the Greater Toronto Area. The study provides some empirical evidence on the ways social…

Tetanus: Questions and Answers

Science.gov (United States)

... given to adolescents and adults, usually as a single dose; the exception is pregnant women who should receive Tdap during each pregnancy. • Td: ... catch-up vaccinations. All adults should receive a single dose of Tdap as soon as ... women should receive Tdap during each preg- nancy. Adolescents ...

From Poetry to Music: "Northern Lullaby"

Science.gov (United States)

Cardany, Audrey Berger

2011-01-01

Nancy White Carlstrom's children's book, "Northern Lullaby," conjures through poetry the beauty of the Alaskan landscape in the evening. The book provides an opportunity for music teachers to help their students transform text and visual images to music. The author describes connections for reading comprehension in the general music…

Uvidet zad Dzheka Nikolsona i ne umeret! / Jevgeni Levik

Index Scriptorium Estoniae

Levik, Jevgeni

2004-01-01

Komöödiafilm "Parem hilja kui mitte kunagi" ("Something's Gotta Give") : režissöör Nancy Meyers : Ameerika Ühendriigid 2003 ja mängufilm "Tõlkes kaduma läinud" ("Lost In Translation") : režissöör Sofia Coppola : Ameerika Ühendriigid 2003

Judging children's participatory parity from social justice and the ...

African Journals Online (AJOL)

This article proposes a model for judging children's participatory parity in different social spaces. The notion of participatory parity originates in Nancy Fraser's normative theory for social justice, where it concerns the participatory status of adults. What, then, constitutes participatory parity for children? How should we judge ...

77 FR 14419 - Notice of Meeting, National Capital Memorial Advisory Commission

Science.gov (United States)

2012-03-09

... (the Commission) will meet at the National Building Museum, Room 312, 401 F Street NW., Washington, DC..., Room 312, 401 F Street NW., Washington, DC 20001. FOR FURTHER INFORMATION CONTACT: Ms. Nancy Young... Commission. Chairman, Commission of Fine Arts. Mayor of the District of Columbia. Architect of the Capitol...

78 FR 59771 - Proposed Information Collection (Create Payment Request for the VA Funding Fee Payment System (VA...

Science.gov (United States)

2013-09-27

... Payment Request for the VA Funding Fee Payment System (VA FFPS); a Computer Generated Funding Fee Receipt.... Title: Create Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated... through the Federal Docket Management System (FDMS) at www.Regulations.gov or to Nancy J. Kessinger...

Didactismo y juego

Directory of Open Access Journals (Sweden)

Alicia Fajardo M.

1989-04-01

Full Text Available Colombia, mi abuelo y yo. Pilar Lozano. Circulo de Lectores, Bogotá, 1987, 112 págs. Ilustraciones de Olga Cuéllar. Las cosas de la casa. Celso Román. Carlos Valencia Editores, Bogotá, 1988, 81 págs. Ilustraciones de Nancy Friedemann.

effects of Vitamin D deficiency on pregnancy outcomes.

African Journals Online (AJOL)

use of multi-vitamins and season at sampling. Low 25(OH)D levels ... The main source of vitamin D is en- dogenous ... as a urine dipstick test ≥2+, or more than 300 mg of protein in a ..... Longitudinal vitamin D status in preg- nancy and the ...

L'Entrainement a la Comprehension Ecrite des Etudiants Etrangers de la Faculte des Sciences (Reading Comprehension Training for Foreign Students in the Science Faculty). Melanges Pedagogiques, 1977.

Science.gov (United States)

Duda, R.; Regent, O.

The ability of foreign students to read non-scientific material efficiently is important for rapid social and cultural integration. This report describes the reading comprehension section of a French language course aimed at foreign students at the Nancy Science Faculty. Exercises are presented which cover morpho-syntactic, communicative and…

Student Pressure Subject of Debate

Science.gov (United States)

Gewertz, Catherine

2006-01-01

This article discusses student pressure as a subject of debate. The latest debate about schoolwork is being fueled by three recent books: "The Homework Myth" by Alfie Kohn, "The Case Against Homework" by Sara Bennett and Nancy Kalish, and "The Overachievers", by Alexandra Robbins, which depicts overextended high…

Impossible Practice and Theories of the Impossible: A Response to Helene Illeris's "Potentials of Togetherness"

Science.gov (United States)

Kallio-Tavin, Mira

2014-01-01

In a recent commentary in "Studies in Art Education," Helene Illeris (2013) discussed the idea of "performative experimental communities" via a critique of visual culture pedagogy and the romanticism of community-oriented art education in Nordic countries. Illeris underpinned her arguments with Jean-Luc Nancy's (1997)…

Measurement of relative permittivity of LTCC ceramic at different temperatures

Directory of Open Access Journals (Sweden)

Qiulin Tan

2014-02-01

Full Text Available Devices based on LTCC (low-temperature co-fired ceramic technology are more widely applied in high temperature environments, and the temperature-dependent properties of the LTCC material play an important role in measurements of the characteristics of these devices at high temperature. In this paper, the temperature-dependence of the relative permittivity of DuPont 951 LTCC ceramic is studied from room temperature to 500 °C. An expression for relative permittivity is obtained, which relates the relative permittivity to the resonant frequency, inductance, parasitic capacitance and electrode capacitance of the LTCC sample. Of these properties, the electrode capacitance is the most strongly temperature-dependent. The LTCC sample resonant frequency, inductance and parasitic capacitance were measured (from room temperature to 500 °C with a high temperature measurement system comprising a muffle furnace and network analyzer. We found that the resonant frequency reduced and the inductance and parasitic capacitance increased slightly as the temperature increases. The relative permittivity can be calculated from experimental frequency, inductance and parasitic capacitance measurements. Calculating results show that the relative permittivity of DuPont 951 LTCC ceramic ceramic increases to 8.21 from room temperature to 500 °C.

Analysis of proton exchange membrane fuel cell performance with alternate membranes

Energy Technology Data Exchange (ETDEWEB)

Wakizoe, Masanobu; Velev, O A; Srinivasan, S [Texas A and M Univ., College Station, TX (United States). Texas Engineering Experiment Station

1995-02-01

Renewed interest in proton exchange membrane fuel cell technology for space and terrestrial (particularly electric vehicles) was stimulated by the demonstration, in the mid 1980s, of high energy efficiencies and high power densities. One of the most vital components of the PEMFC is the proton conducting membrane. In this paper, an analysis is made of the performances of PEMFCs with Dupont`s Nafion, Dow`s experimental, and Asahi Chemical`s Aciplex-S membranes. Attempts were also made to draw correlations between the PEMFC performances with the three types of membranes and their physico-chemical characteristics. Practically identical levels of performances (energy efficiency, power density, and lifetime) were achieved in PEMFCs with the Dow and the Aciplex-S membranes and these performances were better than in the PEMFCs with the Nafion-115 membrane. The electrode kinetic parameters for oxygen reduction are better for the PEMFCs with the Aciplex-S and Nafion membranes than with the Dow membranes. The PEMFCs with the Aciplex-S and Dow membranes have nearly the same internal resistances which are considerably lower than for the PEMFC with the Nafion membrane. The desired membrane characteristics to obtain high levels of performance are low equivalent weight and high water content. (Author)

Experiences with a new film-screen system in pediatric chest radiography

International Nuclear Information System (INIS)

Leenen, A.; Brandt, G.A.; Riebel, T.; Marciniak, H.

1996-01-01

Purpose: To compare the X-ray images made by the Kodak InSight Pediatric Imaging System (InSight P) with conventional film-screen systems in pediatric chest radiography. Material and methods: The comparison involved chest radiographs made using Quanta-Fast-Detail/Cronex 4 (DuPont), Trimax 16/XDA (3 M) and DuPont UVR/UVL systems. The image quality of critical structures and the physical parameters of quantum interference, contrast and resolution were assessed. The energy path of the system was assessed by preparing density curves. Test conditions were in accordance with the latest guidelines of the Bundesaerztekammer (German Physicians' Association). Results: The mediastinal area, retrocardiac and paravertebral spaces and the peripheral vessels of the lung were all displayed more distinctly using InSight P. The reason for this seems to be a lower degree of quantum interference associated with this system. With tube voltages between 60 and 80 kV, InSight P displayed a relatively low degree of sensitivity. Conclusion: InSight P can be used to produce predominantly high quality chest radiographs on infants between one and five years of age. However, this system has limited sensitivity in the tube voltage range recommended by the German Physicians' Association. (orig.) [de

Studies of scintillator response to 60 MeV protons in a proton beam imaging system

Directory of Open Access Journals (Sweden)

Rydygier Marzena

2015-09-01

Full Text Available A Proton Beam Imaging System (ProBImS is under development at the Institute of Nuclear Physics, Polish Academy of Sciences (IFJ PAN. The ProBImS will be used to optimize beam delivery at IFJ PAN proton therapy facilities, delivering two-dimensional distributions of beam profiles. The system consists of a scintillator, optical tract and a sensitive CCD camera which digitally records the light emitted from the proton-irradiated scintillator. The optical system, imaging data transfer and control software have already been developed. Here, we report preliminary results of an evaluation of the DuPont Hi-speed thick back screen EJ 000128 scintillator to determine its applicability in our imaging system. In order to optimize the light conversion with respect to the dose locally deposited by the proton beam in the scintillation detector, we have studied the response of the DuPont scintillator in terms of linearity of dose response, uniformity of light emission and decay rate of background light after deposition of a high dose in the scintillator. We found a linear dependence of scintillator light output vs. beam intensity by showing the intensity of the recorded images to be proportional to the dose deposited in the scintillator volume.

Harvard Education Letter. Volume 26, Number 3, May-June 2010

Science.gov (United States)

Chauncey, Caroline T., Ed.

2010-01-01

"Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Unleashing the "Brain Power" of Groups in the Classroom: The Neuroscience behind Collaborative Work (Nancy Walser); (2) Putting AP to the Test: New Research Assesses the…

Serving the Community: A Small, Liberal Arts College Writing Center.

Science.gov (United States)

Rossini, Carol

The word "service" certainly conjures some undesirable connotations, and theorists such as Nancy Grimm propose that writing centers need to shed their service labels to attain respectability. In this paper, the writing center director of a small liberal arts college shares her perspective and juxtaposes that with Grimm's position that…

Harry Potter ja Scarlett käivad kohut / Ilona Martson

Index Scriptorium Estoniae

Martson, Ilona, 1970-

2001-01-01

Alice Randalli romaan "Tuul on läinud" - samad sündmused kui Margaret Mitchelli romaanis "Tuulest viidud", ainult neegerorjade vaatevinklist. Nancy Stofferi raamatud "Larry Potter ja tema parim sõber Lilly" ja "Legend Rah'ist ja Mugudest" ilmusid 1984. a. Joanne Kathleen Rowlingi "Harry Potter" lood aga valmisid hiljem

Civic Fragmentation or Voluntary Association? Habermas, Fraser, and Charter School Segregation

Science.gov (United States)

Wilson, Terri S.

