WorldWideScience

Sample records for na yadre 12c

  1. Application of inverse kinematics to [sup 1]H+[sup 23]Na[yields][sup 12]C+[sup 12]C

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Clarke, N.M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Freer, M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Fulton, B.R. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Hall, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Karban, O. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Murgatroyd, J.T. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Tungate, G. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Gyapong, G.J. (Dept. of Physics, York Univ. (United Kingdom)); Jarvis, N.S. (Dept. of Physics, York Univ. (United Kingdom)); Watson, D.L. (Dept. of Physics, York Univ. (United Kingdom)); Rae, W.D.M. (Dept. of Nuclear Physics, Oxford Univ. (United Kingdom)); Smith, A.E. (Dept. of Nuclear; Charissa Collaboration

    1993-08-15

    Some experimental techniques used in the measurement and analysis of inverse kinematic reactions are described and applied to a kinematically complete study of the [sup 1]H([sup 23]Na, [sup 12]C)[sup 12]C reaction at an incident energy of 180 MeV. An excitation function is obtained for the energy range of 18.5 to 19.2 MeV in [sup 24]Mg*; equivalent to proton energies from 7.1 MeV to 7.8 MeV for the [sup 23]Na(p, [sup 12]C)[sup 12]C reaction. (orig.)

  2. The 12C + 12C: 1. Decay into high spin states of 23Mg, and 23Na. 2. Hauser-Feshbach analysis of the reaction mechanism

    International Nuclear Information System (INIS)

    Denhoefer, G.

    1980-01-01

    In this thesis different aspects of the reaction 12 C + 12 C were studied. The first part deals with high spin states in the mirror nucki 23 Na and 23 Mg experially with the states resonantly populated at Esub(cm) = 19.3 MeV. For the state at 9.80 MeV in 23 Na with (p,γ) angular correlation measurements a spin of 17/2 + and by Doppler form analysis a lifetime of (21 +- 9)fs was found. The probably analogous state at 9.61 MeV in 23 Mg decays both under p-emission to 22 Na and under γ-emission. Because of the p-decay probabilities to 3 + and 4 + of 22 Na, which were observed in (p,n) coincidence measurements, it has also the spin 17/2 + . In the second part of this thesis it was studied whether the reaction 12 C + 12 C at incident energies between 26 MeV and 42 MeV can be described using the statistical model. (orig./HSI) [de

  3. Theoretical assessment of the electro-optical features of the group III nitrides (B{sub 12}N{sub 12}, Al{sub 12}N{sub 12} and Ga{sub 12}N{sub 12}) and group IV carbides (C{sub 24}, Si{sub 12}C{sub 12} and Ge{sub 12}C{sub 12}) nanoclusters encapsulated with alkali metals (Li, Na and K)

    Energy Technology Data Exchange (ETDEWEB)

    Tahmasebi, Elham [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of); Shakerzadeh, Ehsan, E-mail: e.shakerzadeh@scu.ac.ir [Chemistry Department, Faculty of Science, Shahid Chamran University, Ahvaz (Iran, Islamic Republic of); Biglari, Zeinab [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of)

    2016-02-15

    Graphical abstract: - Highlights: • Encapsulation of Li, Na and K narrow the HOMO–LUMO gaps of the clusters. • The group III nitrides nanoclusters strongly interacted with the alkali metals. • First hyperpolarizabilities remarkably enhance for B{sub 12}N{sub 12} encapsulated with Na/K. - Abstract: Density functional theory (DFT) calculations have been carried out to study the influence of alkali metals (Li, Na and K) encapsulation within the group III nitrides (B{sub 12}N{sub 12}, Al{sub 12}N{sub 12} and Ga{sub 12}N{sub 12}) and the group IV carbides (C{sub 24}, Si{sub 12}C{sub 12}and Ge{sub 12}C{sub 12}) nanoclusters. The encapsulation of Li, Na and K atoms is found to narrow the HOMO–LUMO gaps of the considered clusters. The electronic properties of these clusters, especially the group III nitrides nanoclusters, are strongly sensitive to interaction with the alkali metals. Moreover it is observed that the encapsulation of alkali metals enhances the first hyperpolarizabilities of B{sub 12}N{sub 12} nanocluster. Surprisingly, due to the alkali metals encapsulation within B{sub 12}N{sub 12} nanocluster, the first hyperpolarizability values are remarkably increased to 8505.49 and 122,503.76 a.u. for Na@B{sub 12}N{sub 12} and K@B{sub 12}N{sub 12}, respectively. Also the TD-DFT calculations at both CAM-B3LYP/6-311+G(d) and PBE0/6-311+G(d) levels of theory are also performed to investigate the origin of first hyperpolarizabilities.

  4. Solubilization of Na,K-ATPase from rabbit kidney outer medulla using only C12E8

    Directory of Open Access Journals (Sweden)

    H.L. Santos

    2002-03-01

    Full Text Available SDS, C12E8, CHAPS or CHAPSO or a combination of two of these detergents is generally used for the solubilization of Na,K-ATPase and other ATPases. Our method using only C12E8 has the advantage of considerable reduction of the time for enzyme purification, with rapid solubilization and purification in a single chromatographic step. Na,K-ATPase-rich membrane fragments of rabbit kidney outer medulla were obtained without adding SDS. Optimum conditions for solubilization were obtained at 4ºC after rapid mixing of 1 mg of membrane Na,K-ATPase with 1 mg of C12E8/ml, yielding 98% recovery of the activity. The solubilized enzyme was purified by gel filtration on a Sepharose 6B column at 4ºC. Non-denaturing PAGE revealed a single protein band with phosphomonohydrolase activity. The molecular mass of the purified enzyme estimated by gel filtration chromatography was 320 kDa. The optimum apparent pH obtained for the purified enzyme was 7.5 for both PNPP and ATP. The dependence of ATPase activity on ATP concentration showed high (K0.5 = 4.0 µM and low (K0.5 = 1.4 mM affinity sites for ATP, with negative cooperativity. Ouabain (5 mM, oligomycin (1 µg/ml and sodium vanadate (3 µM inhibited the ATPase activity of C12E8-solubilized and purified Na,K-ATPase by 99, 81 and 98.5%, respectively. We have shown that Na,K-ATPase solubilized only with C12E8 can be purified and retains its activity. The activity is consistent with the form of (alphaß2 association.

  5. Application of inverse kinematics to 1H+23Na→12C+12C

    International Nuclear Information System (INIS)

    Bennett, S.J.; Clarke, N.M.; Freer, M.; Fulton, B.R.; Hall, S.J.; Karban, O.; Murgatroyd, J.T.; Tungate, G.; Gyapong, G.J.; Jarvis, N.S.; Watson, D.L.; Rae, W.D.M.; Smith, A.E.; Lilley, J.S.; Woods, P.J.; Page, R.D.

    1993-01-01

    Some experimental techniques used in the measurement and analysis of inverse kinematic reactions are described and applied to a kinematically complete study of the 1 H( 23 Na, 12 C) 12 C reaction at an incident energy of 180 MeV. An excitation function is obtained for the energy range of 18.5 to 19.2 MeV in 24 Mg*; equivalent to proton energies from 7.1 MeV to 7.8 MeV for the 23 Na(p, 12 C) 12 C reaction. (orig.)

  6. Absolute cross sections measurement for the 12C + 12C system at astrophysically relevant energies

    International Nuclear Information System (INIS)

    Barron-Palos, L.; Aguilera, E.F.; Aspiazu, J.; Huerta, A.; Martinez-Quiroz, E.; Monroy, R.; Moreno, E.; Murillo, G.; Ortiz, M.E.; Policroniades, R.; Varela, A.; Chavez, E.

    2006-01-01

    The 12 C + 12 C fusion reaction has been studied in the center-of-mass energy range of 2.25 to 6.01 MeV. Through the detection of gamma rays from the first excited states of the residual nuclei 20 Ne, 23 Na and 23 Mg, absolute cross sections for the 12 C( 12 C,-bar α), 12 C( 12 C,-bar p) and 12 C( 12 C,-bar n) reactions have been obtained. In this new measurement, the energy dependence of the S-factor is found to increase as the energy decreases below 3 MeV in the center of mass. This tendency was observed in previous measurements by Mazarakis et al., and has since then become a subject of controversy. In this work, where the cross sections are measured at even lower energies, we confirm the rise in the S-factor toward the energy region relevant for star evolution and nucleosynthesis calculations (E c.m. =1-3 MeV)

  7. Excited states in 22Mg via the 12C(12C,2n)22Mg reaction

    International Nuclear Information System (INIS)

    Jewett, Cybele; Baktash, Cyrus; Bardayan, Daniel W.; Blackmon, Jeff C.; Chipps, K.; Galindo-Uribarri, Alfredo; Greife, U.; Gross, Carl J.; Jones, K. L.; Liang, Junjien; Livesay, Jake; Kozub, R. L.; Nesaraja, Caroline D; Radford, David C.; Sarazin, F.; Smith, Michael Scott; Thomas, J. S.; Yu, Chang-Hong

    2007-01-01

    The 12C(12C, 2n)22Mg reaction was measured with the CLARION array and the RMS separator at the Holifield Facility of Oak Ridge National Laboratory. This experiment was performed to gather more information on the excited states in 22Mg, which might be of relevance to recent radioactive ion beam measurements of the astrophysically important 21Na(p,γ)22Mg reaction. The results are compared to direct measurements, transfer experiments and a competing experiment performed with Gammasphere

  8. Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections

    Science.gov (United States)

    Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.

    2012-01-01

    The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.

  9. Low-temperature sol-gel synthesis of NaZr2P3O12

    International Nuclear Information System (INIS)

    Agrawal, D.K.; Adair, J.H.

    1990-01-01

    The NZP family of new low-expansion materials has attracted wide interest for its potential in advanced technological applications. NaZr 2 P 3 O 12 , which is the parent composition of this family, has been synthesized by the solution sol-gel method using special precursor solutions, which led to its formation (although poorly crystalline) at temperatures as low as 120 degrees C. The lowest temperature of formation of a single phase of NaZr 2 P 3 O 12 with a high degree of crystallinity was found to be 600 degrees C

  10. THE {sup 12}C + {sup 12}C REACTION AND THE IMPACT ON NUCLEOSYNTHESIS IN MASSIVE STARS

    Energy Technology Data Exchange (ETDEWEB)

    Pignatari, M. [Department of Physics, University of Basel, Klingelbergstrasse 82, CH-4056 Basel (Switzerland); Hirschi, R.; Bennett, M. [Astrophysics Group, EPSAM Institute, Keele University, Keele, ST5 5BG (United Kingdom); Wiescher, M.; Beard, M. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Gallino, R. [Universita' di Torino, Torino, Via Pietro Giuria 1, I-10126 Torino (Italy); Fryer, C.; Rockefeller, G. [Computational Physics and Methods (CCS-2), LANL, Los Alamos, NM 87545 (United States); Herwig, F.; Timmes, F. X., E-mail: marco.pignatari@unibas.ch [The Joint Institute for Nuclear Astrophysics, Notre Dame, IN 46556 (United States)

    2013-01-01

    Despite much effort in the past decades, the C-burning reaction rate is uncertain by several orders of magnitude, and the relative strength between the different channels {sup 12}C({sup 12}C, {alpha}){sup 20}Ne, {sup 12}C({sup 12}C, p){sup 23}Na, and {sup 12}C({sup 12}C, n){sup 23}Mg is poorly determined. Additionally, in C-burning conditions a high {sup 12}C+{sup 12}C rate may lead to lower central C-burning temperatures and to {sup 13}C({alpha}, n){sup 16}O emerging as a more dominant neutron source than {sup 22}Ne({alpha}, n){sup 25}Mg, increasing significantly the s-process production. This is due to the chain {sup 12}C(p, {gamma}){sup 13}N followed by {sup 13}N({beta} +){sup 13}C, where the photodisintegration reverse channel {sup 13}N({gamma}, p){sup 12}C is strongly decreasing with increasing temperature. Presented here is the impact of the {sup 12}C+{sup 12}C reaction uncertainties on the s-process and on explosive p-process nucleosynthesis in massive stars, including also fast rotating massive stars at low metallicity. Using various {sup 12}C+{sup 12}C rates, in particular an upper and lower rate limit of {approx}50,000 higher and {approx}20 lower than the standard rate at 5 Multiplication-Sign 10{sup 8} K, five 25 M {sub Sun} stellar models are calculated. The enhanced s-process signature due to {sup 13}C({alpha}, n){sup 16}O activation is considered, taking into account the impact of the uncertainty of all three C-burning reaction branches. Consequently, we show that the p-process abundances have an average production factor increased up to about a factor of eight compared with the standard case, efficiently producing the elusive Mo and Ru proton-rich isotopes. We also show that an s-process being driven by {sup 13}C({alpha}, n){sup 16}O is a secondary process, even though the abundance of {sup 13}C does not depend on the initial metal content. Finally, implications for the Sr-peak elements inventory in the solar system and at low metallicity are

  11. Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets

    International Nuclear Information System (INIS)

    Swamy, K.S.K.

    1987-01-01

    The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)

  12. Molecular resonances in sub-Coulomb energy region (12C-12C, 12C-24Mg, 12C-9Be systems)

    International Nuclear Information System (INIS)

    Takimoto, Kiyohiko; Shimomura, Susumu; Tanaka, Makoto; Murakami, Tetsuya; Fukada, Mamoru; Sakaguchi, Atsushi

    1982-01-01

    Molecular resonance in sub-Coulomb energy region was studied on 12 C- 12 C, 12 C- 24 Mg and 12 C- 9 Be systems. The excitation functions and the angular distributions were measured on the reactions 12 C( 12 C, 8 Besub(g,s,)) 16 Osub(g,s,), 24 Mg( 12 C, α) 32 S and 9 Be ( 12 C, 8 Besub(g,s,)) 13 Csub(g,s,). Sub-Coulomb resonances were observed in all systems and the contribution of the 12 Csub(2nd)*(0 + , 7.65 MeV) state is proposed. (author)

  13. FTIR spectra of the solid solutions (Na0.88K0.12)VO3, (Na0.5K0.5)VO3, and Na(V0.66P0.34)O3

    Science.gov (United States)

    de Waal, D.; Heyns, A. M.

    1992-03-01

    It is known that three different solid solutions, (Na0.88K0.12)VO3, (Na0.5K0.5)VO3 and Na(V0.66P0.34)O3, form in the (Na,K)(V,P)O3 system. These compounds all have monoclinic crystal structures similar to the pure alkali metal metavanadates containing small cations, e.g. Li+ and Na+ (Space group C2/c). Metavanadates with large cations like K+, Rb+, C+s and NH+4 form orthorhombic crystals, space group Pbcm. All those are structurally related to the silicate pyroxenes. Na(V0.66P0.34)O3 and (Na0.88K0.12)VO3 have the same modified diopside structure as (alpha) - NaVO3 while (Na0.5K0.5)VO3 adopts the true diopside structure. The infrared spectra of the three solid solutions are reported here in comparison with those of (alpha) -NaVO3 and KVO3. The results are also correlated with those obtained in two independent high pressure Raman studies of NH4VO3 and RbVO3 as the introduction of a larger cation like K+ should increase the pressure in the structure.

  14. Papel da vitamina B12 na patogenia da mielose funicular

    Directory of Open Access Journals (Sweden)

    Horacio M. Canelas

    1965-12-01

    Full Text Available Foi estudada a absorção da vitamina B12 radioativa em 29 casos de mielose funicular. O diagnóstico baseou-se na clássica sintomatologia neu- rológica e na presença de acloridria gástrica e eventuais alterações hemato-lógicas. As manifestações neurológicas foram avaliadas de modo semiquan-titativo e correlacionadas com os resultados do teste de excreção urinária da vitamina B12. Não foi verificada correlação significante da absorção da vitamina B12, quer com a sintomatologia nuerológica total, quer com as síndromes periférica e funicular dorsal. Contudo, foi encontrada significante correlação negativa entre a síndrome piramidal e a absorção da vitamina B12. Os resultados são confrontados com o papel desempenhado pela vitamina B12 na síntese das bainhas de mielina e do ácido ribonuclêico, sendo salientada a importância dêste último para a vida das células nervosas e dos longos axônios.

  15. Role of alkali carbonate and salt in topochemical synthesis of K1/2Na1/2NbO3 and NaNbO3 templates

    Science.gov (United States)

    Lee, Jae-Seok; Jeon, Jae-Ho; Choi, Si-Young

    2013-11-01

    Since the properties of lead-free piezoelectric materials have thus far failed to meet those of lead-based materials, either chemical doping or morphological texturing should be employed to improve the piezoelectric properties of lead-free piezoelectric ceramics. The goal of this study was to synthesize plate-like K1/2Na1/2NbO3 and NaNbO3 particles, which are the most favorable templates for morphological texturing of K1/2Na1/2NbO3 ceramics. To achieve this goal, Bi2.5Na3.5Nb5O18 precursors in a plate-like shape were first synthesized and subsequently converted into K1/2Na1/2NbO3 or NaNbO3 particles that retain the morphology of Bi2.5Na3.5Nb5O18. In this study, we found that sodium or potassium carbonate does not play a major role in converting the Bi2.5Na3.5Nb5O18 precursor to K1/2Na1/2NbO3 or NaNbO3, on the contrary to previous reports; however, the salt contributes to the conversion reaction. All synthesis processes have been performed via a molten salt method, and scanning electron microscopy, scanning probe microscopy, and inductively coupled plasma mass spectroscopy were used to characterize the synthesized K1/2Na1/2NbO3 or NaNbO3 templates.

  16. Cross sections for 12C+12C→12C(0+2)+12C(g.s.) using breathing mode doorways

    International Nuclear Information System (INIS)

    Ahmed, M.U.; Beres, W.P.

    1982-01-01

    A previously derived projection operator method is applied to the calculation of the cross section for 12 C+ 12 C→ 12 C(0 + 2 )+ 12 C(g.s.) with a breathing mode model being used to describe the 0 + 2 (7.68 MeV) state of 12 C. The relationship to processes leading to alpha particle channels is discussed. The cross section for 12 C+ 12 C→ 12 C(3 - )+ 12 C(g.s.) is also calculated and possible correlations with inelastic scattering to the 0 + 2 and 2 + states of 12 C are discussed. The results for both 0 + 2 and 3 - inelastic scattering are in reasonable agreement with experiment

  17. Inhibition of epithelial Na+ transport by atriopeptin, protein kinase c, and pertussis toxin

    International Nuclear Information System (INIS)

    Mohrmann, M.; Cantiello, H.F.; Ausiello, D.A.

    1987-01-01

    The authors have recently shown the selective inhibition of an amiloride-sensitive, conductive pathway for Na + by atrial natriuretic peptide and 8-bromoguanosine 3',5'-cyclic monophosphate (8-BrcGMP) in the renal epithelial cell line, LLC-PK i . Using 22 Na + fluxes, they further investigated the modulation of Na + transport by atrial natriuretic peptide and by agents that increase cGMP production, activate protein kinase c, or modulate guanine nucleotide regulatory protein function. Sodium nitroprusside increases intracellular cGMP concentrations without affecting cAMP concentrations and completely inhibits amiloride-sensitive Na + uptake in a time- and concentration-dependent manner. Oleoyl 2-acetylglycerol and phorbol 12-myristate 13-acetate, activators of protein kinase c, inhibit Na + uptake by 93 ± 13 and 51 ± 10%, respectively. Prolonged incubation with phorbol ester results in the downregulation of protein kinase c activity and reduces the inhibitory effect of atrial natriuretic peptide, suggesting that the action of this peptide involves stimulation of protein kinase c. Pertussis toxin, which induces the ADP-ribosylation of a 41-kDa guanine nucleotide regulatory protein in LLC-PK i cells, inhibits 22 Na + influx to the same extent as amiloride. Thus, increasing cGMP, activating protein kinase c, and ADP-ribosylating a guanine nucleotide regulatory protein all inhibit Na + uptake. These events may be sequentially involved in the action of atrial natriuretic peptide

  18. Microscopic investigation of the 12C + 12C interaction

    International Nuclear Information System (INIS)

    Baye, D.; Pecher, N.; Brussels Univ.

    1982-01-01

    The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)

  19. Excitation functions of the systems 12C+14C and 13C+12C

    International Nuclear Information System (INIS)

    Haindl, E.

    1975-01-01

    The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de

  20. Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems

    International Nuclear Information System (INIS)

    Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.

    1978-01-01

    Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)

  1. Corrosion Fatigue Characteristics of 12Cr Alloy Steel in Na2SO4 Solution

    Science.gov (United States)

    Bae, D. H.; Cho, S. Y.

    In order to estimate reliability of 12Cr alloy steel using as the turbine blade material of the steam power plant, its corrosion fatigue characteristics in Na2SO4 solution considering its percentage and temperature that were determined from the polarization test results were investigated, and compared with the results in air. The corrosion characteristic of 12Cr alloy steel was remarkably susceptible in 12.7wt.% (IM) Na2SO4 solution, and its susceptibility increased with the solution temperature increase. The corrosion fatigue characteristics in 12.7wt.% Na2SO4 solution were similar to that of in air at 25°C. The crack growth rate was however increased with the temperature of solution increase. The reasons showing such results are due to the difference of the crack growth mechanism according to the electro-chemical activity of the corrosion factors.

  2. Membrane self assembly in mixed DMPC/NaC systems by SANS

    International Nuclear Information System (INIS)

    Kiselev, M.A.; Lombardo, D.; Lesieur, P.; Kisselev, A.M.; Borbely, S.; Simonova, T.N.; Barsukov, L.I.

    2008-01-01

    Morphological transition in a mixed system of the dimyristoylphosphatidylcholine (DMPC)/sodium cholate (NaC) has been investigated by small-angle scattering of neutron (SANS) and X-ray (SAXS). Structural investigation, performed as a function of temperature and NaC concentration, show that the system containing 15 mM DMPC and 6 mM NaC reveals a strong dependence of SANS spectra on the temperature. The morphological transformations has been interpreted as a micelle-to-vesicle transition which is induced by the temperature variation (TI-MVT). The main features of the obtained results show that the temperature effect are far less profound in the system containing 2 or 12 mM NaC and can be assigned to small morfological changes within the same population of particles (vesicular or micellar, respectively). The main features of the structural analysis suggest that structural transformations at the TI-MVT proceed in the following sequence: globular micelles - rod-like micelles - polymer-like micelles - unilamellar vesicles. More specifically the globular and rod like micelles present an ellipsoidal cross-section rather than circular one, the former being geometrically more favourable for accommodation of bilayer-forming molecules like DMPC into the micellar structures

  3. Screening effects on 12C+12C fusion reaction

    Science.gov (United States)

    Koyuncu, F.; Soylu, A.

    2018-05-01

    One of the important reactions for nucleosynthesis in the carbon burning phase in high-mass stars is the 12C+12C fusion reaction. In this study, we investigate the influences of the nuclear potentials and screening effect on astrophysically interesting 12C+12C fusion reaction observables at sub-barrier energies by using the microscopic α–α double folding cluster (DFC) potential and the proximity potential. In order to model the screening effects on the experimental data, a more general exponential cosine screened Coulomb (MGECSC) potential including Debye and quantum plasma cases has been considered in the calculations for the 12C+12C fusion reaction. In the calculations of the reaction observables, the semi-classical Wentzel-Kramers-Brillouin (WKB) approach and coupled channel (CC) formalism have been used. Moreover, in order to investigate how the potentials between 12C nuclei produce molecular cluster states of 24Mg, the normalized resonant energy states of 24Mg cluster bands have been calculated for the DFC potential. By analyzing the results produced from the fusion of 12C+12C, it is found that taking into account the screening effects in terms of MGECSC is important for explaining the 12C+12C fusion data, and the microscopic DFC potential is better than the proximity potential in explaining the experimental data, also considering that clustering is dominant for the structure of the 24Mg nucleus. Supported by the Turkish Science and Research Council (TÜBİTAK) with (117R015)

  4. Investigation of low spin resonances in the 12C+12C and 16O+12C systems

    International Nuclear Information System (INIS)

    Uzureau, J.L.; Fieni, J.M.; Cocu, F.; Michaudon, A.

    1979-01-01

    The excitation functions of the 12 C( 12 C,α) 20 Ne and 12 C( 16 O,α) 24 Mg reactions were measured at different angles below the Coulomb barrier. Resonant structures were found at Esub(cm)=5.80 MeV in the 12 C+ 12 C system and at Esub(cm)=6.10 MeV in the 16 O+ 12 C system. From the analysis of angular distributions measured at the previous resonant energies, values of respectively Jsup(π)=0 + and 2 + have been deduced [fr

  5. 12C(3He,3He n)11C cross section at 910 MeV

    International Nuclear Information System (INIS)

    Aslanides, E.; Fassnacht, P.; Dellacasa, G.; Gallio, M.; Tuyn, J.W.N.

    1981-01-01

    The 12 C( 3 He, 3 He n) 11 C cross section at 910 MeV was measured by using a Ge(Li) gamma spectrometer to determine the disintegration rate and measuring the incident flux by means of a scintillator telescope. Cross sections for the production of 7 Be in C and Al and for the production of 24 Na in Al are then determined using the measured cross section as a monitor

  6. 12(R)-hydroxyicosatetraenoic acid: a cytochrome P450-dependent arachidonate metabolite that inhibits Na+, K+-ATPase in the cornea

    International Nuclear Information System (INIS)

    Schwartzman, M.L.; Balazy, M.; Masferrer, J.; Abraham, N.G.; McGiff, J.C.; Murphy, R.C.

    1987-01-01

    When corneal microsomes were incubated with arachidonic acid in the presence of an NADPH-generating system, four polar metabolites (compounds A-D) were formed. Synthesis of these metabolites could be inhibited by carbon monoxide, SKF 525A, and anti-cytochrome c reductase antibodies. One of the metabolites, compound C, was found to inhibit partially purified Na + , K + -ATPase from the corneal epithelium in a dose-dependent manner. After compound C was purified by TLC and HPLC, it was found to have a UV absorption spectrum with a maximum absorbance at 236 nm suggesting the presence of a conjugated diene. Mass spectrometric analysis using positive- and negative-ionization modes was carried out on derivatized compound C. Abundant fragment ions were consistent with compound C being a monooxygenated derivative of arachidonic acid with a hydroxyl substituent at carbon-12 of the icosanoid backbone; all deuterium atoms from [ 2 H 8 ]arachidonate were retained in the structure. Compound C was characterized as a 12-hydroxyicosatetraenoic acid. However, only 12(R) isomer was found to be an inhibitor of the Na + , K + -ATPase from the corneal epithelium, suggesting that the biologically active compound C was 12(R)-hydroxyy-5,8,10,14-icosatetraenoic acid. Such an inhibitor of Na + , K + -ATPase synthesized in the cornea may have an important role in regulating ocular transparency and aqueous human secretion

  7. Long-term adaptation of methanol-fed thermophilic (55°C) sulfate-reducing reactors to NaCl

    NARCIS (Netherlands)

    Vallero, M.V.G.; Lettinga, G.; Lens, P.N.L.

    2003-01-01

    A laboratory-scale upflow anaerobic sludge bed (UASB) reactor was operated during 273 days at increasing NaCl concentrations (0.5-12.5 g NaCl l(-1)) to assess whether the stepwise addition of the salt NaCl results in the acclimation of that sludge. The 6.5-1 thermophilic (55 degreesC), sulfidogenic

  8. Electrical and microstructural properties of CaTiO3-doped K1/2Na1 ...

    Indian Academy of Sciences (India)

    KNN) and CaTiO3- modified K1/2Na1/2NbO3 (CTO-KNN) systems, were investigated. Discs doped with 0 to 0.55% mol of CaTiO3 (CTO) were sintered at 1125°C for 2 h. Although minority phases were found in doped samples, CaTiO3 was not ...

  9. Study of the Na-C-O and Na-H-O ternary systems in the sodium rich corner

    International Nuclear Information System (INIS)

    Maupre, J.-P.

    1978-02-01

    The purpose of this study is to provide a contribution to the understanding of the sodium - carbon - oxygen and sodium - hydrogen - oxygen ternary systems in the sodium rich corner. In order to do this the Na-NaH-Na 2 O-NaOH phase diagram was completed and the Na-Na 2 O-Na 2 CO 3 -C phase diagram was outlined. This work is made up of two parts. The first is devoted to a critical literature survey essential to establish correct phase diagrams. The second is an experimental study followed by a discussion collating our finding to the literary data. The basic experimental technique used is differential thermal analysis (DTA) but it has been completed by quenching, X-ray and chemical analysis methods. The proposed phase diagrams imply that Na-NaH-Na 2 O-NaOH and Na-Na 2 O-Na 2 CO 3 -C systems are reciprocal ternary systems. Temperatures of stable pairs reversal are respectively 410 and 690 0 C. The stable pairs are Na-NaOH and Na-Na 2 CO 3 at elevated temperature, Na 2 O-NaH and Na 2 O-C at low temperature [fr

  10. Layered P2-Na 2/3 Co 1/2 Ti 1/2 O 2 as a high-performance cathode material for sodium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Sabi, Noha; Doubaji, Siham; Hashimoto, Kazuki; Komaba, Shinichi; Amine, Khalil; Solhy, Abderrahim; Manoun, Bouchaib; Bilal, Essaid; Saadoune, Ismael

    2017-02-01

    Layered oxides are regarded as promising cathode materials for sodium-ion batteries. We present Na2/3Co1/2Ti1/2O2 as a potential new cathode material for sodium-ion batteries. The crystal features and morphology of the pristine powder were characterized by X-ray diffraction (XRD) and scanning electron microscopy (SEM). The cathode material is evaluated in galvanostatic charge-discharge and galvanostatic intermittent titration tests, as well as ex-situ X-ray diffraction analysis. Synthesized by a high-temperature solid state reaction, Na2/3Co1/2Ti1/2O2 crystallizes in P2-type structure with P6(3)/mmc space group. The material presents reversible electrochemical behavior and delivers a specific discharge capacity of 100 mAh g(-1) when tested in Na half cells between 2.0 and 4.2 V (vs. Na+/Na), with capacity retention of 98% after 50 cycles. Furthermore, the electrochemical cycling of this titanium-containing material evidenced a reduction of the potential jumps recorded in the NaxCoO2 parent phase, revealing a positive impact of Ti substitution for Co. The ex-situ XRD measurements confirmed the reversibility and stability of the material. No structural changes were observed in the XRD patterns, and the P2-type structure was stable during the charge/discharge process between 2.0 and 4.2 V vs. Na+/Na. These outcomes will contribute to the progress of developing low cost electrode materials for sodium-ion batteries. (C) 2017 Elsevier B.V. All rights reserved.

  11. The two C-terminal tyrosines stabilize occluded Na/K pump conformations containing Na or K ions.

    Science.gov (United States)

    Vedovato, Natascia; Gadsby, David C

    2010-07-01

    Interactions of the three transported Na ions with the Na/K pump remain incompletely understood. Na/K pump crystal structures show that the extended C terminus of the Na,K-adenosine triphosphatase (ATPase) alpha subunit directly contacts transmembrane helices. Deletion of the last five residues (KETYY in almost all Na/K pumps) markedly lowered the apparent affinity for Na activation of pump phosphorylation from ATP, a reflection of cytoplasmic Na affinity for forming the occluded E1P(Na3) conformation. ATPase assays further suggested that C-terminal truncations also interfere with low affinity Na interactions, which are attributable to extracellular effects. Because extracellular Na ions traverse part of the membrane's electric field to reach their binding sites in the Na/K pump, their movements generate currents that can be monitored with high resolution. We report here electrical measurements to examine how Na/K pump interactions with extracellular Na ions are influenced by C-terminal truncations. We deleted the last two (YY) or five (KESYY) residues in Xenopus laevis alpha1 Na/K pumps made ouabain resistant by either of two kinds of point mutations and measured their currents as 10-mM ouabain-sensitive currents in Xenopus oocytes after silencing endogenous Xenopus Na/K pumps with 1 microM ouabain. We found the low affinity inhibitory influence of extracellular Na on outward Na/K pump current at negative voltages to be impaired in all of the C-terminally truncated pumps. Correspondingly, voltage jump-induced transient charge movements that reflect pump interactions with extracellular Na ions were strongly shifted to more negative potentials; this signals a several-fold reduction of the apparent affinity for extracellular Na in the truncated pumps. Parallel lowering of Na affinity on both sides of the membrane argues that the C-terminal contacts provide important stabilization of the occluded E1P(Na3) conformation, regardless of the route of Na ion entry into the

  12. Effect of He pressure on the superconducting transition temperatures of Na2CsC60 and (NH3)4Na2CsC60

    International Nuclear Information System (INIS)

    Schirber, J.E.; Bayless, W.R.; Rosseinsky, M.J.; Zhou, O.; Fleming, R.M.; Murphy, D.; Fischer, J.E.

    1994-01-01

    The Na based mixed alkali doped C 60 superconductors show anomalous behavior with respect to the ''universal'' superconducting transition temperature T c vs lattice constant a 0 relation followed by most of the fcc A 3 C 60 superconductors. We have measured dt c /dP for Na 2 CsC 60 and (NH 3 ) 4 Na 2 CsC 60 using solid He as the pressure medium to ∼ 6 kbar finding dT c /dP equal to -0.8±(0.01) K/kbar and -1.0(±0.1)K/kbar for Na 2 CsC 60 and Na 2 (NH 3 ) 4 C 60 respectively. Our value for Na 2 CsC 60 differs markedly from that obtained by Mizuki et al of about -1.3 K/kbar. However, using N 2 or Ar, we obtain values for dT c /dP in substantial agreement with Mizuki et al who used fluorinert to generate their pressure. This work emphasizes the need for compressibility measurements with the same pressure medium in the appropriate temperature range so that meaningful comparisons can be made between various pressure measurements and models which are based on lattic spacing

  13. Rotational dynamics of C60 in Na2RbC60

    International Nuclear Information System (INIS)

    Christides, C.; Prassides, K.; Neumann, D.A.; Copley, J.R.D.; Mizuki, J.; Tanigaki, K.; Hirosawa, I.; Ebbesen, T.W.

    1993-01-01

    We have measured the low-energy neutron inelastic-scattering (NIS) spectra of superconducting Na 2 RbC 60 in the temperature range 50-350 K. Well-defined librational peaks are observed at 50 K at 2.83(17) meV (FWHM = 1.7(5) meV). They soften and broaden with increasing temperature. Their behaviour mimics that found in solid C 60 and differs markedly from K 3 C 60 . The rotational barrier for C 60 reorientations in Na 2 RbC 60 is somewhat higher than in pristine C 60 and approximately half as large as in K 3 C 60 . An order-disorder transition is anticipated at a temperature higher than that found in C 60 . (orig.)

  14. High-pressure growth of NaMn7O12 crystals

    International Nuclear Information System (INIS)

    Gilioli, Edi; Calestani, Gianluca; Licci, Francesca; Paorici, Carlo; Gauzzi, Andrea; Bolzoni, Fulvio; Prodi, Andrea

    2006-01-01

    With the aim of producing large crystals of metastable NaMn 7 O 12 manganite, suitable for physical measurements (i.e.: RXS, Raman, EPR, STS, single-crystal neutron diffraction), we carried out a systematic investigation of the parameters controlling the growth of crystals, including the thermodynamic variables (T, P, and reagent composition) and the kinetic factors, such as reaction time and heating/cooling rate. By varying each parameter while maintaining constant the other ones, we found the thermodynamic conditions under which an optimum equilibrium is reached between the competing nucleation and growth rates. They were found to range between 400 and 700 o C (T) and between 20 and 60 Kbars (P), respectively. Under these conditions, we further optimized the growth process, by establishing the most appropriate growth duration (several hours), reagent type (pre-reacted precursor) and composition (presence of 0.4 mole% water and of 5% Na excess with respect to the stoichiometric composition). Typical crystals having several hundreds μm in linear sizes were reproducibly obtained, while the largest sample was about 800 μm. A description of the crystal growth mechanism, based on the experimental results, is also presented and discussed. It assumes that two different mechanisms control the crystal growth, depending on whether the crystallization is taking place outside the stability field, i.e. in presence of native reagents, or inside it, i.e. in a polycrystalline NaMn 7 O 12 phase matrix. In the first case, large crystal growth occurs thanks to the low nucleation and high diffusion rates, while in the second one the crystallization is due to the solid-state mechanism based on the free energy reduction caused by grain boundary migration. - Graphical abstract: Optical (a) and SEM images (b) of NaMn 7 O 12 crystals. Note the markers: 300 μm, top-right corner (a) and 40 μm, bottom left (b)

  15. Search for 12 C+ 12 C clustering in 24 Mg ground state

    Indian Academy of Sciences (India)

    In the backdrop of many models, the heavy cluster structure of the ground state of 24 Mg has been probed experimentally for the first time using the heavy cluster knockout reaction 24 Mg( 12 C, 212 C) 12 C in thequasifree scattering kinematic domain. In the ( 12 C, 212 C) reaction, the direct 12 C-knockout cross-section was ...

  16. C-peptide increases Na,K-ATPase expression via PKC- and MAP kinase-dependent activation of transcription factor ZEB in human renal tubular cells.

    Directory of Open Access Journals (Sweden)

    Dana Galuska

    Full Text Available Replacement of proinsulin C-peptide in type 1 diabetes ameliorates nerve and kidney dysfunction, conditions which are associated with a decrease in Na,K-ATPase activity. We determined the molecular mechanism by which long term exposure to C-peptide stimulates Na,K-ATPase expression and activity in primary human renal tubular cells (HRTC in control and hyperglycemic conditions.HRTC were cultured from the outer cortex obtained from patients undergoing elective nephrectomy. Ouabain-sensitive rubidium ((86Rb(+ uptake and Na,K-ATPase activity were determined. Abundance of Na,K-ATPase was determined by Western blotting in intact cells or isolated basolateral membranes (BLM. DNA binding activity was determined by electrical mobility shift assay (EMSA. Culturing of HRTCs for 5 days with 1 nM, but not 10 nM of human C-peptide leads to increase in Na,K-ATPase α(1-subunit protein expression, accompanied with increase in (86Rb(+ uptake, both in normal- and hyperglycemic conditions. Na,K-ATPase α(1-subunit expression and Na,K-ATPase activity were reduced in BLM isolated from cells cultured in presence of high glucose. Exposure to1 nM, but not 10 nM of C-peptide increased PKCε phosphorylation as well as phosphorylation and abundance of nuclear ERK1/2 regardless of glucose concentration. Exposure to 1 nM of C-peptide increased DNA binding activity of transcription factor ZEB (AREB6, concomitant with Na,K-ATPase α(1-subunit mRNA expression. Effects of 1 nM C-peptide on Na,K-ATPase α(1-subunit expression and/or ZEB DNA binding activity in HRTC were abolished by incubation with PKC or MEK1/2 inhibitors and ZEB siRNA silencing.Despite activation of ERK1/2 and PKC by hyperglycemia, a distinct pool of PKCs and ERK1/2 is involved in regulation of Na,K-ATPase expression and activity by C-peptide. Most likely C-peptide stimulates sodium pump expression via activation of ZEB, a transcription factor that has not been previously implicated in C

  17. Structural and electrical properties of Na{sub 1/2}La{sub 1/2}TiO{sub 3} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Barik, S K; Mahapatra, P K [Vidyasagar University, Department of Physics and Technophysics, Midnapur, West Bengal (India); Choudhary, R N.P. [Department of Physics and Meteorology, I.I.T. Kharagpur (India)

    2006-11-15

    Na{sub 1/2}La{sub 1/2}TiO{sub 3} (NLT) ceramic was prepared by a high-temperature solid-state reaction technique. A preliminary structural analysis (XRD) suggested the formation of a single-phase orthorhombic structure. SEM micrograph of the material showed uniform grain distribution on the surface of the sample. The dielectric permittivity and the loss tangent of the sample were measured in a frequency range from 1 kHz to 1 MHz and a temperature range 28 C to 525 C. Electrical properties of the material were studied using an ac impedance spectroscopic technique. Detailed analysis of the impedance spectrum suggested that the electrical properties of the material are strongly temperature dependant. The Nyquist plots clearly showed the presence of both bulk and grain boundary effect in the compound. The activation energy was estimated to be 1.1 eV from the temperature variation of dc conductivity. The a.c. conductivity spectrum suggests a typical signature of ion conducting system. (orig.)

  18. 12(R)-hydroxyicosatetraenoic acid: a cytochrome P450-dependent arachidonate metabolite that inhibits Na/sup +/, K/sup +/-ATPase in the cornea

    Energy Technology Data Exchange (ETDEWEB)

    Schwartzman, M.L.; Balazy, M.; Masferrer, J.; Abraham, N.G.; McGiff, J.C.; Murphy, R.C.

    1987-11-01

    When corneal microsomes were incubated with arachidonic acid in the presence of an NADPH-generating system, four polar metabolites (compounds A-D) were formed. Synthesis of these metabolites could be inhibited by carbon monoxide, SKF 525A, and anti-cytochrome c reductase antibodies. One of the metabolites, compound C, was found to inhibit partially purified Na/sup +/, K/sup +/-ATPase from the corneal epithelium in a dose-dependent manner. After compound C was purified by TLC and HPLC, it was found to have a UV absorption spectrum with a maximum absorbance at 236 nm suggesting the presence of a conjugated diene. Mass spectrometric analysis using positive- and negative-ionization modes was carried out on derivatized compound C. Abundant fragment ions were consistent with compound C being a monooxygenated derivative of arachidonic acid with a hydroxyl substituent at carbon-12 of the icosanoid backbone; all deuterium atoms from (/sup 2/H/sub 8/)arachidonate were retained in the structure. Compound C was characterized as a 12-hydroxyicosatetraenoic acid. However, only 12(R) isomer was found to be an inhibitor of the Na/sup +/, K/sup +/-ATPase from the corneal epithelium, suggesting that the biologically active compound C was 12(R)-hydroxyy-5,8,10,14-icosatetraenoic acid. Such an inhibitor of Na/sup +/, K/sup +/-ATPase synthesized in the cornea may have an important role in regulating ocular transparency and aqueous human secretion.

  19. Preparation and photonic bandgap properties of Na1/2Bi1/2TiO3 inverse opal photonic crystals

    International Nuclear Information System (INIS)

    Yang Zhengwen; Zhou Ji; Huang Xueguang; Xie Qin; Fu Ming; Li Bo; Li Longtu

    2009-01-01

    The Na 1/2 Bi 1/2 TiO 3 (NBT) inverse opal photonic crystals were prepared by the self-assembly technique in combination with a sol-gel method. In the preparation process, NBT precursors were filled into the interstices of the opal template assembled by monodispersive polystyrene microspheres. The polystyrene template was then removed by calcination at 800 deg. C for 5 h, meanwhile, a perovskite NBT inverse opal photonic crystal was formed. An optical micrograph shows that the NBT inverse opals reflect green-yellow light strongly. Moreover, a photonic band gap was observed by reflective spectra of NBT sample

  20. Influence of organic matter type and medium composition on the sorption affinity of C12-benzalkonium cation

    International Nuclear Information System (INIS)

    Chen, Yi; Hermens, Joop L.M.; Droge, Steven T.J.

    2013-01-01

    We used the 7-μm polyacrylate ion-exchange SPME fibers to investigate C12-benzalkonium sorption to 10 mg/L natural organic matter at concentrations well below the cation-exchange capacity. C12-BAC sorption at constant medium conditions differed within 0.4 log units for two humic acids (Aldrich, Leonardite) and peat (Sphagnum, Pahokee), with similar nonlinear sorption isotherms (K F ∼ 0.8). Sorption to the SPME fibers and Aldrich humic acid (AHA) was reduced at both low pH and high electrolyte concentration, and reduced more strongly by Ca 2+ compared with Na + at similar concentrations. Sorption isotherms for AHA (5–50–500 mM Na + , pH 6) was modeled successfully by the NICA-Donnan approach, resulting in an intrinsic sorption coefficient of 5.35 (C aq = 1 nM). The NICA-Donnan model further explained the stronger specific binding of Ca 2+ compared to Na + by differences in Boltzmann factors. This study provides relevant information to interpret bioavailability of quaternary ammonium compounds, and possibly for other organic cations. -- Highlights: •The ion-exchange SPME was used to investigate C12-benzalkonium sorption behavior. •Sorption to different organic matter differed within 0.4 log units (5 mM Ca 2+ , pH6). •Sorption to AHA was reduced at both low pH and high electrolyte concentration. •The NICA-Donnan approach lead to an intrinsic log D OC,IE of 5.35 (C aq = 1 nM). •The Boltzmann factors in NICA-Donnan model explained the specific binding of Ca 2+ . -- C12-BAC sorption to the four organic matter samples were investigated by the ion-exchange SPME and the NICA-Donnan model explained the different sorption affinities caused by Na + and Ca 2+

  1. Pycnonuclear 12C+12C reaction at zero temperature

    International Nuclear Information System (INIS)

    Gasques, L R; Beard, M; Chamon, L C; Wiescher, M

    2005-01-01

    We present pycnonuclear reaction calculations for a one-component ionic crystal at zero temperature considering different theoretical approaches. The rates depend directly on the determination of the astrophysical S-factor at low energies, which has been obtained through the barrier penetration formalism. A totally parameter-free model for the real part of the nuclear interaction has been employed in the calculation of 12 C+ 12 C fusion cross sections

  2. Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands

    International Nuclear Information System (INIS)

    Amiot, C.

    1983-01-01

    The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41

  3. Inelastic 12C(12C, 12C)12C scattering via the Glauber optical potential at E/A=30 MeV and 85 MeV

    International Nuclear Information System (INIS)

    Chauvin, J.; Lebrun, D.; Durand, F.; Buenerd, M.

    1984-07-01

    It is shown that some approximations implied in the optical limit of the Glauber theory are justified for low energies heavy-ions surface collisions. The Glauber optical potential -with no free parameters- leads to reasonable predictions for both elastic and inelastic scattering in the 12 C + 12 C system

  4. Theoretical prediction of morphotropic compositions in Na1/2Bi1/2TiO3-based solid solutions from transition pressures

    Science.gov (United States)

    Gröting, Melanie; Albe, Karsten

    2014-02-01

    In this article we present a method based on ab initio calculations to predict compositions at morphotropic phase boundaries in lead-free perovskite solid solutions. This method utilizes the concept of flat free energy surfaces and involves the monitoring of pressure-induced phase transitions as a function of composition. As model systems, solid solutions of Na1/2Bi1/2TiO3 with the alkali substituted Li1/2Bi1/2TiO3 and K1/2Bi1/2TiO3 and the alkaline earth substituted CaTiO3 and BaTiO3 are chosen. The morphotropic compositions are identified by determining the composition at which the phase transition pressure equals zero. In addition, we discuss the different effects of hydrostatic pressure (compression and tension) and chemical substitution on the antiphase tilts about the [111] axis (a-a-a-) present in pure Na1/2Bi1/2TiO3 and how they develop in the two solid solutions Na1/2Bi1/2TiO3-CaTiO3 and Na1/2Bi1/2TiO3-BaTiO3. Finally, we discuss the advantages and shortcomings of this simple computational approach.

  5. Structural and electrical properties of Na{sub 1/2}Gd{sub 1/2}TiO{sub 3} nanoceramics

    Energy Technology Data Exchange (ETDEWEB)

    Barik, Subrat K [Department of Physics and Meteorology, IIT Kharagpur, Kharagpur 721302 (India); Choudhary, R N.P. , [Department of Physics and Meteorology, IIT Kharagpur, Kharagpur 721302 (India); Mahapatra, P K [Department of Physics and Technophysics, Vidyasagar University, Midnapur 721102, West Bengal (India)

    2008-07-14

    The polycrystalline fine (i.e., 38 nm) powder of Na{sub 1/2}Gd{sub 1/2}TiO{sub 3} was prepared by a high-temperature solid-state reaction technique. The formation of single phase compound was confirmed by an X-ray diffraction technique. A preliminary structural analysis exhibited the orthogonal crystal structure of the compound. The surface morphology was studied by scanning electron microscopy. The dielectric permittivity and the loss tangent of the pellet sample were obtained in a wide frequency range (1 kHz-1 MHz) at different temperatures (28-500 deg. C). A dielectric anomaly was observed at 73 deg. C which may be related to ferroelectric-paraelectric phase transition. The ferroelectric transition was confirmed by observation of hysteresis loop at room temperature. Electrical properties of the pellet sample were studied using an AC impedance spectroscopic technique. Detailed analysis of impedance spectra indicated the bulk contribution to electrical properties below 375 deg. C, and the grain boundary above 375 deg. C. The negative temperature coefficient of resistance (NTCR) effect and the temperature dependant electrical relaxation phenomenon in the sample were also observed. Studies of DC conductivity exhibited that the material has a thermally activated process. AC conductivity spectrum obeys Jonscher's universal power law.

  6. The influence of FLiNaK salt impregnation on the mechanical properties of a 2D woven C/C composite

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Dongsheng, E-mail: zhangdongsheng@sinap.ac.cn; Xia, Huihao; Yang, Xinmei, E-mail: yangxinmei@sinap.ac.cn; Feng, Shanglei; Song, Jinliang; Zhou, Xingtai

    2017-03-15

    Impregnating of molten LiF-NaF-KF salt (LiF-NaF-KF: 46.5–11.5-42 mol%, FLiNaK) into a 2D woven C/C composite was performed at 650 °C under different pressure. The weight gain and mechanical properties change of the 2D woven C/C composite after FLiNaK salt impregnation were measured. The FLiNaK salt distribution into the 2D woven C/C composite was observed by X-ray computed tomography (X-ray CT) and scanning electron microscopy. The results showed that the weight gain of the 2D woven C/C composite increased with increasing impregnating pressure. In X-ray CT images, FLiNaK salt was distributed into the open pores and fissures among fiber bundles and neighboring plies. The interlaminar shear strength, compressive strength, and flexural strength of the 2D woven C/C composite increased with the increase of weight gain. The influence of FLiNaK salt impregnation on the mechanical properties was attributed to the coupling effect of re-densification of FLiNaK salt impregnation and residual stress formed in 2D woven C/C composite. - Highlights: • FLiNaK salt was distributed into the open pores and fissures among fiber bundles. • The mechanical properties of the 2D woven C/C composite increased with the increase of weight gain. • The influence of FLiNaK was attributed to the re-densification of FLiNaK salt and residual stress.

  7. Solubility of NaNd(CO3)2.6H2O(c) in concentrated Na2CO3 and NaHCO3 solutions

    International Nuclear Information System (INIS)

    Rao, L.; Rai, D.; Felmy, A.R.; Fulton, R.W.; Novak, C.F.

    1996-01-01

    NaNd(CO 3 ) 2 x 6 H 2 O(c) was identified to be the final equilibrium solid phase in suspensions containing concentrated sodium carbonate (0.1 to 2.0 M) and sodium bicarbonate (0.1 to 1.0 M), with either NaNd(CO 3 ) 2 x 6 H 2 O(c) or Nd 2 (CO 3 ) 3 x xH 2 O(s) as initial solids. A thermodynamic model, based on Pitzer's specific into-interaction approach, was developed to interpret the solubility of NaNd(CO 3 ) 2 x 6 H 2 O(c) as functions of sodium carbonate and sodium bicarbonate concentrations. In this model, the solubility data of NaNd(CO 3 ) 2 x 6 H 2 O(c) were explained by assuming the formation of NdCO 3 + , Nd(CO 3 ) 2 - and Nd(CO 3 ) 3 3- species and invoking the specific ion interactions between Na + and Nd(CO 3 ) 3 3- . Ion interaction parameters for Na + -Nd(CO 3 ) 3 3- were developed to fit the solubility data. Based on the model calculations, Nd(CO 3 ) 3 3- was the predominant aqueous neodymium species in 0.1 to 2 M sodium carbonate and 0.1 to 1 M sodium bicarbonate solutions. The logarithm of the NaNd(CO 3 ) 2 x 6 H 2 O solubility product (NaNd(CO 3 ) 2 x 6 H 2 O(c)=Na + +Nd 3+ +2 CO 3 2- +6 H 2 O) was calculated to be -21.39. This model also provided satisfactory interpretation of the solubility data of the analogous Am(III) system in less concentrated carbonate and bicarbonate solutions. (orig.)

  8. PLC-dependent intracellular Ca2+ release was associated with C6-ceramide-induced inhibition of Na+ current in rat granule cells.

    Science.gov (United States)

    Liu, Zheng; Fei, Xiao-Wei; Fang, Yan-Jia; Shi, Wen-Jie; Zhang, Yu-Qiu; Mei, Yan-Ai

    2008-09-01

    In this report, the effects of C(6)-ceramide on the voltage-gated inward Na(+) currents (I(Na)), two types of main K(+) current [outward rectifier delayed K(+) current (I(K)) and outward transient K(+) current (I(A))], and cell death in cultured rat cerebellar granule cells were investigated. At concentrations of 0.01-100 microM, ceramide produced a dose-dependent and reversible inhibition of I(Na) without alteration of the steady-state activation and inactivation properties. Treatment with C(2)-ceramide caused a similar inhibitory effect on I(Na). However, dihydro-C(6)-ceramide failed to modulate I(Na). The effect of C(6)-ceramide on I(Na) was abolished by intracellular infusion of the Ca(2+)-chelating agent, 1,2-bis (2-aminophenoxy) ethane-N, N, N9, N9-tetraacetic acid, but was mimicked by application of caffeine. Blocking the release of Ca(2+) from the sarcoplasmic reticulum with ryanodine receptor blocker induced a gradual increase in I(Na) amplitude and eliminated the effect of ceramide on I(Na). In contrast, the blocker of the inositol 1,4,5-trisphosphate-sensitive Ca(2+) receptor did not affect the action of C(6)-ceramide. Intracellular application of GTPgammaS also induced a gradual decrease in I(Na) amplitude, while GDPbetaS eliminated the effect of C(6)-ceramide on I(Na). Furthermore, the C(6)-ceramide effect on I(Na) was abolished after application of the phospholipase C (PLC) blockers and was greatly reduced by the calmodulin inhibitors. Fluorescence staining showed that C(6)-ceramide decreased cell viability and blocking I(Na) by tetrodotoxin did not mimic the effect of C(6)-ceramide, and inhibiting intracellular Ca(2+) release by dantrolene could not decrease the C(6)-ceramide-induced cell death. We therefore suggest that increased PLC-dependent Ca(2+) release through the ryanodine-sensitive Ca(2+) receptor may be responsible for the C(6)-ceramide-induced inhibition of I(Na), which does not seem to be associated with C(6)-ceramide-induced granule

  9. Study of the alpha+12C →16O capture via 12C(16O,12C)16O transfer reaction

    International Nuclear Information System (INIS)

    Morais, M.C.; Lichtenthaeler, R.; Arazi, A.; Hojman, D.; Cardona, M.A.; Fimiani, L.; Carnelli, P.F.; Marti, G.V.; Pacheco, A.J.; Heimann, D. Martinez; Negri, A.E.; Capurro, O.A.; Niello, J.O. Fernandez; Montero, P.

    2009-01-01

    Full text: The 12 C(α γ) 16 O reaction is one of the most important in nuclear astrophysics. The rate of this reaction influences the subsequent nucleosynthesis of heavier elements in massive stars and consequently determines the stellar evolution. The 12 C(α γ) 16 O reaction cross section is extremely small at stellar temperature, this is mainly due to the Gamow energy (∼ 300KeV at T= 2x10 8 K) be much lower than the Coulomb barrier, E C.B. : = 3:142MeV. The α+ 12 C → 16 O at low energies is dominated by subthreshold states (1 - , 7:12MeV) and (2 + , 6:92MeV) of the 16 O, thus spectroscopic factors measurements of these states are very important. We propose to use the α-transfer reaction 12 C( 16 O, 12 C) 16 O * at very forward angles to obtain those spectroscopic factors. In this way, measurements of elastic and inelastic angular distributions for the 12 C+ 16 O system were performed at the TANDAR Laboratory in Buenos Aires, using an 16 O beam of E lab = 46.3MeV. These angular distributions were obtained using 8 adjacent surface barrier detectors and the measurements were performed from 5 deg to 48.5 deg with steps of 1 deg. The scattering chamber has an angular precision better than 0.1 deg. The transfer angular distributions are being analysed by DWBA using the computer code FRESCO in order to obtain the two spectroscopic factors. (author)

  10. Emission of particles in the 12 C + 12 C fusion

    International Nuclear Information System (INIS)

    Martinez Q, E.; Aguilera, E.F.; Rosales, P.

    2002-01-01

    A fusion process analysis of the 12 C + 12 C reaction is done, using the LILITA program. The analysis consisted mainly in varying the value of the Levels density parameter, determining on this way the value of such parameter which reproduces better the contribution of the different channels of fusion-evaporation of particles for this system at different energies. Moreover a comparison with measures done in the Instituto Nacional de Investigaciones Nucleares is realized. (Author)

  11. The influence of excess K2O on the electrical properties of (K,Na)1/2Bi1/2TiO3 ceramics

    Science.gov (United States)

    Li, Linhao; Li, Ming; Sinclair, Derek C.

    2018-04-01

    The solid solution (KxNa0.50-x)Bi0.50TiO3 (KNBT) between Na1/2Bi1/2TiO3 and K1/2Bi1/2TiO3 (KBT) has been extensively researched as a candidate lead-free piezoelectric material because of its relatively high Curie temperature and good piezoelectric properties, especially near the morphotropic phase boundary (MPB) at x ˜ 0.10 (20 mol. % KBT). Here, we show that low levels of excess K2O in the starting compositions, i.e., (Ky+0.03Na0.50-y)Bi0.50TiO3.015 (y-series), can significantly change the conduction mechanism and electrical properties compared to a nominally stoichiometric KNBT series (KxNa0.50-x)Bi0.50TiO3 (x-series). Impedance spectroscopy measurements reveal significantly higher bulk conductivity (σb) values for y ≥ 0.10 samples [activation energy (Ea) ≤ 0.95 eV] compared to the corresponding x-series samples which possess bandgap type electronic conduction (Ea ˜ 1.26-1.85 eV). The largest difference in electrical properties occurs close to the MPB composition (20 mol. % KBT) where y = 0.10 ceramics possess σb (at 300 °C) that is 4 orders of magnitude higher than that of x = 0.10 and the oxide-ion transport number in the former is ˜0.70-0.75 compared to processing. This demonstrates the electrical properties of KNBT to be sensitive to low levels of A-site nonstoichiometry and indicates that excess K2O in KNBT starting compositions to compensate for volatilisation can lead to undesirable high dielectric loss and leakage currents at elevated temperatures.

  12. Search for 12 C+ 12 C clustering in 24 Mg ground state

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 2. Search for 12C+12C clustering in 24Mg ground state. B N JOSHI ARUN K JAIN D C BISWAS B V JOHN Y K GUPTA L S DANU R P VIND G K PRAJAPATI S MUKHOPADHYAY A SAXENA. Regular Volume 88 Issue 2 February 2017 Article ID 29 ...

  13. Emission of particles in the {sup 12} C + {sup 12} C fusion; Emision de particulas en la fusion de {sup 12} C + {sup 12} C

    Energy Technology Data Exchange (ETDEWEB)

    Martinez Q, E.; Aguilera, E.F.; Rosales, P. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    2002-07-01

    A fusion process analysis of the {sup 12} C + {sup 12} C reaction is done, using the LILITA program. The analysis consisted mainly in varying the value of the Levels density parameter, determining on this way the value of such parameter which reproduces better the contribution of the different channels of fusion-evaporation of particles for this system at different energies. Moreover a comparison with measures done in the Instituto Nacional de Investigaciones Nucleares is realized. (Author)

  14. 12C(n , 2 n )11C cross section from threshold to 26.5 MeV

    Science.gov (United States)

    Yuly, M.; Eckert, T.; Hartshaw, G.; Padalino, S. J.; Polsin, D. N.; Russ, M.; Simone, A. T.; Brune, C. R.; Massey, T. N.; Parker, C. E.; Fitzgerald, R.; Sangster, T. C.; Regan, S. P.

    2018-02-01

    The 12C(n ,2 n )11C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3H(d ,n )4He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β+ decay of 11C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1H(n ,p ) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.

  15. Study for the charge symmetric systems, 12C+13N and 12C+13C with the orthogonalized coupled-reaction-channel method

    International Nuclear Information System (INIS)

    Imanishi, B.; Denisov, V.; Motobayashi, T.

    1996-10-01

    The charge-symmetric scattering systems, 12 C+ 13 N and 12 C+ 13 C have been investigated by using the orthogonalized coupled-reaction-channel (OCRC) method with the basis functions of the elastic, inelastic and transfer channels defined by the single-particle states, 1p1/2, 2s1/2, 1d5/2 and 1d3/2 of the valence nucleon in 13 N or 13 C. The data of the elastic scattering of 13 N on 12 C measured by Lienard et al. have been explained consistently with the data of the elastic and inelastic scattering of the 12 C+ 13 C system. The CRC effects both on the above systems are very strong, although those on the 12 C+ 13 N system are fairly weaker than the 12 C+ 13 C system. The role of the highly excited single-particle states 1d3/2 is particularly important in the formation of a specific CRC scheme, i.e., the formation of the covalent molecules due to the hybridization caused by the mixing of the different parity single-particle states. The fusion cross sections of the 12 C+ 13 C system at energies below the Coulomb barrier are strongly enhanced as a result of the strong CRC effects as compared with those of the 12 C+ 12 C system, while in 12 C+ 13 N system the enhancement of the sub-barrier fusion has not been observed. The above absorption mechanism for the 12 C+ 13 C system explains the lack of the molecular-resonance phenomena observed in the 12 C+ 12 C system. We check the effects of the dipole (E1) transition of the valence nucleon in 13 N (and also in 13 C) due to the core-core Coulomb interaction in the scattering at sub-barrier energies. The effects are not appreciable. (author)

  16. Nuclear molecules in the systems 12C+12C and 16O+16O

    International Nuclear Information System (INIS)

    Tiereth, W.

    1986-01-01

    For the two heavy ion systems 12 C+ 12 C and 16 O+ 16 O by means of scattering experiments studies on the phenomena of nuclear molecules were performed. For the 12 C+ 12 C system in the range of the Coulomb wall precision measurements of the elastic scattering were performed. In the two energy ranges of 5.5 ≤ E c.m. ≤ 6.65 MeV and 6.95 ≤ E c.m ≤ 7.375 MeV where the existence of many quasimolecular resonances is known in energy steps of ΔE c.m. = 25 keV angular distributions in the range 10 0 ≤ θ c.m. ≤ 90 0 with Δθ c.m. = 1 0 were measured. For several of the found quasimolecular resonances the spin and the carbon width could be uniquely determined. This was reached by a partial wave analysis of the obtained data. Supplemented were the measurements of the elastic scattering by measurements of the excitation function of the θ 0 exit channel of the reaction 12 ( 12 C, θ) 20 Ne in the energy range from 5.2 ≤ E c.m. ≤ 6.1 MeV. At some known resonances in the 16 O+ 16 O system in the energy range from 15.5 MeV to 18 MeV the spin and the elastic width of these structures could be determined. For this a constrained partial wave analysis on complete angular distributions of the elastic scattering (9 0 ≤ θ c.m. ≤ 90 0 ) which were measured in energy steps of ΔE c.m. = 50 keV was performed. In the 16 O+ 16 O system besides the proof for the existence of a nuclear glory scattering was given. (orig.) [de

  17. Enhancement of Palmarumycins C(12) and C(13) production in liquid culture of endophytic fungus Berkleasmium sp. Dzf12 after treatments with metal ions.

    Science.gov (United States)

    Mou, Yan; Luo, Haiyu; Mao, Ziling; Shan, Tijiang; Sun, Weibo; Zhou, Kaiyi; Zhou, Ligang

    2013-01-07

    The influences of eight metal ions (i.e., Na+, Ca2+, Ag+, Co2+, Cu2+, Al3+, Zn2+, and Mn4+) on mycelia growth and palmarumycins C(12) and C(13) production in liquid culture of the endophytic fungus Berkleasmium sp. Dzf12 were investigated. Three metal ions, Ca2+, Cu2+ and Al3+ were exhibited as the most effective to enhance mycelia growth and palmarumycin production. When calcium ion (Ca2+) was applied to the medium at 10.0 mmol/L on day 3, copper ion (Cu2+) to the medium at 1.0 mmol/L on day 3, aluminum ion (Al3+) to the medium at 2.0 mmol/L on day 6, the maximal yields of palmarumycins C(12) plus C(13) were obtained as 137.57 mg/L, 146.28 mg/L and 156.77 mg/L, which were 3.94-fold, 4.19-fold and 4.49-fold in comparison with that (34.91 mg/L) of the control, respectively. Al3+ favored palmarumycin C(12) production when its concentration was higher than 4 mmol/L. Ca2+ had an improving effect on mycelia growth of Berkleasmium sp. Dzf12. The combination effects of Ca2+, Cu2+ and Al3+ on palmarumycin C(13) production were further studied by employing a statistical method based on the central composite design (CCD) and response surface methodology (RSM). By solving the quadratic regression equation between palmarumycin C(13) and three metal ions, the optimal concentrations of Ca2+, Cu2+ and Al3+ in medium for palmarumycin C(13) production were determined as 7.58, 1.36 and 2.05 mmol/L, respectively. Under the optimum conditions, the predicted maximum palmarumycin C(13) yield reached 208.49 mg/L. By optimizing the combination of Ca2+, Cu2+ and Al3+ in medium, palmarumycin C(13) yield was increased to 203.85 mg/L, which was 6.00-fold in comparison with that (33.98 mg/L) in the original basal medium. The results indicate that appropriate metal ions (i.e., Ca2+, Cu2+ and Al3+) could enhance palmarumycin production. Application of the metal ions should be an effective strategy for palmarumycin production in liquid culture of the endophytic fungus Berkleasmium sp. Dzf12.

  18. Hydrothermal crystallization of Na2Ti6O13, Na2Ti3O7, and Na16Ti10O28 in the NaOH-TiO2-H2O system at a temperature of 500 deg. C and a pressure of 0.1 GPa: The structural mechanism of self-assembly of titanates from suprapolyhedral clusters

    International Nuclear Information System (INIS)

    Hyushin, G. D.

    2006-01-01

    An increase in the NaOH concentration in the NaOH-TiO 2 (rutile)-H 2 O system at a temperature of 500 deg. C and a pressure of 0.1 GPa leads to the crystallization R-TiO 2 + Na 2 Ti 6 O 13 → Na 2 Ti 3 O 7 → Na 16 Ti 10 O 28 . Crystals of the Na 2 Ti 6 O 13 titanate (space group C2/m) have the three-dimensional framework structure Ti 6 O 13 . The structure of the Na 2 Ti 3 O 7 titanate (space group P2 1 /m) contains the two-dimensional layers Ti 3 O 7 . The structure of the Na 16 Ti 10 O 28 titanate (space group P-1) is composed of the isolated ten-polyhedron cluster precursors Ti 10 O 28 . In all the structures, the titanium atoms have an octahedral coordination (MTiO 6 ). The matrix self-assembly of the Na 2 Ti 6 O 13 and Na 2 Ti 3 O 7 (Na 4 Ti 6 O 14 ) crystal structures from Na 4 M 12 invariant precursors is modeled. These precursors are clusters consisting of twelve M polyhedra linked through the edges. It is demonstrated that the structurally rigid precursors Na 4 M 12 control all processes of the subsequent evolution of the crystal-forming titanate clusters. The specific features of the self-assembly of the Na 2 Ti 3 O 7 structure that result from the additional incorporation of twice the number of sodium atoms into the composition of the high-level clusters are considered

  19. Comparison of aggregation behaviors between ionic liquid-type imidazolium gemini surfactant [C12-4-C12im]Br2 and its monomer [C12mim]Br on silicon wafer.

    Science.gov (United States)

    Ao, Mingqi; Xu, Guiying; Pang, Jinyu; Zhao, Taotao

    2009-09-01

    The aggregation of ionic liquid-type imidazolium gemini surfactant [C(12)-4-C(12)im]Br(2) on silicon wafer, which is compared with its monomer [C(12)mim]Br, have been studied. AFM morphology images and contact angle measurements suggest that the aggregations of [C(12)-4-C(12)im]Br(2) and [C(12)mim]Br on silicon wafer follow different mechanisms. Below the critical surface aggregation concentrations (CSAC), both surfactant molecules are adsorbed with their hydrophobic tails facing the air. But above the CSAC, [C(12)-4-C(12)im]Br(2) molecules finally form a bilayer structure with hydrophilic head groups facing the air, whereas [C(12)mim]Br molecules form a multilayer structure, and with increasing its concentration, the layer numbers increase with the hydrophobic chains and hydrophilic head groups facing the air by turns. Besides, the watery wettability of [C(12)-4-C(12)im]Br(2)-treated silica surface is lower than that of [C(12)mim]Br at the concentration of 5.0 cmc, and the infrared spectroscopy suggests that the poorer watery wettability of [C(12)-4-C(12)im]Br(2) may be relative to the less-ordered packing of methylene chains inside the aggregate. These different aggregation behaviors for the two surfactants ascribe to the different molecular structures and electrostatic interactions. This work would have certain theoretical guidance meaning on the modification of solid surface.

  20. Oracle 12c for dummies

    CERN Document Server

    Ruel, Chris

    2013-01-01

    Demystifying the power of the Oracle 12c database The Oracle database is the industry-leading relational database management system (RDMS) used from small companies to the world's largest enterprises alike for their most critical business and analytical processing. Oracle 12c includes industry leading enhancements to enable cloud computing and empowers users to manage both Big Data and traditional data structures faster and cheaper than ever before. Oracle 12c For Dummies is the perfect guide for a novice database administrator or an Oracle DBA who is new to Oracle 12c. The book covers what

  1. The 12C(n, 2n)11C cross section from threshold to 26.5 MeV.

    Science.gov (United States)

    Yuly, M; Eckert, T; Hartshaw, G; Padalino, S J; Polsin, D N; Russ, M; Simone, A T; Brune, C R; Massey, T N; Parker, C E; Fitzgerald, R; Sangster, T C; Regan, S P

    2018-02-01

    The 12 C(n, 2n) 11 C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3 H(d,n) 4 He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β + decay of 11 C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1 H(n,p) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.

  2. Structure in the 12C+ 12C and 8Be+16O fission width distribution of 24Mg observed via the reaction 12C(16O,α)24Mg(→X+Y)

    International Nuclear Information System (INIS)

    Lazzarini, A.J.; Steadman, S.G.; Ledoux, R.J.; Sperduto, A.; Young, G.R.; Van Bibber, K.; Cosman, E.R.

    1983-01-01

    Prominent gross and intermediate width structures are observed in the 12 C+ 12 C, 12 C+ 12 C((2 + ), 1 C((2 + )+ 12 C((2 + ), 8 Be+ 16 O, and 8 Be+ 16 O + (3 - , O + ) decay channels following 24 Mg* population via the 12 C( 16 O,α) 24 Mg reaction at E/sub c.m./ = 33 MeV. Evidence that the 12 C( 16 O,α) 24 Mg reaction populates states in 24 Mg which are associated with 12 C+ 12 C resonances is presented in the form of correlation analyses between the α+ 12 C+ 12 C three-body spectra and previously measured 12 C+ 12 C elastic and inelastic excitation functions. Direct determination of 12 C+ 12 C widths from these measurements is obscured by a background of other strong transitions which appear to be present in the 12 C( 16 O,α) 24 Mg singles spectrum

  3. Dielectron production in {sup 12}C+{sup 12}C collisions at 1 GeV per nucleon; Dielektronenproduktion in {sup 12}C+{sup 12}C Kollisionen bei 1 GeV pro Nukleon

    Energy Technology Data Exchange (ETDEWEB)

    Pachmayer, Yvonne C.

    2008-08-22

    This thesis contains the experimental results on dielectron production in {sup 12}C+{sup 12}C collisions at 1 GeV/u recorded with HADES. Within this work, the analysis is demonstrated, showing that leptons are efficiently reconstructed and hadrons very well discriminated. The described pair analysis shows that the combinatorial background is successfully reduced and the amount of true electron-positron pairs is not decreased. After subtracting the combinatorial background, the efficiency-corrected and normalized invariant-mass, transverse momentum and rapidity distributions of the dileptons are investigated. In the invariant-mass region 0.2-0.6 GeV/c{sup 2} the measured pair yield shows a strong excess above the contribution expected from hadron decays after freeze-out according to predictions. Together with the results obtained in {sup 12}C+{sup 12}C at 2 GeV/u it becomes evident that the overshoot of the data increases with decreasing beam energy. A detailed analysis shows that the beam energy dependence of the excess yield, i.e. the pair yield above the known eta contribution, integrated over the 0.15-0.5 GeV/c{sup 2} mass range, scales like pion production. (orig.)

  4. Effects of dietary Na+ deprivation on epithelial Na+ channel (ENaC, BDNF, and TrkB mRNA expression in the rat tongue

    Directory of Open Access Journals (Sweden)

    Stähler Frauke

    2009-03-01

    Full Text Available Abstract Background In rodents, dietary Na+ deprivation reduces gustatory responses of primary taste fibers and central taste neurons to lingual Na+ stimulation. However, in the rat taste bud cells Na+ deprivation increases the number of amiloride sensitive epithelial Na+ channels (ENaC, which are considered as the "receptor" of the Na+ component of salt taste. To explore the mechanisms, the expression of the three ENaC subunits (α, β and γ in taste buds were observed from rats fed with diets containing either 0.03% (Na+ deprivation or 1% (control NaCl for 15 days, by using in situ hybridization and real-time quantitative RT-PCR (qRT-PCR. Since BDNF/TrkB signaling is involved in the neural innervation of taste buds, the effects of Na+ deprivation on BDNF and its receptor TrkB expression in the rat taste buds were also examined. Results In situ hybridization analysis showed that all three ENaC subunit mRNAs were found in the rat fungiform taste buds and lingual epithelia, but in the vallate and foliate taste buds, only α ENaC mRNA was easily detected, while β and γ ENaC mRNAs were much less than those in the fungiform taste buds. Between control and low Na+ fed animals, the numbers of taste bud cells expressing α, β and γ ENaC subunits were not significantly different in the fungiform, vallate and foliate taste buds, respectively. Similarly, qRT-PCR also indicated that Na+ deprivation had no effect on any ENaC subunit expression in the three types of taste buds. However, Na+ deprivation reduced BDNF mRNA expression by 50% in the fungiform taste buds, but not in the vallate and foliate taste buds. The expression of TrkB was not different between control and Na+ deprived rats, irrespective of the taste papillae type. Conclusion The findings demonstrate that dietary Na+ deprivation does not change ENaC mRNA expression in rat taste buds, but reduces BDNF mRNA expression in the fungiform taste buds. Given the roles of BDNF in survival of

  5. C1-2 arthrography

    Energy Technology Data Exchange (ETDEWEB)

    Chevrot, A [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Cermakova, E [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Vallee, C [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Chancelier, M D [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Chemla, N [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Rousselin, B [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Langer-Cherbit, A [Service de Radiologie B, Hopital Cochin, 75 - Paris (France)

    1995-08-01

    One hundred patients with the following conditions were studied: cervical pain or neuralgia without radiographic changes, osteoarthritis, rheumatoid arthritis, ankylosing spondylarthritis and diverse conditions. The technique consists of lateral puncture of the posterior aspect of the C1-2 joint with a 20-gauge needle under fluoroscopic control, arthrography using 1 ml contrast medium, and a 1-ml long-acting steroid injection subsequently. The articular cavity has an anterior and a posterior recess. Sometimes the posterior recess is large. In 18% of cases the contralateral joint also opacifies. C1-2 arthrography appears to be an efficient and safe technique for the treatment of upper cervical pain due to C1-2 articular disorders. (orig.)