2010-01-01

In this essay, Terri Wilson puts the argument developed by Kathleen Knight Abowitz that charter schools could be considered as counterpublic spaces into interaction with empirical research that explores patterns of voluntary self-segregation in charter schools. Wilson returns to the theoretical tension between Jurgen Habermas and Nancy Fraser over…

The Denaturation of Environmental Education: Exploring the Role of Ecotechnologies

Science.gov (United States)

Gough, Annette; Gough, Noel

2016-01-01

This article explores the changing ways "environment" has been represented in the discourses of environmental education and education for sustainable development (ESD) in United Nations (and related) publications since the 1970s. It draws on the writings of Jean-Luc Nancy and discusses the increasingly dominant view of the environment as…

A Comparison of HAART Outcomes between the US Military HIV Natural History Study (NHS) and HIV Atlanta Veterans Affairs Cohort Study (HAVACS)

Science.gov (United States)

2013-05-01

Acknowledgments The IDCRP HIV Working Group includes: Susan Banks, RN, CAPT Mary Bavaro, MD, Ionut Bebu, PhD, Helen Chun, MD, Nancy Crum- Cianflone, MD, MPH...Cathy Decker, MD, Conner Eggleston, LTC Tomas Ferguson, MD, COL Susan Fraser, MD, MAJ Joshua Hartzell, MD, MAJ Joshua Hawley, MD, LTC Gunther Hsue, MD

Micro-Recognition - Erving Goffman as Recognition Thinker

DEFF Research Database (Denmark)

Jacobsen, Michael Hviid; Kristiansen, Søren

2009-01-01

and civil inattention guide the conduct of people in many of their face-to-face encounters with each other. This article therefore shows how Goffman may in fact supplement many of the most fashionable and celebrated contemporary recognition theories as advanced by e.g. Nancy Fraser, Charles Taylor or Axel...

75 FR 61252 - Proposed Information Collection (Create Payment Request for the VA Funding Fee Payment System (VA...

Science.gov (United States)

2010-10-04

... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... information through the Federal Docket Management System (FDMS) at http://www.Regulations.gov or to Nancy J...

75 FR 61859 - Proposed Information Collection (Create Payment Request for the VA Funding Fee Payment System (VA...

Science.gov (United States)

2010-10-06

... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... Payment Request for the VA Funding Fee Payment System (VA FFPS); A Computer Generated Funding Fee Receipt... information through the Federal Docket Management System (FDMS) at http://www.Regulations.gov or to Nancy J...

Effects of Trade Restrictions on Imports of Steel.

Science.gov (United States)

1980-11-01

unfortunate that the report has little or demand for steel eqialion Yet results using the noingto say about steel esports . which have been sgnitiant...Sprull. Nancy. (Repinted from Economic Inquiry. Vol. XIV. No 94th annual convention of the American Psycho "Pubic Drug Treatment and Addict Crim," Jose 1

Affective telepathy, or the intuition of the heart: 'Persona' with 'Mulholland Drive'

NARCIS (Netherlands)

Laine, T.

2009-01-01

This paper investigates the affective dynamism of the cinematic experience in terms of the so-called intuition of the heart. Inspired by the writings of Jean-Luc Nancy, it shows how the affective circulation between the film and the spectator can be a matter of sharing rather than a consequence of

Navigating the Meanings of Social Justice, Teaching for Social Justice, and Multicultural Education

Science.gov (United States)

Cho, Hyunhee

2017-01-01

This article uses well-received contemporary scholarship--works by Iris Young, Nancy Fraser, Morva McDonald, Connie North, and Geneva Gay--to illuminate a high degree of coherence among the substantive meanings of social justice, teaching for social justice, and multicultural education. Based on these relationships, the article suggests that…

75 FR 56146 - Arts Advisory Panel; Meetings

Science.gov (United States)

2010-09-15

... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES National Endowment for the Arts Arts Advisory... amended, notice is hereby given that four meetings of the Arts Advisory Panel to the National Council on the Arts will be held at the Nancy Hanks Center, 1100 Pennsylvania Avenue, NW., Washington, DC 20506...

76 FR 78316 - National Endowment for the Arts; Arts Advisory Panel

Science.gov (United States)

2011-12-16

... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES National Endowment for the Arts; Arts Advisory..., notice is hereby given that eleven meetings of the Arts Advisory Panel to the National Council on the Arts will be held at the Nancy Hanks Center, 1100 Pennsylvania Avenue NW., Washington, DC, 20506 as...

Intimate Distance: Rethinking the Unthought God in Christianity

NARCIS (Netherlands)

Kate, L. ten

2008-01-01

The work of the French philosopher Jean-Luc Nancy shares with the thinkers of the ‘theological turn in phenomenology’ the programmatic desire to place the ‘theological’, in the broad sense of rethinking the religious traditions in our secular time, back on the agenda of critical thought. Like those

Author Details

African Journals Online (AJOL)

Abushady, Nancy M. Vol 13, No 1 (2015) - Articles Increased myeloperoxidase activity as an indicator of neutrophil-induced inflammation and sepsis in neonates. Abstract PDF. ISSN: 2134-8934. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

Research tools application for female fashion underwear comfort assesment

OpenAIRE

Andreia Salvan Pagnan

2016-01-01

Within the women's clothing of the universe's underwear were long an insignificant plan with regard to the development of new textile materials, shapes and colors. The panties that had been known as breeches or long underwear only became a necessity around the twentieth century with the vaporous dresses Christian Dior in the 50 Technological advances in the textile industry brought spandex created by the American laboratory DuPont's better known as the lycr...

FAR 13.5 Acquisition Streamlining: Observations and Recommendations for the Defense Logistics Agency

Science.gov (United States)

2011-04-01

revenues of nearly $41 billion that would put DLA in the top 60 of the Fortune 500 list, ahead of companies like American Express, DuPont and Coca ... Cola . • Employs about 27,000 civilian and military employees. • Supports nearly 1,900 weapon systems. • Manages eight supply chains and nearly 5...achieving performance objectives. Currently there are no reported efforts to incentivize the use of FAR 13.5. Given congressional sponsorship and

Finanční analýza

OpenAIRE

Špániková, Jana

2010-01-01

The subject of the bachelor thesis is financial analysis of company Zoeller system s.r.o.. The thesis has two parts, methodological and practical. Methodological part describes individual methods of financial analysis, which are used in practical part of thesis. The thesis contains analysis of company by absolute and ratio indicators, DuPont analysis, analysis of net working capital, calculation of economic value added and prediction of financial distress. The practical part also includes the...

Empirical Bayes Estimation of Proportions in Several Groups.

Science.gov (United States)

1981-01-01

Street NW Washington, DC 20208 Dr. William Graham Testing Directorate 1 Dr. Lorraine D. Eyde MEPCOM/MEPCT-P Personnel R&D Center Ft. Sheridan, IL...D-53 BONN 1, GERMANY Princeton, NJ 08540 1 Dr. Mark D. Reckase Dr. Gary Marco Educational Psychology Dept. Educational Testing Service University of...GED Testing Service, Suite 20 Columbia, SC 29208 One Dupont Cirle, NW Washington, DC 20036 1 PROF. FUMIKO SAMEJIMA DEPT. OF PSYCHOLOGY UNIVERSITY OF

Harvard Education Letter. Volume 24, Number 5, September-October 2008

Science.gov (United States)

Chauncey, Caroline, Ed.

2008-01-01

"Harvard Education Letter" is published bimonthly by the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Teaching 21st Century Skills: What Does It Look Like in Practice? (Nancy Walser); (2) Getting and Spending: Schools and Districts Share Lessons on the Effective Uses of…

The Relationship between School Climate, Trust, Enabling Structures, and Perceived School Effectiveness

Science.gov (United States)

Mayerson, Deborah R.

2010-01-01

The purpose of Deborah R. Mayerson was to assess the relative impact of climate, trust, and bureaucratic structure upon teachers' perceptions of organizational effectiveness. An existing data set compiled by Nancy Casella (2006) for her dissertation was analyzed. The data consisted of questionnaire responses of a random sample of 220 public school…

Reviewing Policy: Starting the Wrong Conversations--The Public School Crisis and "Waiting for Superman"

Science.gov (United States)

Swalwell, Katy; Apple, Michael W.

2011-01-01

The documentary "Waiting for Superman" has become one of those rare things, a (supposed) documentary that generates a wider audience. It also is one of the more recent embodiments of what Nancy Fraser (1989) labels as the "politics of needs and needs discourses." Dominant groups listen carefully to the language and issues that…

De duurzame controller neemt leiding in een traditie naar maatschappelijk verantwoord ondernemen

NARCIS (Netherlands)

Boersma-de Jong, Margreet F.

2015-01-01

Steeds meer dringt het besef door dat er geen andere weg meer is dan duurzaam ondernemen. Organisaties die dit inzien streven naar meer dan al- leen nanciële winstmaximalisatie: er moet ook winst worden gecreëerd voor de mens, samenleving en milieu. Als de MVO-ambities meer zijn dan window-dressing,

Methodological Pluralism and Narrative Inquiry

Science.gov (United States)

Michie, Michael

2013-01-01

This paper considers how the integral theory model of Nancy Davis and Laurie Callihan might be enacted using a different qualitative methodology, in this case the narrative methodology. The focus of narrative research is shown to be on "what meaning is being made" rather than "what is happening here" (quadrant 2 rather than…

Correction to: Comparing the UK EQ-5D-3L and English EQ-5D-5L Value Sets

NARCIS (Netherlands)

B. Mulhern (Brendan); Feng, Y. (Yan); K.K. Shah (Koonal); M.F. Janssen (Bas); M. Herdman (Michael); van Hout, B. (Ben); N. Devlin (Nancy)

2018-01-01

textabstractThe article Comparing the UK EQ-5D-3L and English EQ-5D-5L Value Sets, written by Brendan Mulhern, Yan Feng, Koonal Shah, Mathieu F. Janssen, Michael Herdman, Ben van Hout, Nancy Devlin was originally published electronically on the publisher’s internet portal (currently SpringerLink) on

Childhood malignancies in University of Abuja Teaching Hospital ...