  6. C1-2 arthrography

    International Nuclear Information System (INIS)

    Chevrot, A.; Cermakova, E.; Vallee, C.; Chancelier, M.D.; Chemla, N.; Rousselin, B.; Langer-Cherbit, A.

    1995-01-01

    One hundred patients with the following conditions were studied: cervical pain or neuralgia without radiographic changes, osteoarthritis, rheumatoid arthritis, ankylosing spondylarthritis and diverse conditions. The technique consists of lateral puncture of the posterior aspect of the C1-2 joint with a 20-gauge needle under fluoroscopic control, arthrography using 1 ml contrast medium, and a 1-ml long-acting steroid injection subsequently. The articular cavity has an anterior and a posterior recess. Sometimes the posterior recess is large. In 18% of cases the contralateral joint also opacifies. C1-2 arthrography appears to be an efficient and safe technique for the treatment of upper cervical pain due to C1-2 articular disorders. (orig.)

  7. Anisotropy and polarization in charge changing collisions of C4+ with Na(3s) and laser aligned Na(3p)

    NARCIS (Netherlands)

    Hoekstra, R; Morgenstern, R; Olson, RE

    1996-01-01

    Absolute cross sections for C3+(6-->5) emission at 465.7 nm after collisions of C4+ ions with ground state Na(3s) and laser excited aligned Na(Sp) atoms are measured over the collision energy range of 3-7 keV amu(-1). For Na(3s) polarizations are observed by measuring the linear polarization of the

  8. Systematic study of multi-nucleon transfer reactions for 12C + 58Ni and 12C + 56Fe systems at ELab(12C) = 45 and 60 MeV

    International Nuclear Information System (INIS)

    Roy, B.J.; Jha, V.; Biswas, D.C.; Parmar, A.; Mohanty, Biraja; Oswal, M.; Jhingan, Akhil; Nandi, T.

    2013-01-01

    With a motivation to understand the reaction mechanism aspects, systematic study of multi-nucleon transfer in different projectile + target combinations has been made. Data taken at the BARC-TIFR Pelletron - LINAC facility, Mumbai for the systems 18 O+ 206 Pb and 18 O+ 12 C both studied at an incident energy of E( 18 O) = 140.4 MeV are reported in different communications to this proceedings. The present communication reports the measurements for 58 Ni( 12 C, x) and 56 Fe( 12 C, x) at incident 12 C energies of E( 12 C) = 45 and 60 MeV carried out at the pelletron accelerator facility, IUAC, Delhi

  9. Impacto da proteína-C reativa no risco cardiovascular de adolescentes Impacto de la Proteína-C reactiva en el riesgo cardiovascular de adolescentes Impact of C-reactive protein on cardiovascular risk in adolescents

    Directory of Open Access Journals (Sweden)

    Isis Tande da Silva

    2010-05-01

    Full Text Available FUNDAMENTO: Vários estudos sugerem que a proteína-C reativa (PCR se correlaciona com doença arterial coronariana em adultos. Entretanto, essa associação ainda é pouco explorada em adolescentes. OBJETIVO: Avaliar a associação entre a PCR e os fatores de risco cardiovascular em adolescentes obesos. MÉTODOS: Oitenta e quatro adolescentes (12,6 ± 1,3 anos, ambos os sexos, foram distribuídos nos grupos Eutrófico (n = 28, Sobrepeso (n = 28 e Obeso (n = 28, segundo o índice de massa corpórea (IMC. A concentração de PCR (ELISA ultrassensível, o perfil lipídico e o conteúdo de anticorpos anti-LDLox (ELISA foram determinados após jejum de 12h. RESULTADOS: Os grupos foram semelhantes quanto a idade (p = 0,13 e sexo (p = 0,83. Colesterol total, HDL-C, CT/HDL-C e LDL-C/HDL-C apresentaram diferenças significativas entre os grupos Eutrófico e Obeso. Não houve variação significativa no conteúdo de anticorpos anti-LDLox. Os valores de PCR foram diferentes entre os três grupos (p FUNDAMENTO: Diversos estudios sugieren que la proteína-C reactiva (PCR se correlaciona con la enfermedad arterial coronaria en adultos. Sin embargo, esta asociación es todavía poco explorada en adolescentes. OBJETIVO: Evaluar la asociación entre la PCR y los factores de riesgo cardiovascular en adolescentes obesos. MÉTODOS: Ochenta y cuatro adolescentes (12,6 ± 1,3 años, de ambos sexos, se distribuyeron en los grupos Eutrófico (n=28, Sobrepeso (n=28 y Obeso (n=28, según el IMC. La concentración de PCR (ELISA ultrasensible, el perfil lipídico y el contenido de anticuerpos anti-LDLox (ELISA fueron determinados tras ayuno de 12h. RESULTADOS: Los grupos se hallaron semejantes en cuanto a la edad (p=0,13 y sexo (p=0,83. Colesterol total, HDL-C, CT/HDL-C y LDL-C/HDL-C expresaron diferencias significativas entre los grupos Eutrófico y Obeso. No hubo variación significativa en el contenido de anticuerpos anti-LDLox. Los valores de PCR fueron diferentes

  10. Partial inelasticity coefficients of negative pions in p, d, α, 12C + 12C and p, 12C + 181Ta collisions at 4.2 GeV/c per nucleon

    International Nuclear Information System (INIS)

    Olimov, K.K.; Olimov, K.; Gulamov, K.G.; Olimov, A.K.; Lutpullaev, S.L.; Yuldashev, B.S.; Haseeb, M.Q.

    2015-01-01

    The partial inelasticity coefficients of the negative pions were determined in minimum bias p, d, α, 12 C + 12 C and p, 12 C + 18 Ta collisions at 4.2A GeV/c taking into account the average number of participant nucleons of a projectile nucleus. In nucleus–nucleus collisions, the average values of partial inelasticity coefficients (〈K(π-)〉) of the negative pions did not depend on the mass numbers of projectile and target nuclei. Increase of 〈K(π - )〉 in going from p + 12 C to d, α, 12 C + 12 C collisions was due to an additional source of production of fast negative pions in nucleus–nucleus collisions — a charge exchange conversion of one or more neutrons of a projectile nucleus into a proton and π - . Linking the experimental results of the present analysis at intermediate energy with those obtained at high and ultra-high energies, it was concluded that the average values of partial inelasticity coefficients of pions in nucleon–nucleus and nucleus–nucleus collisions manifest a transitive behavior. At intermediate energies, the values of 〈K(π - )〉 were smaller by a factor of two and more as compared to those at high energies, and they increased further with increasing incident energy, reaching a plateau at E 0 > 100A GeV. (author)

  11. The 12C+12C → 8Begs+16Ogs reaction at Ecm=27 to 36 MeV

    International Nuclear Information System (INIS)

    Aliotta, M.; Lattuada, M.; Spitaleri, C.

    1996-01-01

    The 12 C + 12 C → 8 Be gs + 16 O gs reaction has been experimentally investigated at c.m. energies between 27 and 36 MeV. A resonance is present at 32.5 MeV, i.e. at the same energy of the resonance previously observed [1] in the 12 C(0 + 2 ) + 12 C(0 + 2 ) exit channel, but its width is about three times narrower. Moreover the data indicate an enhancement of the cross section at a c.m. energy close to 29 MeV. These results are discussed and compared to the predictions of the Band Crossing Model obtained for different exit channels of the 12 C + 12 C reaction. (orig.)

  12. Impedance spectroscopy study of Na{sub 1/2}Sm{sub 1/2}TiO{sub 3} ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Barik, S K; Choudhary, R N.P. [I.I.T., Department of Physics and Meteorology, Kharagpur (India); Mahapatra, P K [Vidyasagar University, Department of Physics and Technophysics, Midnapur, West Bengal (India)

    2007-07-15

    Complex impedance analysis of a valence-compensated perovskite ceramic oxide Na{sub 1/2}Sm{sub 1/2}TiO{sub 3}, prepared by a mixed oxide (solid-state reaction) method, has been carried out. The formation of single-phase material was confirmed by X-ray diffraction studies, and it was found to be an orthorhombic phase at room temperature. In a scanning electron microscope, grains separated by well-defined boundaries are visible, which is in good agreement with that of impedance analysis. Alternating current impedance measurements were made over a wide temperature range (31-400 C) in an air atmosphere. Complex impedance and modulus plots helped to separate out the contributions of grain and grain boundaries to the overall polarization or electrical behavior. The physical structure of the samples was visualized most prominently at higher temperatures (275 C) from the Nyquist plots showing inter- and intragranular impedance present in the material. The frequency dependence of electrical data is also analyzed in the framework of the conductivity and modulus formalisms. The bulk resistance, evaluated from the impedance spectrum, was observed to decrease with rise in temperature, showing a typical negative temperature coefficient of resistance-type behavior like that of semiconductors. The modulus mechanism indicates the non-Debye type of conductivity relaxation in the materials, which is supported by the impedance data. (orig.)

  13. Angular correlation measurements for {sup 12}C{sup 12}C,{sup 12}C{sup 12}C 3{sup -} scattering

    Energy Technology Data Exchange (ETDEWEB)

    Wuosmaa, A.H.; Betts, R.R.; Freer, M.

    1995-08-01

    Previous studies of inelastic {sup 12}C + {sup 12}C scattering to a variety of final states identified significant resonance behavior in a number of different reaction channels. These resonances can be interpreted as either potential scattering resonances, or as population of cluster structures in the compound nucleus {sup 24}Mg, or as some interplay between the two mechanisms. Currently, for many of these resonances the situation remains unclear. One example is a large peak observed in the excitation function for the 3{sup -} - g.s. excitation, identified in previous work performed at the Daresbury Laboratory in England. This peak is observed at the same center-of-mass energy as one observed in the O{sub 2}{sup +}-O{sub 2}{sup +} inelastic scattering channel. That structure was suggested to correspond to exotic deformed configurations in the compound nucleus {sup 24}Mg. As the peak in the 3{sup -} + g.s. exit channel occurs at precisely the same energy as the purported resonance, it is tempting to associate the two. Before such an association can be confirmed or ruled out, further information must be obtained about the 3{sup -} + g.s. structure. In particular, it is important to determine the angular momenta that dominate the 3{sup -} + g.s. structure.

  14. Dielectron production in 12C+12C collisions at 1 GeV per nucleon

    International Nuclear Information System (INIS)

    Pachmayer, Yvonne C.

    2008-01-01

    This thesis contains the experimental results on dielectron production in 12 C+ 12 C collisions at 1 GeV/u recorded with HADES. Within this work, the analysis is demonstrated, showing that leptons are efficiently reconstructed and hadrons very well discriminated. The described pair analysis shows that the combinatorial background is successfully reduced and the amount of true electron-positron pairs is not decreased. After subtracting the combinatorial background, the efficiency-corrected and normalized invariant-mass, transverse momentum and rapidity distributions of the dileptons are investigated. In the invariant-mass region 0.2-0.6 GeV/c 2 the measured pair yield shows a strong excess above the contribution expected from hadron decays after freeze-out according to predictions. Together with the results obtained in 12 C+ 12 C at 2 GeV/u it becomes evident that the overshoot of the data increases with decreasing beam energy. A detailed analysis shows that the beam energy dependence of the excess yield, i.e. the pair yield above the known eta contribution, integrated over the 0.15-0.5 GeV/c 2 mass range, scales like pion production. (orig.)

  15. Reassessment of the C-13/C-12 and C-14/C-12 isotopic fractionation ratio and its impact on high-precision radiocarbon dating

    NARCIS (Netherlands)

    Fahrni, Simon M.; Southon, John R.; Santos, Guaciara M.; Palstra, Sanne W. L.; Meijer, Harro A. J.; Xu, Xiaomei

    2017-01-01

    The vast majority of radiocarbon measurement results (C-14/C-12 isotopic ratios or sample activities) are corrected for isotopic fractionation processes (measured as C-13/C-12 isotopic ratios) that occur in nature, in sample preparation and measurement. In 1954 Harmon Craig suggested a value of 2.0

  16. Elastic scattering of {sup 12} C by {sup 12} C at intermediate energies

    Energy Technology Data Exchange (ETDEWEB)

    Khallaf, S A.E. [Department of Physics, Faculty of Science, Assiut University, Assiut, (Egypt); Abdel-Rahman, M A; Abdel-Raheem, S K; Mahmoud, S W.Z. [Department of Physics, Faculty of Science, El-Minia University, El-Minia, (Egypt)

    1997-12-31

    Using the double folding model (DF), the real part of the central potential for {sup 12} C + {sup 12} C system is derived. This potential as well as the single folding cluster model potential (SFC) were used to calculate the total and differential cross sections for {sup 12} C elastically scattered on {sup 12} C at three laboratory energies; E{sub 1ab}. = 300, 344.5 and 360 MeV. The calculations were carried out using five sets of nucleon nucleon (NN) interaction of the integrable Gaussian form and two sets of parameters for the nuclear matter density of the harmonic oscillator form. The transparency of the target nucleus was found to increase as the projectile energy increases. Good fits between the present calculations and the experimental data as well as the previously published calculations were obtained. The present simple methods used to calculate the real part of the optical potential stand on equal footing with the density dependent (DDM 3 Y) procedure and it reduces the potential computing time enormously. The suitable choice of NN interaction as well as nuclear matter densities is important. 24 figs., 3 tabs.

  17. Oxide-Based Composite Electrolytes Using Na3Zr2Si2PO12/Na3PS4 Interfacial Ion Transfer.

    Science.gov (United States)

    Noi, Kousuke; Nagata, Yuka; Hakari, Takashi; Suzuki, Kenji; Yubuchi, So; Ito, Yusuke; Sakuda, Atsushi; Hayashi, Akitoshi; Tatsumisago, Masahiro

    2018-05-31

    All-solid-state sodium batteries using Na 3 Zr 2 Si 2 PO 12 (NASICON) solid electrolytes are promising candidates for safe and low-cost advanced rechargeable battery systems. Although NASICON electrolytes have intrinsically high sodium-ion conductivities, their high sintering temperatures interfere with the immediate development of high-performance batteries. In this work, sintering-free NASICON-based composites with Na 3 PS 4 (NPS) glass ceramics were prepared to combine the high grain-bulk conductivity of NASICON and the interfacial formation ability of NPS. Before the composite preparation, the NASICON/NPS interfacial resistance was investigated by modeling the interface between the NASICON sintered ceramic and the NPS glass thin film. The interfacial ion-transfer resistance was very small above room temperature; the area-specific resistances at 25 and 100 °C were 15.8 and 0.40 Ω cm 2 , respectively. On the basis of this smooth ion transfer, NASICON-rich (70-90 wt %) NASICON-NPS composite powders were prepared by ball-milling fine powders of each component. The composite powders were well-densified by pressing at room temperature. Scanning electron microscopy observation showed highly dispersed sub-micrometer NASICON grains in a dense NPS matrix to form closed interfaces between the oxide and sulfide solid electrolytes. The composite green (unfired) compacts with 70 and 80 wt % NASICON exhibited high total conductivities at 100 °C of 1.1 × 10 -3 and 6.8 × 10 -4 S cm -1 , respectively. An all-solid-state Na 15 Sn 4 /TiS 2 cell was constructed using the 70 wt % NASICON composite electrolyte by the uniaxial pressing of the powder materials, and its discharge properties were evaluated at 100 °C. The cell showed the reversible capacities of about 120 mAh g -1 under the current density of 640 μA cm -2 . The prepared oxide-based composite electrolytes were thus successfully applied in all-solid-state sodium rechargeable batteries without sintering.

  18. Angular correlation, spin alignment, and systematics of mis-matched {sup 12}C+{sup 12}C inelastic scattering resonances

    Energy Technology Data Exchange (ETDEWEB)

    Wuosmaa, A.H.; Wiedenhoever, I.; Caggiano, J.; Carpenter, M.P.; Devlin, M.; Heinz, A.; Janssens, R.V.F.; Kondev, F.; Lauritsen, T.; Sarantites, D.G.; Sobotka, L.G.; Battacharyya, P

    2003-10-09

    Particle gamma-ray angular correlation measurements have been used to study the spin alignment and magnetic-substate population parameters for the 2{sup +}{sub 1} (4.443 MeV) state in {sup 12}C, populated in the {sup 12}C({sup 12}C,{sup 12}C[0{sup +}{sub 2}]){sup 12}C(2{sup +}{sub 1}) inelastic scattering reaction in the vicinity of a prominent, narrow peak in the scattering excitation function. The data show a strong alignment of the spin with the orbital angular momentum, and suggest that the cross section peak corresponds to a spin 14{sup +} resonance at E{sub c.m.}=28.0 MeV. This energy is close to that where a strong peak is also observed in the 0{sup +}{sub 1}+0{sup +}{sub 2} excitation function. A comparison between the data for these two channels lends some support to recent theoretical calculations of resonance behavior for angular-momentum-mismatched channels in {sup 12}C+{sup 12}C inelastic scattering.

  19. Giant strain with low cycling degradation in Ta-doped [Bi{sub 1/2}(Na{sub 0.8}K{sub 0.2}){sub 1/2}]TiO{sub 3} lead-free ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xiaoming; Tan, Xiaoli, E-mail: xtan@iastate.edu [Department of Materials Science and Engineering, Iowa State University, Ames, Iowa 50011 (United States)

    2016-07-21

    Non-textured polycrystalline [Bi{sub 1/2}(Na{sub 0.8}K{sub 0.2}){sub 1/2}](Ti{sub 1−x}Ta{sub x})O{sub 3} ceramics are fabricated and their microstructures and electrical properties are characterized. Transmission electron microscopy reveals the coexistence of the rhombohedral R3c and tetragonal P4bm phases in the form of nanometer-sized domains in [Bi{sub 1/2}(Na{sub 0.8}K{sub 0.2}){sub 1/2}]TiO{sub 3} with low Ta concentration. When the composition is x = 0.015, the electrostrain is found to be highly asymmetric under bipolar fields of ±50 kV/cm. A very large value of 0.62% is observed in this ceramic, corresponding to a large-signal piezoelectric coefficient d{sub 33}* of 1240 pm/V (1120 pm/V under unipolar loading). These values are greater than most previously reported lead-free polycrystalline ceramics and can even be compared with some lead-free piezoelectric single crystals. Additionally, this ceramic displays low cycling degradation; its electrostrain remains above 0.55% even after undergoing 10 000 cycles of ±50 kV/cm bipolar fields at 2 Hz. Therefore, Ta-doped [Bi{sub 1/2}(Na{sub 0.8}K{sub 0.2}){sub 1/2}]TiO{sub 3} ceramics show great potential for large displacement devices.

  20. Effect of cholera toxin on cAMP levels and Na+ influx in isolated intestinal epithelial cells

    International Nuclear Information System (INIS)

    Hyun, C.S.; Kimmich, G.A.

    1982-01-01

    Freshly isolated chicken intestinal cells contain approximately 20 pmol adenosine 3',5'-cyclic monophosphate (cAMP)/mg cellular protein. Incubation with 3 μg/ml cholera toxin (CT) at 37 0 C induces an elevation of cellular cAMP beginning 10-15 min after initial exposure. The response is linear with time for 40-50 min and causes a six- to eightfold increase over control levels at steady state. Dibutyryl cAMP and agents that increase cAMP production inhibit Na + influx into the isolated enterocytes. Chlorpromazine completely abolishes the toxin-induced elevation of cAMP in the isolated cells and also reverses the effect on Na + entry. The data provide evidence for a cAMP-mediated control of intestinal cell Na + uptake, which may represent the mechanistic basis for the antiabsorptive effect of CT on Na + during induction of intestinal secretory activity. Studies on the time-dependent effects of chlorpromazine on both intracellular cAMP concentration and Na + influx suggest that the reactivation of the Na + transport system after cAMP-induced inhibition is slow relative to the disappearance of cAMP

  1. Combustion of Na2B4O7 + Mg + C to synthesis B4C powders

    International Nuclear Information System (INIS)

    Jiang Guojian; Xu Jiayue; Zhuang Hanrui; Li Wenlan

    2009-01-01

    Boron carbide powder was fabricated by combustion synthesis (CS) method directly from mixed powders of borax (Na 2 B 4 O 7 ), magnesium (Mg) and carbon. The adiabatic temperature of the combustion reaction of Na 2 B 4 O 7 + 6 Mg + C was calculated. The control of the reactions was achieved by selecting reactant composition, relative density of powder compact and gas pressure in CS reactor. The effects of these different influential factors on the composition and morphologies of combustion products were investigated. The results show that, it is advantageous for more Mg/Na 2 B 4 O 7 than stoichiometric ratio in Na 2 B 4 O 7 + Mg + C system and high atmosphere pressure in the CS reactor to increase the conversion degree of reactants to end product. The final product with the minimal impurities' content could be fabricated at appropriate relative density of powder compact. At last, boron carbide without impurities could be obtained after the acid enrichment and distilled water washing.

  2. Resonance states in 16O+16O, 12C+16O, α+ 16O and α+ 12C with ...

    Indian Academy of Sciences (India)

    The resonance states in 16O + 16O, 12C + 16O, + 16O and + 12C are described using modified Morse potential proposed earlier whose success has already been demon-strated in the case of 12C + 12C system. The general validity of such a potential with long range, shallow depth and repulsive soft core determined ...

  3. Crystal Structure of Na3MoCl6

    Directory of Open Access Journals (Sweden)

    Martin Beran

    2011-07-01

    Full Text Available The ternary chloride Na3MoCl6 is obtained as red crystals from a disproportionation reaction of molybdenum dichloride, {Mo6}Cl12, in an acidic NaCl/AlCl3 melt at 350 °C. The crystal structure (trigonal, P-31c, a = 687.1(1, c = 1225.3(2 pm, Z = 2, V = 501,0(1 106 pm3 is that of Na3CrCl6: within a hexagonal closest-packing of chloride ions two thirds of the octahedral voids are filled between the AB double layers with Na+/Mo3+, and between the BA layers with Na+.

  4. A tomografia de córnea e segmento anterior na propedêutica do exame complementar na avaliação de ectasia

    Directory of Open Access Journals (Sweden)

    Bruno de Freitas Valbon

    2013-02-01

    Full Text Available Descrevemos a importância da tomografia de córnea e segmento anterior na propedêutica do exame complementar na avaliação de ectasia. Esta descrição da interpretação clínica dos índices da tomografia de córnea e segmento anterior (Pentacam - Oculus, Wetzlar, Germany neste relato de caso, demonstra a relevância de uma nova tecnologia na avaliação da córnea e segmento anterior na suspeita de ceratocone. O diagnóstico de ceratocone foi excluído pela análise dos índices tomográficos de ectasia. Detectou-se assimetria entre os lados nasal e temporal por meio da avaliação do mapa de profundidade de câmara anterior. No exame biomicroscópico sob midríase foi constatado subluxação do cristalino, sendo assim devemos estar atentos não somente aos índices tomográficos corneanos na avaliação do exame complementar e sim analisarmos outros dados importantes oferecidos pela tomografia de córnea e segmento anterior.

  5. Crystal structure of Na3Sc2(PO4)3 at 60 deg C

    International Nuclear Information System (INIS)

    Lazoryak, B.I.; Kalinin, V.B.; Stefanovich, S.Yu.; Efremov, V.A.

    1980-01-01

    The structure of the ferroelectric phase of Na 3 Sc 2 (PO 4 ) 3 compound was studied. Na 3 Sc 2 (PO 4 ) 3 monocrystal heated by a jet of warm N 2 was investigated at 60 deg C. The rhombohedron modification was determined: a=8.927(3), c=22.34(4) A, Z=6, space group R anti 3c. Interatomic distances and inner angles of polyhedrons in Na 3 Sc 2 (PO 4 ) 3 structure were determined

  6. Raman spectroscopy of isotopically pure ({sup 12}C, {sup 13}C) and isotopically mixed ({sup 12.5}C) diamond single crystals at ultrahigh pressures

    Energy Technology Data Exchange (ETDEWEB)

    Enkovich, P. V., E-mail: enkovich@hppi.troitsk.ru; Brazhkin, V. V.; Lyapin, S. G.; Novikov, A. P. [Russian Academy of Sciences, Troitsk, Institute for High-Pressure Physics (Russian Federation); Kanda, H. [National Institute for Materials Science (Japan); Stishov, S. M. [Russian Academy of Sciences, Troitsk, Institute for High-Pressure Physics (Russian Federation)

    2016-09-15

    The Raman scattering by isotopically pure {sup 12}C and {sup 13}C diamond single crystals and by isotopically mixed {sup 12.5}C diamond single crystals is studied at a high accuracy. The studies are performed over a wide pressure range up to 73 GPa using helium as a hydrostatic pressure-transferring medium. It is found that the quantum effects, which determine the difference between the ratio of the Raman scattering frequencies in the {sup 12}C and {sup 13}C diamonds and the classical ratio (1.0408), increase to 30 GPa and then decrease. Thus, inversion in the sign of the quantum contribution to the physical properties of diamond during compression is detected. Our data suggest that the maximum possible difference between the bulk moduli of the {sup 12}C and {sup 13}C diamonds is 0.15%. The investigation of the isotopically mixed {sup 12.5}C diamond shows that the effective mass, which determines the Raman frequency, decreases during compression from 12.38 au at normal pressure to 12.33 au at 73 GPa.

  7. Search for aligned structure of 12C-α-12C type at high excitation energy in 28Si

    International Nuclear Information System (INIS)

    Burnereau, Nicole.

    1975-01-01

    The 16 O+ 12 C→ 12 C+α+ 12 C reaction is studied mainly at 46MeV (at this energy a state of 28 Si is presumably formed with a spin value of 14 + ; resonance of 19.7MeV c.m.). The motivation is to detect an α particle with a negligible energy in the c.m. system. This is the signature of the preformation of three aligned clusters in which the average location of the α particle is in between the two 12 C's at the center of symmetry of the system. Such a detection is performed by detecting two 12 C's in coincidence at specific angles. The data are understood by three-body calculations with a coupling of relative angular momenta governed by an unique J value. Experimentally, an α energy of 200keV is measured with good statistics, supporting the idea of aligned clusters as 28 Si intrinsic shape, related to some highly excited states [fr

  8. Neutrino cross sections on 12C

    International Nuclear Information System (INIS)

    Sandberg, V.D.

    1996-01-01

    Measurements of the charged current reactions 12 C(v e ,e - ) 12 N and 12 C(v μ ,μ - ) 12 N for inclusive transitions to 12 N excited states and exclusive transitions to 12 N , are presented. The data presented represent 3 years of running of the LSND experiments and are from runs in 1993, 1994, and 1995 and total to 14772 Coulombs of protons on target. The v e scattering and v μ - exclusive scattering results are in good agreement with theoretical expectations, while the v μ - inclusive scattering results are smaller than expected from a continuum random phase calculation

  9. Efeito do cloreto de cálcio na qualidade de abacaxi 'Pérola' minimamente processado

    Directory of Open Access Journals (Sweden)

    Antoniolli Lucimara Rogéria

    2003-01-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos do cloreto de cálcio na qualidade do abacaxi 'Pérola' minimamente processado. Os tratamentos, arranjados em delineamento inteiramente casualizado e dispostos em esquema fatorial 3x5, consistiram das concentrações de CaCl2 e dos períodos de armazenamento, com três repetições. Frutos previamente sanitizados foram descascados mecanicamente, fatiados manualmente e imersos em solução de CaCl2 a 1% e a 2% e em água (controle, durante 30 segundos. As fatias foram acondicionadas em embalagens de polietileno tereftalato e mantidas à temperatura de 4±1degreesC durante períodos de 0, 3, 6, 9 e 12 dias. A textura não foi influenciada por nenhum dos fatores estudados. Constatou-se menor atividade peroxidásica nos frutos tratados com CaCl2 2%. Quanto à coloração, a imersão em solução de CaCl2 1% resultou em fatias mais escurecidas, com menor valor L* e maior valor a* ao final do período de armazenamento. A utilização de CaCl2 em abacaxi 'Pérola' minimamente processado não proporciona efeitos benéficos na textura, e interfere negativamente na coloração da polpa do fruto.

  10. Interactions of [14C]phosphonoformic acid with renal cortical brush-border membranes. Relationship to the Na+-phosphate co-transporter

    International Nuclear Information System (INIS)

    Szczepanska-Konkel, M.; Yusufi, A.N.; Dousa, T.P.

    1987-01-01

    Since phosphonoformic acid (PFA) acts as a specific competitive inhibitor of Na+-Pi co-transport across renal brush-border membrane (BBM), we employed the [ 14 C]PFA as a probe to determine the mechanism of its interaction with rat renal BBM. The binding of [ 14 C]PFA to BBM vesicles (BBMV), with Na+ present in extravesicular medium (Na+o), was time- and temperature-dependent. The replacement of Na+o with other monovalent cations reduced the PFA binding by -80%. Cl- was the most effective accompanying monovalent anion as NaCl for maximum PFA binding. The Na+o increased the apparent affinity of BBMV for [ 14 C]PFA binding, but it did not change the maximum binding capacity. The maximum [ 14 C]PFA binding was achieved at Na+o approximately equal to 50 mM. The extent of Na+-dependent [ 14 C]PFA binding correlated with percent inhibition by an equimolar dose of PFA of the dependent BBMV uptake of 32Pi. Intravesicular Na+ (Na+i) decreased [ 14 C]PFA binding, on BBMV, and this inhibition by Na+i was dependent on the presence of Na+o. The increase in Na+i, at constant [Na+]o, decreased the Vmax, but not the Km, for [ 14 C]PFA binding on BBMV. Bound [ 14 C]PFA was displaced from BBMV by phosphonocarboxylic acids proportionally to their ability to inhibit gradient-dependent Pi transport, whereas other monophosphonates, diphosphonates, L-proline, or D-glucose did not influence the [ 14 C]PFA binding. The Na+-dependent binding of [ 14 C]PFA and of [ 3 H]phlorizin by BBMV was 10 times higher than binding of these ligands to renal basolateral membranes and to mitochondria. [ 14 C]PFA probably binds onto the same locus on the luminal surface of BBM, where Pi and Na+ form a ternary complex with the Na+-Pi co-transporter

  11. Influencia de las condiciones de procesamiento sobre las propiedades dieléctricas y microestructurales de cerámicos de K1/2Na1/2NbO3

    Directory of Open Access Journals (Sweden)

    Castro, M. S.

    2011-02-01

    Full Text Available The objective of this work was to analyze different processing condition of Na1/2K1/2NbO3 (KNN in order to obtain a material with good properties and without secondary phases. Solid state reaction method was used and the influence of milling time, calcination temperature and time, and sintering temperature was analyzed. It was found that sintering temperatures were limited by the component decomposition. Also, it was observed that samples sintered at 1125 ºC showed the highest density and permittivity with a homogeneous structure. In general, samples calcined at higher temperatures and times showed the best properties.El objetivo de este trabajo es analizar diferentes condiciones de procesamiento del K1/2Na1/2NbO3 (KNN que permitan obtener un material con buenas propiedades y libre de fases secundarias. Se implementó el método de activación mecanoquímica de los precursores y posterior reacción en estado sólido. Se analizaron las principales condiciones de procesamiento (tiempo de molienda, temperaturas de calcinación y sinterizado, y se determinaron las propiedades dieléctricas y microestructurales de cada sistema. Se encontró que las temperaturas máximas de calcinación estuvieron limitadas por la descomposición de los constituyentes. También se observó que las pastillas sinterizadas a 1125ºC registraron mayor densidad, mayor permitividad y una microestructura homogénea. En general, se observó que los sistemas calcinados a mayores temperaturas y por tiempos mayores tuvieron mejores propiedades.

  12. Sub-Coulomb α Transfers on C12 and the C12(α, γ)O16 S Factor

    International Nuclear Information System (INIS)

    Brune, C. R.; Geist, W. H.; Kavanagh, R. W.; Veal, K. D.

    1999-01-01

    The 12 C( α, γ) 16 O reaction is crucial for the understanding of He burning in massive stars, but the low-energy cross section is highly uncertain. To address this problem we have measured at sub-Coulomb energies total cross sections for the 12 C( 6 Li, d) 16 O and 12 C( 7 Li, t) 16 O reactions to the bound 2 + and 1 - states of 16 O . The data are analyzed to obtain the reduced α widths of these states. Together with capture and phase-shift data, these results provide for a more accurate determination of the low-energy 12C(α, γ) 16 O S factor: S E1 (0.3 MeV) =101±17 keV b and S E2 (0.3 MeV) =42 +16 -23 keV b for the E1 and E2 multipole components of the reaction. (c) 1999 The American Physical Society

  13. RCNP E398 {sup 16}O,{sup 12}C(p,p’) experiment: Measurement of the γ-ray emission probability from giant resonances in relation to {sup 16}O,{sup 12}C(ν,ν’) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Ou, I.; Yamada, Y.; Mori, T.; Yano, T.; Sakuda, M. [Department of Physics, Okayama University, Okayama 700-8530 (Japan); Tamii, A.; Suzuki, T.; Yosoi, M.; Aoi, N.; Ideguchi, E.; Hashimoto, T.; Miki, K.; Ito, T.; Iwamoto, C.; Yamamoto, T. [Research Center for Nuclear Physics (RCNP), Osaka University, Ibaraki, Osaka 567-0047 (Japan); Akimune, H. [Department of Physics, Konan University, Okamoto 8-9-1, Higashinada, Kobe 658-8501 (Japan)

    2015-05-15

    We propose to measure the γ-ray emission probability from excited states above 5 MeV including giant resonance of {sup 16}O and {sup 12}C as a function of excitation energy in 1-MeV step. Here, we measure both the excitation energy (E{sub x}=5-30MeV) at the forward scattering angles (0°-3°) of the {sup 16}O, {sup 12}C (p, p’) reaction using Grand-Raiden Spectrometer and the energy of γ-rays (E{sub γ}) using an array of NaI(Tl) counters. The purpose of the experiment is to provide the basic and important information not only for the γ-ray production from primary neutral-current neutrino-oxygen (-carbon) interactions but also for that from the secondary hadronic (neutron-oxygen and -carbon) interactions.

  14. Isospin dependent Boltzmann-langevin equation and the production cross section of 19Na

    International Nuclear Information System (INIS)

    Ming Zhaoyu; Zhang Fengshou; Chen Liewen; Zhu Zhiyuan; Zhang Wenlong; Guo Zhongyan; Xiao Guoqing

    2000-01-01

    A new transport model (isospin dependent Boltzmann-Langevin equation) is developed and it is shown that this model can regenerate the experimental data for reaction of 12 C + 12 C at 28.7 MeV/u. The production cross section of 19 Na is systematically studied for reactions of 17-20,22 Ne + 12 C at 28.7 MeV/u. It is found that a neutron deficient projectile has larger 19 Na cross section than a stable projectile

  15. Lipopolysaccharide increases Na(+),K(+)-pump, but not ENaC, expression in guinea-pig airway epithelium.

    Science.gov (United States)

    Dodrill, Michael W; Beezhold, Donald H; Meighan, Terence; Kashon, Michael L; Fedan, Jeffrey S

    2011-01-25

    Earlier, we found in functional experiments that lipopolysaccharide (LPS; 4mg/kg; i.p.) hyperpolarized the epithelium by stimulating the transepithelial transport of Na(+) in guinea-pig tracheal epithelium. Epithelial sodium channel (ENaC) activity and Na(+),K(+)-pump activity were increased. In this study, we hypothesized that LPS increases the expression of ENaC and the Na(+),K(+)-pump in the epithelium and investigated the levels of transcription and protein abundance. Using qPCR, the effects of LPS on the transcription of αENaC, α(1) Na(+),K(+)-pump, COX-2, eNOS, iNOS, IL-1β, and TNF-α were measured at 3 and 18h. In the epithelium, LPS increased the transcription of COX-2, IL-1β, and, to a nonsignificant extent, TNF-α at 3h, but not at 18h. In alveolar macrophages, TNF-α, and, to a nonsignificant extent, COX-2 and IL-1β were up-regulated at 3h, but not at 18h. Even though LPS stimulated the transcription of some genes, αENaC and α(1) Na(+),K(+)-ATPase transcription were not affected. The expressions of α-, β-, and γ-ENaC and α(1) Na(+),K(+)-pump from the tracheal epithelium and kidney cortex/medulla were investigated by western blotting. All three ENaC subunits were detected as cleavage fragments, yet LPS had no effect on their expression. LPS increased the expression of the α(1) subunit and the α(1), α(2), and α(3) subunits, collectively, of the Na(+),K(+)-pump. Taken together, these data indicate that LPS increases Na(+) transport downstream of the genetic level, in part, by stimulating the expression of the Na(+),K(+)-pump. Published by Elsevier B.V.

  16. Measurements of Ay(θ) for 12C(n,n)12C from En=2.2 to 8.5 MeV

    International Nuclear Information System (INIS)

    Roper, C.D.; Tornow, W.; Braun, R.T.; Chen, Q.; Crowell, A.; Trotter, D. Gonzalez; Howell, C.R.; Salinas, F.; Setze, R.; Walter, R.L.; Chen Zemin; Tang Hongqing; Zhou Zuying

    2005-01-01

    The analyzing power A y (θ) for neutron elastic scattering from 12 C has been measured for 33 neutron energies between E n =2.2 and 8.5 MeV in the angular range from 25 deg. to 145 deg. in the laboratory system. The primary motivation for these measurements is the need for an accurate knowledge of A y (θ) for 12 C(n,n) 12 C elastic scattering to enable corrections to high-precision neutron-proton and neutron-deuteron A y (θ) data in the neutron-energy range below E n =30 MeV. In their own right, 12 C(n,n) 12 C A y (θ) data are of crucial importance for improving both the parametrization of n- 12 C scattering and our knowledge of the level scheme of 13 C. The present A y (θ) data are compared with published data and previous phase-shift-analysis results

  17. Methylcobalamin promotes proliferation and migration and inhibits apoptosis of C2C12 cells via the Erk1/2 signaling pathway

    Energy Technology Data Exchange (ETDEWEB)

    Okamoto, Michio [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Tanaka, Hiroyuki, E-mail: tanahiro-osk@umin.ac.jp [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Okada, Kiyoshi [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Kuroda, Yusuke [Department of Orthopaedic Surgery, Kansai Rosai Hospital, 3-1-69 Inabaso, Amagasaki, Hyogo 660-8511 (Japan); Nishimoto, Shunsuke; Murase, Tsuyoshi; Yoshikawa, Hideki [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan)

    2014-01-17

    Highlights: •Methylcobalamin activated the Erk1/2 signaling pathway in C2C12 cells. •Methylcobalamin promoted the proliferation and migration in C2C12 cells. •C2C12 cell apoptosis during differentiation was inhibited by methylcobalamin. -- Abstract: Methylcobalamin (MeCbl) is a vitamin B12 analog that has some positive effects on peripheral nervous disorders. Although some previous studies revealed the effects of MeCbl on neurons, its effect on the muscle, which is the final target of motoneuron axons, remains to be elucidated. This study aimed to determine the effect of MeCbl on the muscle. We found that MeCbl promoted the proliferation and migration of C2C12 myoblasts in vitro and that these effects are mediated by the Erk1/2 signaling pathway without affecting the activity of the Akt signaling pathway. We also demonstrated that MeCbl inhibits C2C12 cell apoptosis during differentiation. Our results suggest that MeCbl has beneficial effects on the muscle in vitro. MeCbl administration may provide a novel therapeutic approach for muscle injury or degenerating muscle after denervation.

  18. IMPROVED LINE DATA FOR THE SWAN SYSTEM 12C13C ISOTOPOLOGUE

    International Nuclear Information System (INIS)

    Ram, Ram S.; Brooke, James S. A.; Bernath, Peter F.; Sneden, Christopher; Lucatello, Sara

    2014-01-01

    We present new, accurate predictions for rotational line positions, excitation energies, and transition probabilities of the 12 C 13 C isotopologue Swan d 3 Π-a 3 Π system 0-0, 0–1, 0–2, 1–0, 1–1, 1–2, 2–0, 2–1, and 2–2 vibrational bands. The line positions and energy levels were predicted through new analyses of published laboratory data for the 12 C 13 C lines. Transition probabilities were derived from recent computations of transition dipole moments and related quantities. The 12 C 13 C line data were combined with similar data for 12 C 2, reported in a companion paper, and applied to produce synthetic spectra of carbon-rich metal-poor stars that have strong C 2 Swan bands. The matches between synthesized and observed spectra were used to estimate band head positions for a few of the 12 C 13 C vibrational bands and to verify that the new computed line data match observed spectra. The much weaker C 2 lines of the bright red giant Arcturus were also synthesized in the band head regions

  19. The compressibility mechanism of Li3Na3In2F12 garnet

    DEFF Research Database (Denmark)

    Grzechnik, Andrzej; Balic Zunic, Tonci; Makovicky, Emil

    2006-01-01

    The high pressure behaviour of Li3Na3In2F12 garnet (Ia¯3d, Z = 8) is studied up to 9.2 GPa at room temperature in diamond anvil cells using xray diffraction. Its equation of state to 9.2 GPa and the pressure dependences of the structural parameters to 4.07 GPa are determined from synchrotron angle......-dispersive powder and laboratory single-crystal data, respectively. No indication of any structural phase transition in this material has been found up to 9.2 GPa. The fitting of the Murnaghan equation of state yields B0 = 36.2(5) GPa, B0 = 5.38(18), and V0 = 2051.76(0.69) °A 3. The compressibility mechanism of Li3......Na3In2F12 is attributed to the substantial bending of the In-F-Li angles linking the InF6 octahedra and LiF4 tetrahedra. The most compressible polyhedral units are the NaF8 triangulated dodecahedra. These results are discussed in relation to previous high pressure photoluminescence measurements...

  20. Quasi-exclusive measurement of /sup 12/C(/sup 12/C, 3. cap alpha. )X at 2. 1 GeV/nucleon

    Energy Technology Data Exchange (ETDEWEB)

    Engelage, J; Baumgartner, M; Greiner, D E; Lindstrom, P J; Olson, D L; Wada, R; Crawford, H J; Webb, M L

    1986-05-29

    A study of the reaction /sup 12/C(/sup 12/C,3..cap alpha..)X at 2.1 GeV/nucleon has been completed. The energy and momentum transferred to the /sup 12/C projectile and the cross section for the dissociation of /sup 12/C into three alpha particles have been measured, 9.7 (+5.0/-2.5) millibarns. It is found that the results from this analysis are inconsistent with the predictions of current theoretical models for peripheral relativistic heavy ion collisions.

  1. Elastic scattering, inelastic scattering, and transfer reactions induced by 12C bombardment of 12C

    International Nuclear Information System (INIS)

    Stokstad, R.G.; Wieland, R.M.; Fulmer, C.B.; Hensley, D.C.; Raman, S.; Snell, A.H.; Stelson, P.H.

    1977-06-01

    Graphs and tables of differential cross sections are presented for the elastic scattering of 12 C by 12 C, the single excitation (Q = -4.43 MeV) and the mutual excitation (Q = -8.86 MeV) for 14 bombarding energies in the range 70.7 less than or equal to E/sub lab/ less than or equal to 126.7 MeV. Differential cross sections for one- and two-nucleon transfer are presented for E/sub lab/ = 93.8 MeV

  2. Efeitos do ultra-som terapêutico contínuo sobre a proliferação e viabilidade de células musculares C2C12 Effects of continuous therapeutic ultrasound on proliferation and viability of C2C12 muscle cells

    Directory of Open Access Journals (Sweden)

    Paola Pelegrineli Artilheiro

    2010-06-01

    Full Text Available O ultra-som terapêutico (US é um recurso bioestimulante utilizado para propiciar reparo muscular de melhor qualidade e menor duração, mas o potencial terapêutico do US contínuo não está totalmente estabelecido. O objetivo deste trabalho foi avaliar o efeito do US contínuo sobre a proliferação e viabilidade de células musculares precursoras (mioblastos C2C12. Mioblastos C2C12 foram cultivados em meio de cultura contendo 10% de soro fetal bovino e irradiados com US contínuo nas freqüências de 1 e 3 MHz nas intensidades de 0,2 e 0,5 W/cm2, durante 2 e 5 minutos. A viabilidade e proliferação celular foram avaliadas após 24, 48 e 72 h de incubação. Grupos não-irradiados serviram como controle. Foram realizados experimentos independentes em cada condição acima, e os dados obtidos submetidos à análise estatística. Os resultados mostram que não houve diferença estatisticamente significativa na proliferação e viabilidade celular entre os mioblastos tratados com US e as culturas controles após os diferentes períodos de incubação, em todos os parâmetros avaliados. Conclui-se que o US contínuo, nos parâmetros avaliados, não foi capaz de alterar a proliferação e viabilidade dos mioblastos.Therapeutic ultrasound (US is a biophysical stimulation resource widely used in order to promote better, faster muscle repair, but the effectiveness of continuous US in treating injuries is not fully established. The aim of the present in vitro study was to assess the effects of continuous ultrasound on viability and proliferation of skeletal muscle precursor cells (C2C12 myoblasts. C2C12 myoblasts were cultured in a medium containing 10% foetal bovine serum and irradiated with continuous ultrasound at 1 and 3 MHz frequencies, at intensities of 0.2 and 0.5 W/cm² for 2 and 5 minutes. Cell viability and proliferation were assessed after different incubation periods (24, 48 and 72 h. Non-irradiated groups served as control and data were

  3. Controvérsias na fibrose cística: do pediatra ao especialista

    Directory of Open Access Journals (Sweden)

    Ribeiro Jose Dirceu

    2002-01-01

    Full Text Available Objetivos: nos últimos 70 anos, a fibrose cística emergiu da obscuridade para o reconhecimento como a mais importante doença hereditária, potencialmente letal, incidente na raça branca. Embora seja uma doença genética, na qual o defeito básico acomete células de vários órgãos, nem todos os indivíduos expressam respostas clínicas na mesma intensidade. Várias manifestações clínicas, principalmente pulmonares e digestivas, podem ocorrer durante a vida dos pacientes fibrocísticos. O objetivo deste artigo é propiciar ao pediatra geral uma visão atualizada dos principais assuntos referentes à fibrose cística. Fontes dos dados: revisão sistemática e atualizada em fonte de dados oficial (Medline. Síntese dos dados: foram revisados 79 artigos sobre fibrose cística, de periódicos internacionais, colocando, de modo atual e crítico, os principais eventos relacionados com a incidência, a fisiopatogenia, as manifestações clínicas, o diagnóstico e o tratamento da fibrose cística. Conclusões: apesar de não existir cura para essa doença, muitos conhecimentos novos sobre a etiologia e a fisiopatologia, adquiridos nas duas últimas décadas, propiciaram uma nova abordagem para o tratamento da fibrose cística. A compreensão dos mecanismos básicos da doença pulmonar, bem como das manifestações digestivas na fibrose cística, decorrente dos conhecimentos de pesquisas recentes, tem sido a chave para o aumento da sobrevida e a melhora da qualidade de vida dos pacientes.

  4. Lattice sites of Na dopants in ZnO

    CERN Document Server

    AUTHOR|(CDS)2069243; Martins Correia, Joao; Amorim, Lígia; Decoster, Stefan; Ribeiro da Silva, Manuel; Da Costa Pereira, Lino Miguel

    2016-01-01

    The angular distribution of beta− particles emitted by the radioactive isotope 24Na was monitored following implantation into ZnO single crystals at fluences above 5E12 cm−2 at CERN’s ISOLDE facility. We identified sodium on two distinct sites: on substitutional Zn sites and on interstitial sites that are close to the so-called octahedral site. The interstitial Na was to large extent converted to substitutional Na already for annealing at 200°C, from which an activation energy of 0.8−1.3 eV, most likely around 1.2 eV, is estimated for the migration of interstitial Na in ZnO.

  5. Probing the possibility of a C-12/C-13 galactic abundance gradient

    International Nuclear Information System (INIS)

    Hawkins, I.

    1990-01-01

    High S/N (equal to or greater than 500) observations of interstellar CH+ with the 3.0 m telescope were performed at Lick Observatory and with the 4.0 m telescope at CTIO, of the reddened, early-type stars HD 183143, HD 24432, and HD 157038 in an effort to probe the existence of a C-12/C-13 abundance gradient in our Galaxy. Previous very high quality optical observations of interstellar CH+ toward five stars within 1 kpc of the Sun have yielded a precise weighted mean C-12/C-13 isotope ratio of 43 plus or minus 4 (1 sigma) (Hawkins, Jura, and Meyer 1985; Hawkins and Jura 1987). The isotope ratios derived toward four lines of sight in the local ISM are uniform within 12 percent. The similarity among these carbon isotope ratios determined in diffuse clouds possessing different physical conditions precludes the possibility that the CH+ molecule is suffering from isotope selective effects in these regions. The precise C-12/C-13 derivable from high quality observations of (12)CH+ and (13)CH+ provide the unique opportunity to probe the homogeneity of the ISM in a large scale and the history of nucleosynthesis in our Galaxy. Since CH+ seems to be the most sensitive probe of C-12/C-13 in the diffuse ISM, observations toward more distant stars located up to 2.5 kpc from the Sun are the best way to study the possibility of a Galactic (C-12/C-13) abundance gradient. The researcher obtained 4232 angstrom data toward all three of the stars mentioned above, 3957 angstrom data toward HD 183143 and HD 157038, and 3745 angstrom data toward HD 157038. Because of the poorer quality of the HD 24432 spectrum, and its weaker CH+ absorption lines, the satellite (13)CH+ line was not detected, and thus only a lower limit on the C-12/C-13 ratio toward this star was obtained. The results obtained from careful reduction and analysis of the data toward these stars in the Northern and Southern Hemispheres are presented

  6. SRS-sensor 13C/12C isotops measurements for detecting Helicobacter Pylori

    Science.gov (United States)

    Grishkanich, Aleksandr; Chubchenko, Yan; Elizarov, Valentin; Zhevlakov, Aleksandr; Konopelko, Leonid

    2018-02-01

    We developed SRS-sensor 13C/12C isotops measurements detecting Helicobacter Pylori for medical diagnostics of human health. Measuring of absolute 13C/12C isotope amount ratios allows to explore the topical problems of the modern world, alcoholic beverages and tobacco, medical diagnostics of human health. SRS method is used to measure the ratio of carbon isotopes in the exhaled carbon dioxide, which is used to diagnose the human infection of Helicobacter pylori and the influence of the Helicobacter pylori bacterium on the occurrence of gastritis, gastric and duodenal ulcers. A method for the analysis of human infection with Helicobacter pylori was developed on the basis of measurements of the ratio of 13C / 12C carbon isotopes in human exhaled air with a high level of measurement accuracy. The article reviews the work in the field of provision comparability of absolute 13C/12C isotope amount ratios in the environment and food. The analysis of the technical and metrological characteristics of traditional and perspective instruments for measuring isotope ratios is presented. The provision of comparability of absolute 13C/12C isotope amount ratios is carried by gravimetrically prepared reference standards. The key features and emerging issues are discussed.

  7. Insight to the Thermal Decomposition and Hydrogen Desorption Behaviors of NaNH2-NaBH4 Hydrogen Storage Composite.

    Science.gov (United States)

    Pei, Ziwei; Bai, Ying; Wang, Yue; Wu, Feng; Wu, Chuan

    2017-09-20

    The lightweight compound material NaNH 2 -NaBH 4 is regarded as a promising hydrogen storage composite due to the high hydrogen density. Mechanical ball milling was employed to synthesize the composite NaNH 2 -NaBH 4 (2/1 molar ratio), and the samples were investigated utilizing thermogravimetric-differential thermal analysis-mass spectroscopy (TG-DTA-MS), X-ray diffraction (XRD), and Fourier transform infrared spectroscopy (FTIR) analyses. The full-spectrum test (range of the ratio of mass to charge: 0-200) shows that the released gaseous species contain H 2 , NH 3 , B 2 H 6 , and N 2 in the heating process from room temperature to 400 °C, and possibly the impurity gas B 6 H 12 also exists. The TG/DTA analyses show that the composite NaNH 2 -NaBH 4 (2/1 molar ratio) is conductive to generate hydrogen so that the dehydrogenation process can be finished before 400 °C. Moreover, the thermal decomposition process from 200 to 400 °C involves two-step dehydrogenation reactions: (1) Na 3 (NH 2 ) 2 BH 4 hydride decomposes into Na 3 BN 2 and H 2 (200-350 °C); (2) remaining Na 3 (NH 2 ) 2 BH 4 reacts with NaBH 4 and Na 3 BN 2 , generating Na, BN, NH 3 , N 2 , and H 2 (350-400 °C). The better mechanism understanding of the thermal decomposition pathway lays a foundation for tailoring the hydrogen storage performance of the composite complex hydrides system.

  8. Gamow-Teller matrix elements from the C-12(d,He-2) and Mg-24(d,He-2) reactions at 170 MeV

    NARCIS (Netherlands)

    Baumer, C; Frekers, D; Schmidt, R; van den Berg, AM; Hannen, VM; Harakeh, MN; de Huu, MA; Wörtche, HJ; De Frenne, D; Hagemann, M; Heyse, J; Jacobs, E; Fujita, Y

    The Mg-24(d,He-2)Na-24 and the C-12(d,He-2)B-12 charge-exchange reactions have been studied at an incident energy of 170 MeV. The two protons in the S-1(0)(pp) state (indicated as He-2) were both momentum analyzed and detected by the same spectrometer and detector. Background-free He-2 spectra with

  9. Comparative yields of alkali elements and thallium from uranium irradiated with GeV protons, $^{3}$He and $^{12}$C

    CERN Document Server

    Bjørnstad, T; Jonson, B; Jonsson, O C; Lindfors, V; Mattsson, S; Poskanzer, A M; Ravn, H L; Schardt, D

    1981-01-01

    Mass-separated ion beams of the alkali elements Na, K and Fr, and of the element Tl, are produced by bombarding a uranium target with 600 MeV protons, 890 MeV /sup 3/He/sup 2+/, and 936 MeV /sup 12/C/sup 4+/. Isotopic production yields are reported. In the case of the /sup 12/C beam, these are thick target yields. Absolute cross-sections for the proton beam data are deduced by normalizing the delay-time corrected yield curves to measured cross-sections. For products farthest away from stability, the /sup 3/He/sup 2+/ beam generally gives the highest yields. (17 refs).

  10. β‐Taxilin participates in differentiation of C2C12 myoblasts into myotubes

    Energy Technology Data Exchange (ETDEWEB)

    Sakane, Hiroshi; Makiyama, Tomohiko; Nogami, Satoru; Horii, Yukimi [Department of Molecular and Cell Biology, Graduate school of Medicine, Dokkyo Medical University, 880 Kitakobayashi, Mibu-town, Tochigi 321-0293 (Japan); Akasaki, Kenji [Faculty of Pharmacy and Pharmaceutical Sciences, Fukuyama University, Fukuyama, Hiroshima 729-0292 (Japan); Shirataki, Hiromichi, E-mail: hiro-sh@dokkyomed.ac.jp [Department of Molecular and Cell Biology, Graduate school of Medicine, Dokkyo Medical University, 880 Kitakobayashi, Mibu-town, Tochigi 321-0293 (Japan)

    2016-07-15

    Myogenesis is required for the development of skeletal muscle. Accumulating evidence indicates that the expression of several genes are upregulated during myogenesis and these genes play pivotal roles in myogenesis. However, the molecular mechanism underlying myogenesis is not fully understood. In this study, we found that β-taxilin, which is specifically expressed in the skeletal muscle and heart tissues, was progressively expressed during differentiation of C2C12 myoblasts into myotubes, prompting us to investigate the role of β-taxilin in myogenesis. In C2C12 cells, knockdown of β-taxilin impaired the fusion of myoblasts into myotubes, and decreased the diameter of myotubes. We also found that β-taxilin interacted with dysbindin, a coiled-coil-containing protein. Knockdown of dysbindin conversely promoted the fusion of myoblasts into myotubes and increased the diameter of myotubes in C2C12 cells. Furthermore, knockdown of dysbindin attenuated the inhibitory effect of β-taxilin depletion on myotube formation of C2C12 cells. These results demonstrate that β-taxilin participates in myogenesis through suppressing the function of dysbindin to inhibit the differentiation of C2C12 myoblasts into myotubes. - Highlights: • β‐Taxilin is progressively expressed during differentiation of C2C12 cell. • Knockdown of β-taxilin impaired C2C12 myotube formation. • β‐Taxilin interacted with dysbindin. • Knockdown of dysbindin promoted C2C12 myotube formation. • The function of β-taxilin in C2C12 myotube formation depends on dysbindin.

  11. Ethane's 12C/13C Ratio in Titan: Implications for Methane Replenishment

    Science.gov (United States)

    Jennings, Donald E.; Nixon, C. A.; Romani, P. N.; Bjoraker, G. L.; Sada, P. V.; Lunsford, A. W.; Boyle, R. J.; Hesman, B. E.; McCabe, G. H.

    2009-01-01

    As the .main destination of carbon in the destruction of methane in the atmosphere of Titan, ethane provides information about the carbon isotopic composition of the reservoir from which methane is replenished. If the amount of methane entering the atmosphere is presently equal to the amount converted to ethane, the 12C/13C ratio in ethane should be close to the ratio in the reservoir. We have measured the 12C/13C ratio in ethane both with Cassini CIRS(exp 1) and from the ground and find that it is very close to the telluric standard and outer planet values (89), consistent with a primordial origin for the methane reservoir. The lower 12C/13C ratio measured for methane by Huygens GCMS (82.3) can be explained if the conversion of CH4 to CH3 (and C2H6) favors 12C over 13C with a carbon kinetic isotope effect of 1.08. The time required for the atmospheric methane to reach equilibrium, i.e., for replenishment to equal destruction, is approximately 5 methane atmospheric lifetimes.

  12. Synthesis, single-crystal structure determination and Raman spectra of the tricyanomelaminates NaA{sub 5}[C{sub 6}N{sub 9}]{sub 2} . 4 H{sub 2}O (A = Rb, Cs)

    Energy Technology Data Exchange (ETDEWEB)

    Reckeweg, Olaf; DiSalvo, Francis J. [Cornell Univ., Ithaca, NY (United States). Baker Lab.; Schulz, Armin [Max-Planck-Institut fuer Festkoerperforschung, Stuttgart (Germany)

    2016-07-01

    Transparent colorless crystals of NaA{sub 5}[C{sub 6}N{sub 9}]{sub 2} . 4 H{sub 2}O (A = Rb, Cs) were obtained by blending aqueous solutions of Na{sub 3}[C{sub 6}N{sub 9}] and RbF or CsF, respectively, and subsequent evaporation of the water under ambient conditions. Both compounds crystallize in the space group P2{sub 1}/m (no. 11) with the cell parameters a = 815.56(16), b = 1637.7(4) and c = 1036.4(3) pm, and β = 110.738(12) for NaRb{sub 5}[C{sub 6}N{sub 9}]{sub 2} . 4 H{sub 2}O and a = 843.32(6), b = 1708.47(11) and c = 1052.42(7) pm, and β = 112.034(2) for NaCs{sub 5}[C{sub 6}N{sub 9}]{sub 2} . 4 H{sub 2}O, respectively. Raman spectra of the title compounds complement our results.

  13. Structural Stability and Electronic Properties of Na2C6O6 for a Rechargeable Sodium-ion Battery

    Science.gov (United States)

    Yamashita, Tomoki; Fujii, Akihiro; Momida, Hiroyoshi; Oguchi, Tamio

    2014-03-01

    Sodium-ion batteries have been explored as a promising alternative to lithium-ion batteries owing to a significant advantage of a natural abundance of sodium. Recently, it has been reported that disodium rhodizonate, Na2C6O6, exhibit good electrochemical properties and cycle performance as a minor-metal free organic cathode for sodium-ion batteries. However, its crystal structures during discharge/charge cycle still remain unclear. In this work, we theoretically propose feasible crystal structures of Na2+xC6O6 using first principles calculations. A structural phase transition has been found: Na4C6O6 has a different C6O6 packing arrangement from Na2C6O6. Electronic structures of Na2+xC6O6 during discharge/charge cycle are also discussed. Our predictions could be the key to understanding the discharge/charge process of Na2C6O6. Supported by MEXT program ``Elements Strategy Initiative to Form Core Rersearch Center'' (since 2012), MEXT; Ministry of Education Culture, Sports, Science and Technology, Japan.

  14. Leptin rapidly activates PPARs in C2C12 muscle cells

    International Nuclear Information System (INIS)

    Bendinelli, Paola; Piccoletti, Roberta; Maroni, Paola

    2005-01-01

    Experimental evidence suggests that leptin operates on the tissues, including skeletal muscle, also by modulating gene expression. Using electrophoretic mobility shift assays, we have shown that physiological doses of leptin promptly increase the binding of C2C12 cell nuclear extracts to peroxisome proliferator-activated receptor (PPAR) response elements in oligonucleotide probes and that all three PPAR isoforms participate in DNA-binding complexes. We pre-treated C2C12 cells with AACOCF 3 , a specific inhibitor of cytosolic phospholipase A 2 (cPLA 2 ), an enzyme that supplies ligands to PPARs, and found that it abrogates leptin-induced PPAR DNA-binding activity. Leptin treatment significantly increased cPLA 2 activity, evaluated as the release of [ 3 H]arachidonic acid from pre-labelled C2C12 cells, as well as phosphorylation. Further, using MEK1 inhibitor PD-98059 we showed that leptin activates cPLA 2 through ERK induction. These results support a direct effect of leptin on skeletal muscle cells, and suggest that the hormone may modulate muscle transcription also by precocious activation of PPARs through ERK-cPLA 2 pathway

  15. The role of three-body coulomb fields versus final state interactions in the decay of 12C-α-12C

    International Nuclear Information System (INIS)

    Quebert, J.L.; Bertault, D.; Scheurer, J.N.; Fouan, J.P.

    1980-01-01

    The alpha emission in 16 O + 12 C→ 12 C + α + 12 C has been thoroughly studied in the region of the rapidity plot: Ysub(α)=Ysub(c.m.). The three-body coulomb fields, as well as configurations close to alignment, account for the alpha yield which is observed. The apparent competition between direct and sequential decays is well explained by the coulomb break-up

  16. Chemical alteration of calcium silicate hydrates in saline groundwater. Mechanism of sorption of Na on C-S-H and effect of NaCl on leaching of Ca from C-S-H

    International Nuclear Information System (INIS)

    Sugiyama, Daisuke; Fujita, Tomonari

    2004-01-01

    In the concept for TRU waste disposal in Japan, cement is a potential waste packaging and backfilling material and is expected to provide chemical containment. In the presence of some reactive ions in a saline groundwater, the chemical properties of cement materials should be affected. In this study, the mechanism of sorption of sodium (Na) on C-S-H and the effect of sodium chloride (NaCl) concentration on dissolution of Calcium Silicate Hydrate (C-S-H) are discussed by measuring the sorption isotherm of sodium onto C-S-H gel (Ca/Si = 0.65-1.2). Based on the experimental results, it is showed that sodium sorbs by substitution for Ca in C-S-H phases and leaching of Ca from C-S-H is enhanced in NaCl solution ( -1 mol dm -3 ). The results of sorption experiments are reasonably well modelled by the ion-exchange model assuming some calcium sites with different ion-exchange log K values. It is also suggested that the dissolution of C-S-H can be modelled reasonably well by considering the effect of ionic strength on activity coefficients of aqueous species for high Ca/Si ratio of C-S-H, and the effect of exchange of sodium with calcium of C-S-H on leaching of Ca becomes obvious for lower Ca/Si ratio of C-S-H. (author)

  17. Homocisteína, folato e vitamina B12 em pacientes colombianos portadores de coronariopatia Homocysteine, folate and vitamin B12 in colombian patients with coronary disease

    Directory of Open Access Journals (Sweden)

    Gilberto Garcia

    2007-08-01

    Full Text Available OBJETIVO: Determinar a existência de associação entre os níveis plasmáticos de homocisteína, folato ou vitamina B12 e síndrome coronariana aguda em pacientes colombianos. MÉTODOS: Estudo caso-controle: foram 50 pacientes portadores de síndrome coronariana aguda e 50 pacientes ambulatoriais sem síndrome coronariana. Foram medidos os níveis de homocisteína, folato e vitamina B12 por meio de imunoensaio por quimioluminescência. Foram também medidos os níveis de colesterol e frações, triglicérides, uréia, creatinina, hemoglobina e hematócrito. RESULTADOS: As concentrações plasmáticas médias de homocisteína foram significativamente diferentes entre os casos (12,4 µmol/l ± 6,0 e os controles (9,7 µmol/l ± 2,4, p=0,01. Os níveis de ácido fólico dos casos foram menores que os dos controles (respectivamente 10,5 ng/ml ± 3,5 x 12,6 ng/ml ± 3,6; p=0,01. Foi observada relação inversa entre os níveis de folato e os de homocisteína. Não houve relação entre os níveis de vitamina B12 e os de homocisteína. Houve diferença significativa nos níveis de triglicérides entre os grupos caso e controle (respectivamente 136,91 ± 67,27 x 174,3 ± 77,6; p=0,01. A razão das chances para hiper-homocisteinemia na síndrome coronariana aguda foi de 4,45 (intervalo de confiança de 95%: 1,5 - 13,3. CONCLUSÃO: O presente estudo demonstrou associação significativa entre os níveis de homocisteína e síndrome coronariana aguda em pacientes colombianos semelhante à encontrada em populações européias e norte-americanas. Houve correlação negativa entre os níveis plasmáticos de homocisteína e os de folato. Não houve associação entre os níveis plasmáticos de homocisteína e os de vitamina B12.OBJECTIVE: To determine the occurrence of association between homocysteine, folate, or vitamin B12 plasma levels and acute coronary syndrome in Colombian patients. METHODS: Case control study: cases were 50 patients with acute

  18. The 90deg excitation function for elastic 12C+12C scattering. The importance of Airy elephants

    International Nuclear Information System (INIS)

    McVoy, K.W.; Brandan, M.E.

    1992-01-01

    The 90deg excitation function for elastic 12 C+ 12 C scattering, at laboratory energies between the Coulomb barrier and 130 MeV, exhibits a complex structure of peaks and valleys whose nature has remained an unsolved mystery for more than 20 years. The problem has primarily been caused by the difficulty of choosing from a plethora of discretely ambiguous optical potentials. However, data accumulated above 150 MeV over the last decade have determined unique potentials at these higher energies, and the requirement of continuity downward in energy has recently permitted the determination of a unique set of potentials for angular distributions at energies below 130 MeV, where the excitation-function data exist. These new potentials are used to provide a mean-field (i.e., nonresonant) interpretation of the structure in the 12 C+ 12 C 90deg excitation function between 70 and 130 MeV. Its most prominent minima are found to be Airy minima from nuclear rainbows, with the remaining structure arising primarily from more elementary optical phenomena related to Fraunhofer diffraction. These same potentials are also successful in explaining the details of excitation functions measured very recently at other angles by Morsad. (orig.)

  19. Evidence for the 3-fold α-cluster symmetry of 12C

    International Nuclear Information System (INIS)

    Rae, W.D.M.; Fry, P.E.; Merchant, A.C.

    1996-01-01

    Recently, resonances have been observed in the reactions 12 C( 12 C, 12 C(O 2 + )) 12 C(3 - ) and 12 C( 12 C, 12 C(3 - )) 12 C(3 - ) at E cm ∼ 33 MeV. Previously resonances in the reaction 12 C( 12 C, 12 C) 12 C(3 - ) have been reported by Fulton et al. Here we present a new model of these resonances. We relate this model to the classical theory of both the asymmetric rotor and the symmetric top. We believe that detailed spin measurements from these data will provide evidence for the 3-fold symmetry of 12 C. (author). Letter-to-the-editor

  20. Enhancement of Palmarumycin C12 and C13 Production by the Endophytic Fungus Berkleasmium sp. Dzf12 in an Aqueous-Organic Solvent System.

    Science.gov (United States)

    Mou, Yan; Xu, Dan; Mao, Ziling; Dong, Xuejiao; Lin, Fengke; Wang, Ali; Lai, Daowan; Zhou, Ligang; Xie, Bingyan

    2015-11-12

    The endophytic fungus Berkleasmium sp. Dzf12, isolated from Dioscorea zingiberensis, was found to produce palmarumycins C12 and C13 which possess a great variety of biological activities. Seven biocompatible water-immiscible organic solvents including n-dodecane, n-hexadecane, 1-hexadecene, liquid paraffin, dibutyl phthalate, butyl oleate and oleic acid were evaluated to improve palmarumycins C12 and C13 production in suspension culture of Berkleasmium sp. Dzf12. Among the chosen solvents both butyl oleate and liquid paraffin were the most effective to improve palmarumycins C12 and C13 production. The addition of dibutyl phthalate, butyl oleate and oleic acid to the cultures of Berkleasmium sp. Dzf12 significantly enhanced palmarumycin C12 production by adsorbing palmarumycin C12 into the organic phase. When butyl oleate was fed at 5% (v/v) in medium at the beginning of fermentation (day 0), the highest palmarumycin C12 yield (191.6 mg/L) was achieved, about a 34.87-fold increase in comparison with the control (5.3 mg/L). n-Dodecane, 1-hexadecene and liquid paraffin had a great influence on the production of palmarumycin C13. When liquid paraffin was added at 10% (v/v) in medium on day 3 of fermentation, the palmarumycin C13 yield reached a maximum value (134.1 mg/L), which was 4.35-fold that of the control (30.8 mg/L). Application of the aqueous-organic solvent system should be a simple and efficient process strategy for enhancing palmarumycin C12 and C13 production in liquid cultures of the endophytic fungus Berkleasmium sp. Dzf12.

  1. Enhancement of Palmarumycin C12 and C13 Production by the Endophytic Fungus Berkleasmium sp. Dzf12 in an Aqueous-Organic Solvent System

    Directory of Open Access Journals (Sweden)

    Yan Mou

    2015-11-01

    Full Text Available The endophytic fungus Berkleasmium sp. Dzf12, isolated from Dioscorea zingiberensis, was found to produce palmarumycins C12 and C13 which possess a great variety of biological activities. Seven biocompatible water-immiscible organic solvents including n-dodecane, n-hexadecane, 1-hexadecene, liquid paraffin, dibutyl phthalate, butyl oleate and oleic acid were evaluated to improve palmarumycins C12 and C13 production in suspension culture of Berkleasmium sp. Dzf12. Among the chosen solvents both butyl oleate and liquid paraffin were the most effective to improve palmarumycins C12 and C13 production. The addition of dibutyl phthalate, butyl oleate and oleic acid to the cultures of Berkleasmium sp. Dzf12 significantly enhanced palmarumycin C12 production by adsorbing palmarumycin C12 into the organic phase. When butyl oleate was fed at 5% (v/v in medium at the beginning of fermentation (day 0, the highest palmarumycin C12 yield (191.6 mg/L was achieved, about a 34.87-fold increase in comparison with the control (5.3 mg/L. n-Dodecane, 1-hexadecene and liquid paraffin had a great influence on the production of palmarumycin C13. When liquid paraffin was added at 10% (v/v in medium on day 3 of fermentation, the palmarumycin C13 yield reached a maximum value (134.1 mg/L, which was 4.35-fold that of the control (30.8 mg/L. Application of the aqueous-organic solvent system should be a simple and efficient process strategy for enhancing palmarumycin C12 and C13 production in liquid cultures of the endophytic fungus Berkleasmium sp. Dzf12.

  2. Binary and ternary fission yields induced by 12C and 20Ne ions on 238U targets

    International Nuclear Information System (INIS)

    Otto, R.J.

    1974-01-01

    Evidence for ternary fission of 250 Cf* and 258 No* compound nuclei has been found. Relative cross section data for nuclides with masses between 24 Na and 161 Tb have been determined for 12 C bombardments of natural uranium at laboratory energies of 122 MeV, 113 MeV and 105 MeV. Relative cross section data for 8 nuclides between 24 Na and 66 Ni were sought for 20 Ne bombardments of natural uranium at 150 MeV laboratory energies. The binary fission fragment mass distribution for 238 U( 12 C,f) was determined by analysis of fission fragment recoil collection foils using radiochemical techniques and high resolution gamma ray spectroscopy. The results indicated the existence of a ternary fission branch similar to mass distributions obtained for He induced fission of Th, U, and Pu nuclei at intermediate energies. Comparison of the data with He induced ternary fission data obtained previously in this laboratory indicated an increase in the ternary fission probability with increasing Z 2 /A of the compound nucleus and with excitation energy. A shift of the binary-ternary fission product intersection point to lower mass numbers with increasing Z 2 /A and excitation energy of the compound nucleus was also observed. (Diss. Abstr. Int., B)

  3. Interação entre células do cumulus e atividade da proteína quinase C em diferentes fases da maturação nuclear de oócitos bovinos Interaction between cumulus cells and the activity of protein kinase C at different stages of bovine oocyte nuclear maturation

    Directory of Open Access Journals (Sweden)

    A.C. Bertagnolli

    2004-08-01

    Full Text Available Verificou-se a influência da proteína quinase C (PK-C no reinício e na progressão da meiose em oócitos bovinos, determinando se as células do cumulus são mediadoras da PK-C na regulação da maturação dos oócitos. Complexos cumulus-oócitos (CCO e oócitos desnudos (OD, distribuídos aleatoriamente em seis tratamentos (T com base na presença de um ativador da PK-C (PMA (T1 e T2, de um forbol éster incapaz de ativar a PK-C (4alfa-PDD-controle (T3 e T4 ou de apenas o meio básico (TCM-199-controle (T5 e T6, foram cultivados por 7, 9, 12, 18 e 22 horas. A percentagem de rompimento da vesícula germinativa no grupo cultivado com PMA foi maior do que nos dois grupos controle, com e sem células do cumulus. O cultivo de CCO e OD por 12 e 18 horas demonstrou que a PK-C influencia a progressão para os estádios de metáfase I (MI e metáfase II (MII de maneira dependente das células do cumulus. Nos períodos de 9 e 22 horas, não foi possível observar diferença entre os grupos quanto aos diferentes estádios de maturação. A ativação da PK-C acelera o reinício da meiose independentemente das células somáticas e acelera a progressão até os estádios de MI e MII na dependência das células do cumulus.The aim of this study was to evaluate the effect of protein kinase C (PK-C on the meiotic resumption and progression in bovine oocyte, and to determine if the cumulus cells mediate the PK-C action in the regulation of bovine oocyte nuclear maturation. Cumulus-oocyte complexes (COC and denuded oocytes (DO, randomly allotted to 6 treatments (T based on the presence of an activator of PK-C (PMA (T1 and T2, or a phorbol ester unable to activate PK-C (4alphaPDD-control (T3 and T4 or a basic culture medium (T5 and T6, were cultivated for 7, 9, 12, 18 and 22 hours. The percentage of germinal vesicle breakdown (GVBD was higher when the oocytes were cultured with PMA than in the control groups with and without cumulus cells. However, PK-C was

  4. On centrality and rapidity dependences of transverse momentum spectra of negative pions in 12C + 12C collisions at 4.2 GeV/c per nucleon

    International Nuclear Information System (INIS)

    Iqbal, A.; Haseeb, M.Q.; Olimov, K.K.; Khan, Imran; Yuldashev, B.S.