African Journals Online (AJOL)

Prof Ezechukwu

2011-12-20

Dec 20, 2011 ... study period. Burkitt's lymphoma was the highest encountred malig- nancy, while medulloblastoma was least occurring. Only 36.9 percent. (N=17) of patients received che- motherapy. Of these, 6.5 percent. (n=3) completed therapy. Twenty nine percent of patients died. 4 percent of those that died had com-.

First report of microcephaly-capillary malformations syndrome in ...

African Journals Online (AJOL)

Nataliya S. Demikova

2017-09-01

Sep 1, 2017 ... nancy ended in a medical abortion, the second pregnancy ended in ... third pregnancy. The parents' fourth pregnancy was complicated by a threatened miscarriage at 20 weeks of gestation. Intrauterine growth retardation was diagnosed at 30 ... A CT brain scan at the age of 3.5 months showed the growing.

Bunburra Rockhole: A New Anomalous Achondrite

Czech Academy of Sciences Publication Activity Database

Bland, P.A.; Spurný, Pavel; Greenwood, R.C.; Towner, M.C.; Bevan, A.W.R.; Bottke jr., W.F.; Shrbený, Lukáš; McClafferty, T.; Vaughan, D.; Benedix, G.K.; Franchi, I.A.; Hough, R.M.

2009-01-01

Roč. 72, Supplement (2009), A34-A34 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * anomalous achondrite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

Cosmogenic Radionuclides in Bunburra Rockhole Achondrite Fall

Czech Academy of Sciences Publication Activity Database

Welten, K.C.; Nishiizumi, K.; Caffee, M. W.; Meier, M.M.M.; Bland, P.A.; Spurný, Pavel

2009-01-01

Roč. 44, Supplement (2009), A216-A216 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * cosmogenic radionuclide concentrations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

2002 Department of Defense Survey of Health Related Behaviors Among Military Personnel

Science.gov (United States)

2003-10-01

development, iv Mr. Russ Vandermaas-Peeler led the data collection task, and Ms. Antonieta Diaz coordinated day-to-day activities with the field sites. Ms...Wright-Woods CPT Candace Adair CPT Karen Gremba TSGT Diane Gustafson MAJ Nancy Klein LT Alicia LaPray MSGT Sharon Proxmire CPT Iris Reedom LT Daniel C

Child-Centered Play Therapy: Nancy from Baldness to Curls.

Science.gov (United States)

Barlow, Karen; And Others

1985-01-01

Presents a case study of a four-year-old girl who had pulled out all her hair. The child's responsiveness to play therapy is described, and implications for the use of play therapy in school counseling situations are described. (JAC)

Glazunov: From the middle ages, Op.79 / Nancy Malitz

Index Scriptorium Estoniae

Malitz, Nancy

1990-01-01

Uuest heliplaadist "Glazunov: From the middle ages, Op.79, Scenes de ballet, Op.52; Liadov: A musical snuffbox, Op.31. Scottish National Orchestra, Neeme Järvi. Chandos CD cassette ABTD 1432; CD CHAN 8804"

Simultaneous determinations of U-Pb age and REE abundances for zircons using AfF excimer laser ablation-ICPMS

International Nuclear Information System (INIS)

Iizuka, Tsuyoshi; Hirata, Takafumi

2004-01-01

Using a laser-ablation-inductively coupled plasma mass spectrometer (LA-ICPMS), U-Pb age and rare earth element (REE) abundances have been determined simultaneously from a single 20 μm ablation pit of zircon. The laser ablation system utilizing 193 nm wave-length ArF excimer laser produces stable and reproducible signal intensities resulted in good precisions on measurements of element concentrations and isotopic ratios. Because of the higher energy density of the deep ultra-violet laser beam, ablation fractionation between Pb and U were reduced even with the prolonged ablation, and thus accuracy of Pb-U age was improved significantly. A chicane-type ion lens system was applied to a quadrupole-based ICPMS instrument. With the chicane ion lens, higher elemental sensitivity (4 times or light mass range and 3 times for mid to heavy mass range) and lower white background ( 238 U- 206 Pb ages for Nancy standard zircon (Nancy 91500), SHRIMP calibration standard zircon (SL13) and Antarctic zircon (PMA7) obtained in this study were 1064 ± 24 Ma, 569 ± 78 Ma and 2438 ± 101 Ma (2-sigma), respectively. Relative age differences from previous reports were 0.2%, 0.4% and 3.2% respectively, demonstrative of high reliability of the method. The REE abundances in zircon samples were calibrated using a NIST 610 glass standard reference material. The resulting REE abundance data for zircons (Nancy 91500 and SL13) show good agreement with those for literature values within the analytical precision of ∼20%. The matrix effect that may occur between the synthetic glass standard and zircon crystals is obviously smaller than the precision and thus negligible for this precision levels. The data presented here demonstrate clearly that the combination of ArF excimer laser an ICPMS equipped with the chicane ion lens has a potential to become a significant tool for zircon geochemistry. (author)

PREFACE: 6th EEIGM International Conference on Advanced Materials Research

Science.gov (United States)

Horwat, David; Ayadi, Zoubir; Jamart, Brigitte

2012-02-01

The 6th EEIGM Conference on Advanced Materials Research (AMR 2011) was held at the European School of Materials Engineering (EEIGM) on the 7-8 November 2011 in Nancy, France. This biennial conference organized by the EEIGM is a wonderful opportunity for all scientists involved in the EEIGM programme, in the 'Erasmus Mundus' Advanced Materials Science and Engineering Master programme (AMASE) and the 'Erasmus Mundus' Doctoral Programme in Materials Science and Engineering (DocMASE), to present their research in the various fields of Materials Science and Engineering. This conference is also open to other universities who have strong links with the EEIGM and provides a forum for the exchange of ideas, co-operation and future orientations by means of regular presentations, posters and a round-table discussion. This edition of the conference included a round-table discussion on composite materials within the Interreg IVA project '+Composite'. Following the publication of the proceedings of AMR 2009 in Volume 5 of this journal, it is with great pleasure that we present this selection of articles to the readers of IOP Conference Series: Materials Science and Engineering. Once again it represents the interdisciplinary nature of Materials Science and Engineering, covering basic and applicative research on organic and composite materials, metallic materials and ceramics, and characterization methods. The editors are indebted to all the reviewers for reviewing the papers at very short notice. Special thanks are offered to the sponsors of the conference including EEIGM-Université de Lorraine, AMASE, DocMASE, Grand Nancy, Ville de Nancy, Region Lorraine, Fédération Jacques Villermaux, Conseil Général de Meurthe et Moselle, Casden and '+Composite'. Zoubir Ayadi, David Horwat and Brigitte Jamart

The Millennium Cohort Family Study: A Prospective Evaluation of the Health and Well-Being of Military Service Members and Their Families

Science.gov (United States)

2014-06-10

psychology , family, military, epidemiology, mental health, deployments Correspondence Nancy Crum-Cianflone, Deployment Health Research Department...American Psychological Association, 2007; Siegel et al., 2013; US Army Medical Research and Materiel Command, 2013). Although studies on military...functional health Modules on common types of mental disorders: depression, anxiety, panic syndrome, somatoform symptoms, alcohol abuse, bulimia nervosa

The baby has not come: obstructed labour | MacKeith | South Sudan ...

African Journals Online (AJOL)

The baby has not come: obstructed labour. Nancy MacKeith, Wal Bichiok Wur. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's ...

USAs avati suurim Balti kunsti näitus / Neeme Raud

Index Scriptorium Estoniae

Raud, Neeme, 1969-

2002-01-01

New Jerseys Rutgersi ülikooli kunstimuuseumis on väljas 190 Eesti, Läti ja Leedu kunstniku tööd Norton ja Nancy Dodge'i mitte-konformistliku nõukogude kunsti kollektsioonist, mille omanikud ülikoolile kinkisid. Näitusekataloogi artiklid on kirjutanud Juta Kivimäe, Eha Komissarov, Sirje Helme ja kanadalane Eha Sepp

Pursuing the Depths of Knowledge

Science.gov (United States)

Boyles, Nancy

2016-01-01

Today's state literacy standards and assessments demand deeper levels of knowledge from students. But many teachers ask, "What does depth of knowledge look like on these new, more rigorous assessments? How do we prepare students for this kind of thinking?" In this article, Nancy Boyles uses a sampling of questions from the PARCC and SBAC…

II BOOK REVIEW "Radiology Where There Are no Radiologists"

African Journals Online (AJOL)

reactions to roentgen contrast media, the indica- tions for and the interpretation of radiographs of the chest, skeleton, spine, skull, abdomen, preg- nancy and the urinary tract. They do this with the aid of several diagrams and high quality radiographs. They cover most of the common diseases that are met in major hospitals in ...

Mean Girls (and Boys): Cyberbullying and What Can Be Done about It

Science.gov (United States)

Fredrick, Kathy

2009-01-01

A basic definition of "cyberbullying" is provided by Nancy Willard, director of the Center for Safe and Responsible Internet Use. She has defined cyberbullying as using the Internet or other mobile devices to send or post harmful or cruel text or images to bully others. The advent of social networking has highlighted cyberbullying. Library media…

Best Collaborative Publication Announced during Spring Research Festival Week | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer The winner of the 2012 competition for the best collaborative publication was announced on May 7, as part of the lead-up to the Spring Research Festival sponsored by the National Interagency Confederation for Biological Research (NICBR) and the National Cancer Institute at Frederick on May 8 and 9.

Rhetoric and Gender in Jane Austen's "Persuasion."

Science.gov (United States)

Walzer, Arthur E.

1995-01-01

Argues for a reading of Jane Austen's "Persuasion" that undermines Joseph Duffy's reading of the novel as a commentary on shifting social class structures, and which bolsters Nancy Armstrong's reading as a commentary on female voice and the values of the domestic household. Interprets the novel in the light of 18th-century rhetorical…

Light Noble Gases and a Cosmic Ray Exposure Age for the Bunburra Rockhole Meteorite

Czech Academy of Sciences Publication Activity Database

Meier, M.M.M.; Bland, P.A.; Welten, K.C.; Spurný, Pavel; Baur, H.; Wieler, R.