    2014-01-01

    The dependences of the experimental transverse momentum spectra of the negative pions, produced in minimum bias 12 C + 12 C collisions at a momentum of 4.2A GeV/c, on the collision centrality and the pion rapidity range were studied. To analyze quantitatively the change in the p t spectra of π - mesons with the changes of collision centrality and pion rapidity range, the extracted p t spectra were fitted by Hagedorn, Boltzmann, simple exponential and Gaussian functions. The values of the extracted spectral temperatures T 1 and T 2 were consistently larger for the p t spectra of π - mesons coming from midrapidity range as compared to those of the negative pions generated in the target and projectile fragmentation regions. The spectral temperatures T 1 and T 2 extracted from fitting the p t spectra of π - mesons in range p t = 0.1–1.2 GeV/c practically coincided with each other in peripheral, semicentral and central 12 C + 12 C collision events, and thus did not show any collision centrality dependence. However, the values of T 1 and T 2 extracted from fitting in range p t = 0.1–0.7 GeV/c were consistently and noticeably larger in case of central collisions as compared to peripheral and semicentral 12 C + 12 C collisions. Hagedorn and Boltzmann functions provided significantly better fits of the transverse momentum spectra of the negative pions with the physically acceptable values of the extracted temperatures as compared to Gaussian and simple exponential functions. (author)

  5. Double molybdates in Li2MoO4 - Na2MoO4 - H2O system at 25 grad C

    International Nuclear Information System (INIS)

    Karov, Z.G.; Mirzoev, R.S.; Makitova, D.D.; Zhilova, S.B.; Podnek, A.G.; Urusova, R.Kh.

    1989-01-01

    Solubility in Li 2 MoO 4 - Na 2 MoO 4 - H 2 O system at 25 deg C is first stuied. Formation of two Li 2 MoO 4 · Na 2 MoO 4 · 4H 2 O and Li 2 MoO 4 · 3Na 2 MoO 4 · 12H 2 O compounds in a system is ascertained. Density, refractive index, viscosity, surface tension, electric conductivity and pH of saturated solutions are determined. Isothermes of mole volume, equivalent and reduced electric conductivity and seeming mole volume of salts sum in solutions are calculated. All these properties adequtely confirm the character of components interaction in a system determined by solubility method. Crystallhydrates of binary molybdates are separated, indentified and studied

  6. Determinação de daidzeína, genisteína e gliciteína em cápsulas de isoflavonas por cromatografia em camada delgada (CCD e cromatografia líquida de alta eficiência (CLAE

    Directory of Open Access Journals (Sweden)

    Isabela da Costa César

    Full Text Available A utilização de produtos naturais e suplementos contendo extratos secos de isoflavonas aumentou na última década, devido, principalmente, aos efeitos benéficos atribuídos a estes compostos no alívio dos sintomas da menopausa. Genisteína, daidzeína e gliciteína são as agliconas mais abundantes nos extratos de soja, ocorrendo também como glicosídeos. Tendo em vista seus usos, não existe ainda na literatura uma definição da quantidade mínima de cada uma das agliconas que os extratos ou cápsulas de isoflavonas devem ter, e também não existe um método oficial para o controle de qualidade dos mesmos. O presente trabalho apresenta um método por CCD para análise qualitativa das três agliconas e de seus glicosídeos em extratos e cápsulas de isoflavonas, antes e após hidrólise ácida. A análise quantitativa das cápsulas de isoflavonas, realizada por cromatografia líquida de alta eficiência (CLAE, revelou grandes variações nos teores das três agliconas, após hidrólise ácida. Os teores variaram da seguinte forma, nos 18 lotes de cápsulas avaliados: daidzeína (13,34 a 76,20 mg/cápsula, genisteína (0,61 a 27,18 mg/cápsula e gliciteína (0,49 a 8,80 mg/cápsula.

  7. Effects of the co-addition of LiSbO3-LiTaO3 on the densification of (Na1/2K1/2)NbO3 lead free ceramics by atmosphere sintering

    International Nuclear Information System (INIS)

    Jiang Na; Fang Bijun; Wu Jian; Du Qingbo

    2011-01-01

    Research highlights: → This manuscript shows a synthesis method that can easily obtain excellent lead-free samples, which is valuable for industrial production. → Pure phase perovskite 0.94(Na 1/2 K 1/2 )NbO 3 -0.03LiSbO 3 -0.03LiTaO 3 (0.94NKN-0.03LS-0.03LT) lead-free piezoelectric ceramics with high relative density, being 94.73%, and excellent integral electrical properties, piezoelectric constant d 33 being 228 pC/N, were prepared by atmosphere sintering method. Which can be attributed to the co-doping of LiSbO 3 -LiTaO 3 . - Abstract: Pure phase perovskite 0.94(Na 1/2 K 1/2 )NbO 3 -0.03LiSbO 3 -0.03LiTaO 3 (0.94NKN-0.03LS-0.03LT) lead-free piezoelectric ceramics were prepared by the conventional solid-state reaction method. Due to the co-addition of LiSbO 3 -LiTaO 3 , the 0.94NKN-0.03LS-0.03LT ceramics prepared by atmosphere sintering at 1040 deg. C exhibit high relative density, being 94.73%, and rather homogenous microstructure. X-ray diffraction (XRD) measurement confirmed that the sintered ceramics exhibit pure tetragonal perovskite structure. The 0.94NKN-0.03LS-0.03LT ceramics exhibit excellent integral electrical properties, in which the value of piezoelectric constant d 33 is 228 pC/N, the electromechanical coupling factors K p and K t are 0.220 and 0.230, respectively, the mechanical quality factor Q m is 32.19, and the remnant polarization P r is 23.06 μC/cm 2 . Such excellent electrical properties are considered as correlating with the high relative density of the synthesized ceramics induced by the co-doping of LiSbO 3 -LiTaO 3 .

  8. Spin measurement for symmetric fission states of sup 24 Mg. A new angle on the sup 12 C+ sup 12 C interaction

    Energy Technology Data Exchange (ETDEWEB)

    Fulton, B.R.; Bennett, S.J.; Freer, M.; Murgatroyd, J.T. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Gyapong, G.J.; Jarvis, N.S.; Jones, C.D.; Watson, D.L. (Dept. of Physics, York Univ. (United Kingdom)); Brown, J.D.; Rae, W.D.M.; Smith, A.E. (Dept. of Nuclear Physics, Oxford Univ. (United Kingdom)); Lilley, J.S. (Daresbury Lab., Warrington (United Kingdom))

    1991-09-19

    A new high resolution measurement of the {sup 12}C({sup 24}Mg, {sup 12}C{sup 12}C){sup 12}C breakup reaction has been performed. Sequential breakup is observed from specific states in {sup 24}Mg at excitation energies ranging from 20 to 26 MeV. Angular correlation measurements indicate that states with spins ranging from J=4 to 8 are populated. These states are consistent with superdeformed shape isomeric bands predicted by cranked cluster model and Nilsson-Strutinsky calculations. (orig.).

  9. Thermophysical properties of Na2Th (MoO4)3 (s) and Na4Th (MoO4)4 (s)

    International Nuclear Information System (INIS)

    Dash, Smruti; Rakshit, S.K.; Singh, Ziley; Keskar, Meera; Dahale, N.D.

    2009-01-01

    The heat capacity of Na 2 Th (MoO 4 ) 3 (s) and Na 4 Th (MoO 4 ) 4 (s) have been measured by differential scanning calorimeter in the temperature range 318 to 845 K. The corresponding values are: C p,m (Na 2 Th (MoO 4 ) 3 ,s,T) (JK-1 mol-1) 368.710+ 1.0 10-1 (T/K) - 4950267 (K/T)2 (318 ≤ T (K) ≤ 845). C p,m (Na 4 Th (MoO 4 ) 4 ,s,T) (JK-1 mol-1) = 638.761+ 5.12 10-3 (T/K) - 12691691 (K/T)-2 (318 ≤ T (K) ≤ 845). Experimental heat capacity values for Na 2 Th (MoO 4 ) 3 (s) match reasonably well with that of additive oxide values. But C p,m (T) values of Na 4 Th (MoO 4 ) 4 (s) deviates substantially from the additive oxide values above 700 K. The uncertainty of the measurements reported in this study is calculated to be within 1 to 3 % . (author)

  10. The 12C/13C Isotopic Ratio in Planetary Nebulae as Deduced from IUE Data

    Science.gov (United States)

    Miskey, C. L.; Feibelman, W. A.; Bruhweiler, F. C.

    2000-05-01

    The relative abundances of C, N, and O and the isotopic ratio of 12C/13C represent tracers of nucleosynthesis in intermediate stars with main-sequence masses between 0.6 and 8.0 solar masses in our Galaxy. Determining these abundances and the isotopic 12C/13C ratio in planetary nebulae (PNe) represent perhaps the best means to discern exactly how the ISM is enriched by CNO stellar nucleosynthesis. Walsh et al. (1996) and Clegg et al. (1997), using the Hubble Space Telescope, have derived the isotopic 12C/13C abundance ratio in the galactic carbon-rich PN, NGC 3918, and placed marginal constraints on it for the Magellanic PNe, N2 (SMC) and N122 (LMC). This was done using the well-known 12C 3P-1S (J=1-0 and J=2-0) transitions of C+2 at 1906.68 Angstroms and 1908.77 Angstroms and a J=0-0 transition at 1909.6 Angstroms, which is strictly forbidden in 12C. The finite nuclear spin of 13C (I=1/2) permits a corresponding F=1/2-1/2 electric dipole transition not seen in 12C. Since the 1909.6 Angstroms line is well separated from the other two 12C transitions, it provides an important means of determining 12C/13C in planetary nebulae. We have just completed a search of archival International Ultraviolet Explorer (IUE) high-dispersion spectra of approximately three dozen PNe, and derived 12C/13C ratios of 39 and 23 for the galactic PNe, NGC 2440 and NGC 6302, respectively. These are values much lower than the solar value of 89. In the other objects, the limited S/N of the IUE data indicate 12C/13C ratio upper limits much higher than 50. The implications of these results and their pertinence to stellar evolution are discussed.

  11. Total reaction cross section for 12C+16O below the Coulomb barrier

    International Nuclear Information System (INIS)

    Cujec, B.; Barnes, C.A.

    1976-01-01

    The energy dependence of the total reaction cross section, sigma(E), for 12 C+ 16 0 has been measured over the range Esub(c.m.)=4-12 MeV, by detecting γ-rays from the various possible residual nuclei with two large NaI(Tl) detectors placed close to the target. This technique for measuring total reaction cross sections was explored in some detail and shown to yield reliable values for sigma(E). Although the principal emphasis of this work was placed on obtaining reliable cross sections, a preliminary study has been made of the suitability of various methods for extrapolating the cross section to still lower energies. The statistical model provides a good fit with a reasonable value for the strength function, 2 >/ =6.8x10 -2 , over the range Esub(c.m.)=6.5-12 MeV, but predicts cross sections which are much too large for Esub(c.m.)<6.5 MeV. Optical model fits at low energies are especially sensitive to the radius and diffuseness of the imaginary component of the potential and, since these are still poorly known at present, such extrapolations may be wrong by orders of magnitude. A simple barrier penetration model gives a moderately good fit to the data and seems to provide the safest extrapolation to lower energies at the present time. It is clear, however, that our knowledge of the heavy-ion reaction mechanism at low energies is incomplete, and that cross-section measurements at still lower energies are needed to establish the correct procedure for extrapolating heavy-ion reaction cross sections to low energies. (Auth.)

  12. File list: InP.Myo.20.AllAg.C2C12 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.Myo.20.AllAg.C2C12 mm9 Input control Muscle C2C12 SRX262224,SRX262225,SRX148229...695944 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Myo.20.AllAg.C2C12.bed ...

  13. Purine 3':5'-cyclic nucleotides with the nucleobase in a syn orientation: cAMP, cGMP and cIMP.

    Science.gov (United States)

    Řlepokura, Katarzyna Anna

    2016-06-01

    Purine 3':5'-cyclic nucleotides are very well known for their role as the secondary messengers in hormone action and cellular signal transduction. Nonetheless, their solid-state conformational details still require investigation. Five crystals containing purine 3':5'-cyclic nucleotides have been obtained and structurally characterized, namely adenosine 3':5'-cyclic phosphate dihydrate, C10H12N5O6P·2H2O or cAMP·2H2O, (I), adenosine 3':5'-cyclic phosphate 0.3-hydrate, C10H12N5O6P·0.3H2O or cAMP·0.3H2O, (II), guanosine 3':5'-cyclic phosphate pentahydrate, C10H12N5O7P·5H2O or cGMP·5H2O, (III), sodium guanosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H11N5O7P(-)·4H2O or Na(cGMP)·4H2O, (IV), and sodium inosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H10N4O7P(-)·4H2O or Na(cIMP)·4H2O, (V). Most of the cyclic nucleotide zwitterions/anions [two from four cAMP present in total in (I) and (II), cGMP in (III), cGMP(-) in (IV) and cIMP(-) in (V)] are syn conformers about the N-glycosidic bond, and this nucleobase arrangement is accompanied by Crib-H...Npur hydrogen bonds (rib = ribose and pur = purine). The base orientation is tuned by the ribose pucker. An analysis of data obtained from the Cambridge Structural Database made in the context of syn-anti conformational preferences has revealed that among the syn conformers of various purine nucleotides, cyclic nucleotides and dinucleotides predominate significantly. The interactions stabilizing the syn conformation have been indicated. The inter-nucleotide contacts in (I)-(V) have been systematized in terms of the chemical groups involved. All five structures display three-dimensional hydrogen-bonded networks.

  14. Systematic study of photoluminescence upon band gap excitation in perovskite-type titanates R 1/2Na1/2TiO3:Pr (R=La, Gd, Lu, and Y)

    International Nuclear Information System (INIS)

    Inaguma, Yoshiyuki; Tsuchiya, Takeshi; Katsumata, Tetsuhiro

    2007-01-01

    Pr 3+ -doped perovskites R 1/2 Na 1/2 TiO 3 :Pr (R=La, Gd, Lu, and Y) were synthesized, and their structures, optical absorption and luminescent properties were investigated, and the relationship between structures and optical properties are discussed. Optical band gap of R 1/2 Na 1/2 TiO 3 increases in the order R=La, Gd, Y, and Lu, which is primarily due to a decrease in band width accompanied by a decrease in Ti-O-Ti bond angle. Intense red emission assigned to f-f transition of Pr 3+ from the excited 1 D 2 level to the ground 3 H 4 state upon the band gap photo-excitation (UV) was observed for all compounds. The wavelength of emission peaks was red-shifted in the order R=La, Gd, Y, and Lu, which originates from the increase in crystal field splitting of Pr 3+ . This is attributed to the decrease in inter-atomic distances of Pr-O together with the inter-atomic distances (R, Na)-O, i.e., increase in covalency between Pr and O. The results indicate that the luminescent properties in R 1/2 Na 1/2 TiO 3 :Pr are governed by the relative energy level between the ground and excited state of 4f 2 for Pr 3+ , and the conduction and valence band, which is primarily dependent on the structure, e.g., the tilt of TiO 6 octahedra and the Pr-Ti inter-atomic distance and the site symmetry of Pr ion. - Graphical abstract: The red intense emission assigned to f-f transition of Pr 3+ from the excited 1 D 2 level to the ground 3 H 4 state upon the band gap photo-excitation (UV) was observed upon the band gap photo-excitation in perovskites R 1/2 Na 1/2 TiO 3 :Pr(R=La, Gd, Lu, and Y). It was found that the systematic changes in their luminescent properties are strongly dependent on the structure

  15. Comparative study of A-site order in the lead-free bismuth titanates M1/2Bi1/2TiO3 (M=Li, Na, K, Rb, Cs, Ag, Tl) from first-principles

    International Nuclear Information System (INIS)

    Gröting, Melanie; Albe, Karsten

    2014-01-01

    We investigate the possibility of enhancing chemical order in the relaxor ferroelectric Na 1/2 Bi 1/2 TiO 3 upon substitution of Na + by other monovalent cations M + using total energy calculations based on density functional theory. All chemically available monovalent cations M + , which are Li, Na, Ag, K, Tl, Rb and Cs, are considered and an analysis of the structurally relaxed structures in terms of symmetry-adapted distortion modes is given in order to quantify the chemically induced structural distortions. We demonstrate that the replacement of Na + by other monovalent cations can hardly alter the tendency of chemical order with respect to Na 1/2 Bi 1/2 TiO 3 . Only Tl 1/2 Bi 1/2 TiO 3 and Ag 1/2 Bi 1/2 TiO 3 show enhanced tendency for chemical ordering. Both heavy metals behave similar to the light alkali metals in terms of structural relaxations and relative stabilities of the ordered configurations. Although a comparison of the Goldschmidt factors of components (M TiO 3 ) − reveals for Tl a value above the upper stability limit for perovskites, the additional lone-pair effect of Tl + stabilizes the ordered structure. - Graphical abstract: Amplitudes of chemically induced distortion modes in different ordered perovskites M 1/2 Bi 1/2 TiO 3 and visualisation of atomic displacements associated with distortion mode X + 1 in the 001-ordered compounds Li 1/2 Bi 1/2 TiO 3 and Cs 1/2 Bi 1/2 TiO 3 . Due to a substantial size mismatch between bismuth (green) and caesium (dark blue), incorporation of the latter leads to enhanced displacements of oxygen atoms (red) and suppresses displacements of titanium (silver) as compared to lithium (light blue) or other smaller monovalent cations. - Highlights: • Lead-free A-site mixed bismuth titanates M 1/2 Bi 1/2 TiO 3 are studied by first-principles calculations. • Investigation of chemical ordering tendency for M=Li, Na, K, Rb, Cs, Ag, and Tl. • Group theoretical analysis of different ordered structures. • Ag and Tl

  16. Measurement of Fragment Production Cross Sections in the $^{12}$C+$^{12}$C and $^{12}$C+$^{197}$Au Reactions at 62 $A$ MeV for Hadrontherapy and Space Radiation Protection

    CERN Document Server

    Tropea, S; Agodi, C; Blancato, A A; Bondì, M; Cappuzzello, F; Carbone, D; Cavallaro, M; Cirrone, G A P; Cuttone, G; Giacoppo, F; Nicolosi, D; Pandola, L; Raciti, G; Rapisarda, E; Romano, F; Sardina, D; Scuderi, V; Sfienti, C

    2014-01-01

    Over the last twenty years, there has been a renewed interest in nuclear fragmentation studies for both hadrontherapy applications and space radiation protection. In both fields, fragmentation cross sections are needed to predict the effects of the ions nuclear interactions within the patient’s and the astronaut’s body. Indeed, the Monte Carlo codes used in planning tumor treatments and space missions must be tuned and validated by experimental data. However, only a limited set of fragmentation cross sections are available in literature, especially at Fermi energies. Therefore, we have studied the production of secondary fragments in the 12 C+ 12 C and 12 C+ 197 Au reactions at 62 A MeV. In this work, the measured 4 He cross sections angular distributions at four selected angles are presented and compared.

  17. Domain structure of human complement C4b extends with increasing NaCl concentration: implications for its regulatory mechanism.

    Science.gov (United States)

    Fung, Ka Wai; Wright, David W; Gor, Jayesh; Swann, Marcus J; Perkins, Stephen J

    2016-12-01

    During the activation of complement C4 to C4b, the exposure of its thioester domain (TED) is crucial for the attachment of C4b to activator surfaces. In the C4b crystal structure, TED forms an Arg 104 -Glu 1032 salt bridge to tether its neighbouring macroglobulin (MG1) domain. Here, we examined the C4b domain structure to test whether this salt bridge affects its conformation. Dual polarisation interferometry of C4b immobilised at a sensor surface showed that the maximum thickness of C4b increased by 0.46 nm with an increase in NaCl concentration from 50 to 175 mM NaCl. Analytical ultracentrifugation showed that the sedimentation coefficient s 20,w of monomeric C4b of 8.41 S in 50 mM NaCl buffer decreased to 7.98 S in 137 mM NaCl buffer, indicating that C4b became more extended. Small angle X-ray scattering reported similar R G values of 4.89-4.90 nm for C4b in 137-250 mM NaCl. Atomistic scattering modelling of the C4b conformation showed that TED and the MG1 domain were separated by 4.7 nm in 137-250 mM NaCl and this is greater than that of 4.0 nm in the C4b crystal structure. Our data reveal that in low NaCl concentrations, both at surfaces and in solution, C4b forms compact TED-MG1 structures. In solution, physiologically relevant NaCl concentrations lead to the separation of the TED and MG1 domain, making C4b less capable of binding to its complement regulators. These conformational changes are similar to those seen previously for complement C3b, confirming the importance of this salt bridge for regulating both C4b and C3b. © 2016 The Author(s).

  18. Hydrothermal synthesis of Li4-xNaxTi5O12 and Li4-xNaxTi5O12/graphene composites as anode materials for lithium-ion batteries

    Directory of Open Access Journals (Sweden)

    Zhu Jiping

    2016-01-01

    Full Text Available A potential Lithium-ion battery anode material Li4-xNaxTi5O12 (0≤x≤0.15 has been synthesized via a facile hydrothermal method with short processing time and low temperature. The XRD and FE-SEM results indicate that samples with Na-doped are well-crystallized and have more homogeneous particle distributions with smaller overall particle size in the range of 300-600nm. Electrochemical tests reveal that Na-doped samples exhibit impressive specific capacity and cycle stability compared to pristine Li4Ti5O12 at high rate. The Li3.9Na0.1Ti5O12 electrode deliver an initial specific discharge capacity of 169mAh/g at 0.5C and maintained at 150.4mAh/g even after 40 cycles with the reversible retention of 88.99%. Finally, a simple solvothermal reduction method was used to fabricate Li3.9Na0.1Ti5O12/graphene(Li3.9Na0.1Ti5O12/G composite. Galvanostatic charge-discharge tests demonstrate that this sample has remarkable capacities of 197.4mAh/g and 175.5mAh/g at 0.2C and 0.5C rate, respectively. This indicates that the Li3.9Na0.1Ti5O12/G composite is a promising anode material for using in lithium-ion batteries.

  19. Search for alpha particles emitted at rest in the break-up of the 12C-α-12C molecule-like configuration

    International Nuclear Information System (INIS)

    Scheurer, J.N.; Bertault, D.; Caussanel, M.; Quebert, J.L.; Fouan, J.P.

    1978-01-01

    A yield of alpha particles emitted at rest is clearly observed in 16 O+ 12 C at several incident energies. These alpha particles are detected by two methods: i) the alpha particle is considered as a missing mass in the detection of two 12 C nuclei in coincidence; ii) the alpha particle is detected at zero degree with a velocity due to centre of mass motion. Such a yield is assigned to a linear chain formation of the type 12 C-α- 12 C and an excitation function between 40 and 65 MeV is given. The emission due to Coulomb effects is emphasized in the discussion to give the chief explanation of the coincidence results

  20. Enhancement of Palmarumycin C12 and C13 Production by the Endophytic Fungus Berkleasmium sp. Dzf12 in an Aqueous-Organic Solvent System

    OpenAIRE

    Mou, Yan; Xu, Dan; Mao, Ziling; Dong, Xuejiao; Lin, Fengke; Wang, Ali; Lai, Daowan; Zhou, Ligang; Xie, Bingyan

    2015-01-01

    The endophytic fungus Berkleasmium sp. Dzf12, isolated from Dioscorea zingiberensis, was found to produce palmarumycins C12 and C13 which possess a great variety of biological activities. Seven biocompatible water-immiscible organic solvents including n-dodecane, n-hexadecane, 1-hexadecene, liquid paraffin, dibutyl phthalate, butyl oleate and oleic acid were evaluated to improve palmarumycins C12 and C13 production in suspension culture of Berkleasmium sp. Dzf12. Among the chosen solvents bot...

  1. Comparative yields of alkali elements and thallium from uranium irradiated with high-energy protons, /sup 3/He and /sup 12/C

    CERN Document Server

    Gustafsson, Hans Åke; Jonson, B; Jonsson, O C; Lindfors, V; Mattsson, S; Poskanzer, A M; Ravn, H L; Schardt, D

    1981-01-01

    Mass-separated ion beams of the alkali elements Na, K, and Fr, and of the element Tl are produced by bombarding a uranium target with 600 Me V protons, 890 MeV /sup 3/He/sup 2+/, and 936 MeV /sup 12/C/sup 4+/. Isotopic production yields are reported. In the case of the /sup 12/C beam these are thick target yields. Absolute cross-sections for the proton-beam data were deduced by normalizing the delay-time corrected yield curves to measured cross-sections. For products farthest away from stability the /sup 3/He/sup 2+/ beam generally gives the highest yields. (17 refs).

  2. Characterization of an acute muscle contraction model using cultured C2C12 myotubes.

    Directory of Open Access Journals (Sweden)

    Yasuko Manabe

    Full Text Available A cultured C2C12 myotube contraction system was examined for application as a model for acute contraction-induced phenotypes of skeletal muscle. C2C12 myotubes seeded into 4-well rectangular plates were placed in a contraction system equipped with a carbon electrode at each end. The myotubes were stimulated with electric pulses of 50 V at 1 Hz for 3 ms at 997-ms intervals. Approximately 80% of the myotubes were observed to contract microscopically, and the contractions lasted for at least 3 h with electrical stimulation. Calcium ion (Ca²⁺ transient evoked by the electric pulses was detected fluorescently with Fluo-8. Phosphorylation of protein kinase B/Akt (Akt, 5' AMP-activated protein kinase (AMPK, p38 mitogen-activated protein kinase (p38, and c-Jun NH2-terminal kinase (JNK1/2, which are intracellular signaling proteins typically activated in exercised/contracted skeletal muscle, was observed in the electrically stimulated C2C12 myotubes. The contractions induced by the electric pulses increased glucose uptake and depleted glycogen in the C2C12 myotubes. C2C12 myotubes that differentiated after exogenous gene transfection by a lipofection or an electroporation method retained their normal contractile ability by electrical stimulation. These findings show that our C2C12 cell contraction system reproduces the muscle phenotypes that arise invivo (exercise, in situ (hindlimb muscles in an anesthetized animal, and invitro (dissected muscle tissues in incubation buffer by acute muscle contraction, demonstrating that the system is applicable for the analysis of intracellular events evoked by acute muscle contraction.

  3. Effect of B-site substitution of complex ions on dielectric and piezoelectric properties in (Bi1/2Na1/2)TiO3 piezoelectric ceramics

    International Nuclear Information System (INIS)

    Zhou Changrong; Liu Xinyu

    2008-01-01

    The effect of B-site substitution of complex ions on dielectric and piezoelectric properties in (Bi 1/2 Na 1/2 )Ti 1-x (Zn 1/3 Nb 2/3 ) x O 3 (BNTZN-100x) lead-free piezoelectric ceramics was investigated. X-ray diffraction analysis shows that the materials are mono-perovskite phase. The morphotropic phase boundary (MPB) of BNTZN-100x ceramics between rhombohedral and tetragonal locates in the range of 0.5% ≤ x ≤ 2.0%. Temperature dependence of dielectric constant shows that these compounds are relaxor ferroelectrics. The compositions near the MPB exhibit relatively high piezoelectric properties. The piezoelectric constant (d 33 ) and the electromechanical coupling factor (k t ) show the maximum values of d 33 = 97 pC N -1 and k t = 0.46 at x = 2.0% and x = 1.0%, respectively. The BNTZN-100x ceramics are good candidate for use as ultrasonic transducer ceramics for high anisotropic with high k t value and low k p value

  4. Excitation functions of inelastic and transfer channels in {sup 12} C+{sup 12} C around E{sub c.m.} = 32.5 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Szilner, S.; Basrak, Z.; Freeman, R.M.; Haas, F.; Beck, C. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires]|[Strasbourg-1 Univ., 67 (France); Morsad, A. [Universite Hassan II, Casablanca (Morocco). Faculte des Sciences

    1996-12-31

    A prominent and wide resonance centered at E{sub c.m.} = 32.5 MeV has recently been found in the (0{sub 2}{sup +}, 0{sub 2}{sup +}) inelastic channel of the {sup 12}C+{sup 12}C reaction. It has been suggested that it corresponds to a 6{alpha}-particle-chain state in {sup 24}Mg. In the present work we study {sup 12}C+{sup 12}C excitation functions between center-of-mass energies of 30 and 35 MeV in steps of 250 keV for weakly populated outgoing channels. We present the inelastic channels to the states above the {alpha}-particle decay threshold, (0{sub 1}{sup +},0{sub 2}{sup +}), (0{sub 1}{sup +},3{sub 1}{sup -}), and (0{sub 1}{sup +},4{sub 1}{sup 4}), and the one- and two-nucleon transfer channels. In the inelastic and the transfer channels we observe correlated intermediate-width structures at E{sub c.m.} = 31, 32.5, and 33.5 MeV, whose widths are appreciably smaller than the width measured in the (0{sub 2}{sup +},0{sub 2}{sup +}) channel. Our E{sub c.m.} = 31, 32.5, and 33.5 MeV, whose widths are appreciably smaller than the width measured in the (0{sub 2}{sup +},0{sub 2}{sup +}) channel. Our E{sub c.m.} = 32.5 MeV angular distribution of the (0{sub 1}{sup +},0{sub 2}{sup +})channel exhibits oscillatory behavior and, unlike that of the (0{sup +}{sub 2}, 0{sup +}{sub 2}) channel, does not display enhancement around {Theta}{sub c.m.} = 90 deg. Data were collected via the kinematic coincidence technique. For data reduction we use a novel approach allowing for the extraction of results on non-binary channels. (authors). 39 refs.

  5. Structure and stability of nonstoichiometric cubic phase δ-NbN1.2(O,C)

    International Nuclear Information System (INIS)

    Shalaeva, E.V.; Mitrofanov, B.V.; Shveikin, G.P.

    1996-01-01

    The nonstoichiometric δ-niobium nitride with surplus content of nitrogen atoms and the NaCl-type structure (a=0.439 nm), i.e. δ-NbN 1.2 (O, C), is stabilized in epitaxial deposited films. The diffraction patterns of these films display intensive diffuse scattering with regular intensity vanishings in the form of plane regions in the vicinity of structural and superstructural reciprocal space points of the δ-phase and in the form of spherical surfaces in the neighbourhood of structural points. The analysis performed shows that this scattering can be associated with the presence of mixed-nature short-range order regions in the nonstoichiometric δ-NbN 1.2 (O, C) phase which are characterized by longitudinal uncorrelated atomic displacement waves, as well as by concentration-type waves. The ordered oxycarbonitride phase (X-phase) described in the first approximation by the cubic lattice with parameter a=0.392 nm is found to precipitate when annealing the films at T=873 K. It has been established that the diffuse scattering occurring in δ-NbN 1.2 (O, C) and the structure of short-range order regions exhibit certain correlation with the structure of the precipitated ordered phase - G 100 x ∼1.1G 100 δ = K 1 ; G 010 x ∼1.1G 010 δ = K 2 (where K 1 and K 2 are wave vectors of longitudinal atomic displacement waves characterizing short-range order). (orig.)

  6. The 12C/ 13C isotopic ratio in Titan hydrocarbons from Cassini/CIRS infrared spectra

    Science.gov (United States)

    Nixon, C. A.; Achterberg, R. K.; Vinatier, S.; Bézard, B.; Coustenis, A.; Irwin, P. G. J.; Teanby, N. A.; de Kok, R.; Romani, P. N.; Jennings, D. E.; Bjoraker, G. L.; Flasar, F. M.

    2008-06-01

    We have analyzed infrared spectra of Titan recorded by the Cassini Composite Infrared Spectrometer (CIRS) to measure the isotopic ratio 12C/ 13C in each of three chemical species in Titan's stratosphere: CH 4, C 2H 2 and C 2H 6. This is the first measurement of 12C/ 13C in any C 2 molecule on Titan, and the first measurement of 12CH 4/ 13CH 4 (non-deuterated) on Titan by remote sensing. Our spectra cover five widely-spaced latitudes, 65° S to 71° N and we have searched for both latitude variability of 12C/ 13C within a given species, and also for differences between the 12C/ 13C in the three gases. For CH 4 alone, we find C12/C13=76.6±2.7 (1- σ), essentially in agreement with the 12CH 4/ 13CH 4 measured by the Huygens Gas Chromatograph/Mass Spectrometer instrument (GCMS) [Niemann, H.B., and 17 colleagues, 2005. Nature 438, 779-784]: 82.3±1.0, and also with measured values in H 13CN and 13CH 3D by CIRS at lower precision [Bézard, B., Nixon, C., Kleiner, I., Jennings, D., 2007. Icarus 191, 397-400; Vinatier, S., Bézard, B., Nixon, C., 2007. Icarus 191, 712-721]. For the C 2 species, we find C12/C13=84.8±3.2 in C 2H 2 and 89.8±7.3 in C 2H 6, a possible trend of increasingly value with molecular mass, although these values are both compatible with the Huygens GCMS value to within error bars. There are no convincing trends in latitude. Combining all fifteen measurements, we obtain a value of C12/C13=80.8±2.0, also compatible with GCMS. Therefore, the evidence is mounting that 12C/ 13C is some 8% lower on Titan than on the Earth (88.9, inorganic standard), and lower than typical for the outer planets ( 88±7 [Sada, P.V., McCabe, G.H., Bjoraker, G.L., Jennings, D.E., Reuter, D.C., 1996. Astrophys. J. 472, 903-907]). There is no current model for this enrichment, and we discuss several mechanisms that may be at work.

  7. Role of protein kinase C in regulation of Na+- and K +-dependent ATPase activity and pump function in corneal endothelial cells.

    Science.gov (United States)

    Hatou, Shin; Yamada, Masakazu; Mochizuki, Hiroshi; Nishida, Teruo

    2009-05-01

    Na+- and K+-dependent ATPase (Na,K-ATPase) plays an important role in the pump function of the corneal endothelium. We investigated the possible role of protein kinase C (PKC) in regulation of Na,K-ATPase activity and pump function in corneal endothelial cells. Confluent monolayers of mouse corneal endothelial cells were exposed to phorbol 12,13-dibutyrate (PDBu) to induce activation of PKC. ATPase activity of the cells was evaluated by using ammonium molybdate in spectrophotometric measurement of phosphate released from ATP, with Na,K-ATPase activity being defined as the portion of total ATPase activity sensitive to ouabain. Pump function of the cells was measured with a Ussing chamber, with the pump function attributable to Na,K-ATPase activity being defined as the portion of the total short-circuit current sensitive to ouabain. PDBu (10(-7) M) increased the Na,K-ATPase activity and pump function of the cultured cells. These effects of PDBu were potentiated by the cyclooxygenase inhibitor indomethacin and the cytochrome P(450) inhibitor resorufin and were blocked by okadaic acid, an inhibitor of protein phosphatases 1 and 2A. Our results suggest that PKC bidirectionally regulates Na,K-ATPase activity in mouse corneal endothelial cells: it inhibits Na,K-ATPase activity in a cyclooxygenase- and cytochrome P(450)-dependent manner, whereas it stimulates such activity by activating protein phosphatases 1 or 2A.

  8. Tailoring the piezoelectric and relaxor properties of (Bi1/2 Na1/2) TiO3- BaTiO3 via zirconium doping

    DEFF Research Database (Denmark)

    Glaum, Julia; Simons, Hugh; Acosta, Matias

    2013-01-01

    This article details the influence of zirconium doping on the piezoelectric properties and relaxor characteristics of 94(Bi1/2Na1/2)TiO3-6Ba(ZrxTi1-x)O3 (BNT-6BZT) bulk ceramics. Neutron diffraction measurements of BNT-6BZT doped with 0%-15% Zr revealed an electric-field-induced transition...

  9. Observation of non-statistical structures in the excitation function of the reaction 10B(14N,12C)12C under extreme forward angles

    International Nuclear Information System (INIS)

    Klauss, E.U.

    1984-01-01

    In the present thesis the excitation functions of the reaction 10 B( 14 N, 12 C) 12 C to the ground states, the first excited state at 4.43 MeV (Jsup(π) = 2 1 + ) of a 12 C residual nucleus, and to the double excitation of ejectile and residue nucleus to the 4.43 state are studied. The measurements were performed in an energy range 13MeV 14 N) 0 (in the c.m. system). By a fitting to elastic scattering data the optical potential for 10 B+ 14 N was determined. With this potential it was tried by means of Hauser-Feshbach calculations to calculate the cross sections of the reaction 10 B( 14 N, 12 C) 12 C. The strong 16 + resonance and indications of 18 + in the excitation function of the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 Csub(g.s.) should be pronounced. An unexpected large cross section was observed in the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 C(4 1 + ). This is considered as a further indication to the strong contribution of a direct process. (orig./HSI) [de

  10. Characterizing the astrophysical S factor for 12C+12C fusion with wave-packet dynamics

    Science.gov (United States)

    Diaz-Torres, Alexis; Wiescher, Michael

    2018-05-01

    A quantitative study of the astrophysically important subbarrier fusion of 12C+12C is presented. Low-energy collisions are described in the body-fixed reference frame using wave-packet dynamics within a nuclear molecular picture. A collective Hamiltonian drives the time propagation of the wave packet through the collective potential-energy landscape. The fusion imaginary potential for specific dinuclear configurations is crucial for understanding the appearance of resonances in the fusion cross section. The theoretical subbarrier fusion cross sections explain some observed resonant structures in the astrophysical S factor. These cross sections monotonically decline towards stellar energies. The structures in the data that are not explained are possibly due to cluster effects in the nuclear molecule, which need to be included in the present approach.

  11. Dicty_cDB: AFL314 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration ...NA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, m

  12. Fragmentation of 12C nuclei in emulsion at 50 GeV/c

    International Nuclear Information System (INIS)

    El-Naghy, A.

    1981-01-01

    A total of 852 12 C-emulsion interactions at 4.2 GeV/nucleon was investigated. In 86% of these events, at least one projectile fragment was oberserved in each. The angular distributions of Z = 1,2, and >= 3 projectile fragments are narrow, and the dispersion of the distribution decreases with the increasing of Z. The production cross section of the reaction 12 C + Em → Li (from the projectile) + anything is about 6 x 10 -3 sigmasub(in). Only the projectile-fragmentation events, nsub(h) = O, were studied in detail; the percentage of these events is 10% of the total inelastic events. The events with the maximum probability are those in which α-fragment is the maximum-charged projectile fragment emitted. This indicates that the projectile nuclear structure plays an important role in the fragmentation process. In 1.2% of the total events, 12 C has been dissociated into 3 α-particles. (orig.)

  13. NaSO2Ph Induced Exclusive Isomerization of 1,2-Allenyl Sulfoxides to 2-Alkynylic Phenyl Sulfoxides

    Institute of Scientific and Technical Information of China (English)

    傅春玲; 麻生明

    2005-01-01

    The clean isomerization of 1,2-allenyl sulfoxides in the presence of NaSO2Ph afforded 2-alkynylic phenyl sulfoxides in good yields and selectivities. Although strong base-catalyzed isomerization of allenes to alkynes is known, the mechanism for the current reaction is interesting for the obvious reason that NaSOEPh is a weak base.

  14. The 12C/13C ratio in stellar atmospheres. VI. Five luminous cool stars

    International Nuclear Information System (INIS)

    Hinkle, K.H.; Lambert, D.L.; Snell, R.L.

    1976-01-01

    The isotopic abundance ratio, 12 C/ 13 C, is derived from the CO vibration rotation lines at 1.6 and 2.3 μ for five cool luminous stars by a simple curve-of-growth technique. A new analysis of CN lines at 8000 A is also described for α Sco and α Ori. Results derived independently from CO and CN are in agreement. Final results are 12 C/ 13 C=7 +- 2(α Ori), 12 +- 3(α Sco), 7 +- 3(β Peg), 25 +- 7(chi Cyg), 17 +- 4(α Her), and 7 +- 1.5(α Boo). The α Boo analysis provides a check on the CO curve-of-growth technique; the 12 C/ 13 C ratio from the 2.3 μ CO lines is in good agreement with the previously determined ratio from CN and CH lines

  15. Bonding wood-saxon potential and the mechanism of resonance states in the ''1''2C+''1''2C system

    International Nuclear Information System (INIS)

    Kim, G.; Khaydarov, R.R.

    2001-01-01

    In present work the ''1''2C+''1''2C system are investigated in the realistic Woods--Saxon potential with Coulomb interaction. The comparison of the calculated states with the experimental data has shown, that the observed (identified) resonances may be explained by the single-channel description, i.e., as potential resonances. The quadrupole moments and transition probabilities for low-laying states have been calculated

  16. Cloning of the cDNA for human 12-lipoxygenase

    International Nuclear Information System (INIS)

    Izumi, T.; Hoshiko, S.; Radmark, O.; Samuelsson, B.

    1990-01-01

    A full-length cDNA clone encoding 12-lipoxygenase was isolated from a human platelet cDNA library by using a cDNA for human reticulocyte 15-lipoxygenase as probe for the initial screening. The cDNA had an open reading frame encoding 662 amino acid residues with a calculated molecular weight of 75,590. Three independent clones revealed minor heterogeneities in their DNA sequences. Thus, in three positions of the deduced amino acid sequence, there is a choice between two different amino acids. The deduced sequence from the clone plT3 showed 65% identity with human reticulocyte 15-lipoxygenase and 42% identity with human leukocyte 5-lipoxygenase. The 12-lipoxygenase cDNA recognized a 3.0-kilobase mRNA species in platelets and human erythroleukemia cells (HEL cells). Phorbol 12-tetradecanoyl 13-acetate induced megakaryocytic differentiation of HEL cells and 12-lipoxygenase activity and increased mRNA for 12-lipoxygenase. The identity of the cloned 12-lipoxygenase was assured by expression in a mammalian cell line (COS cells). Human platelet 12-lipoxygenase has been difficult to purify to homogeneity. The cloning of this cDNA will increase the possibilities to elucidate the structure and function of this enzyme

  17. Dicty_cDB: Contig-U14329-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 0.41 3 ( DV113252 ) CV03005B1A12.f1 CV03-normalized library Euphorbia... 32 0.42 3 ( CB610770 ) ALBEDO0002_IaF_C05 Mature...NA non acclimated Bluecrop library Vaccin... 34 0.057 3 ( AL645532 ) Mouse DNA sequence from clone RP23-295E...formis cDNA, cleaving embryo clone:m... 38 0.085 2 ( CF811518 ) NA72 cDNA non acclimated Bluecrop library...TTEAF92THC Tetrahymena thermophila EST library, c... 44 0.22 2 ( AC096661 ) Homo sapiens BAC clone RP11-61G2...4425 ) TTEAV71THB Tetrahymena thermophila EST library, c... 44 0.27 2 ( CQ870098 ) Sequence 519 from Patent

  18. Mudanças na ultra-estrutura da parede celular de mangas 'Tommy Atkins' tratadas com cloreto de cálcio na pré-colheita

    Directory of Open Access Journals (Sweden)

    EVANGELISTA REGINA MARTA

    2002-01-01

    Full Text Available Mangas 'Tommy Atkins' produzidas na região de Ibirá, São Paulo, foram pulverizadas na pré-colheita com cloreto de cálcio, nas concentrações de 0,0%, 2,5% e 5,0%, em três épocas de seu desenvolvimento (40; 60 e 90 dias após a floração a fim de verificar a influência do cálcio na estrutura da parede celular destes frutos através de microscopia eletrônica de transmissão, imediatamente após a colheita e depois de 35 dias de armazenamento. Para fixar o material da polpa, utilizou-se metodologia descrita por Jacob e Gowanlock (1995. Nas condições experimentais, verificou-se que os frutos do tratamento-controle (sem cloreto de cálcio, no dia da colheita, já apresentavam desestruturação da parede celular e dissolução da lamela média (LM. A degradação da parede celular ocorre inicialmente na LM, levando à formação de espaços vazios bastante distintos, apresentando uma dissolução ainda maior, com o armazenamento prolongado (35 dias. Os frutos tratados com cloreto de cálcio a 5,0% apresentaram uma LM bem definida e ausência de espaços vazios, mesmo após o armazenamento, mostrando ser uma concentração efetiva na preservação da lamela média.

  19. Tratamento cognitivo-comportamental de grupo na fobia social: resultados de 12 semanas Cognitive-behavioral group treatment in social phobia: 12-week outcome

    Directory of Open Access Journals (Sweden)

    Gustavo J. Fonseca D'El Rey

    2008-01-01

    Full Text Available CONTEXTO: A fobia social é um dos transtornos mentais mais prevalentes na população geral. A terapia cognitivo-comportamental é o modelo não-farmacológico mais estudado nesse transtorno de ansiedade. OBJETIVOS: Este estudo teve como objetivo verificar a efetividade da terapia cognitivo-comportamental de grupo em pacientes com fobia social generalizada. MÉTODOS: Trinta e um pacientes com diagnóstico de fobia social generalizada foram randomicamente distribuídos em dois grupos: um de terapia cognitivo-comportamental de grupo - TCCG (n = 15 e um grupo-controle na Lista de Espera - LE (n = 16. Os pacientes preencheram quatro escalas de avaliação (Inventário de Fobia Social, Escala de Medo de Avaliação Negativa, Inventário de Ansiedade Beck e Escala de Impressão Clínica Global na semana 1 de tratamento e na semana 12. RESULTADOS: Em todas as medidas de avaliações, ao final de 12 semanas, os pacientes que receberam TCCG apresentaram melhoras superiores aos da LE. CONCLUSÕES: Neste ensaio clínico randomizado, simples-cego, a terapia cognitivo-comportamental de grupo foi superior à Lista de Espera no tratamento da fobia social generalizada.BACKGROUND: Social phobia is a widespread mental disorder in the general population. Cognitive-behavioral therapy is the most thoroughly studied nonpharmacologic approach in this anxiety disorder. OBJECTIVES: The aim of this study is to assess the effectiveness of cognitive-behavioral group therapy in patients with generalized social phobia. METHODS: Thirty one patients with diagnosis of generalized social phobia were randomly allocated in two groups. One group of cognitive-behavioral group therapy - CBGT (n = 15 and one Waiting List control group - WL (n = 16. The patients completed four rating scales (Social Phobia Inventory, Fear of Negative Evaluation Scale, Beck Anxiety Inventory and Clinical Global Impression Scale in the weeks 1 and 12. RESULTS: In all rating scales in the week 12 of

  20. Comparative investigation of the solution species [U(CO3)5]6- and the crystal structure of Na6[U(CO3)5].12H2O.

    Science.gov (United States)

    Hennig, Christoph; Ikeda-Ohno, Atsushi; Emmerling, Fanziska; Kraus, Werner; Bernhard, Gert

    2010-04-21

    The limiting U(IV) carbonate species in aqueous solution was investigated by comparing its structure parameters with those of the complex preserved in a crystal structure. The solution species prevails in aqueous solution of 0.05 M U(IV) and 1 M NaHCO(3) at pH 8.3. Single crystals of Na(6)[U(CO(3))(5)].12H(2)O were obtained directly from this mother solution. The U(IV) carbonate complex in the crystal structure was identified as a monomeric [U(CO(3))(5)](6-) anionic complex. The interatomic distances around the U(IV) coordination polyhedron show average distances of U-O = 2.461(8) A, U-C = 2.912(4) A and U-O(dist) = 4.164(6) A. U L(3)-edge EXAFS spectra were collected from the solid Na(6)[U(CO(3))(5)].12H(2)O and the corresponding solution. The first shell of the Fourier transforms (FTs) revealed, in both samples, a coordination of ten oxygen atoms at an average U-O distance of 2.45 +/- 0.02 A, the second shell originates from five carbon atoms with a U-C distance of 2.91 +/- 0.02 A, and the third shell was fit with single and multiple scattering paths of the distal oxygen at 4.17 +/- 0.02 A. These data indicate the identity of the [U(CO(3))(5)](6-) complex in solid and solution state. The high negative charge of the [U(CO(3))(5)](6-) anion is compensated by Na(+) cations. In solid state the Na(+) cations form a bridging network between the [U(CO(3))(5)](6-) units, while in liquid state the Na(+) cations seem to be located close to the anionic complex. The average metal-oxygen distances of the coordination polyhedron show a linear correlation to the radius contraction of the neighbouring actinide(IV) ions and indicate the equivalence of the [An(CO(3))(5)](6-) coordination within the series of thorium, uranium, neptunium and plutonium.

  1. 13C/12C ratios in human urine concrementes

    International Nuclear Information System (INIS)

    Hoefs, J.; Armbruster, T.

    1978-01-01

    Oxalate, uric acid, and phosphate stones have been analyzed for their carbon isotope composition. The oxalate stones show delta 13 C values between -17.0 and -19.5 pro mille, the uric acid stones between -14.9 and -19.4 pro mille, and the phosphate stones between -13.0 and -23.9 pro mille. It is proposed that endogenic rather than exogenic sources are responsible for the 13 C/ 12 C ratios of the stones. The isotopic composition of the phosphate stones seems to be influenced primarily by bacterial activity. (orig.) [de

  2. Observation of Λ-hypernuclei in the reaction 12C(π+,K+)/sub Λ/12C

    International Nuclear Information System (INIS)

    Milner, E.C.

    1985-12-01

    The observation of Λ-hypernuclear levels in /sub Λ/ 12 C by associated production through the (π + ,K + ) reaction is reported. Spectrometers used in the measurements are discussed. The /sub Λ/ 12 C excitation energy spectra were recorded at laboratory scattering angles of 5.6 0 , 10.3 0 , and 15.2 0 . The spectra show two major peaks - one attributed to the ground state, and one about 11 MeV higher in excitation. The peak near 11 MeV excitation energy is believed to be almost entirely composed of a multiplet of three J/sup π/ = 2 + states. Relativistic DWBA calculations imply support for the expectation that higher spin states are preferentially populated in the (π + ,K + ) reaction, compared to the (K - ,π - ) reaction in which lower spin states are excited. 29 refs., 40 figs

  3. DRAGON, a GPI-anchored membrane protein, inhibits BMP signaling in C2C12 myoblasts.

    Science.gov (United States)

    Kanomata, Kazuhiro; Kokabu, Shoichiro; Nojima, Junya; Fukuda, Toru; Katagiri, Takenobu

    2009-06-01

    Bone morphogenetic proteins (BMPs) induce osteoblastic differentiation of myoblasts via binding to cell surface receptors. Repulsive guidance molecules (RGMs) have been identified as BMP co-receptors. We report here that DRAGON/RGMb, a member of the RGM family, suppressed BMP signaling in C2C12 myoblasts via a novel mechanism. All RGMs were expressed in C2C12 cells that were differentiated into myocytes and osteoblastic cells, but RGMc was not detected in immature cells. In C2C12 cells, only DRAGON suppressed ALP and Id1 promoter activities induced by BMP-4 or by constitutively activated BMP type I receptors. This inhibition by DRAGON was dependent on the secretory form of the von Willbrand factor type D domain. DRAGON even suppressed BMP signaling induced by constitutively activated Smad1. Over-expression of neogenin did not alter the inhibitory capacity of DRAGON. Taken together, these findings indicate that DRAGON may be an inhibitor of BMP signaling in C2C12 myoblasts. We also suggest that a novel molecule(s) expressed on the cell membrane may mediate the signal transduction of DRAGON in order to suppress BMP signaling in C2C12 myoblasts.

  4. From 14C/12C measurements towards radiocarbon dating of ice

    NARCIS (Netherlands)

    Oerlemans, J.; Wal, R.S.W. van de; Roijen, J.J. van; Raynaud, D.; Borg, K. van der; Jong, A.F.M. de; Lipenkov, V.; Huybrechts, P.

    1994-01-01

    A dry extraction method of CO2 included in glacier ice adds a contamination equivalent to 1.8 μg modern carbon for a 35 μg C sample. This enables radiocarbon dating by accelerator mass spectrometry of 35 μg C samples to about 25 000 BP. Measured 14C/12C ratios are presented for a part of the Vostok

  5. Presentación diferencial de ARN mensajeros e identificación del gen selenocisteína liasa en células de carcinoma hepatocelular con expresión transitoria de la proteína core del virus de la hepatitis C.

    Directory of Open Access Journals (Sweden)

    Jesús Orlando Yepes

    2006-06-01

    Full Text Available Introducción. El virus de la hepatitis C se asocia a diversas hepatopatías como hepatitis aguda, hepatitis crónica, esteatosis, cirrosis y carcinoma hepatocelular. Numerosos estudios han explorado mecanismos virales implicados en el establecimiento de la infección persistente y en las propiedades oncogénicas e inmunomoduladoras de la proteína core del virus de la hepatitis C. Las investigaciones orientadas a evaluar los cambios en la expresión de genes celulares endógenos inducidos por la proteína core son importantes para identificar genes candidatos responsables de los mecanismos de patogenicidad del virus de la hepatitis C. Objetivos. Comparar perfiles de expresión e identificar genes celulares endógenos en la línea celular derivada de carcinoma hepatocelular humano, HepG2, con expresión transitoria de la proteína core del virus de la hepatitis C. Materiales y métodos. Se utilizó la técnica de presentación diferencial de ARN mensajero por RT-PCR en células HepG2 con y sin expresión transitoria de la proteína core del virus de la hepatitis C o de la proteína verde fluorescente, obtenidas previamente con el sistema de expresión del Semliki Forest Virus, mediante transducción de partículas recombinantes rSFVCore o rSFV-GFP. Resultados. Se observaron diferencias en las intensidades de las bandas de ARNm expresadas en células HepG2 transducidas con rSFV-Core comparadas con células sin transducir y trasducidas con rSFV-GFP. Un ARNm de 258 pb expresado diferencialmente en células HepG2 transducidas con rSFV-Core fue clonado e identificado como selenocisteína liasa. Conclusión. Los resultados confirman que la expresión de la proteína core del virus de la hepatitis C se asocia con cambios en la expresión de ARN mensajeros específicos, incluido al gen selenocisteina liasa, el cual puede estar involucrado en la fisiopatología del carcinoma hepatocelular.

  6. The differential cross section of the 12C(p,p)12C reaction near the resonance at energy 1.726 MeV

    International Nuclear Information System (INIS)

    Duvanov, S.M.; Kobzev, A.P.

    1996-01-01

    New experimental results on the differential cross section of the 12 C(p,p) 12 C reaction near the separate resonance at 1726 keV were obtained for the 170 deg scattering angle. The cross section measured with a thin target has been used for computer simulation of the spectra measured for a defined initial proton energy for two thick targets. The precision measurements of the proton energies have been carried out using the resonance of 27 Al(p,γ) 28 Si reaction at 1726.0 keV. The energy scale of the excitation function of the 12 C(p,p) 12 C reaction near the resonance at 1726 keV has been defined more exactly. It will improve the precision of depth profiling of carbon in solids. 11 refs., 5 figs., 1 tab

  7. C30F12.4 influences oogenesis, fat metabolism, and lifespan in C. elegans

    Directory of Open Access Journals (Sweden)

    Lu Wang

    2016-09-01

    Full Text Available ABSTRACT Reproduction, fat metabolism, and longevity are intertwined regulatory axes; recent studies in C. elegans have provided evidence that these processes are directly coupled. However, the mechanisms by which they are coupled and the reproductive signals modulating fat metabolism and lifespan are poorly understood. Here, we find that an oogenesis-enriched gene, c30f12.4, is specifically expressed and located in germ cells and early embryos; when the gene is knocked out, oogenesis is disrupted and brood size is decreased. In addition to the reproductive phenotype, we find that the loss of c30f12.4 alters fat metabolism, resulting in decreased fat storage and smaller lipid droplets. Meanwhile, c30f12.4 mutant worms display a shortened lifespan. Our results highlight an important role for c30f12.4 in regulating reproduction, fat homeostasis, and aging in C. elegans, which helps us to better understand the relationship between these processes.

  8. C-12/C-13 Ratio in Ethane on Titan and Implications for Methane's Replenishment

    Science.gov (United States)

    Jennings, Donald E.; Romani, Paul N.; Bjoraker, Gordon L.; Sada, Pedro V.; Nixon, Conor A.; Lunsford, Allen W.; Boyle, Robert J.; Hesman, Brigette E.; McCabe, George H.

    2009-01-01

    The C-12/C-13 abundance ratio in ethane in the atmosphere of Titan has been measured at 822 cm(sup -1) from high spectral resolution ground-based observations. The value 89(8), coincides with the telluric standard and also agrees with the ratio seen in the outer planets. It is almost identical to the result for ethane on Titan found by the composite infrared spectrometer (CIRS) on Cassini. The C-12/C-13 ratio for ethane is higher than the ratio measured in atmospheric methane by Cassini/Huygens GCMS, 82.3(l), representing an enrichment of C-12 in the ethane that might be explained by a kinetic isotope effect of approximately 1.1 in the formation of methyl radicals. If methane is being continuously resupplied to balance photochemical destruction, then we expect the isotopic composition in the ethane product to equilibrate at close to the same C-12/C-13 ratio as that in the supply. The telluric value of the ratio in ethane then implies that the methane reservoir is primordial.

  9. The influence of Na2O on the hydration of C3A II. Suspension hydration

    NARCIS (Netherlands)

    Spierings, G.A.C.M.; Stein, H.N.

    1976-01-01

    The influence of Na2O on the hydration of C3A was studied in suspensions from the start of the reaction onwards. The heat evolution rate in very early stages of the hydration, measured at varying NaOH concentrations, and SEM, indicate that at NaOH concentrations larger then 0.1 M the reaction

  10. Altered sensitivity of system A amino acid transport to ouabain in normal and transformed C3H-10T1/2 cells during the cell cycle

    International Nuclear Information System (INIS)

    Leister, K.J.; Schenerman, M.A.; Racker, E.

    1989-01-01

    Quiescent C3H-10T1/2 mouse fibroblasts that have not undergone any type of stress have a relatively low rate of 2-aminoisobutyrate (Aib) uptake by means of system A, which is primarily energized by the transmembrane Na + chemical gradient potential. System A activity in these cells is not sensitive to ouabain or proton ionophores. In contrast, methylcholanthrene-transformed and cofluent C3H-10T1/2 cells treated with ouabain utilize the membrane potential generated by the Na + , K + -ATPase pump to drive Aib transport by means of system A as shown by the sensitivity of transport activity to ouabain and proton ionophores. Since glucose is present during the assay, the proton ionophores do not affect the availability of ATP, as indicated by the undiminished uptake of 86 Rb + by the Na + , K + -ATPase pump. As cells progress through the G 1 phase of the cell cycle, they show an increased system A activity prior to entry into the S phase, which is also dependent on the electrogenicity of the Na + , K + -ATPase pump. There appears to be in all these cases a qualitative shift in the bioenergetic mechanism for the uptake of Aib as well as a marked quantitative increase in Aib uptake. The high activity after ouabain treatment was sustained in the transformed cells after removal of the ouabain, whereas in the confluent 10T1/2 cells the rate of uptake decayed rapidly, suggesting a difference in the mode of regulation. The authors conclude that transformed cells and normal cells in late G 1 or under stress make use of the membrane potential generated by the Na + , K + -ATPase pump to drive amino acid uptake by means of system A

  11. IGF-1 prevents simvastatin-induced myotoxicity in C2C12 myotubes.

    Science.gov (United States)

    Bonifacio, Annalisa; Sanvee, Gerda M; Brecht, Karin; Kratschmar, Denise V; Odermatt, Alex; Bouitbir, Jamal; Krähenbühl, Stephan

    2017-05-01

    Statins are generally well tolerated, but treatment with these drugs may be associated with myopathy. The mechanisms of statin-associated myopathy are not completely understood. Statins inhibit AKT phosphorylation by an unclear mechanism, whereas insulin-like growth factor (IGF-1) activates the IGF-1/AKT signaling pathway and promotes muscle growth. The aims of the study were to investigate mechanisms of impaired AKT phosphorylation by simvastatin and to assess effects of IGF-1 on simvastatin-induced myotoxicity in C2C12 myotubes. C2C12 mouse myotubes were exposed to 10 μM simvastatin and/or 10 ng/mL IGF-1 for 18 h. Simvastatin inhibited the IGF-1/AKT signaling pathway, resulting in increased breakdown of myofibrillar proteins, impaired protein synthesis and increased apoptosis. Simvastatin inhibited AKT S473 phosphorylation, indicating reduced activity of mTORC2. In addition, simvastatin impaired stimulation of AKT T308 phosphorylation by IGF-1, indicating reduced activation of the IGF-1R/PI3K pathway by IGF-1. Nevertheless, simvastatin-induced myotoxicity could be at least partially prevented by IGF-1. The protective effects of IGF-1 were mediated by activation of the IGF-1R/AKT signaling cascade. Treatment with IGF-1 also suppressed muscle atrophy markers, restored protein synthesis and inhibited apoptosis. These results were confirmed by normalization of myotube morphology and protein content of C2C12 cells exposed to simvastatin and treated with IGF-1. In conclusion, impaired activity of AKT can be explained by reduced function of mTORC2 and of the IGF-1R/PI3K pathway. IGF-1 can prevent simvastatin-associated cytotoxicity and metabolic effects on C2C12 cells. The study gives insight into mechanisms of simvastatin-associated myotoxicity and provides potential targets for therapeutic intervention.

  12. Cobalt triggers necrotic cell death and atrophy in skeletal C2C12 myotubes

    International Nuclear Information System (INIS)

    Rovetta, Francesca; Stacchiotti, Alessandra; Faggi, Fiorella; Catalani, Simona; Apostoli, Pietro; Fanzani, Alessandro; Aleo, Maria Francesca

    2013-01-01

    Severe poisoning has recently been diagnosed in humans having hip implants composed of cobalt–chrome alloys due to the release of particulate wear debris on polyethylene and ceramic implants which stimulates macrophagic infiltration and destroys bone and soft tissue, leading to neurological, sensorial and muscular impairments. Consistent with this premise, in this study, we focused on the mechanisms underlying the toxicity of Co(II) ions on skeletal muscle using mouse skeletal C2C12 myotubes as an in vitro model. As detected using propidium iodide incorporation, increasing CoCl 2 doses (from 5 to 200 μM) affected the viability of C2C12 myotubes, mainly by cell necrosis, which was attenuated by necrostatin-1, an inhibitor of the necroptotic branch of the death domain receptor signaling pathway. On the other hand, apoptosis was hardly detectable as supported by the lack of caspase-3 and -8 activation, the latter resulting in only faint activation after exposure to higher CoCl 2 doses for prolonged time points. Furthermore, CoCl 2 treatment resulted in atrophy of the C2C12 myotubes which was characterized by the increased expression of HSP25 and GRP94 stress proteins and other typical 'pro-atrophic molecular hallmarks, such as early activation of the NF-kB pathway and down-regulation of AKT phosphorylation, followed by the activation of the proteasome and autophagy systems. Overall, these results suggested that cobalt may impact skeletal muscle homeostasis as an inducer of cell necrosis and myofiber atrophy. - Highlights: • The effects of cobalt on muscle myofibers in vitro were investigated. • Cobalt treatment mainly causes cell necrosis in skeletal C2C12 myotubes. • Cobalt impacts the PI3K/AKT and NFkB pathways and induces cell stress markers. • Cobalt induces atrophy of C2C12 myotubes through the activation of proteasome and autophagy systems. • Co treatment triggers NF-kB and PI3K/AKT pathways in C2C12 myotubes

  13. Cobalt triggers necrotic cell death and atrophy in skeletal C2C12 myotubes

    Energy Technology Data Exchange (ETDEWEB)

    Rovetta, Francesca [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy); Stacchiotti, Alessandra [Institute of Human Anatomy, Department of Clinical and Experimental Sciences, University of Brescia, Brescia I-25123 (Italy); Faggi, Fiorella [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy); Catalani, Simona; Apostoli, Pietro [Unit of Occupational Health and Industrial Hygiene, Department of Medical and Surgical Specialties, Radiological Sciences and Public Health, University of Brescia, Brescia I-25123 (Italy); Fanzani, Alessandro, E-mail: fanzani@med.unibs.it [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy); Aleo, Maria Francesca, E-mail: aleo@med.unibs.it [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy)

    2013-09-01

    Severe poisoning has recently been diagnosed in humans having hip implants composed of cobalt–chrome alloys due to the release of particulate wear debris on polyethylene and ceramic implants which stimulates macrophagic infiltration and destroys bone and soft tissue, leading to neurological, sensorial and muscular impairments. Consistent with this premise, in this study, we focused on the mechanisms underlying the toxicity of Co(II) ions on skeletal muscle using mouse skeletal C2C12 myotubes as an in vitro model. As detected using propidium iodide incorporation, increasing CoCl{sub 2} doses (from 5 to 200 μM) affected the viability of C2C12 myotubes, mainly by cell necrosis, which was attenuated by necrostatin-1, an inhibitor of the necroptotic branch of the death domain receptor signaling pathway. On the other hand, apoptosis was hardly detectable as supported by the lack of caspase-3 and -8 activation, the latter resulting in only faint activation after exposure to higher CoCl{sub 2} doses for prolonged time points. Furthermore, CoCl{sub 2} treatment resulted in atrophy of the C2C12 myotubes which was characterized by the increased expression of HSP25 and GRP94 stress proteins and other typical 'pro-atrophic molecular hallmarks, such as early activation of the NF-kB pathway and down-regulation of AKT phosphorylation, followed by the activation of the proteasome and autophagy systems. Overall, these results suggested that cobalt may impact skeletal muscle homeostasis as an inducer of cell necrosis and myofiber atrophy. - Highlights: • The effects of cobalt on muscle myofibers in vitro were investigated. • Cobalt treatment mainly causes cell necrosis in skeletal C2C12 myotubes. • Cobalt impacts the PI3K/AKT and NFkB pathways and induces cell stress markers. • Cobalt induces atrophy of C2C12 myotubes through the activation of proteasome and autophagy systems. • Co treatment triggers NF-kB and PI3K/AKT pathways in C2C12 myotubes.

  14. Graphene-Based Patterning and Differentiation of C2C12 Myoblasts

    DEFF Research Database (Denmark)

    Bajaj, Piyush; Rivera, Jose A; Marchwiany, Daniel

    2014-01-01

    This study aims at generating highly aligned functional myotubes using graphene as the underlying scaffold. Graphene not only supports the growth of C2C12 muscle cells but also enhances its differentiation and leads to spontaneous patterning of myotubes....

  15. 3D organic Na4C6O6/graphene architecture for fast sodium storage with ultralong cycle life.

    Science.gov (United States)

    Gu, Jianan; Gu, Yue; Yang, Shubin

    2017-11-23

    Sodium-ion batteries (SIBs) have aroused increasing interest as one of the most promising replacements for lithium-ion batteries (LIBs). Here, a novel organic-inorganic 3D Na 4 C 6 O 6 -graphene architecture was successfully fabricated from commercial Na 2 C 6 O 6 and for the first time applied for sodium storage. Hence, the 3D Na 4 C 6 O 6 -graphene architecture exhibits a high reversible capacity, good cyclic performance and high-rate capability for sodium storage.

  16. Reação de bis-inserção de 1,2-difenilacetileno na ligação Pd-C de ciclometalados Bis insertion reaction of 1,2-diphenylacetilene into Pd-C bond of cyclometallated species

    Directory of Open Access Journals (Sweden)

    Sandra Regina Ananias

    2003-01-01

    Full Text Available The present paper deals with the bis-insertion reactions of 1,2-diphenylacetylene into Pd-C bond of the cyclopalladated complexes [Pd(dmba(µ-NCO]2 (1 and [Pd(dmba(MeCN2](NO3 (2 (dmba = N,N-dimethylbenzylamine, MeCN = acetonitrile. Two new complexes [Pd{PhC=CPh-CPh=CPhC6H4CH2N(CH 32}(NCO] (3 and [Pd{PhC=CPh-CPh=CPhC6H4CH2N(CH 32}(NO3 ] (4 were obtained and characterized by IR and NMR spectroscopy and elemental analysis.

  17. Measurements of $$\\pi ^\\pm $$ π ± , K $$^\\pm $$ ± , p and $${\\bar{\\text {p}}}$$ p ¯ spectra in proton-proton interactions at 20, 31, 40, 80 and 158  $$\\text{ GeV }/c$$ GeV / c with the NA61/SHINE spectrometer at the CERN SPS: The NA61/SHINE Collaboration

    Energy Technology Data Exchange (ETDEWEB)

    Aduszkiewicz, A.; Ali, Y.; Andronov, E.; Antićić, T.; Baatar, B.; Baszczyk, M.; Bhosale, S.; Blondel, A.; Bogomilov, M.; Brandin, A.; Bravar, A.; Brzychczyk, J.; Bunyatov, S. A.; Busygina, O.; Cherif, H.; Ćirković, M.; Czopowicz, T.; Damyanova, A.; Davis, N.; Dembinski, H.; Deveaux, M.; Dominik, W.; Dorosz, P.; Dumarchez, J.; Engel, R.; Ereditato, A.; Feofilov, G. A.; Fodor, Z.; Francois, C.; Garibov, A.; Gaździcki, M.; Golubeva, M.; Grebieszkow, K.; Guber, F.; Haesler, A.; Hervé, A. E.; Hylen, J.; Igolkin, S.; Ivashkin, A.; Johnson, S. R.; Kadija, K.; Kaptur, E.; Kiełbowicz, M.; Kireyeu, V. A.; Klochkov, V.; Knezević, N.; Kolesnikov, V. I.; Kolev, D.; Kondratiev, V. P.; Korzenev, A.; Kovalenko, V.; Kowalik, K.; Kowalski, S.; Koziel, M.; Krasnoperov, A.; Kucewicz, W.; Kuich, M.; Kurepin, A.; Larsen, D.; László, A.; Lewicki, M.; Lundberg, B.; Lyubushkin, V. V.; Łysakowski, B.; Maćkowiak-Pawłowska, M.; Maksiak, B.; Malakhov, A. I.; Manić, D.; Marchionni, A.; Marcinek, A.; Marino, A. D.; Marton, K.; Mathes, H. -J.; Matulewicz, T.; Matveev, V.; Melkumov, G. L.; Merzlaya, A.; Messerly, B.; Mik, Ł.; Mills, G. B.; Morozov, S.; Mrówczyński, S.; Nagai, Y.; Naskręt, M.; Ozvenchuk, V.; Paolone, V.; Pavin, M.; Petukhov, O.; Pistillo, C.; Płaneta, R.; Podlaski, P.; Popov, B. A.; Posiadała, M.; Puławski, S.; Puzović, J.; Rameika, R.; Rauch, W.; Ravonel, M.; Renfordt, R.; Richter-Wąs, E.; Röhrich, D.; Rondio, E.; Roth, M.; Rumberger, B. T.; Rustamov, A.; Rybczynski, M.; Rybicki, A.; Sadovsky, A.; Schmidt, K.; Selyuzhenkov, I.; Seryakov, A.; Seyboth, P.; Słodkowski, M.; Snoch, A.; Staszel, P.; Stefanek, G.; Stepaniak, J.; Strikhanov, M.; Ströbele, H.; Šuša, T.; Szuba, M.; Taranenko, A.; Tefelska, A.; Tefelski, D.; Tereshchenko, V.; Toia, A.; Tsenov, R.; Turko, L.; Ulrich, R.; Unger, M.; Veberič, D.; Vechernin, V. V.; Vesztergombi, G.; Vinogradov, L.; Walewski, M.; Wickremasinghe, A.; Wilkinson, C.; Włodarczyk, Z.; Wojtaszek-Szwarc, A.; Wyszyński, O.; Zambelli, L.; Zimmerman, E. D.; Zwaska, R.

    2017-10-01

    Measurements of inclusive spectra and mean multiplicities of $\\pi^\\pm$, K$^\\pm$, p and $\\bar{\\textrm{p}}$ produced in inelastic p+p interactions at incident projectile momenta of 20, 31, 40, 80 and 158 GeV/c ($\\sqrt{s} = $ 6.3, 7.7, 8.8, 12.3 and 17.3 GeV, respectively) were performed at the CERN Super Proton Synchrotron using the large acceptance NA61/SHINE hadron spectrometer. Spectra are presented as function of rapidity and transverse momentum and are compared to predictions of current models. The measurements serve as the baseline in the NA61/SHINE study of the properties of the onset of deconfinement and search for the critical point of strongly interacting matter.

  18. Characterization of starter-free Queso Fresco made with sodium-potassium salt blends over 12 weeks of 4°C storage.

    Science.gov (United States)

    Van Hekken, D L; Tunick, M H; Renye, J A; Tomasula, P M

    2017-07-01

    Development of reduced-sodium cheese to meet the demands of consumers concerned about sodium levels in their diet is challenging when a high-moisture, higher pH, fresh cheese, such as Queso Fresco (QF), depends on its NaCl salt content to obtain its signature flavor and quality traits. This study evaluated the effects of different Na-K salt blends on the compositional, sensorial, microbial, functional, and rheological properties of QF stored for up to 12 wk at 4°C. Queso Fresco curd from each vat was divided into 6 portions and salted with different blends of NaCl-KCl (Na-K, %): 0.75-0.75, 1.0-0.5, 1.0-1.0, 1.0-1.3, 1.0-1.5, and 2.0-0 (control). Within this narrow salt range (1.5 to 2.5% total salt), the moisture, protein, fat, and lactose levels; water activity; pH; and the textural and rheological properties were not affected by salt treatment or aging. The total salt, sodium, potassium, and ash contents reflected the different Na-K ratios added to the QF. Total aerobic microbial count, overall proteolysis, the release of casein phosphopeptides, and the level of volatile compounds were affected by aging but not by the salt treatment. Only the 1.0-1.3 and 1.0-1.5 Na-K cheeses had sensory saltiness scores similar to that of the 2.0-0 Na-K control QF. Loss of free serum from the cheese matrix increased steadily over the 12 wk, with higher losses found in QF containing 1.5% total salt compared with the higher Na-K blends. In conclusion, KCl substitution is a viable means for reduction of sodium in QF resulting in only minor differences in the quality traits, and levels of 1.0-1.3 and 1.0-1.5 Na-K are recommended to match the saltiness intensity of the 2.0-0 Na-K control. The findings from this study will aid cheese producers in creating reduced-sodium QF for health-conscious consumers. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  19. Giant strain with low cycling degradation in Ta-doped [Bi_1_/_2(Na_0_._8K_0_._2)_1_/_2]TiO_3 lead-free ceramics

    International Nuclear Information System (INIS)

    Liu, Xiaoming; Tan, Xiaoli

    2016-01-01

    Non-textured polycrystalline [Bi_1_/_2(Na_0_._8K_0_._2)_1_/_2](Ti_1_−_xTa_x)O_3 ceramics are fabricated and their microstructures and electrical properties are characterized. Transmission electron microscopy reveals the coexistence of the rhombohedral R3c and tetragonal P4bm phases in the form of nanometer-sized domains in [Bi_1_/_2(Na_0_._8K_0_._2)_1_/_2]TiO_3 with low Ta concentration. When the composition is x = 0.015, the electrostrain is found to be highly asymmetric under bipolar fields of ±50 kV/cm. A very large value of 0.62% is observed in this ceramic, corresponding to a large-signal piezoelectric coefficient d_3_3* of 1240 pm/V (1120 pm/V under unipolar loading). These values are greater than most previously reported lead-free polycrystalline ceramics and can even be compared with some lead-free piezoelectric single crystals. Additionally, this ceramic displays low cycling degradation; its electrostrain remains above 0.55% even after undergoing 10 000 cycles of ±50 kV/cm bipolar fields at 2 Hz. Therefore, Ta-doped [Bi_1_/_2(Na_0_._8K_0_._2)_1_/_2]TiO_3 ceramics show great potential for large displacement devices.

  20. BAMBI Promotes C2C12 Myogenic Differentiation by Enhancing Wnt/β-Catenin Signaling

    Directory of Open Access Journals (Sweden)

    Qiangling Zhang

    2015-08-01

    Full Text Available Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI is regarded as an essential regulator of cell proliferation and differentiation that represses transforming growth factor-β and enhances Wnt/β-catenin signaling in various cell types. However, its role in skeletal muscle remains largely unknown. In the current study, we found that the expression level of BAMBI peaked in the early differentiation phase of the C2C12 rodent myoblast cell line. Knockdown of BAMBI via siRNA inhibited C2C12 differentiation, indicated by repressed MyoD, MyoG, and MyHC expression as well as reductions in the differentiation and fusion indices. BAMBI knockdown reduced the activity of Wnt/β-catenin signaling, as characterized by the decreased nuclear translocation of β-catenin and the lowered transcription of Axin2, which is a well-documented target gene of the Wnt/β-catenin signaling pathway. Furthermore, treatment with LiCl, an activator of Wnt/β-catenin signaling, rescued the reduction in C2C12 differentiation caused by BAMBI siRNA. Taken together, our data suggest that BAMBI is required for normal C2C12 differentiation, and that its role in myogenesis is mediated by the Wnt/β-catenin pathway.