2009-01-01

Roč. 44, Supplement (2009), A138-A138 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * light noble gas * concentration Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

Reflections on Generativity and Flourishing: A Response to Snow's Kohlberg Memorial Lecture

Science.gov (United States)

Snarey, John

2015-01-01

In his response to Nancy's Snow's "Generativity and Flourishing" (EJ1077701), John Snarey proposes that during the first seasons of one's life one is nurtured by one's parents, but during the latter seasons of life, one is nurtured by one's children. Generative parents interact with their offspring in ways that offer valuable support for…

Alternative Education and Social Justice: Considering Issues of Affective and Contributive Justice

Science.gov (United States)

Mills, Martin; McGregor, Glenda; Baroutsis, Aspa; Te Riele, Kitty; Hayes, Debra

2016-01-01

This article considers the ways in which three alternative education sites in Australia support socially just education for their students and how injustice is addressed within these schools. The article begins with recognition of the importance of Nancy Fraser's work to understandings of social justice. It then goes on to argue that her framework…

The Problems with Language Policy and Planning

Science.gov (United States)

Leibowitz, Brenda

2015-01-01

This article begins with a critique of dominant approaches to language policy in education that are based on the notion of "rights" and "peoples." It makes the case for an approach that is based on the tripartite view of social justice, as articulated by Nancy Fraser. This view of social justice sees a complementary…

Educating Young Giants: What Kids Learn (and Don't Learn) in China and America

Science.gov (United States)

Pine, Nancy

2012-01-01

In her groundbreaking book, Educating Young Giants, Nancy Pine reveals how reliance on antiquated teaching methods and ineffectual reform efforts has left youth in the United States and China ill-equipped for the demands of modern technology and the global economy. Transporting us into Chinese elementary and high school classrooms, Pine, a U.S.…

Reasoned opinion on the modification of the existing MRLs for indoxacarb in various crops

OpenAIRE

European Food Safety Authority

2012-01-01

In accordance with Article 6 of Regulation (EC) No 396/2005, Spain received an application from the Spanish Federation of Associations of Producers and Exporters of Fruits, Vegetables, Flowers and Live Plants (FEPEX) to modify the existing MRLs for the active substance indoxacarb in raspberries and strawberries. In accordance with Article 6 of Regulation (EC) No 396/2005, The Netherlands received an application from DuPont Danmark to modify the existing MRLs for the active substance ...

Adult Learning and the Establishment of Training Programs in Bureaucratic-Like Organizations

Science.gov (United States)

1986-05-01

environment, and provide the methodology and resources required. 3. Product Use Training for Customers at DuPont ( Green , 8 1-85) When Du Pont developed a...contains pedorniance.-relate(, lot behavors that foremen, their supervsors and their subordinates have reported) as critcal ’to the foreman S job success...Please consider the above-named individual s behavior on the loo for the past three months Do not ccnsider other foremen or tlOs rnuividua;’s behavor at

A New Look for the Shopping Mall

Science.gov (United States)

1985-01-01

STRUCTO-FAB, a product of Owens-Corning Fiberglas Corporation, is a lightweight but extremely durable tent-like material made of Fiberglas coated with Teflon. It transmits daylight with a reduced need for artificial lighting. It is an outgrowth of a material formulated by NASA in 1967 as a new space suit fabric. Owens-Corning and DuPont provided the original material, which was the basis for Structo-Fab, a permanent architectural fabric used for shopping malls, sports stadiums, etc.

Tribute to Daniel Simon

CERN Multimedia

2011-01-01

Daniel Simon, PS Division Leader from 1994 to 1999, died on 2 June, 2011, at the age of 74, in Nancy. CERN owes him for a great number of contributions to the experimental areas around the PS and the existence of the Antiproton Decelerator (AD).   Daniel came to CERN in 1962 from the University of Nancy. He first worked in the Nuclear Physics Apparatus (NPA) Division on the electrostatic separators for the secondary beams at the PS, a subject he also chose for his thesis. Then, as a member of the PS-Division, he designed a variety of beam lines, including those providing protons and antiprotons to ICE, the decisive experiment for CERN to launch the antiproton project, based on stochastic cooling. His contributions to the initial layout and further evolution of the experimental areas of LEAR were essential for the success of the LEAR programme. He subsequently drove the decision and worked on the conversion of LEAR into LEIR for the provision of lead-ions to the LHC. He was one of the leaders of t...

Recycle Runway

Science.gov (United States)

Stephens, Pam

2009-01-01

Nancy Judd has been called a folk artist, an outsider artist, and a designer--all characterizations that she tends to shirk. Perhaps if labels are needed, environmental artist educator is more appropriate. Judd lives and works in Santa Fe, New Mexico. She dedicates much of her time to creating art that raises public awareness of environmental…

Browse Title Index

African Journals Online (AJOL)

Items 76 - 100 of 1853 ... Vol 27, No 3 (1992), A new record of Craspedacusta sowerbii (Cnidaria: Limnomedusae) from southern Africa, Abstract PDF. Nancy A. Rayner, C.C. Appleton. Vol 5, No 2 (1970), A new record of a moerisiid hydroid from South Africa, Abstract PDF. NAH Millard. Vol 27, No 4 (1992), A new sandperch, ...

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

TIMP2 gene polymorphisms are associated with hypertension in patients with myocardial infarction. José Manuel Rodríguez-Pérez Nancy Martínez-Rodríguez Gilberto Vargas-Alarcón Maite Vallejo Irma Eloisa Monroy-Muñoz Carlos Posadas-Romero Eric Kimura-Hayama Teresa Juárez-Cedillo José Manuel Fragoso ...

Browse Title Index

African Journals Online (AJOL)

Items 351 - 400 of 412 ... Vol 28, No 3 (2009), Tony Yengeni's ritual slaughter: Animal anti-cruelty vs. Culture, Abstract. K Behrens. Vol 25, No 1 (2006), Torturers and the tortured, Abstract. Nancy Sherman. Vol 28, No 4 (2009), Touched by genius: on animal and madmen, Abstract. R ten Bos. Vol 31, No 3 (2012), Towards ...

The Intelligence Revolution: A Historical Perspective

Science.gov (United States)

1988-10-01

dimension. Orbis 24:771-86, Winter 1981. Gray, Colin S. Moscow is cheating. Foreign Polic No.56:141-152, 1984. Knight, Amy W. The KGB’s special... Bamford , James. The puzzle palace: a report on America’s most secret agency. Boston, MA: Houghton Mifflin, 1982. (UB 251 .U5 B35 1982) Braswell, Nancy S

Participating Unequally: Student Experiences at UWC

Science.gov (United States)

Clowes, Lindsay; Shefer, Tamara; Ngabaza, Sisa

2017-01-01

This paper uses Nancy Fraser's concept of participatory parity to reflect on data gathered by and from third year students in a final year research module in the Women's and Gender Studies Department at the University of the Western Cape in 2015. During the course students developed a research proposal, collected and shared data with other…

New Location Improves Efficiency | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer The physical proximity of the SAIC-Frederick Intellectual Property (IP) Office to the NCI Technology Transfer Center (NCI-TTC) is one of the many benefits of being at the Advanced Technology Research Facility (ATRF), according to Courtney Silverthorn, Ph.D. Being in one location “has increased the effectiveness of both informal communication and

A Novel Ras Effector Pathway Found to Play Significant Role in Tumor Suppression | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer; photo by Richard Frederickson, Staff Photographer Normal cells have mechanisms to prevent the development of cancer. Among these is a type of tumor suppressor mechanism known as oncogene-induced senescence, or OIS, which halts the uncontrolled growth of cells caused by mutations in oncogenes. The oncogene Ras plays a crucial role in inducing OIS

Livres | Page 10 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

African Urban Harvest : Agriculture in the Cities of Cameroon, Kenya and Uganda. Au cours des deux dernières décennies, comment l'agriculture urbaine a-t-elle évolué dans les pays de l'Afrique subsaharienne ? Directeur(s) : Gordon Prain, Nancy Karanja, et Diana Lee-Smith. Maison(s) d'édition : Springer, CIP, CRDI.

Lady Astor's Campaign for Nursery Schools in Britain, 1930-1939: Attempting to Valorize Cultural Capital in a Male-Dominated Political Field

Science.gov (United States)

Brehony, Kevin J.

2009-01-01

This article examines the work of Lady Nancy Astor (1879-1964) in campaigning for nursery education and nursery schools in Britain from the late 1920s until the Second World War. Arguably no elected politician in England at any time, including the present, has identified themselves more closely with the cause of nursery schooling in Britain.…

Relationship between CEO remuneration and company financial performance in the South African retail and consumer goods sector

Directory of Open Access Journals (Sweden)

Mark Bussin

2015-04-01

Full Text Available Purpose: This study was motivated by the need to better understand the effects of the global financial crisis in 2008 on the relationship between company financial performance and CEO guaranteed cost to company (CTC. The aim of this study was to understand the relationship between company financial performance using DuPont analysis and CEO guaranteed CTC in the South African retail and consumer goods sector. Design: The research was a quantitative, archival study of companies listed on the Johannesburg Stock Exchange (JSE, measured over a period of six years (2006–2011. The statistical analysis included regression and correlation analysis. Findings: The research found that CEO guaranteed CTC has shown no sensitivity towards company financial performance in terms of DuPont analysis over the six-year period, which included the global financial crises in 2008. Furthermore, a negative relationship existed between the return on equity and the guaranteed CTC of CEOs in the retail and consumer goods sector during this period. Practical implications: The findings suggest that there is misalignment between company strategy and performance and the guaranteed CTC of CEOs. A practical implication would be to have independent and competent remuneration committees ensuring alignment of the interests of a company with those of its leaders in this regard.

Reduction of patient dose delivered by CHR diagnostic x-ray examinations

International Nuclear Information System (INIS)

Evans, R.D.; Schlenker, R.A.

1978-01-01

Three changes in technique have been made which reduce the x-ray dose delivered by diagnostic examinations of patients of the Center for Human Radiobiology (CHR): Kodak Lanex Regular screens and Kodak Ortho G film have been substituted for DuPont Cronex Parspeed screens and DuPont Cronex 4 film for five projections in the MIT examinations; 3 mm Al added filtration is now used in place of 1 mm Al added filtration in the ANL examination; improvements in collimation for the ANL examination have been made. Use of the new screen-film combination at MIT has reduced the mean dose to the active marrow of the female RANDO phantom from 606 +- 69 mrad to 235 +- 16 mrad; it has reduced the ovary dose from 606 +- 40 mrad to 291 +- 19 mrad and has left the breast dose unchanged at 333 +- 103 mrad. The change from 1 mm Al to 3 mm Al added filtration at ANL, without changes in collimation, would reduce the mean marrow dose in the phantom from 232 +- 14 mrad to 175 +- 26 mrad, reduce the ovary dose from 243 +- 25 mrad to 162 +- 38 mrad and reduce the breast dose from 388 +- 35 mrad to 226 +- 9 mrad. The changes in collimation at ANL should reduce these doses even further but the quantitative effect has not been ascertained

Influence of fluorosurfactants on hydrate formation rates

Energy Technology Data Exchange (ETDEWEB)

Kim, C.U.; Jeong, K.E.; Chae, H.J.; Jeong, S.Y. [Korea Reasearch Inst. of Chemical Technology, Alternative Chemicals/Fuel Research Center, Yuseong-Gu, Daejon (Korea, Republic of)

2008-07-01

Gas hydrates, or clathrates, are ice-like solids that forms when natural gas is in contact with liquid water or ice under high pressure and low temperature. There is significant interest in studying the storage and transportation of gas in the form of hydrates. However, a critical problem impacting the industrial application of gas hydrates for storage and transportation of natural gas is the slow formation rate of natural gas hydrate. Researchers have previously reported on the promotion effect of some additives on gas hydrate formation and hydrate gas content. Fluorosurfactants are significantly superior to nonfluorinated surfactants in wetting action, as well as stability in harsh environments, both thermal and chemical. This paper discussed an experimental investigation into the effects of fluorosurfactants with different ionic types on the formation of methane hydrate. The surfactants used were FSN-100 of DuPont Zonyl as non-ionic surfactant and FC-143 of DuPont as anionic surfactant. The paper discussed the experimental apparatus for methane hydrate formation. It also discussed hydrate formation kinetics and the series of hydrate formation experiments that were conducted in the presence of fluorosurfactants. Last, the paper explored the results of the study. It was concluded that anionic fluorosurfactant of FC-143 had a better promoting effect on methane hydrate formation compared with nonionic surfactant of FSN-100. 8 refs., 2 tabs., 2 figs.

Molecular characterization of diarrheagenic Escherichia coli strains from stools samples and food products in Colombia

OpenAIRE

Rúgeles, Laura Cristina; Bai, Jing; Martínez, Aída Juliana; Vanegas, María Consuelo; Gómez-Duarte, Oscar Gilberto

2010-01-01

The prevalence of diarrheagenic E. coli in childhood diarrhea and the role of contaminated food products in disease transmission in Colombia are largely unknown. The aim of this study is to identify E. coli pathotypes, including E. coli O157:H7, from 108 stool samples from children with acute diarrhea, 38 meat samples and 38 vegetable samples. Multiplex PCR and Bax Dupont systems were used for E. coli pathotype detection. Eighteen (9.8%) E. coli diarrheagenic pathotypes were detected among al...

Intramolecular Charge Transfer of Conjugated Liquid Crystal Ferrocene Macromolecules - Synthesis and Characterization

Science.gov (United States)

2016-04-12

Bello 2800 Santiago, Chile 10. SPONSOR/MONITOR’S ACRONYM(S) AFRL/AFOSR IOS 11. SPONSOR/MONITOR’S REPORT NUMBER(S) AFRL-AFOSR-CL-TR-2016-0012   12...properties are of interest because polarized light emitters or light absorption devices, such as OLEDS, solar cells or wave guides, filters and Faraday...DSC) analyses were carried out on a DuPont 951 instrument under nitrogen at a heating rate of 10 °C/min. Small and wide angle X ray scattering

Thermophysical Properties of Aircraft Structural Materials in Solid and Molten States. A Comprehensive Survey of Available Data and Feasibility Study of Estimation and Measurement.

Science.gov (United States)

1974-08-01

methylmethacrylate and 0-100% methacrylic acid . 25-300 90025 Polymethacrylic acid . 50-200 66583 Polyethylm ethacrylate, poly-n-butyl acrylate, and...Polyacrylic acid and some of its salts (H, Na, Cu, Hg). 10. Lucite "Lucite" is a trade name of DuPont for polymethylmethacrylate (PMMA). The other trade name...2.2 40338 7.13 mm before and after methacrylate) fading. Poly(n-butyl 300 2.0-15.0 19814 methacrylate) Poly(acrylic acid ) 300 3-7 34840 Poly( ethylene

The primitives of Santa Clara of Ubeda: stylistic and iconographic study, critical appraisals and vicissitudes of a dispersed heritage

Directory of Open Access Journals (Sweden)

Clara Beltrán Catalán

2016-12-01

Full Text Available The authors study the stylistic and iconographic aspects of a collection of paintings on wood dating from the 15th and 16th centuries, originally in the Royal Monastery of Santa Clara at Úbeda. This collection was sold in the 1920s with the participation of the antique dealer Celestino Dupont. The research is complemented by an analysis of the critical appraisals given to these works and their history since their introduction into the art market.

Double cross-linked polyetheretherketone proton exchange membrane for fuel cell

CSIR Research Space (South Africa)

Luo, H

2012-04-01

Full Text Available and separating the fuel from oxidant. A polyperfluorosulfonic acid ionomer Nafion? (developed by Dupont) is the mostly used proton exchange membrane in PEMFCs, because of its high proton conductivity and excellent chemical stability [3, 4]. However, the high...-Methyl-2-pyrrolidinone. After the solution was homogenized by stirring, the polymer solution was cast on a glass Petri dish. The solvent was then removed in a vacuum oven at 130 ?C. The membrane was peeled off from the Petri dish. Thereafter...

E.I. duPont de Nemours & Co., Process Section Manufacturing Division, November 1956

Energy Technology Data Exchange (ETDEWEB)

NONE

1956-12-15

This document presents monthly progress at the Savannah River Plant in the 100, 200, 300, and 400 Areas. In the 100 Area (reactors), the power ascension program, the productivity improvement program and general progress is given. Tritium processing, 200-F increased capacity, and waste disposal are reported for the solvent extraction plants in the 200 Area. The increased productivity program is reported for the 300 Area. Dana plant activities and 400-D progress are reported in the 400 area report (heavy water).

Feature-based Detection and Discrimination at DuPont's Lake Success Business Park, Connecticut

National Research Council Canada - National Science Library

Keiswetter, Dean A

2007-01-01

The objective of this demonstration was to determine if laser-positioned, high-density EM61 data acquired in a moving survey mode could support feature-based discrimination decisions for a canopied...

Eesti on USA uus lemmik / Argo Ideon

Index Scriptorium Estoniae

Ideon, Argo, 1966-

2007-01-01

President Toomas Hendrik Ilvese visiidist Washingtoni, kohtumistest USA presidendi George W. Bushi, asepresident Dick Cheney, asevälisminister John Negroponte, kaitseminister Robert M. Gates'i, USA Kongressi esindajatekoja spiikri Nancy Pelosi ja kongresmenidega. Eestil õnnestus korraldada USA pealinnas kohtumised, mille järjekorras ootab hulk palju suuremaid riike. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

The OSS Model and the Future of the SOF Warrior

Science.gov (United States)

2011-11-01

historians served as academic advisors to the project: Dr. Nancy W. Collins, Columbia University; Dr. Troy Sacquety, USASOC historian; and Mr. Rob Townley ...December 2010. 23 Rob Townley , Conversation with OSS historian and descendant of OSS veteran, November 2010. 24 Careers, CIA, available at https...Operations Group (OG) officers. 32 29 Rob Townley , 2010. 30 Although this quote is commonly

Rein and Zheng Elected to American Academy of Microbiology | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer Earlier this year, Alan Rein, Ph.D., and Zhi-Ming (Thomas) Zheng, M.D., Ph.D., were elected to fellowship in the American Academy of Microbiology, the honorific leadership group within the American Society for Microbiology (ASM). They were among 88 microbiologists who were elected to the academy “through a highly selective, peer-review process,

Development of the isotopic analysis of individual macroparticles: a study of desert dust and interplanetary dust

International Nuclear Information System (INIS)

Aleon, Jerome

2001-01-01

During this thesis a new analytical technique has been developed to allow the determination of isotopic ratios in microparticles. This technique is based on the imaging properties of the IMS 1270 ion microprobe in CRPG in Nancy. The development of quantitative isotopic imaging allows the determination of the "1"8O/"1"6O ratio of individual macroparticles having a size [fr

Software Training Classes Now Open | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer                                            Data Management Services, Inc. (DMS), has announced the opening of its spring session of software training classes, available to all employees at NCI at Frederick. Classes begin on March 31 and run through June 30.

Gut Microorganisms Found Necessary for Successful Cancer Therapy | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer Humans play host to trillions of microorganisms that help our bodies perform basic functions, like digestion, growth, and fighting disease. In fact, bacterial cells outnumber the human cells in our bodies by 10 to 1.1 The tens of trillions of microorganisms thriving in our intestines are known as gut microbiota, and those that are not harmful to

A utilização das imagens de radar meteorológico em Climatologia

Directory of Open Access Journals (Sweden)

Marcelo Fragoso

1996-05-01

Full Text Available WEATHER RADAR IMAGE IN CLIMATOLOGY - After a brief overview about weather radar as a remote sensing instrument, some problems concerning the use of radar images are discussed. The great interest of radar images as a tool in Climatology is pointed out. Finally, a case study about two rainfall events in Nancy (France in April 1995 is presented.

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 399 ... Geoffrey R. Atelu, Nancy Duah, Michael D Wilson. Vol 44, No 3 (2010), Case control study to determine the factors associated with leprosy in the Sene ... A.I Gidwani, S.A Gidwani, A Khan, J.G Carson. Vol 44, No 2 (2010), Congenital malaria in newborn twins, Abstract PDF. DA Opare. Vol 38, No 1 ...

Charity with an arm twist. Senate hearing starts the ball rolling on tougher community benefits standard, greater federal oversight of not-for-profits.

Science.gov (United States)

Becker, Cinda

2006-09-18

A Senate hearing last week helped boost not-for-profit hospitals' chances of facing a new standard for reporting community benefits. At stake for hospitals are billions in tax breaks. The standard for exemption hasn't been modified since 1969, and "has not kept up with the substantial unfunded health needs of communities," says Nancy Kane, right, a member of MedPAC.