  1. Ultrafine Nanocrystalline CeO2@C-Containing NaAlH4 with Fast Kinetics and Good Reversibility for Hydrogen Storage.

    Science.gov (United States)

    Zhang, Xin; Liu, Yongfeng; Wang, Ke; Li, You; Gao, Mingxia; Pan, Hongge

    2015-12-21

    A nanocrystalline CeO2@C-containing NaAlH4 composite is successfully synthesized in situ by hydrogenating a NaH-Al mixture doped with CeO2@C. Compared with NaAlH4 , the as-prepared CeO2@C-containing NaAlH4 composite, with a minor amount of excess Al, exhibits significantly improved hydrogen storage properties. The dehydrogenation onset temperature of the hydrogenated [NaH-Al-7 wt % CeO2@C]-0.04Al sample is 77 °C lower than that of the pristine sample because of a reduced kinetic barrier. More importantly, the dehydrogenated sample absorbs ∼4.7 wt % hydrogen within 35 min at 100°C and 10 MPa of hydrogen. Compositional and structural analyses reveal that CeO2 is converted to CeH2 during ball milling and that the newly formed CeH2 works with the excess of Al to synergistically improve the hydrogen storage properties of NaAlH4. Our findings will aid in the rational design of novel catalyst-doped complex hydride systems with low operating temperatures, fast kinetics, and long-term cyclability. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. 17 CFR 240.15c1-2 - Fraud and misrepresentation.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...

  3. Dicty_cDB: Contig-U16090-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available us leaf cDNA library Populus tremul... 46 6e-04 2 ( BJ279262 ) Triticum aesti... USDA-FP_186955 Lysiphlebus testaceipes adult whol... 50 1e-09 4 ( AL115000 ) Botrytis cinerea strain T4 cDNA library...-12 2 ( AL115390 ) Botrytis cinerea strain T4 cDNA library. 66 1e-12 2 ( EH017168 ) USDA-FP_182606 Lysiphlebus testaceipes adult...NA... 52 5e-08 2 ( BI127108 ) I086P23P Populus leaf cDNA library Populus tremul.....hophyton rubrum cDNA library 8 Tric... 48 6e-04 2 ( FC653988 ) CAXW13373.rev CAXW Lotti

  4. Preparation and characterization of carbon/SiC nanowire/Na-doped carbonated hydroxyapatite multilayer coating for carbon/carbon composites

    International Nuclear Information System (INIS)

    Leilei, Zhang; Hejun, Li; Kezhi, Li; Shouyang, Zhang; Qiangang, Fu; Yulei, Zhang; Jinhua, Lu; Wei, Li

    2014-01-01

    Highlights: • CSH coatings were prepared by combination of magnetron sputter ion plating, CVD and UECD. • Na + and CO 3 2− were developed to co-substitute hydroxyapatite. • SiC nanowires were introduced into Na-doped carbonated hydroxyapatite. • CSH coatings showed excellent cell activity and cell proliferation behavior. - Abstract: A carbon/SiC nanowire/Na-doped carbonated hydroxyapatite multilayer coating (CSH coating) was prepared on carbon/carbon composites using a combination method of magnetron sputter ion plating, chemical vapor deposition and ultrasound-assisted electrochemical deposition procedure. The morphology, microstructure and chemical composition of the coating were investigated by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), Raman spectroscopy and X-ray photoelectron spectroscopy (XPS). The results showed that the CSH coating was consisted of three components: carbon layer, SiC nanowires and Na-doped carbonated hydroxyapatite. The carbon layer provided a dense and uniform surface structure for the growth of SiC nanowires. The SiC nanowires exhibited a porous structure, favoring the infiltration of Na-doped carbonated hydroxyapatite crystals. The Na-doped carbonated hydroxyapatite could infiltrate into the pores of SiC nanowires and finally cover the SiC nanowires entirely with a needle shape. The osteoblast-like MG63 cells were employed to assess the in vitro biocompatibility of the CSH coating. The MG63 cells favorably spread and grew well across the CSH coating surface with plenty of filopods and microvilli, exhibiting excellent cell activity. Moreover, the CSH coating elicited higher cell proliferation as compared to bare carbon/carbon composites. In conclusion, the CSH offers great potential as a coating material for future medical application in hard tissue replacement

  5. Preparation and characterization of carbon/SiC nanowire/Na-doped carbonated hydroxyapatite multilayer coating for carbon/carbon composites

    Energy Technology Data Exchange (ETDEWEB)

    Leilei, Zhang, E-mail: zhangleilei1121@aliyun.com; Hejun, Li; Kezhi, Li; Shouyang, Zhang; Qiangang, Fu; Yulei, Zhang; Jinhua, Lu; Wei, Li

    2014-09-15

    Highlights: • CSH coatings were prepared by combination of magnetron sputter ion plating, CVD and UECD. • Na{sup +} and CO{sub 3}{sup 2−} were developed to co-substitute hydroxyapatite. • SiC nanowires were introduced into Na-doped carbonated hydroxyapatite. • CSH coatings showed excellent cell activity and cell proliferation behavior. - Abstract: A carbon/SiC nanowire/Na-doped carbonated hydroxyapatite multilayer coating (CSH coating) was prepared on carbon/carbon composites using a combination method of magnetron sputter ion plating, chemical vapor deposition and ultrasound-assisted electrochemical deposition procedure. The morphology, microstructure and chemical composition of the coating were investigated by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), Raman spectroscopy and X-ray photoelectron spectroscopy (XPS). The results showed that the CSH coating was consisted of three components: carbon layer, SiC nanowires and Na-doped carbonated hydroxyapatite. The carbon layer provided a dense and uniform surface structure for the growth of SiC nanowires. The SiC nanowires exhibited a porous structure, favoring the infiltration of Na-doped carbonated hydroxyapatite crystals. The Na-doped carbonated hydroxyapatite could infiltrate into the pores of SiC nanowires and finally cover the SiC nanowires entirely with a needle shape. The osteoblast-like MG63 cells were employed to assess the in vitro biocompatibility of the CSH coating. The MG63 cells favorably spread and grew well across the CSH coating surface with plenty of filopods and microvilli, exhibiting excellent cell activity. Moreover, the CSH coating elicited higher cell proliferation as compared to bare carbon/carbon composites. In conclusion, the CSH offers great potential as a coating material for future medical application in hard tissue replacement.

  6. TU-C-12A-12: Differentiating Bone Lesions and Degenerative Joint Disease in NaF PET/CT Scans Using Machine Learning

    Energy Technology Data Exchange (ETDEWEB)

    Perk, T; Bradshaw, T; Muzahir, S; Jeraj, R [University of Wisconsin, Madison, Wisconsin (United States); Meyer, E [Case Western Reserve University School of Medicine, Cleveland, Ohio (United States)

    2014-06-15

    Purpose: [F-18]NaF PET can be used to image bone metastases; however, tracer uptake in degenerative joint disease (DJD) often appears similar to metastases. This study aims to develop and compare different machine learning algorithms to automatically identify regions of [F-18]NaF scans that correspond to DJD. Methods: 10 metastatic prostate cancer patients received whole body [F-18]NaF PET/CT scans prior to treatment. Image segmentation resulted in 852 ROIs, 69 of which were identified by a nuclear medicine physician as DJD. For all ROIs, various PET and CT textural features were computed. ROIs were divided into training and testing sets used to train eight different machine learning classifiers. Classifiers were evaluated based on receiver operating characteristics area under the curve (AUC), sensitivity, specificity, and positive predictive value (PPV). We also assessed the added value of including CT features in addition to PET features for training classifiers. Results: The training set consisted of 37 DJD ROIs with 475 non-DJD ROIs, and the testing set consisted of 32 DJD ROIs with 308 non-DJD ROIs. Of all classifiers, generalized linear models (GLM), decision forests (DF), and support vector machines (SVM) had the best performance. AUCs of GLM (0.929), DF (0.921), and SVM (0.889) were significantly higher than the other models (p<0.001). GLM and DF, overall, had the best sensitivity, specificity, and PPV, and gave a significantly better performance (p<0.01) than all other models. PET/CT GLM classifiers had higher AUC than just PET or just CT. GLMs built using PET/CT information had superior or comparable sensitivities, specificities and PPVs to just PET or just CT. Conclusion: Machine learning algorithms trained with PET/CT features were able to identify some cases of DJD. GLM outperformed the other classification algorithms. Using PET and CT information together was shown to be superior to using PET or CT features alone. Research supported by the Prostate

  7. TU-C-12A-12: Differentiating Bone Lesions and Degenerative Joint Disease in NaF PET/CT Scans Using Machine Learning

    International Nuclear Information System (INIS)

    Perk, T; Bradshaw, T; Muzahir, S; Jeraj, R; Meyer, E

    2014-01-01

    Purpose: [F-18]NaF PET can be used to image bone metastases; however, tracer uptake in degenerative joint disease (DJD) often appears similar to metastases. This study aims to develop and compare different machine learning algorithms to automatically identify regions of [F-18]NaF scans that correspond to DJD. Methods: 10 metastatic prostate cancer patients received whole body [F-18]NaF PET/CT scans prior to treatment. Image segmentation resulted in 852 ROIs, 69 of which were identified by a nuclear medicine physician as DJD. For all ROIs, various PET and CT textural features were computed. ROIs were divided into training and testing sets used to train eight different machine learning classifiers. Classifiers were evaluated based on receiver operating characteristics area under the curve (AUC), sensitivity, specificity, and positive predictive value (PPV). We also assessed the added value of including CT features in addition to PET features for training classifiers. Results: The training set consisted of 37 DJD ROIs with 475 non-DJD ROIs, and the testing set consisted of 32 DJD ROIs with 308 non-DJD ROIs. Of all classifiers, generalized linear models (GLM), decision forests (DF), and support vector machines (SVM) had the best performance. AUCs of GLM (0.929), DF (0.921), and SVM (0.889) were significantly higher than the other models (p<0.001). GLM and DF, overall, had the best sensitivity, specificity, and PPV, and gave a significantly better performance (p<0.01) than all other models. PET/CT GLM classifiers had higher AUC than just PET or just CT. GLMs built using PET/CT information had superior or comparable sensitivities, specificities and PPVs to just PET or just CT. Conclusion: Machine learning algorithms trained with PET/CT features were able to identify some cases of DJD. GLM outperformed the other classification algorithms. Using PET and CT information together was shown to be superior to using PET or CT features alone. Research supported by the Prostate

  8. 29 CFR 779.504 - The retailer and section 12(c).

    Science.gov (United States)

    2010-07-01

    ... Child Labor Provisions § 779.504 The retailer and section 12(c). Section 12(c) was amended in 1961 to prohibit the employment of oppressive child labor in any enterprise engaged in commerce or in the... comply with section 12(c) of the child labor provisions of the Act. As stated in § 779.503, compliance...

  9. Produção de isomaltulose a partir da transformação enzimática da sacarose, utilizando-se Erwinia sp D12 imobilizada com alginato de cálcio Production of isomaltulose from enzymatic transformation of sucrose, using Erwinia sp D12 immobilized with calcium alginate

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Leite Moraes

    2005-03-01

    Full Text Available A glicosiltransferase de Erwinia sp D12 é capaz de converter a sacarose em isomaltulose (6-o-alfa-glicopiranosil D-frutofuranose, um açúcar alternativo que apresenta baixo potencial cariogênico, e que pode ser utilizado em chocolates, gomas de mascar e balas. A isomaltulose é também utilizada na produção de isomalte, uma mistura de açúcar álcool, de baixo valor calórico e baixo potencial cariogênico. No estudo da influência dos componentes do meio de cultivo, na produção de glicosiltransferase, em frascos agitados, foi obtido maior atividade da enzima (12,8 unidades de atividade/mL do meio de cultura em meio de cultura A constituído de melaço 12% (p/v de sólidos solúveis totais, peptona 4% (p/v e extrato de carne 0,4% (p/v. No estudo do efeito do tempo e da temperatura na fermentação da linhagem de Erwinia sp D12, em fermentador New Brunswick de 3L, contendo meio de cultura A, foi obtida maior atividade de glicosiltransferase (15,6 unidades de atividade/ mL de meio de cultura na fase exponencial de crescimento após 8 horas de fermentação a 30ºC. Na produção de isomaltulose a partir da sacarose utilizando-se células de Erwinia sp D12 imobilizadas em alginato de cálcio, estudou-se o efeito da temperatura (25 - 35ºC e da concentração de substrato (12,5 - 60% p/v. Foi obtido um rendimento em torno de 50% de isomaltulose, com soluções de sacarose entre 20-30% (p/v a 35ºC. Concentrações em excesso de sacarose (ao redor de 40% p/v afetaram a atividade da célula imobilizada, diminuindo a conversão de sacarose em isomaltulose. O xarope de isomaltulose foi purificado através de cromatografia de troca iônica e o eluato cristalizado por abaixamento de temperatura. Os cristais apresentaram 91,39% de isomaltulose.The glucosyltransferase of Erwinia sp D12 is able to convert sucrose into isomaltulose (6-0-alpha-D-glucopyranosyl-D-fructofuranose, an alternative sugar which presents low cariogenic potential, and can be

  10. Cluster correlation effects in 12C+12C and 14N+10B fusion-evaporation reactions

    Directory of Open Access Journals (Sweden)

    Morelli L.

    2015-01-01

    Full Text Available The decay of highly excited states of 24Mg is studied in fusion evaporation events completely detected in charge in the reactions 12C+12C and 14N+10B at 95 and 80 MeV incident energy respectively. The comparison of light charged particles measured spectra with statistical model predictions suggests that the dominant reaction mechanism is compound nucleus (CN formation and decay. However, in both reactions, a discrepancy with statistical expectations is found for α particles detected in coincidence with Carbon, Oxigen and Neon residues. The comparison between the two reactions shows that this discrepancy is only partly explained by an entrance channel effect. Evidence for cluster correlations in excited 24Mg CN is suggested by the comparison between the measured and calculated branching ratios for the channels involving α particles.

  11. Excited states of 12C above the alpha-decay threshold

    International Nuclear Information System (INIS)

    Freer, M; Ashwood, N I; Barr, M; Curtis, N; Malcolm, J D; Wheldon, C; Ziman, V A; Almaraz-Calderon, S; Aprahamian, A; Bucher, B; Couder, M; Fang, X; Jung, F; Lu, W; Roberts, A; Tan, W P; Copp, P; Lesher, S

    2011-01-01

    The excitation energy spectrum of 12 C is important for both structural and astrophysical reasons; here we present evidence for a new state in 12 C. The two reactions 12 C( 4 He, 4 He+ 4 He+ 4 He) 4 He and 9 Be( 4 He, 4 He+ 4 He+ 4 He)n were measured using an array of four double sided strip detectors. Excited states in 12 C were reconstructed filtered by the condition that the alpha-decay proceeded via the 8 Be ground-state. In both measurements evidence was found for a new state at 13.3(0.2) MeV with a width 1.7(0.2) MeV. Angular correlation measurements from the 12 C( 4 He, 4 He+ 4 He+ 4 He) 4 He reaction indicates that the state may have J π = 4 + .

  12. Effect of Sodium Chloride and pH on Enterotoxin C Production

    Science.gov (United States)

    Genigeorgis, Constantin; Foda, Mohamed S.; Mantis, Antony; Sadler, Walter W.

    1971-01-01

    Growth and production of enterotoxin C by Staphylococcus aureus strain 137 in 3% + 3% protein hydrolysate powder N-Z Amine NAK broths with 0 to 12% NaCl and an initial pH of 4.00 to 9.83 were studied during an 8-day incubation period at 37 C. Growth was initiated at pH values as low as 4.00 and as high as 9.83 at 0% salt level as long as the inoculum contained at least 108 cells per ml. Rate of growth decreased as the NaCl concentration was increased gradually to 12%. Enterotoxin C was produced in broths inoculated with 108 cells per ml and above and having initial pH ranges of 4.00 to 9.83, 4.40 to 9.43, 4.50 to 8.55 and respective NaCl concentrations of 0, 4, and 8%. In the presence of 10% NaCl, the pH range supporting enterotoxin C production was 5.45 to 7.30 for an inoculum level of 108 cells per ml and 6.38 to 7.30 for 3.6 × 106 cells per ml. In repeated experiments in which the inoculum contained 108 cells per ml, we failed to demonstrate enterotoxin C production in broths with 12% NaCl and a pH range of 4.50 to 8.55 and concentrated up to 14 times. The effect of NaCl on enterotoxin C production followed the same pattern as its effect on enterotoxin B production. As the concentration of NaCl increased from 0 to 10%, yields of enterotoxin B and C decreased to undetectable amounts. PMID:5574320

  13. Effect of curcumin Extract on Ttranslocation of Glut 4 in C2C12 Myotubes

    Directory of Open Access Journals (Sweden)

    J Zavarreza

    2013-06-01

    Full Text Available Introduction: Curcumin is a major phenolic compound of Curcuma longa, which has long been used in traditional Indian medicine. Recently, curcumin has been reported to have antihyperglycemic activity in animal models. However, the molecular basis of this action has not been adequatedly described. In the present study the antihyperglycemic effect of curcumin was examined using C2C12 myoblast cells. Methods: The effects of curcumin were investigated in C2C12 myotubes by treating the cells with 40 µM of curcumin for 1.5 h. C2C12 myotubes were homogenized and the subcellular fractionation was prepared using ultracentrifugation; Then protein assay was performed using Bradford method and Glut4 determination was done using SDS-PAGE. Moreover, western immunoblotting techniques were exerted for semi-quantitative measurement. Data analysis was performed via gene tools software of Gel documentation and SPSS. An ANOVA test was used to compare three groups together. Results: Comparison of Glut4 levels in C2C12 myotubes showed that myotubes which were exposed to1.5 hours of 40 µM curcunin had higher Glut4 percentages in both cytosolic and membrane fractions and Glut4 percentages were significant with a confidence interval (CI of 95% ( P<0.05 . Conclusion: The study results showed that curcumin can strongly induce the increase of Glut4 translocation in differentiated C2C12 cells, indicating its possible regulatory role in the glucose metabolism of skeletal muscle cells

  14. Magnitude of 14C/12C variations based on archaeological samples

    International Nuclear Information System (INIS)

    Kusumgar, S.; Agrawal, D.P.

    1977-01-01

    The magnitude of 14 C/ 12 C variations in the period A.D. 5O0 to 200 B.C. and 370 B.C. to 2900 B.C. is discussed. The 14 C dates of well-dated archaeological samples from India and Egypt do not show any significant divergence from the historical ages. On the other hand, the corrections based on dendrochronological samples show marked deviations for the same time period. A plea is, therefore, made to study old tree samples from Anatolia and Irish bogs and archaeological samples from west Asia to arrive at a more realistic calibration curve. (author)

  15. Effect of NaCl on thermophilic (55°C) methanol degradation in sulfate reducing granular sludge reactors

    NARCIS (Netherlands)

    Vallero, M.V.G.; Hulshoff Pol, L.W.; Lettinga, G.; Lens, P.N.L.

    2003-01-01

    The effect of NaCl on thermophilic (55degreesC) methanol conversion in the presence of excess of sulfate (COD/SO42-=0.5) was investigated in two 6.5L lab-scale upflow anaerobic sludge bed reactors inoculated with granular sludge previously not adapted to NaCl
    The effect of NaCl on thermophilic

  16. 12C-12C total and reaction cross-section between 6 and 85 MeV/A from an optical model analysis

    International Nuclear Information System (INIS)

    Brandan, M.E.

    1982-07-01

    Values of σsub(R) and σsub(T) are obtained from an optical model analysis of 12 C- 12 C elastic scattering data between 6 and 85 MeV/A. They confirm the general trends predicted by DeVries and collaborators but show discrepancies at the region of the maxima. The o.m. analysis indicates a significant decrease of the real potential strength with energy

  17. Getting started with Oracle WebLogic Server 12c developer's guide

    CERN Document Server

    Nunes, Fabio Mazanatti

    2013-01-01

    Getting Started with Oracle WebLogic Server 12c is a fast-paced and feature-packed book, designed to get you working with Java EE 6, JDK 7 and Oracle WebLogic Server 12c straight away, so start developing your own applications.Getting Started with Oracle WebLogic Server 12c: Developer's Guide is written for developers who are just getting started, or who have some experience, with Java EE who want to learn how to develop for and use Oracle WebLogic Server. Getting Started with Oracle WebLogic Server 12c: Developer's Guide also provides a great overview of the updated features of the 12c releas

  18. Combined activity of post-exercise concentrations of NA and eHsp72 on human neutrophil function: role of cAMP.

    Science.gov (United States)

    Giraldo, Esther; Hinchado, María D; Ortega, Eduardo

    2013-09-01

    Extracellular heat shock proteins of 72 kDa (eHsp72) and noradrenaline (NA) can act as "danger signals" during exercise-induced stress by activating neutrophil function (chemotaxis, phagocytosis, and fungicidal capacity). In addition, post-exercise concentrations of NA increase the expression and release of Hsp72 by human neutrophils, and adrenoreceptors and cAMP are involved in the stimulation of neutrophils by eHsp72. This suggests an interaction between the two molecules in the modulation of neutrophils during exercise-induced stress. Given this context, the aim of the present investigation was to study the combined activity of post-exercise circulating concentrations of NA and eHsp72 on the neutrophil phagocytic process, and to evaluate the role of cAMP as intracellular signal in these effects. Results showed an accumulative stimulation of chemotaxis induced by NA and eHsp72. However, while NA and eHsp72, separately, stimulate the phagocytosis and fungicidal activity of neutrophils, when they act together they do not modify these capacities of neutrophils. Similarly, post-exercise concentrations of NA and eHsp72 separately increased the intracellular level of cAMP, but NA and eHsp72 acting together did not modify the intracellular concentration of cAMP. These results confirm that cAMP can be involved in the autocrine/paracrine physiological regulation of phagocytosis and fungicidal capacity of human neutrophils mediated by NA and eHsp72 in the context of exercise-induced stress. Copyright © 2013 Wiley Periodicals, Inc.

  19. Passivity of alloy C-22 in NaCl solutions

    International Nuclear Information System (INIS)

    Rodriguez, Martin A.; Carranza, Ricardo M.

    2004-01-01

    Alloy C-22 has been proposed as the corrosion resistant barrier of high-level waste nuclear containers. This alloy must be resistant to corrosion in multi-ionic solutions for a period of time as long as 10,000 years. The aim of the present work was to study the corrosion behavior of alloy C-22 in NaCl solutions. General and crevice corrosion were studied by means of electrochemical techniques. Open circuit potential was measured over the time, electrochemical impedance spectroscopy (EIS) measurements were carried out at open circuit and passivity potentials, as well as cyclic potentiodynamic polarization curves. Corrosion rates obtained by EIS measurements were acceptable for a waste nuclear container ( P ) values increased with open circuit potential and polarization time at constant potential. This was attributed to an increase in oxide film thickness and its aging respectively. The passive oxide form on alloy C-22 at the studied conditions presented a n-type semiconductor behavior in the passive potential range. Repassivation potential values (E R1 ) were determined for alloy C-22 at the studied conditions using PCA probes. (author) [es

  20. EFEITO DA DESIDRATAÇÃO FOAM MAT NA RETENÇÃO DA VITAMINA C DA POLPA DE CAJAMANGA

    Directory of Open Access Journals (Sweden)

    Caroline Alves BREDA

    2013-04-01

    Full Text Available O objetivo do trabalho foi avaliar o efeito da desidratação foam mat na retenção da vitamina C em polpa de cajamanga. A polpa de cajamanga foi elaborada a partir de quatro formulações utilizando três agentes espumantes combinados em diferentes concentrações: 1 pectina cítrica, 2 produto à base de monoglicerídeos destilados, monoestearato de sorbitana e polissorbato 60 (Emustab e 3 produto à base de sacarose, carboximetilcelulose e goma guar (Super Liga Neutra. A composição proximal e o conteúdo de vitamina C foram determinados na polpa fresca e nas polpas desidratadas obtidas a partir das formulações. Os resultados mostraram que a adição de agentes espumantes favoreceu ao incremento de açúcares e fibras na polpa desidratada. Os agentes formadores de espuma influenciaram na retenção da vitamina C. A polpa desidratada contendo 1,5% de Emustab e 1,0% de pectina obteve maior retenção da vitamina (28,55%.

  1. Apoptosis in differentiating C2C12 muscle cells selectively targets Bcl-2-deficient myotubes

    Science.gov (United States)

    Schoneich, Christian; Dremina, Elena; Galeva, Nadezhda; Sharov, Victor

    2014-01-01

    Muscle cell apoptosis accompanies normal muscle development and regeneration, as well as degenerative diseases and aging. C2C12 murine myoblast cells represent a common model to study muscle differentiation. Though it was already shown that myogenic differentiation of C2C12 cells is accompanied by enhanced apoptosis in a fraction of cells, either the cell population sensitive to apoptosis or regulatory mechanisms for the apoptotic response are unclear so far. In the current study we characterize apoptotic phenotypes of different types of C2C12 cells at all stages of differentiation, and report here that myotubes of differentiated C2C12 cells with low levels of anti-apoptotic Bcl-2 expression are particularly vulnerable to apoptosis even though they are displaying low levels of pro-apoptotic proteins Bax, Bak and Bad. In contrast, reserve cells exhibit higher levels of Bcl-2 and high resistance to apoptosis. The transfection of proliferating myoblasts with Bcl-2 prior to differentiation did not protect against spontaneous apoptosis accompanying differentiation of C2C12 cell but led to Bcl-2 overexpression in myotubes and to significant protection from apoptotic cell loss caused by exposure to hydrogen peroxide. Overall, our data advocate for a Bcl-2-dependent mechanism of apoptosis in differentiated muscle cells. However, downstream processes for spontaneous and hydrogen peroxide induced apoptosis are not completely similar. Apoptosis in differentiating myoblasts and myotubes is regulated not through interaction of Bcl-2 with pro-apoptotic Bcl-2 family proteins such as Bax, Bak, and Bad. PMID:24129924

  2. Electrochemical preparation of carbon films with a Mo{sub 2}C interlayer in LiCl-NaCl-Na{sub 2}CO{sub 3} melts

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Jianbang; Wang, Shuai; Zhang, Feng; Zhang, Long; Jiao, Handong [State Key Laboratory of Advanced Metallurgy, University of Science and Technology Beijing, Beijing, 100083 (China); Zhu, Hongmin [Department of Metallurgy, Materials Science, and Materials Processing, Tohoku University, Sendai 980-8579 (Japan); Jiao, Shuqiang, E-mail: sjiao@ustb.edu.cn [State Key Laboratory of Advanced Metallurgy, University of Science and Technology Beijing, Beijing, 100083 (China)

    2015-08-30

    Highlights: • The electrodeposition of carbon films with a Mo{sub 2}C interlayer. • Carbon diffusion engenders the formation of Mo{sub 2}C interlayer. • The Mo{sub 2}C interlayer has a good adhesion. - Abstract: The electrodeposition of carbon films with a Mo{sub 2}C interlayer was investigated in LiCl-NaCl-Na{sub 2}CO{sub 3} melts at 900 °C. Cyclic voltammetry was applied to study the electrochemical reaction mechanism on Mo and Pt electrodes, indicating that, two reduction reactions including carbon deposition and carbon monoxide evolution, may take place on the two electrodes simultaneously during the cathodic sweep. Carbon films with a continuous Mo{sub 2}C interlayer were prepared by constant voltage electrolysis, showing a good adhesion between Mo substrate and carbon films. The carbon films with a Mo{sub 2}C interlayer were characterized using X-ray diffraction measurement, Raman spectroscopy, scanning electron microscopy and transmission electron microscopy. The results reveal that carbon materials deposited on the electrodes are mainly composed of graphite and carbon diffusion in Mo (or Mo{sub 2}C) leads to the formation and growth of Mo{sub 2}C interlayer.

  3. Influence exothermical mixtures contents Na or B on elongation and hardness AlSi12 alloy

    Directory of Open Access Journals (Sweden)

    T. Lipiński

    2008-04-01

    Full Text Available The experiments were conducted on alloy AlSi12, following a factor design 23 for 3 independent variables. Mixtures composed of NaNO3, Na2B4O7, and Mg were used for alloy treatment. The amount of a reducing agent (Mg necessary to carry out the process was calculated on the basis of chemical reactions. The mass fraction (weight in weight concentration of individual variables is presented in Table 1. Results of study present by graphical forms. Figures 2-8 present until elongation (A5 and Brinell hardness (HB for each variable, at extreme (lower or higher levels of the other two.

  4. α+12C rotational bands in 16O

    Directory of Open Access Journals (Sweden)

    Katsuma M.

    2014-03-01

    Full Text Available The total quantum number N of the α+12C rotational bands in 16O is determined by a study of α+12C elastic scattering. The 8+ and 9− states are found around the excitation energy Ex = 30 MeV and they are the member of the known rotational bands. At the same time, the 02+ state (Ex = 6.05 MeV is found to be dominated by N = 8.

  5. Neutron Scattering Differential Cross Sections for 12C

    Science.gov (United States)

    Byrd, Stephen T.; Hicks, S. F.; Nickel, M. T.; Block, S. G.; Peters, E. E.; Ramirez, A. P. D.; Mukhopadhyay, S.; McEllistrem, M. T.; Yates, S. W.; Vanhoy, J. R.

    2016-09-01

    Because of the prevalence of its use in the nuclear energy industry and for our overall understanding of the interactions of neutrons with matter, accurately determining the effects of fast neutrons scattering from 12C is important. Previously measured 12C inelastic neutron scattering differential cross sections found in the National Nuclear Data Center (NNDC) show significant discrepancies (>30%). Seeking to resolve these discrepancies, neutron inelastic and elastic scattering differential cross sections for 12C were measured at the University of Kentucky Acceleratory Laboratory for incident neutron energies of 5.58, 5.83, and 6.04 MeV. Quasi mono-energetic neutrons were scattered off an enriched 12C target (>99.99%) and detected by a C6D6 liquid scintillation detector. Time-of-flight (TOF) techniques were used to determine scattered neutron energies and allowed for elastic/inelastic scattering distinction. Relative detector efficiencies were determined through direct measurements of neutrons produced by the 2H(d,n) and 3H(p,n) source reactions, and absolute normalization factors were found by comparing 1H scattering measurements to accepted NNDC values. This experimental procedure has been successfully used for prior neutron scattering measurements and seems well-suited to our current objective. Significant challenges were encountered, however, with measuring the neutron detector efficiency over the broad incident neutron energy range required for these measurements. Funding for this research was provided by the National Nuclear Security Administration (NNSA).

  6. Electron paramagnetic resonance of Na, [(FeEDTA)2oJ-12H20] crystal electrons

    International Nuclear Information System (INIS)

    Esquivel, Darci Motta de Souza

    1974-01-01

    Crystals of Na [(Fe EDTA) 2 o] ·12H 2 0 were investigated by means of electron paramagnetic resonance spectroscopy. The spectra were obtained at various temperatures and crystals orientations. These spectra are very complex with many absorption bands. As the crystal orientation with respect to the magnetic field was changed the variations of the intensity and number of bands were recorded. The antiferromagnetic coupling between the iron atoms in the bridge Fe - 0 - Fe gives rise to states with total spin quantum number S= 0, 1, 2, 3, 4 and 5. Analyses of the EPR spectra as a function of temperature provided a means for the identification of the EPR absorption bands attributed to the states with S = 2. It was also possible to calculate the exchange parameter value J = 300 K. From the study of bands angular dependence in relation to the crystal orientation in the magnetic field it was found that the magnetic crystal axes X, Y, Z and the crystals axes a, b, c are related as (a, b, c) = (Y, Z, X) ! with a precision of 5 deg. Also the crystalline distortion parameters were calculated D = 0.21 ± 0.02 cm 1 ; E = 0.015 ± 0.005 cm 1 . (author)

  7. 12C(d,p) 13C reaction at Esub(d) = 30 MeV to the positive-parity states in 13C

    International Nuclear Information System (INIS)

    Ohnuma, H.; Hoshino, N.; Mikoshiba, O.

    1985-07-01

    The 12 C(d, p) 13 C reaction has been studied at Esub(d) = 30 MeV. All the known positive-parity states of 13 C below 10 MeV in excitation energy, including the 7/2 + and 9/2 + states, are observed in this reaction. The angular distributions for these positive-parity bound and unbound states are analyzed in CCBA frame work. The 13 C wave functions, which reproduce the resonant and non-resonant scattering of neutrons from 12 C, also give good accounts of the experimentally observed angular distributions and energy spectra of outgoing protons in the 12 C(d, p) 13 C reaction. In most cases the cross section magnitude and the angular distribution shape are primarily determined by the 0 + x j component, even if it is only a small fraction of the total wave function. An exception is the 7/2 + state, where the main contribution comes from the 2 + x dsub(5/2) component. The inclusion of the 4 + state in 12 C and the gsub(9/2) and gsub(7/2) neutron components in the n + 12 C system has very small effects on the low-spin states, but is indispensable for a good fit to the 7/2 + and 9/2 + angular distributions. The transitions to the negative-parity states, 1/2 1 - , 3/2 1 - , 5/2 - , 7/2 - and 1/2 3 - , are also observed experimentally, and analyzed by DWBA. (author)

  8. Potent and Selective Covalent Quinazoline Inhibitors of KRAS G12C

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, Mei; Lu, Jia; Li, Lianbo; Feru, Frederic; Quan, Chunshan; Gero, Thomas W.; Ficarro, Scott B.; Xiong, Yuan; Ambrogio, Chiara; Paranal, Raymond M.; Catalano, Marco; Shao, Jay; Wong, Kwok-Kin; Marto, Jarrod A.; Fischer, Eric S.; Jänne, Pasi A.; Scott, David A.; Westover, Kenneth D.; Gray, Nathanael S. (DFCI); (UTSMC); (Harvard-Med); (NYUSM)

    2017-08-01

    Targeted covalent small molecules have shown promise for cancers driven by KRAS G12C. Allosteric compounds that access an inducible pocket formed by movement of a dynamic structural element in KRAS, switch II, have been reported, but these compounds require further optimization to enable their advancement into clinical development. We demonstrate that covalent quinazoline-based switch II pocket (SIIP) compounds effectively suppress GTP loading of KRAS G12C, MAPK phosphorylation, and the growth of cancer cells harboring G12C. Notably we find that adding an amide substituent to the quinazoline scaffold allows additional interactions with KRAS G12C, and remarkably increases the labeling efficiency, potency, and selectivity of KRAS G12C inhibitors. Structural studies using X-ray crystallography reveal a new conformation of SIIP and key interactions made by substituents located at the quinazoline 2-, 4-, and 7-positions. Optimized lead compounds in the quinazoline series selectively inhibit KRAS G12C-dependent signaling and cancer cell growth at sub-micromolar concentrations.

  9. Effects of repulsive three-body force in 12C + 12C scattering at 100A MeV

    Directory of Open Access Journals (Sweden)

    W.W. Qu

    2015-12-01

    Full Text Available The angular distribution of 12C + 12C scattering at an incident energy of 100A MeV has been measured. The elastic and inelastic scatterings in 12C to the excitation energies of up to ∼45 MeV were measured simultaneously for the first time with the high-resolution Grand Raiden spectrometer at the Research Center for Nuclear Physics (RCNP. The angular distributions of the elastic scattering to the ground state (01+ and inelastic scattering to the 4.44 MeV (21+ excited state were precisely obtained in the angular range of 1.0°–7.5° with a step of 0.1°. Additionally, the angular distribution was obtained for the sum of the cross sections for excitation energies above the 4.44 MeV state up to 11 MeV, which includes the 7.65 MeV (02+, 9.64 MeV (31−, and 10.30 MeV (22+ states, in addition to probably the simultaneous excitation of the 4.44 MeV state in the projectile and the target nuclei. Those combined data provide a means to study the effects of channel coupling on the elastic cross section. The observed angular distributions are compared with theoretical calculations based on three double-folding models with complex G-matrix interactions, the CEG07b, MPa, and ESC models. The importance of three-body repulsive forces included in the CEG07b and MPa models will be discussed.

  10. Estudo do efeito da colostomia proximal terminal na cicatrização de anastomoses colo-cólicas em ratos

    Directory of Open Access Journals (Sweden)

    Leme Marcelo Betim Paes

    2002-01-01

    Full Text Available OBJETIVO: Estudar os efeitos da colostomia proximal terminal na cicatrização de anastomoses colo-cólicas em ratos. MÉTODOS: 36 ratas foram divididas em 2 grupos: grupo controle (C com 12 animais submetidos à ressecção cólica segmentar seguida de anastomose colo-cólica primária, e grupo colostomizado (CZ com 24 animais submetidos ao mesmo procedimento do grupo C complementado com uma colostomia proximal. A cicatrização anastomótica foi avaliada em dois períodos distintos, 2º e 7º dias de pós-operatório (PO, em relação à deiscência anastomótica, aderências, epitelização mucosa, pressão de ruptura e variáveis histológicas. Os resultados foram submetidos a estudo estatístico considerando-se como significante valores de p<0,05. RESULTADOS: A deiscência, principal variável analisada nessa pesquisa, não ocorreu em ambos os grupos estudados. As aderências foram significantemente mais intensas no grupo C no 7º PO. Nos dois grupos, a ruptura intestinal sempre ocorreu ao nível da anastomose no 2º PO; no 7º PO, a maior parte das rupturas aconteceram na alça cólica fora da zona anastomótica (100% do grupo C e 70% do grupo CZ. A análise das demais variáveis demonstrou equivalência entre os dois grupos. CONCLUSÃO: Os resultados dessa pesquisa não demonstraram diferença significante entre anastomoses colo-cólicas em ratos associados ou não à colostomia proximal.