Department of Defense 2014 Climate Change Adaptation Roadmap

Science.gov (United States)

2014-06-01

CREDIT: NANCY JONESBONBREST, PEO C3T HATCHLINGS FROM ENDANGERED SEA TURTLES ARE RELEASED INTO THE ATLANTIC OCEAN NEAR KENNEDY SPACE CENTER/CAPE...environmental compliance requirements. • Stressed threatened and endangered species and related ecosystems, on and adjacent to DoD installations...resulting in increased endangered species and land management requirements. • Increased operational health surveillance and health and safety risks

IL-27 Found to Play Significant Role in Conferring HIV Resistance | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer The human immunodeficiency virus (HIV) targets specific immune cells in the body known as macrophages because these are the cells that eliminate foreign material such as bacteria or viruses. HIV is able to reproduce and spread throughout the body if it can avoid destruction by macrophages. A recent study by Lue Dai, Ph.D., and colleagues revealed

Cheyenne-Laramie County Economic Development Strategy

Science.gov (United States)

1986-06-01

Chamber of Commerce John Etchepare Warren Livestock Co. Shirley Francis Laramie County Commissioner Nancy Gire Economic Development Planner, Cheyenne...County Unamounoed 13 Industrial Development Association of Cheyenne- justifloatio Laramie County (IDAC-LC) Greater Cheyenne Chamber of Commerce (GCCC...February 10-21, 1986, in the Greater Cheyenne Chamber of Commerce offices. With a few excep- tions, BBC project team leaders met with each person

Transcription factors: normal and malignant development of blood cells

National Research Council Canada - National Science Library

Ravid, Katya; Licht, Jonathan

2001-01-01

... and the Development of the Erythroid Lineage James J. Bieker 71 II TRANSCRIPTION FACTORS AND THE MYELOID LINEAGE 85 6 RUNX1(AML1) and CBFB: Genes Required for the Development of All Definitive Hematopoietic Lineages 87 Nancy A. Speck and Elaine Dzierzak 7 PU.1 and the Development of the Myeloid Lineage Daniel G. Tenen 103 vvi CONTENTS 8 CCAAT/Enhancer-...

Genetics Research Discovered in a Bestseller | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer One morning in early January, Amar Klar sat down at his computer and found an e-mail with a curious message from a colleague. While reading a bestselling novel, The Marriage Plot by Jeffrey Eugenides, his colleague, a professor at Princeton University, found a description of research on yeast genetics that was surprisingly similar to Klar’s early

AdvanceVT Newsletter: February 2004

OpenAIRE

AdvanceVT

2004-01-01

Inside this issue: Today's Leadership Seminar; Women's Month Reception; Child Care Survey National Science Foundation The AdvanceVT Team Elizabeth Creamer, Assessment Director Associate Professor of Educational Leadership and Policy Studies Catherine Eckel, ADVANCE Professor Professor of Economics Patricia Hyer, Principle Investigator Associate Provost for Academic Administration Barbara Johnson, Administrative Assistant Peggy Layne, Project Coordinator Nancy Love, Co-PI and ADVANCE Pro...

Comparative Assessment of Copper-Coated Kapton: Analysis of Microclad from Several Manufacturing Lots

Energy Technology Data Exchange (ETDEWEB)

Martz, Joseph Christopher [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Spearing, Dane Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Labouriau, Andrea [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Judge, Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kelly, Daniel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dirmyer, Matthew R. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Milenski, Helen Marie [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Patterson, Brian M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sandoval, Cynthia Wathen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Usov, Igor Olegovich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Beaux, Miles Frank II [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Henderson, Kevin C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Torres, Joseph Angelo [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Edwards, Stephanie Lynn [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vodnik, Douglas R. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Keller, Jennie [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mccabe, Rodney James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Livescu, Veronica [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Cowan, Joseph Sarno [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Aragonez, Robert J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Tokash, Justin Charles [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lawrence, Samantha Kay [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Leon Brito, Neliza [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-04-03

Microclad is a composite material consisting of a thin copper coating applied on a single side over a Kapton substrate. Kapton is the commercial designator for polyimide supplied by DuPont. Microclad is a key material in detonator manufacture and function. Detonators which utilize Microclad function when a large current applied through a thin bridge etched into the copper produces a plasma, accelerating a Kapton flyer into an explosive (PETN) pellet. The geometry and properties of the Microclad are a critical element of this process.

Improved cable insulation for superconducting magnets

International Nuclear Information System (INIS)

Anerella, M.; Ghosh, A.K.; Kelly, E.; Schmalzle, J.; Willen, E.; Fraivillig, J.; Ochsner, J.; Parish, D.J.

1993-01-01

Several years ago, Brookhaven joined with DuPont in a cooperative effort to develop improved cable insulation for SSC superconducting dipole magnets. The effort was supported by the SSC Central Design Group and later the SSC Laboratory. It was undertaken because turn-to-turn and midplane shorts were routinely being experienced during the assembly of magnets with coils made of the existing Kapton/Fiberglass (K/FG) system of Kapton film overwrapped with epoxy-impregnated fiberglass tape. Dissection of failed magnets showed that insulation disruption and punch-through was occurring near the inner edges of turns close to the magnet midplane. Coil pressures of greater than 17 kpsi were sufficient to disrupt the insulation at local high spots where wires in neighboring turns crossed one another and where the cable had been strongly compacted in the keystoning operation during cable manufacture. In the joint development program, numerous combinations of polyimide films manufactured by DuPont with varying configurations and properties (including thickness) were subjected to tests at Brookhaven. Early tests were bench trials using wrapped cable samples. The most promising candidates were used in coils and many of these assembled and tested as magnets in both the SSC and RHIC magnet programs currently underway. The Kapton CI (CI) system that has been adopted represents a suitable compromise of numerous competing factors. It exhibits improved performance in the critical parameter of compressive punch-through resistance as well as other advantages over the K/FG system

Improved cable insulation for superconducting magnets

International Nuclear Information System (INIS)

Anerella, M.; Ghosh, A.K.; Kelly, E.; Schmalzle, J.; Willen, E.; Fraivillig, J.; Ochsner, J.; Parish, D.J.

1993-01-01

Several years ago, Brookhaven joined with DuPont in a cooperative effort to develop improved cable insulation for SSC superconducting dipole magnets. The effort was supported by the SSC Central Design Group and later the SSC Laboratory. It was undertaken because turn-to-turn and midplane shorts were routinely being experienced during the assembly of magnets with coils made of the existing Kapton/fiberglass (K/FG) system of Kapton film overwrapped with epoxy-impregnated fiberglass tape. Dissection of failed magnets showed that insulation disruption and punch-through was occurring near the inner edges of turns close to the magnet midplane. Coil pressures of greater than 17 kpsi were sufficient to disrupt the insulation at local high spots where the cable had been strongly compacted in the keystoning operation during cable manufacture. In the joint development program, numerous combinations of polyimide films manufactured by DuPont with varying configurations and properties (including thickness) were subjected to tests at Brookhaven. Early tests were bench trials using wrapped cable samples. The most promising candidates were used in coils and many of these promising candidates were used in coils and many of these assembled and tested as magnets in both the SSC and RHIC magnet programs currently underway. The Kapton CI (CI) system that has been adopted represents a suitable compromise of numerous competing factors. It exhibits improved performance in the critical parameter of compressive punch-through resistance as well as other advantages over the K/FG system

Sustainable source of omega-3 eicosapentaenoic acid from metabolically engineered Yarrowia lipolytica: from fundamental research to commercial production.

Science.gov (United States)

Xie, Dongming; Jackson, Ethel N; Zhu, Quinn

2015-02-01

The omega-3 fatty acids, cis-5, 8, 11, 14, and 17-eicosapentaenoic acid (C20:5; EPA) and cis-4, 7, 10, 13, 16, and 19-docosahexaenoic acid (C22:6; DHA), have wide-ranging benefits in improving heart health, immune function, mental health, and infant cognitive development. Currently, the major source for EPA and DHA is from fish oil, and a minor source of DHA is from microalgae. With the increased demand for EPA and DHA, DuPont has developed a clean and sustainable source of the omega-3 fatty acid EPA through fermentation using metabolically engineered strains of Yarrowia lipolytica. In this mini-review, we will focus on DuPont's technology for EPA production. Specifically, EPA biosynthetic and supporting pathways have been introduced into the oleaginous yeast to synthesize and accumulate EPA under fermentation conditions. This Yarrowia platform can also produce tailored omega-3 (EPA, DHA) and/or omega-6 (ARA, GLA) fatty acid mixtures in the cellular lipid profiles. Fundamental research such as metabolic engineering for strain construction, high-throughput screening for strain selection, fermentation process development, and process scale-up were all needed to achieve the high levels of EPA titer, rate, and yield required for commercial application. Here, we summarize how we have combined the fundamental bioscience and the industrial engineering skills to achieve large-scale production of Yarrowia biomass containing high amounts of EPA, which led to two commercial products, New Harvest™ EPA oil and Verlasso® salmon.

CyberKnife robotic stereotactic radiotherapy: technical aspects and medical indications; Radiotherapie stereotaxique robotisee par CyberKnife: aspects techniques et indications

Energy Technology Data Exchange (ETDEWEB)

Bondiau, P.Y.; Benezery, K.; Gerard, J.P.; Herault, J.; Marcie, S.; Angellier, G. [Centre Antoine-Lacassagne, Dept. de Radiotherapie, 06 - Nice (France); Beckendorf, V.; Peiffert, D.; Noel, A. [Centre Alexis-Vautrin, Dept. de Radiotherapie et Curietherapie, 54 - Vandoeuvre-les-Nancy (France); Mirabel, X.; Marchesi, V.; Lacornerie, T.; Dubus, F.; Sarrazin, T.; Lartigau, E. [Centre Oscar-Lambret, Dept. de Radiotherapie, 59 - Lille (France)

2007-11-15

In 2006, 3 sites have been selected by the Institut national of cancer (Lille, Nancy et Nice) to evaluate a radiotherapy robot, the CyberKnife this machine, able to track mobile tumours in real time, gives new possibilities in the field of extra cranial stereotactic radiotherapy. Functionalities and medico economical issues of the machine will be evaluated during 2 years on the 3 sites. (authors)

Clinical application of optical coherence tomography in combination with functional diagnostics: advantages and limitations for diagnosis and assessment of therapy outcome in central serous chorioretinopathy

OpenAIRE

Koulen, Peter; Schliesser,Joshua; Gallimore,Gary; Kunjukunju,Nancy; Sabates,Nelson; Sabates,Felix

2014-01-01

Joshua A Schliesser, Gary Gallimore, Nancy Kunjukunju, Nelson R Sabates, Peter Koulen, Felix N Sabates Vision Research Center, Department of Ophthalmology, University of Missouri – Kansas City, School of Medicine, Kansas City, MO, USA Purpose: While identifying functional and structural parameters of the retina in central serous chorioretinopathy (CSCR) patients, this study investigated how an optical coherence tomography (OCT)-based diagnosis can be significantly supplemented with...

Precursors to the Development of Anxiety Disorders in Young Children with Autism Spectrum Disorder

Science.gov (United States)

2017-12-01

graduate trainees. Undergraduate Training: Logan Beyer, a Duke University undergraduate student , received course credit as an Independent Study student ...Grace Baranek at UNC Chapel Hill, and Adrianne Harris, a graduate student under Drs. Geraldine Dawson, and Nancy Zucker at Duke University , have... Responsivity in Children with Autism.” Poster presented at the Visual Thinking Symposium at Duke University , Durham, NC. Baranek, G. T. (2015

PVAMU/XULA/BCM Summer Prostate Cancer Research Program

Science.gov (United States)

2017-10-01

degradation of several cancer -related proteins, including the androgen receptor , which is dysregulated in certain prostate cancers . Overall, the goal of my...Behavior of Androgen Receptor Splice Variants in Androgen Dependent Prostate Cancer Cells Turner, Williamson D., Xavier University of Louisiana, Class...AWARD NUMBER: W81XWH-15-1-0677 TITLE: PVAMU/XULA/BCM Summer Prostate Cancer Research Program PRINCIPAL INVESTIGATOR: Nancy L. Weigel

Head Nurse Leadership Style and Staff Nurse Job Satisfaction: Are They Related.

Science.gov (United States)

1987-01-01

AUIN Satisfaction : Are They Related? ______________ W 6. PERFORMING 01G. REPORT NUMBER 7. ~ AUrHOR(s) S. CONTRACT OR GRANT NUMBER(s) Nancy Louis Lewis...of decision-making on subordinate satisfaction ? Vroom and Yetton (1973) reported a high correlation between worker satisfaction and participation in...Registered nurses have specialized skill and knowledge of their job requirements. Thus, according to Vroom , nurses will show greater job satisfaction with

The War Cry

International Nuclear Information System (INIS)

Potterton, L.

2010-01-01

Nancy Brinker, World Health Organization Goodwill Ambassador for Cancer Control, spoke with the IAEA's Louise Potterton about the Agency's role in tackling the cancer crisis in developing countries. The IAEA is playing a significant role by using nuclear technology for peaceful purposes, and more people need to know that the IAEA has been providing radiation medicine and technology for over 30 years to the developing world.

Shaping Columbia’s Stability through Strategic Communication: Evaluating U.S. Effectiveness

Science.gov (United States)

2009-05-21

marketing principles to earning popular support in theaters of operations.62 The report suggests use of social marketing as a method for achieving these...113-114. The authors have adapted the 10 Step framework for military applicability from Philip Kotler , Ned Roberto, and Nancy Lee, Social Marketing ... Principles of Strategic Communication. U.S. Department of Defense, Principles of Strategic Communication, by Robert T. Hastings, Principal Deputy

What is Going to Move the Needle on Citizen Preparedness? Can America Create a Culture of Preparedness?

Science.gov (United States)

2008-03-01

their findings applied to citizen preparedness. Messaging, sociology, psychology, marketing principles , and public health expertise in behavior...use of marketing principles and techniques to influence a target audience to voluntarily accept, reject, modify, or abandon a behavior for the...benefit of individuals, groups, or society as a whole. (Philip Kotler , Ned Roberto, Nancy Lee, 2002) Social marketing is “…A process for influencing human

A Comprehensive Theory of Algorithms for Wireless Networks and Mobile Systems

Science.gov (United States)

2016-06-08

pages 109-118, July 2015. [3] Magnus Halldorsson, Stephan Holzer and Nancy Lynch. A Local Broadcast Layer for the SINR Network Model. ACM Symposium on...publication, 2014. [9] Magnus Halldorsson, Stephan Holzer, Pradipta Mitra and Roger Wattenhofer. The Power of Oblivious Wireless Power. Submitted for...David Peleg. Nonuniform SINR+Voronoi Diagrams are Effectively Uniform. In Yoram Moses, editor, Distributed Computing: 29th International Symposium

Interaction between EphrinB1 and CNK1 Found to Play Role in Tumor Progression | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer The family of proteins known as ephrins plays a critical role in a variety of biological processes. In a recent article in the Journal of Biological Chemistry, Hee Jun Cho, Ph.D., and colleagues report on the interaction between proteins CNK1 and ephrinB1 that promotes cell movement. Their findings may have an important implication in developing

WHK Student Internship Enrollment, Mentor Participation Up More than 50 Percent | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer The Werner H. Kirsten Student Internship Program (WHK SIP) has enrolled the largest class ever for the 2013–2014 academic year, with 66 students and 50 mentors. This enrollment reflects a 53 percent increase in students and a 56 percent increase in mentors, compared to 2012–2013 (43 students and 32 mentors), according to Julie Hartman, WHK SIP

$200,000 Grants Awarded to CCR Researchers for HIV/AIDS Studies | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer Earlier this year, the Office of AIDS Research (OAR) awarded two, two-year grants of $200,000 each to Anu Puri, Ph.D., and Robert Blumenthal, Ph.D., both of the Center for Cancer Research (CCR) Nanobiology Program, and to Eric Freed, Ph.D., of the HIV Drug Resistance Program, for their research on potential new treatments for HIV.

Grande Sertão: Veredas by João Guimarães Rosa

Directory of Open Access Journals (Sweden)

2013-07-01

Full Text Available "What is a translation that stalls comprehension?" asks Nancy Fumero in her introduction to Felipe W. Martinez' English-language renditions of João Guimarães Rosa's Portuguese poetics. In these translations (presented alongside the Portuguese originals Fumero argues that we encounter "a new form of translation that risks everything in order to encounter the same treacherous knowing Rosa had traversed."

Playboy Entertainment for Men Braille Edition June 1996:In collaboration with Rosita McKenzie

OpenAIRE

Douglas, Caroline

2010-01-01

'Playboy Entertainment for Men' features a passage of text read aloud from an article in the 1996 Braille edition of Playboy. The work interrogates issues of femininity, gender and prevailing relations of representation. Capturing the 'female' touch reading the 'male' gaze, it prompts dialogue between touch and the spoken word; seeing and projected fantasy; and text and image. The video was the recipient of the 9th International Keller Award.

Adaptation of Fusarium oxysporum and Fusarium dimerum to the specific aquatic environment provided by the water systems of hospitals.

Science.gov (United States)

Steinberg, Christian; Laurent, Julie; Edel-Hermann, Véronique; Barbezant, Marie; Sixt, Nathalie; Dalle, Frédéric; Aho, Serge; Bonnin, Alain; Hartemann, Philippe; Sautour, Marc

2015-06-01

Members of the Fusarium group were recently detected in water distribution systems of several hospitals in the world. An epidemiological investigation was conducted over 2 years in hospital buildings in Dijon and Nancy (France) and in non-hospital buildings in Dijon. The fungi were detected only within the water distribution systems of the hospital buildings and also, but at very low concentrations, in the urban water network of Nancy. All fungi were identified as Fusarium oxysporum species complex (FOSC) and Fusarium dimerum species complex (FDSC) by sequencing part of the translation elongation factor 1-alpha (TEF-1α) gene. Very low diversity was found in each complex, suggesting the existence of a clonal population for each. Density and heterogeneous distributions according to buildings and variability over time were explained by episodic detachments of parts of the colony from biofilms in the pipes. Isolates of these waterborne populations as well as soilborne isolates were tested for their ability to grow in liquid medium in the presence of increasing concentrations of sodium hypochlorite, copper sulfate, anti-corrosion pipe coating, at various temperatures (4°-42 °C) and on agar medium with amphotericin B and voriconazole. The waterborne isolates tolerated higher sodium hypochlorite and copper sulfate concentrations and temperatures than did soilborne isolates but did not show any specific resistance to fungicides. In addition, unlike waterborne isolates, soilborne isolates did not survive in water even supplemented with glucose, while the former developed in the soil as well as soilborne isolates. We concluded the existence of homogeneous populations of FOSC and FDSC common to all contaminated hospital sites. These populations are present at very low densities in natural waters, making them difficult to detect, but they are adapted to the specific conditions offered by the complex water systems of public hospitals in Dijon and Nancy and probably other

Measurements of reciprocity law failure in green-sensitive X-ray films.

Science.gov (United States)

Arnold, B A; Eisenberg, H; Bjärngard, B E

1978-02-01

Reciprocity law failure was measured for four brands of medical x-ray films exposed with intensifying screens. Three of the films are green light-sensitized for use in combination with green light-emitting rare-earth screens. These films showed larger reciprocity failure effects than one conventional blue-sensitive film, Dupont Cronex-2. Development conditions had a small effect on reciprocity failure. As part of the investigation, a detector was constructed with a response that accurately monitors the light emission from the double screen-cassette combination over a wide range of x-ray photon energies.

Superconductivity Technology Program for electric power systems: Proceedings

Energy Technology Data Exchange (ETDEWEB)

Marriott, K.B.

1993-09-01

Twenty-seven presentations are included in viewgraph form for the wire development panel, applications development panel, and thallium workshop. Authors and affiliations are: (wire development panel) Kreoger/Christen (ORNL), Malozemoff (American Superconductor Corp.), Blaugher (National Renewable Energy Lab.), Haldar (Intermagnetics), Gray/Lanagan/Eror (ANL), Bickel/Voigt/Roth (Sandia), Tkaczyk (GE), Suenaga (BNL), Willis/Korzekwa/Maley (Los Alamos); (applications development panel) Peterson/Stewart (Los Alamos), Iwasa (BNL), Hull/Nieman (ANL), Murphy/DeGregoria (ORNL), Hazelton (Intermagnetics), Dykhuizen (Sandia); (thallium workshop) Goodrich (NIST), Blaugher (NREL), Roth (Sandia), Holstein (DuPont), Paranthaman (ORNL), and Willis (Los Alamos).

Investigation of interactions between water and ion exchanger perfluorinated membranes

International Nuclear Information System (INIS)

Ben Said, Chakir

1983-01-01

In this research thesis, the author, by using nuclear magnetic resonance (NMR), shows the privileged situation of the first absorbed water molecules which come and fix about cations and fill up the first hydration sphere. He reports the study of Nafion membranes provided by DuPont de Nemours: chemical definition (chemical structure, properties, and microstructure), interest of the use of NMR, results and discussion (influence of water content, of temperature, of thermal cycling), and other results obtained by using different techniques (electronic paramagnetic resonance or EPR, differential calorimetry and thermo-porometry, mechanical measurements) [fr

Low Permeable Hydrocarbon Polymer Electrolyte Membrane for Vanadium Redox Flow Battery.

Science.gov (United States)

Jung, Ho-Young; Moon, Geon-O; Jung, Seunghun; Kim, Hee Tak; Kim, Sang-Chai; Roh, Sung-Hee

2017-04-01

Polymer electrolyte membrane (PEM) confirms the life span of vanadium redox flow battery (VRFB). Products from Dupont, Nafion membrane, is mainly used for PEM in VRFB. However, permeation of vanadium ion occurs because of Nafion’s high permeability. Therefore, the efficiency of VRFB decreases and the prices becomes higher, which hinders VRFB’s commercialization. In order to solve this problem, poly(phenylene oxide) (PPO) is sulfonated for the preparation of low-priced hydrocarbon polymer electrolyte membrane. sPPO membrane is characterized by fundamental properties and VRFB cell test.

The Large, the Small and the Human Mind

Science.gov (United States)

Penrose, Roger; Longair, Malcolm; Abner Shimony, With; Cartwright, Nancy; Hawking, Stephen

2000-05-01

Foreword Malcolm Longair; 1. Space-time and cosmology Roger Penrose; 2. The mysteries of quantum physics Roger Penrose; 3. Physics and the mind Roger Penrose; 4. On mentality, quantum mechanics and the actualization of potentialities Abner Shimony; 5. Why physics? Nancy Cartwright; 6. The objections of an unashamed reductionist Stephen Hawking; 7. Response Roger Penrose; Appendix I: Goodstein's theorm and mathematical thinking; Appendix II: Experiments to test gravitationally induced state reduction.

Mindfulness-based cognitive therapy for depression: trends and developments

OpenAIRE

MacKenzie, Meagan B; Kocovski, Nancy L

2016-01-01

Meagan B MacKenzie,1 Nancy L Kocovski21Department of Psychology, Ryerson University, Toronto, ON, Canada; 2Department of Psychology, Wilfrid Laurier University, Waterloo, ON, CanadaAbstract: Mindfulness-based cognitive therapy (MBCT) was developed as a psychological intervention for individuals at risk of depressive relapse. Possible mechanisms of change for this intervention are in line with its theoretical underpinnings, and include increases in mindfulness and/or decreases in nega...

Cultural Resources Survey of Palmetto and Coochie Revetments, Mississippi River M-326 to 315

Science.gov (United States)

1993-11-11

1840 - SION G. ROWAN ’WILKINSON S PAUL PANDELLY!COKTESWORTH P. SMm .- - ’WILLIAM STAMPS SCHOOL MOSES UD .P E WILLIAM STAMPS1 SECTION WIL.IA\\ -1830 /AND... Tourism , Baton Rouge. Smith, Steven D., Philip G. Rivet, Kathleen M. Byrd, and Nancy W. Hawkins 1983 Louisiana’s Comprehensive Archaeological Plan. State...of Louisiana, Department of Culture, Recreation and Tourism , Officer of Cultural Development, Division of Archaeology, Baton Rouge. Society of

Teaching business economics for sustainability with different interests in focus

OpenAIRE

Andersson, Pernilla

2017-01-01

Paper presented at 2nd ARTEM Organizational Creativity and Sustainability International Conference, 14th-16th September 2017, Nancy, France   Teaching business economics for sustainability with different interests in focus Author: Pernilla Andersson (for full abstract (including textboxes and table 1) see attachment) Introduction Calls for the inclusion of ‘sustainable development’ in the business curriculum has increased significantly in the wake of financial crisis and increased concern ab...

Supplier Relationship Management at Army Life Cycle Management Commands: Gap Analysis of Best Practices

Science.gov (United States)

2012-01-01

contracts. - 76 - In step 9, maintaining momentum in supplier management , the relationship between the customer and supplier continues to develop...REPORT DATE 2012 2. REPORT TYPE 3. DATES COVERED 00-00-2012 to 00-00-2012 4. TITLE AND SUBTITLE Supplier Relationship Management at Army Life... Relationship Management at Army Life Cycle Management Commands Gap Analysis of Best Practices Nancy Y. Moore, Amy G. Cox, Clifford A. Grammich

Caring Letters for Military Suicide Prevention: A Randomized Controlled Trial

Science.gov (United States)

2017-03-01

to Department of Defense, Washington Headquarters Services, Directorate for Information Operations and Reports (0704-0188), 1215 Jefferson Davis...ELEMENT NUMBER 6. AUTHOR(S) David D. Luxton, PhD, Nigel Bush, PhD, Nancy Skopp, PhD, 5d. PROJECT NUMBER Tina Lee, MD, PhD, Robert McLay...The Project Manager at MAMC resigned on 15 July 2016. Previous Project Manager returned to the project and all necessary transition was completed

Image Understanding Research

Science.gov (United States)

1981-09-30

Reconnaissance des Formes et Intelligence Artificielle , Sept. 1981, Nancy, France. [11] T.C. Henderson and B. Bhanu, "Extraction of Planar Faces from...34Semantic Description of Aerial Images Using Stochastic Labeling," IEEE Trans. on Pattern Recognition and Machine Intelligence , Nov. 1981. [2] R. Ohlander...Tenenbaum, "MSYS: A System for Reasoning About Scenes," Tech. Note 121, Artificial Intelligence Center, SRI Intl., Menlo Park, CA, 1976. [7]. D. Marr

Dynamically Stable Legged Locomotion

Science.gov (United States)

1981-11-30

the laboratory. Harry Asada, Wayne Book, Nancy Cornelius, Sesh Murthy and Ivan Sutherland read various drafts of this report, for which we are...particularly helpful in providing an atmosphere where things could get started. Craig Fields and Clint Kelly deserve special credit for letting the idea of...legged technology capture their imaginations, even before we could show them tangible results. We are especially indebted to Ivan Sutherland for his

Predicting Academic Achievement from Classroom Behaviors

OpenAIRE

Flynt, Cynthia J.

2008-01-01

PREDICTING ACADEMIC ACHIEVEMENT FROM CLASSROOM BEHAVIORS by Cynthia J. Flynt Nancy Bodenhorn & Kusum Singh, Co-Chairs Counselor Education (ABSTRACT) This study examined the influence of behaviors exhibited in the classroom on reading and math achievement in the first, third and eighth grades; and the influence of teacher perceptions on reading and math achievement of African-Americans versus White students and male versus female students. Lastly, the study examined te...

Hydrogeologic investigation of the Maxey Flats radioactive waste burial site, Fleming County, Kentucky

Science.gov (United States)

Zehner, H.H.

1983-01-01

Burial trenches at the Maxey Flats radioactive waste burial site cover an area of about 20 acres, and are located on a plateau, about 300 to 400 feet above surrounding valleys. All waste is buried in the Nancy Member of the Borden Formation, and most is in the weathered shale (regolith) part of this member. Recharge to the rocks is probably by infiltration of rainfall through regolith at the top of the hill. At least two water tables are present: near the base of the regolith, at a depth of about 25 feet and; in the Ohio Shale, at a depth of about 300 feet. About 95 percent of ground-water discharge to streams is from colluvium on hillsides and valley alluvium. The remaining 5 percent is discharge from bedrock, of which about 0.5 percent is from rocks underlying the burial area. Waste radionuclides in the subsurface, other than tritium, were observed only in the regolith of the Nancy Member. Only tritium was observed with certainty in deeper rocks and in the adjacent valley alluvium. Other waste radionuclides were in streamwater and stream sediment, and may have been transported with overland runoff from the surface of the burial site. (USGS)

Un juego serio en que se va la vida. Fragmentos, citas, reescrituras en Zettel, de Héctor Libertella

Directory of Open Access Journals (Sweden)

Agustina Pérez

2015-06-01

Full Text Available Los papeles sueltos de Zettel, último libro Héctor Libertella, tienen algo de la tarea obstinada que Antoine Compagnon encuentra en niños y ancianos, trabajo del papel como cortar y pegar, juego serio en que se va la vida, o llega. Se revisará Zettel a la luz de otros textos de Libertella para indagar su vínculo con el fragmento como tipo de exposición que no aspira a la exhaustividad sino a lo inacabado, siendo siempre en germen (Lacoue-Labarthe y Nancy y con el trabajo de la citación (Compagnon, donde el texto se vuelve producto de la fuerza del desplazamiento. The loose papers of Zettel, Héctor Libertella’s last book, involve some of the stubborn task that Antoine Compagnon finds in children and the eldery, working paper as cut and paste, serious game in which life slips away, or arrives. This work reads Zettel in the light of another of his works to examine their connection with the fragment as a type of exposition that doesn’t looks for exhaustivity but the unfinished, being always in germ (Lacoue-Labarthe y Nancy and with the work of citation (Compagnon in which text becomes the result of the force of displacement.

Det stedløse fællesskab

DEFF Research Database (Denmark)

Andreasen, Torsten Arni Caleb

2009-01-01

Det værkløse, det uvedgåelige, det kommende fællesskab. I nr. 4 af tidsskriftet Aléa (1983) udkom første udgave af den franske filosof Jean-Luc Nancys artikel "La communauté désœuvrée" (Det værkløse fællesskab), der senere udkom med tilføjelser i bogen af samme navn (1986). Via en analyse af...

A Randomized Clinical Trial of Cognitive Enhancement Therapy for Adults with Autism Spectrum Disorders

Science.gov (United States)

2012-10-01

life for more able individuals with autism or Asperger syndrome. Autism , 4(1), 63-83. Kanner, L. (1971). Follow-up study of eleven autistic...Enhancement Therapy for Adults with Autism Spectrum Disorders PRINCIPAL INVESTIGATOR: Nancy J. Minshew, M.D. & Shaun M. Each, Ph.D...Therapy for Adults with Autism Spectrum Disorders 5a. CONTRACT NUMBER 5b. GRANT NUMBER W81XWH-11-1-0665 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR

The clinical basis of orthorexia nervosa: emerging perspectives

OpenAIRE

Koven, Nancy; Abry,Alexandra

2015-01-01

Nancy S Koven, Alexandra W Abry Department of Psychology, Bates College, Lewiston, ME, USA Abstract: Orthorexia nervosa describes a pathological obsession with proper nutrition that is characterized by a restrictive diet, ritualized patterns of eating, and rigid avoidance of foods believed to be unhealthy or impure. Although prompted by a desire to achieve optimum health, orthorexia may lead to nutritional deficiencies, medical complications, and poor quality of life. Despite its being a di...

Students and Educators Learn about NICBR Science, Careers | Poster

Science.gov (United States)

By Nancy Parrish, Staff Writer; photos by Richard Frederickson, Staff Photographer Approximately 50 college students, professors, and high school teachers from Frederick County Public Schools gathered at Hood College for the second annual National Interagency Confederation for Biological Research (NICBR) Exploring Careers in a Scientific Environment Symposium (NECSES). The Feb. 13 event highlighted the wide range of scientific research as well as the educational and career opportunities available through NICBR partner organizations.