  11. Suplementação de vitaminas na prevenção de câncer

    Directory of Open Access Journals (Sweden)

    SILVA Cyntia Rosa de Melo

    2001-01-01

    Full Text Available Este trabalho constitui uma revisão de dados epidemiológicos sobre a relação entre o consumo de vitaminas e prevenção de câncer. Estudos observacionais evidenciam uma associação inversa consistente entre a ingestão de frutas e hortaliças e risco de câncer, e um efeito protetor das vitaminas C, E e dos carotenóides contra certos tipos de câncer. Resultados de estudos de intervenção, na prevenção primária de câncer, são contraditórios, sendo que em dois desses estudos o beta-caroteno, suplementado em doses consideradas farmacológicas, isolado ou associado à vitamina E ou à vitamina A, mostrou-se deletério para tabagistas. Ao contrário, a ingestão de doses mais fisiológicas de antioxidantes parece ser mais eficaz, sendo que a ação sinérgica dessas substâncias na quimioprevenção de câncer já foi demonstrada tanto em modelo in vivo de carcinogênese quanto em estudo epidemiológico de intervenção. Como estratégia de prevenção de câncer preconiza-se o consumo de dietas ricas em frutas e hortaliças, que aportem cerca de 150 mg de vitamina C, 30 mg de vitamina E e 4 mg de carotenóides. A ingestão de quantidades mais elevadas, na forma de suplementos, não está recomendada.

  12. Spinal instrumentation for unstable C1-2 injury.

    Science.gov (United States)

    Mizuno, J; Nakagawa, H

    1999-06-01

    Seventeen patients with unstable C1-2 injuries were treated between 1990 and 1997. Various methods of instrumentation surgery were performed in 16 patients, excluding a case of atlantoaxial rotatory fixation. Posterior stabilization was carried out in 14 cases using Halifax interlaminar clamp, Sof'wire or Danek cable, or more recently, transarticular screws. Transodontoid anterior screw fixation was performed in four cases of odontoid process fractures, with posterior instrumentation in two cases because of malunion. Rigid internal fixation by instrumentation surgery for the unstable C1-2 injury avoids long-term application of a Halo brace and facilitates early rehabilitation. However, the procedure is technically demanding with the risk of neural and vascular injuries, particularly with posterior screw fixation. Sagittal reconstruction of thin-sliced computed tomography scans at the C1-2 region, neuronavigator, and intraoperative fluoroscopy are essential to allow preoperative surgical planning and intraoperative guidance.

  13. The reaction 12C + 12C at bombarding energies from 5 to 10 MeV per nucleon

    International Nuclear Information System (INIS)

    Morsad, A.

    1986-01-01

    The reaction 12 C + 12 C has been studied for energies ranging from E LAB = 60 to 120 MeV. The excitation functions and angular distributions were obtained for the elastic (0 + , 0 + ) and inelastic (2 + , 0 + ), (2 + , 2 + ) channels as well as for the transfer channels of one and two nucleons. For the transfer reactions, the feeding of the final bound states was very selective. Narrow correlated structures were found in the transfer and especially in the elastic and inelastic channels. In this energy range, there appears to be a transition from surface transparency to interference phenomena. The optical model in its simplest form is unable to describe the elastic scattering at large angles. This has been interpreted as a consequence of the coupling between the elastic and inelastic channels which is particularly strong of these energies. 80 refs [fr

  14. Hepatite C: prevalência e fatores de risco entre portadores do VIH/SIDA em Belém, Pará, na Amazônia brasileira

    Directory of Open Access Journals (Sweden)

    Maria Rita de Cassia Costa Monteiro

    2004-01-01

    Full Text Available Este trabalho objetivou investigar a prevalência de infecção pelo vírus da hepatite C e identificar possíveis fatores de risco para sua transmissão, em 406 indivíduos portadores do vírus da imunodeficiência humana, maiores de dezoito anos de idade, atendidos na rede pública de saúde da cidade de Belém, Pará, situada na Amazônia brasileira. Os exames referentes ao anti-VHC foram realizados pelo método de Elisa e a pesquisa do VHC RNA através da reação de polimerase em cadeia. A prevalência de infecção, atual ou pregressa, pelo vírus da hepatite C foi de 16% (IC: 12,4 - 19,6. A análise multivariada mostrou associação do vírus C com as variáveis idade, cujo risco significante recaiu no grupo com cinqüenta ou mais anos (OR=9,75, antecedente de transfusão de sangue (OR=4,74 e uso de droga ilícita injetável (OR=149,28. A prevalência do vírus da hepatite C entre os usuários de drogas injetáveis foi de 83,7% e de 22,1% na população de transfundidos. Estes resultados indicam a efetiva transmissão do vírus C através da exposição percutânea e reafirmam o grande potencial de risco para hepatite C contido no uso injetável de drogas ilícitas.

  15. 40 CFR 721.10007 - Alcohols, C12-14-secondary, ethoxylated propoxylated.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Alcohols, C12-14-secondary... New Uses for Specific Chemical Substances § 721.10007 Alcohols, C12-14-secondary, ethoxylated... identified as alcohols, C12-14- secondary, ethoxylated propoxylated (PMN P-00-11; CAS No. 103331-86-8) is...

  16. Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18

    Directory of Open Access Journals (Sweden)

    R. F. Weiss

    2012-05-01

    Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.

  17. [The calix[4]arene C-107 is highly effective supramolecular inhibitor of the Na+,K(+)-ATPase of plasma membranes].

    Science.gov (United States)

    Bevza, O V; Veklich, T O; Shkrabak, O A; Rodik, R V; Kal'chenko, V I; Kosterin, S O

    2013-01-01

    The inhibition of the Na+,K(+)-ATPase activity of the myometrium cell plasma membranes with calixarene C-107 (5,17-diamino(2-pyridyl) methylphosphono-11,23-di-tret-butyl-26,28-dihydroxy-25,27-dipropoxycalix[4]arene) was investigated. It has been shown that calixarene C-107 reduced the Na+,K(+)-ATPase activity more efficiently than ouabain did, while it did not practically influence the "basal" Mg(2+)-ATPase activity of the same membrane. The magnitude of the cofficient of inhibition I0.5 was 33 +/- 4 nM, Hill coefficient was 0.38 +/- 0.06. The model calixarene C-150--the calixarene "scaffold" (26,28-dihydroxy-25,27-dipropoxycalix[4]arene), and the model compound M-3 (4-hydroxyaniline(2-pyridine)methylphosphonic acid)--a fragment of the calixarene C-107, had practically no influence on the enzymatic activity of Na+,K(+)-ATPase and Mg(2+)-ATPase. We carried out the computer simulation of interaction of calixarenes C-107 and the mentioned model compound with ligand binding sites of the Na+,K(+)-ATPase of plasma membrane and structure foundation of their intermolecular interaction was found out. The participation of hydrogen, hydrophobic, electrostatic and pi-pi (stacking) interaction between calixarene and enzyme aminoacid residues, some of which are located near the active center of Na+,K(+)-ATPase, was discussed.

  18. Sub-optimal vitamin B-12 levels among ART-naïve HIV-positive individuals in an urban cohort in Uganda.

    Science.gov (United States)

    Semeere, Aggrey S; Nakanjako, Damalie; Ddungu, Henry; Kambugu, Andrew; Manabe, Yukari C; Colebunders, Robert

    2012-01-01

    Malnutrition is common among HIV-infected individuals and is often accompanied by low serum levels of micronutrients. Vitamin B-12 deficiency has been associated with various factors including faster HIV disease progression and CD4 depletion in resource-rich settings. To describe prevalence and factors associated with sub-optimal vitamin B-12 levels among HIV-infected antiretroviral therapy (ART) naïve adults in a resource-poor setting, we performed a cross-sectional study with a retrospective chart review among individuals attending either the Mulago-Mbarara teaching hospitals' Joint AIDS Program (MJAP) or the Infectious Diseases Institute (IDI) clinics, in Kampala, Uganda. Logistic regression was used to determine factors associated with sub-optimal vitamin B-12. The mean vitamin B-12 level was 384 pg/ml, normal range (200-900). Sub-optimal vitamin B-12 levels (ART (CD4ART-naïve adult clinic population in urban Uganda. We recommend prospective studies to further clarify the causal relationships of sub-optimal vitamin B-12, and explore the role of vitamin B-12 supplementation in immune recovery.

  19. Hierarchical domain structure of lead-free piezoelectric (Na{sub 1/2} Bi{sub 1/2})TiO{sub 3}-(K{sub 1/2} Bi{sub 1/2})TiO{sub 3} single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Chengtao, E-mail: lchentao@vt.edu; Wang, Yaojin; Ge, Wenwei; Li, Jiefang; Viehland, Dwight [Materials Science and Engineering, Virginia Tech, Blacksburg, Virginia 24061 (United States); Delaire, Olivier [Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Li, Xiaobin; Luo, Haosu [Shanghai Institute of Ceramics, Chinese Academy of Sciences, 215 Chengbei Road, Jiading, Shanghai 201800 (China)

    2016-05-07

    We report a unique hierarchical domain structure in single crystals of (Na{sub 1/2}Bi{sub 1/2})TiO{sub 3}-xat. %(K{sub 1/2}Bi{sub 1/2})TiO{sub 3} for x = 5 and 8 by transmission electron microscopy (TEM). A high density of polar nano-domains with a lamellar morphology was found, which were self-assembled into a quadrant-like configuration, which then assembled into conventional ferroelectric macro-domains. Studies by high resolution TEM revealed that the polar lamellar regions contained a coexistence of in-phase and anti-phase oxygen octahedral tilt regions of a few nanometers in size. Domain frustration over multiple length scales may play an important role in the stabilization of the hierarchy, and in reducing the piezoelectric response of this Pb-free piezoelectric solid solution.

  20. Activated Integrin-Linked Kinase Negatively Regulates Muscle Cell Enhancement Factor 2C in C2C12 Cells

    Directory of Open Access Journals (Sweden)

    Zhenguo Dong

    2015-01-01

    Full Text Available Our previous study reported that muscle cell enhancement factor 2C (MEF2C was fully activated after inhibition of the phosphorylation activity of integrin-linked kinase (ILK in the skeletal muscle cells of goats. It enhanced the binding of promoter or enhancer of transcription factor related to proliferation of muscle cells and then regulated the expression of these genes. In the present investigation, we explored whether ILK activation depended on PI3K to regulate the phosphorylation and transcriptional activity of MEF2C during C2C12 cell proliferation. We inhibited PI3K activity in C2C12 with LY294002 and then found that ILK phosphorylation levels and MEF2C phosphorylation were decreased and that MCK mRNA expression was suppressed significantly. After inhibiting ILK phosphorylation activity with Cpd22 and ILK-shRNA, we found MEF2C phosphorylation activity and MCK mRNA expression were increased extremely significantly. In the presence of Cpd22, PI3K activity inhibition increased MEF2C phosphorylation and MCK mRNA expression indistinctively. We conclude that ILK negatively and independently of PI3K regulated MEF2C phosphorylation activity and MCK mRNA expression in C2C12 cells. The results provide new ideas for the study of classical signaling pathway of PI3K-ILK-related proteins and transcription factors.

  1. Homocisteína, acido fólico y vitamina B12 en adultos mayores venezolanos

    OpenAIRE

    Meertens G, Lesbia; Díaz W, Nayka; Solano R, Liseti; Baron, Maria Adela; Rodríguez M, Adelmo

    2007-01-01

    Los cambios anatomo-fisiológicos propios del envejecimiento hacen de los adultos mayores un grupo vulnerable a los estados de malnutrición y deficiencias específicas de nutrientes como la vitamina B12 y el folato. El objetivo de este estudio fue establecer la relación existente entre la vitamina B12, folato, homocisteína y el consumo y adecuación de estos nutrientes. Se evaluaron 55 adultos mayores de 60 años de edad, de ambos sexos, no institucionalizados, a quienes se les determinó homocist...

  2. Neutrino and antineutrino charge-exchange reactions on 12C

    International Nuclear Information System (INIS)

    Samana, A. R.; Krmpotic, F.; Paar, N.; Bertulani, C. A.

    2011-01-01

    We extend the formalism of weak interaction processes, obtaining new expressions for the transition rates, which greatly facilitate numerical calculations, for both neutrino-nucleus reactions and muon capture. Explicit violation of the conserved vector current hypothesis by the Coulomb field, as well as development of a sum-rule approach for inclusive cross sections, has been worked out. We have done a thorough study of exclusive (ground-state) properties of 12 B and 12 N within the projected quasiparticle random phase approximation (PQRPA). Good agreement with experimental data achieved in this way put into evidence the limitations of the standard RPA and QRPA models, which come from the inability of the RPA to open the p 3/2 shell and from the nonconservation of the number of particles in the QRPA. The inclusive neutrino/antineutrino (ν/ν-tilde) reactions 12 C(ν,e - ) 12 N and 12 C(ν-tilde,e + ) 12 B are calculated within both the PQRPA and the relativistic QRPA. It is found that (i) the magnitudes of the resulting cross sections are close to the sum-rule limit at low energy, but significantly smaller than this limit at high energies, for both ν and ν-tilde; (ii) they increase steadily when the size of the configuration space is augmented, particularly for ν/ν-tilde energies >200 MeV; and (iii) they converge for sufficiently large configuration space and final-state spin. The quasi-elastic 12 C(ν,μ - ) 12 N cross section recently measured in the MiniBooNE experiment is briefly discussed. We study the decomposition of the inclusive cross section based on the degree of forbiddenness of different multipoles. A few words are dedicated to the ν/ν-tilde- 12 C charge-exchange reactions related to astrophysical applications.

  3. [Comparative investigation of the effect of calix[4]arene C-99 and its analogs on Na+,K(+)-ATPase activity of uterus myocite plasma membrane].

    Science.gov (United States)

    Veklich, T O; Shkrabak, O A; Cherenok, S O; Kal'chenko, V I; Kosterin, S O

    2012-01-01

    The aim of our investigation was to determine structural features of calix[4]arene C-99 which are important for its inhibition properties relative to Na+,K(+)-ATPase of uterus myocite plasma membrane. Therefore we studied the effect of calix[4]arenes C-296, C-297, C-424, C-425, C-426, C-427, which are structurally similar to this inhibitor, on the mentioned enzyme activity. We have shown that calixarenes C-296 and C-297 which have two additional propoxy groups on the lower rim of macrocycle are less effective inhibitors of Na+,K(+)-ATPase relative to calixarene C-99. Calixarenes C-425 and C-427 which have on the upper rim of macrocycle three and four phosponic residues, respectively, also inhibit Na+,K(+)-ATPase activity less effectively as compared to calixarene C-99. Both calixarenes: C-424, which has only two carbonate residues on the upper rim, and C-426, which has on the upper rim ketomethilphosphonate residues instead of hydroxymethilphosphonate residues of calixarene C-99, do not affect Na+,K(+)-ATPase activity. We have made respective conclusions concerning the role of certain chemical groups of calixarene C-99 during its interaction with Na+,K(+)-ATPase.

  4. First-principles study on Ca8Cn (n≤12) and CamC12 (m≤8) metal carbides

    International Nuclear Information System (INIS)

    Chen Gang; Peng Qi; Kawazoe, Yoshiyuki

    2011-01-01

    We performed an extensive structure optimization for small Ca 8 C n (n≤12) and Ca m C 12 (m≤8) clusters by using density functional theory. The structure would gain CaC 2 bulk characters for Ca 8 C n with n≥7 and Ca m C 12 with m≥6, respectively. Two cage-like structures were found and their structural stability was evaluated by molecular dynamics simulations. The Ca 4s valence electrons are donated to the π orbitals of dicarbon and part of the donated electrons is back donated to the Ca 3d split orbitals. Both Ca and C atoms contribute to the magnetic properties. The net charge on Ca analyzed with Bader technique is about +1.4e.

  5. Actin-associated protein palladin is required for migration behavior and differentiation potential of C2C12 myoblast cells

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, Ngoc Uyen Nhi; Liang, Vincent Roderick; Wang, Hao-Ven, E-mail: hvwang@mail.ncku.edu.tw

    2014-09-26

    Highlights: • Palladin is involved in myogenesis in vitro. • Palladin knockdown by siRNA increases myoblast proliferation, viability and differentiation. • Palladin knockdown decreases C2C12 myoblast migration ability. - Abstract: The actin-associated protein palladin has been shown to be involved in differentiation processes in non-muscle tissues. However, but its function in skeletal muscle has rarely been studied. Palladin plays important roles in the regulation of diverse actin-related signaling in a number of cell types. Since intact actin-cytoskeletal remodeling is necessary for myogenesis, in the present study, we pursue to investigate the role of actin-associated palladin in skeletal muscle differentiation. Palladin in C2C12 myoblasts is knocked-down using specific small interfering RNA (siRNA). The results show that down-regulation of palladin decreased migratory activity of mouse skeletal muscle C2C12 myoblasts. Furthermore, the depletion of palladin enhances C2C12 vitality and proliferation. Of note, the loss of palladin promotes C2C12 to express the myosin heavy chain, suggesting that palladin has a role in the modulation of C2C12 differentiation. It is thus proposed that palladin is required for normal C2C12 myogenesis in vitro.

  6. Actin-associated protein palladin is required for migration behavior and differentiation potential of C2C12 myoblast cells

    International Nuclear Information System (INIS)

    Nguyen, Ngoc Uyen Nhi; Liang, Vincent Roderick; Wang, Hao-Ven

    2014-01-01

    Highlights: • Palladin is involved in myogenesis in vitro. • Palladin knockdown by siRNA increases myoblast proliferation, viability and differentiation. • Palladin knockdown decreases C2C12 myoblast migration ability. - Abstract: The actin-associated protein palladin has been shown to be involved in differentiation processes in non-muscle tissues. However, but its function in skeletal muscle has rarely been studied. Palladin plays important roles in the regulation of diverse actin-related signaling in a number of cell types. Since intact actin-cytoskeletal remodeling is necessary for myogenesis, in the present study, we pursue to investigate the role of actin-associated palladin in skeletal muscle differentiation. Palladin in C2C12 myoblasts is knocked-down using specific small interfering RNA (siRNA). The results show that down-regulation of palladin decreased migratory activity of mouse skeletal muscle C2C12 myoblasts. Furthermore, the depletion of palladin enhances C2C12 vitality and proliferation. Of note, the loss of palladin promotes C2C12 to express the myosin heavy chain, suggesting that palladin has a role in the modulation of C2C12 differentiation. It is thus proposed that palladin is required for normal C2C12 myogenesis in vitro

  7. The opacities of 12C-12C reaction and effect of deformed target nucleus on abrasion and absorption cross sections

    International Nuclear Information System (INIS)

    Ramadan, S.; Metawei, Z.

    1995-01-01

    The values of the opacities for 12 C- 12 C reaction are calculated at different incident ion kinetic energy. The exact multiple scattering series for the scattering of two heavy ions which was derived by wilson is used to calculate the abrasion and absorption cross sections of 16 O- 9 Be and 16 O- 16 O collisions, considering a harmonic oscillator matter density for both target and projectiles as spherical nuclei. The effect of including the pauli correlation is considered. The case of deformed target is also investigated. Our results are compared with other calculations as well as with the experimental results

  8. Experimental study on enriching 12C by centrifuge method

    International Nuclear Information System (INIS)

    Xiao Huaxian

    1994-07-01

    The diamond made from the highly enriched 12 C, whose thermal conductivity and electric insulativity are much better than that of natural diamond, has widely uses in new and high technology. In many enriching 12 C methods, the gas centrifuge method is superior to others. After selecting the appropriate process gas and solving key problems, such as feed and extract, the separation experiments are performed by a single stage of centrifuge. To increase the separation capacity of single machine, various parameters in the centrifugal separation are optimized, and appropriate mechanical drive, thermal drive, hold-up and process parameters are selected. The optimal operating condition of single machine is also obtained in the cascade. Thus, highly enriched 12 C is produced in the centrifuge cascade

  9. Measurement of charged pions in {sup 12}C+{sup 12}C collisions at 1A GeV and 2A GeV with HADES

    Energy Technology Data Exchange (ETDEWEB)

    Agakishiev, G.; Destefanis, M.; Gilardi, C.; Kirschner, D.; Kuehn, W.; Lange, J.S.; Metag, V.; Novotny, R.; Pechenov, V.; Pechenova, O.; Perez Cavalcanti, T.; Spataro, S.; Spruck, B. [Justus Liebig Universitaet Giessen, II. Physikalisches Institut, Giessen (Germany); Agodi, C.; Coniglione, R.; Finocchiaro, P.; Maiolino, C.; Piattelli, P.; Sapienza, P. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Catania (Italy); Balanda, A.; Kozuch, A.; Przygoda, W. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Panstwowa Wyzsza Szkola Zawodowa, Nowy Sacz (Poland); Bellia, G. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Catania (Italy); Universita di Catania, Dipartimento di Fisica e Astronomia, Catania (Italy); Belver, D.; Cabanelas, P.; Duran, I.; Garzon, J.A.; Lamas-Valverde, J.; Marin, J. [University of Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Belyaev, A.; Chernenko, S.; Fateev, O.; Ierusalimov, A.; Zanevsky, Y. [Joint Institute of Nuclear Research, Dubna (Russian Federation); Bielcik, J.; Braun-Munzinger, P.; Galatyuk, T.; Gonzalez-Diaz, D.; Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Muench, M.; Palka, M.; Pietraszko, J.; Rustamov, A.; Schroeder, C.; Schwab, E.; Simon, R.S.; Traxler, M.; Yurevich, S.; Zumbruch, P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Blanco, A.; Lopes, L.; Mangiarotti, A. [LIP-Laboratorio de Instrumentacao e Fisica Experimental de Particulas, Coimbra (Portugal); Bortolotti, A.; Michalska, B. [Sezione di Milano, Istituto Nazionale di Fisica Nucleare, Milano (Italy); Boyard, J.L.; Hennino, T.; Moriniere, E.; Ramstein, B.; Roy-Stephan, M.; Sudol, M. [CNRS/IN2P3 - Universite Paris Sud, Institut de Physique Nucleaire, Orsay Cedex (France); Christ, T.; Eberl, T.; Fabbietti, L.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R. [and others

    2009-04-15

    We present the results of a study of charged-pion production in {sup 12}C+{sup 12}C collisions at incident beam energies of 1A GeV and 2A GeV using the HADES spectrometer at GSI. The main emphasis of the HADES program is on the dielectron signal from the early phase of the collision. Here, however, we discuss the data with respect to the emission of charged hadrons, specifically the production of {pi}{sup {+-}} mesons, which are related to neutral pions representing a dominant contribution to the dielectron yield. We have performed the first large-angular-range measurement of the distribution of {pi}{sup {+-}} mesons for the {sup 12}C+{sup 12}C collision system covering a fairly large rapidity interval. The pion yields, transverse-mass and angular distributions are compared with calculations done within a transport model, as well as with existing data from other experiments. The anisotropy of pion production is systematically analyzed. (orig.)

  10. The C-12/C-13 abundance ratio in Comet Halley

    International Nuclear Information System (INIS)

    Wyckoff, S.; Lindholm, E.; Wehinger, P.A.; Peterson, B.A.; Zucconi, J.M.

    1989-01-01

    The individual (C-13)N rotational lines in Comet Halley are resolved using high-resolution spectra of the CN B2Sigma(+)-X2Sigma(+) (0,0) band. The observe C-12/C-13 abundance ratio excludes a site of origin for the comet near Uranus and Neptune and suggests a condensation environment quite distinct from other solar system bodies. Two theories are presented for the origin of Comet Halley. One theory suggest that the comet originated 4.5 Gyr ago in an inner Oort cloud at a heliocentric distance greater than 100 AU where chemical fractionation led to the C-13 enrichment in the CN parent molecule prior to condensation of the comet nucleus. According to the other, more plausible theory, the comet nucleus condensed relatively recently from the interstellar medium which has become enriches in C-13 and was subsequently gravitationally captured by the solar system. 107 refs

  11. Quasi-free K+ photo-production in 12C

    International Nuclear Information System (INIS)

    Maeda, K.; Yamazaki, H.; Asano, S.; Emura, T.; Endo, I.; Endo, S.; Ito, S.; Itoh, H.; Ifuku, K.; Konno, O.; Koike, M.; Maruyama, K.; Niki, K.; Niwa, K.; Okuno, H.; Sakaguchi, A.; Sasaki, T.; Suda, T.; Sumi, Y.; Takeya, M.; Terasawa, T.; Uchida, H.; Yamashita, H.; Yoshida, K.

    1994-01-01

    Quasi-free K + photo-production in the 12 C(γ,K + ) reaction has been investigated in a photon energy range of 0.7-1.1GeV. Differential cross sections for the quasi-free process of the 12 C(γ,K + ) reaction have been obtained and they are compared with a calculation of a quasi-free K + photo-production. The effective proton number Z eff =4.2±0.6 obtained from the experiment was in good agreement with a calculation of a semi-classical attenuation model. ((orig.))

  12. Síndrome metabólica em mulheres na pós-menopausa tratadas de câncer de mama Metabolic syndrome in postmenopausal breast cancer survivors

    Directory of Open Access Journals (Sweden)

    Eliana Aguiar Petri Nahas

    2012-12-01

    Full Text Available OBJETIVO: Avaliar a ocorrência de síndrome metabólica (SM em mulheres na pós-menopausa tratadas de câncer de mama. MÉTODOS: Estudo clínico, transversal, com 158 mulheres na pós-menopausa (amenorreia >12 meses e idade ≥45 anos tratadas de câncer de mama e livres de doença há pelo menos cinco anos. Por meio de entrevista foram coletados dados clínicos e avaliados o índice de massa corpórea (IMC e a circunferência da cintura (CC. Na análise bioquímica foram solicitadas dosagens de colesterol total (CT, HDL, LDL, triglicerídeos (TG, glicemia, insulina e proteína C-reativa (PCR. Foram consideradas com SM as mulheres que apresentaram três ou mais critérios diagnósticos: CC>88 cm; TG≥150 mg/dL; HDL colesterol 88 cm afetando 54,4% (86/158 das mulheres. As pacientes sem SM tiveram maior tempo de seguimento quando comparadas àquelas com SM (pPURPOSE: To assess the occurrence of metabolic syndrome (MetS in postmenopausal breast cancer survivors. METHODS: A total of 158 breast cancer survivors were included in this cross-sectional study. Eligibility criteria were: women with amenorrhea >12 months and age ≥45 years, treated for breast cancer and no metastasis for at least five years. Clinical history and anthropometric indicator data (body mass index (BMI, and waist circumference, (WC were collected. Biochemical parameters, including total cholesterol, HDL, LDL, triglycerides (TG, glucose and C-reactive protein (CRP, were measured. MetS was diagnosed as the presence of at least three of the following diagnostic criteria: WC>88 cm, blood pressure≥130/85 mmHg, triglycerides≥150 mg/dl, HDL 88 cm, affecting 54.4% (86/158 of the women. The patients without MetS had a longer follow-up compared those with MetS (p0.05. CONCLUSION: Postmenopausal breast cancer survivors had a higher risk of developing metabolic syndrome and central obesity.

  13. Particle-gamma coincidence measurements in 12C+12C and 12C+Pb collisions at 2.1 GeV/nucleon incident energy

    International Nuclear Information System (INIS)

    Roche, G.; Koontz, R.; Mulera, T.; Pugh, H.G.; Schroeder, L.S.; Hallman, T.; Madansky, L.; Carroll, J.; Chang, C.C.; Kirk, P.N.; Krebs, G.; Vicente, J.

    1985-01-01

    A particle-gamma coincidence experiment has been performed with a 2.1 GeV per nucleon 12 C beam from the Bevalac. Data were taken with C and Pb targets. The γ-ray spectra are almost independent of the energy or the kind of charged particles detected in coincidence, mainly protons and deuterons. These γ-ray spectra are interpreted as resulting from π 0 decay, and are consistent with known π 0 production rates. A search for a possible decay of singly-charged anomalons into a gamma and a deuteron (or unbound proton-neutron system) has been done by studying the γp and γd invariant mass distributions. The upper limits for such a process are found to be 2 to 20% of the deuteron production rate, for anomalon masses for 200 to 400 MeV above the deuteron mass, with an anomalon mean lifetime of up to 10 -9 s, depending on which kind of decay process is considered. (orig.)

  14. Sub-coulombian fusion of 12 C + 12 C measured with the γ rays improved technique

    International Nuclear Information System (INIS)

    Rosales M, P.

    2005-01-01

    In this work we report the measurements carried out in the National Institute of Nuclear Research of Mexico (ININ) for the absolute section of fusion of the system 12 C + 12 C in an interval of energy of E c.m. 4.5-6.5 MeV with fine steps of 75 keV. The objective of measuring in fine steps is to register all the existent resonances. To be able to obtain an absolute normalization of the cross section, it was applied a method that allows to measure simultaneously the one number of projectiles that arrive to the target, as well as the numbers of nuclei in the target, even when this doesn't stay constant. In the chapter 2 the experimental procedure it is described, it is carried out with detail the analysis of the data and the results are shown. Later on the chapter 3 it is described with detail the method used for the absolute normalization, that is to say the form of obtaining the quantities N p and η T of the equation is explained and the obtained results are presented. Additionally in the chapter 4 it was carried out a theoretical analysis applying models as that of barrier penetration and the optical model combined with the Breit-Wigner theory with the purpose of being able to reproduce the resonances of the excitation function. In the chapter 5 the concept of S-Astrophysicist factor it is introduced and this value is calculated for our data. Finally in the chapter 6 the conclusions of this work are presented. (Author)

  15. Optimization of NaOH Molarity, LUSI Mud/Alkaline Activator, and Na2SiO3/NaOH Ratio to Produce Lightweight Aggregate-Based Geopolymer

    Directory of Open Access Journals (Sweden)

    Rafiza Abdul Razak

    2015-05-01

    Full Text Available This paper presents the mechanical function and characterization of an artificial lightweight geopolymer aggregate (ALGA using LUSI (Sidoarjo mud and alkaline activator as source materials. LUSI stands for LU-Lumpur and SI-Sidoarjo, meaning mud from Sidoarjo which erupted near the Banjarpanji-1 exploration well in Sidoarjo, East Java, Indonesia on 27 May 2006. The effect of NaOH molarity, LUSI mud/Alkaline activator (LM/AA ratio, and Na2SiO3/NaOH ratio to the ALGA are investigated at a sintering temperature of 950 °C. The results show that the optimum NaOH molarity found in this study is 12 M due to the highest strength (lowest AIV value of 15.79% with lower water absorption and specific gravity. The optimum LUSI mud/Alkaline activator (LM/AA ratio of 1.7 and the Na2SiO3/NaOH ratio of 0.4 gives the highest strength with AIV value of 15.42% with specific gravity of 1.10 g/cm3 and water absorption of 4.7%. The major synthesized crystalline phases were identified as sodalite, quartz and albite. Scanning Electron Microscope (SEM image showed more complete geopolymer matrix which contributes to highest strength of ALGA produced.

  16. Optimization of NaOH Molarity, LUSI Mud/Alkaline Activator, and Na2SiO3/NaOH Ratio to Produce Lightweight Aggregate-Based Geopolymer

    Science.gov (United States)

    Abdul Razak, Rafiza; Abdullah, Mohd Mustafa Al Bakri; Hussin, Kamarudin; Ismail, Khairul Nizar; Hardjito, Djwantoro; Yahya, Zarina

    2015-01-01

    This paper presents the mechanical function and characterization of an artificial lightweight geopolymer aggregate (ALGA) using LUSI (Sidoarjo mud) and alkaline activator as source materials. LUSI stands for LU-Lumpur and SI-Sidoarjo, meaning mud from Sidoarjo which erupted near the Banjarpanji-1 exploration well in Sidoarjo, East Java, Indonesia on 27 May 2006. The effect of NaOH molarity, LUSI mud/Alkaline activator (LM/AA) ratio, and Na2SiO3/NaOH ratio to the ALGA are investigated at a sintering temperature of 950 °C. The results show that the optimum NaOH molarity found in this study is 12 M due to the highest strength (lowest AIV value) of 15.79% with lower water absorption and specific gravity. The optimum LUSI mud/Alkaline activator (LM/AA) ratio of 1.7 and the Na2SiO3/NaOH ratio of 0.4 gives the highest strength with AIV value of 15.42% with specific gravity of 1.10 g/cm3 and water absorption of 4.7%. The major synthesized crystalline phases were identified as sodalite, quartz and albite. Scanning Electron Microscope (SEM) image showed more complete geopolymer matrix which contributes to highest strength of ALGA produced. PMID:26006238

  17. Iodide, azide, and cyanide complexes of (N,C), (N,N), and (N,O) metallacycles of tetra- and pentavalent uranium

    International Nuclear Information System (INIS)

    Benaud, Olivier; Berthet, Jean-Claude; Thuery, Pierre; Ephritikhine, Michel

    2011-01-01

    In contrast to the neutral macrocycle [UN* 2 (N,C)] (1) [N* = N(SiMe 3 ) 3 ; N,C = CH 2 SiMe 2 N-(SiMe 3 )] which was quite inert toward I 2 , the anionic bismetallacycle [NaUN*(N,C) 2 ] (2) was readily transformed into the enlarged monometallacycle [UN*(N,N)I] (4) [N,N = (Me 3 Si)NSiMe 2 CH 2 CH 2 SiMe 2 N(SiMe 3 )] resulting from C-C coupling of the two CH 2 groups, and [NaUN*(N,O) 2 ] (3) [N,O = OC(=CH 2 )SiMe 2 N(SiMe 3 )], which is devoid of any U-C bond, was oxidized into the UV bismetallacycle [Na{UN*(N,O) 2 }2(μ-I)] (5). Sodium amalgam reduction of 4 gave the U(III) compound [UN*(N,N)] (6). Addition of MN 3 or MCN to the (N,C), (N,N), and (N,O) metallacycles 1, 4, and 5 led to the formation of the anionic azide or cyanide derivatives M[UN* 2 (N,C)(N 3 )] [M = Na, 7a or Na(15-crown-5), 7b], M[UN* 2 (N,C)(CN)] [M = NEt 4 , 8a or Na(15-crown-5), 8b or K(18-crown-6), 8c], M[UN*(N,N)(N 3 ) 2 ] [M = Na, 9a or Na(THF)4, 9b], [NEt 4 ][UN*(N,N)(CN) 2 ] (10), M[UN*(N,O) 2 (N 3 )] [M = Na, 11a or Na(15-crown-5), 11b], M[UN*(N,O) 2 (CN)] [M = NEt 4 , 12a or Na(15-crown-5), 12b]. In the presence of excess iodine in THF, the cyanide 12a was converted back into the iodide 5, while the azide 11a was transformed into the neutral UV complex [U(N{SiMe 3 }-SiMe 2 C{CHI}O) 2 I(THF)] (13). The X-ray crystal structures of 4, 7b, 8a-c, 9b, 10, 12b, and 13 were determined. (authors)

  18. Quasi-free scattering off {sup 12}C in inverse kinematics at the R3B/LAND-setup

    Energy Technology Data Exchange (ETDEWEB)

    Panin, Valerii; Aumann, Thomas [Institut fuer Kernphysik, TU Darmstadt (Germany); Taylor, Jonathan [Department of Physics, University of Liverpool (United Kingdom); Collaboration: R3B-Collaboration

    2011-07-01

    An important part of the physics program at the future R3B (Reactions with Relativistic Radioactive Beams) experiment at FAIR will be based on the study of proton-induced reactions in a kinematical complete measurement. These are in particular the quasi-free scattering processes of the type (p,2p), (p,pn), (p,p{alpha}) etc, which will be used to investigate the single-particle and cluster structure of neutron-proton asymmetric nuclei and the role of nucleon-nucleon correlations in nuclei. A prototype setup for the detection of high-energy protons in (p,2p) reactions in coincidence with forward emitted light particles and heavy fragments has been built based on an array of Si micro-strip detectors for tracking and thick NaI scintillators for energy measurements. A {sup 12}C beam has been chosen for the bench-mark experiment since its structure is well known, and results from proton- as well as electron-induced knockout reactions are available. First results on two-proton angular correlations and momentum distributions of the knocked-out protons inside {sup 12}C are discussed as well as the excitation energy spectrum of the residual {sup 11}B nuclei.

  19. Facile Synthesis and Superior Catalytic Activity of Nano-TiN@N-C for Hydrogen Storage in NaAlH4.

    Science.gov (United States)

    Zhang, Xin; Ren, Zhuanghe; Lu, Yunhao; Yao, Jianhua; Gao, Mingxia; Liu, Yongfeng; Pan, Hongge

    2018-05-09

    Herein, we synthesize successfully ultrafine TiN nanoparticles (hydrogen storage in NaAlH 4 . Adding 7 wt % nano-TiN@N-C induces more than 100 °C reduction in the onset dehydrogenation temperature of NaAlH 4 . Approximately 4.9 wt % H 2 is rapidly released from the 7 wt % nano-TiN@N-C-containing NaAlH 4 at 140 °C within 60 min, and the dehydrogenation product is completely hydrogenated at 100 °C within 15 min under 100 bar of hydrogen, exhibiting significantly improved desorption/absorption kinetics. No capacity loss is observed for the nano-TiN@N-C-containing sample within 25 de-/hydrogenation cycles because nano-TiN functions as an active catalyst instead of a precursor. A severe structural distortion with extended bond lengths and reduced bond strengths for Al-H bonding when the [AlH 4 ] - group adsorbs on the TiN cluster is demonstrated for the first time by density functional theory calculations, which well-explains the reduced de-/hydrogenation temperatures of the nano-TiN@N-C-containing NaAlH 4 . These findings provide new insights into designing and synthesizing high-performance catalysts for hydrogen storage in complex hydrides.

  20. Baixa temperatura noturna e deficiência hídrica na fotossíntese de cana‑de‑açúcar

    Directory of Open Access Journals (Sweden)

    Daniela Favero São Pedro Machado

    2013-05-01

    Full Text Available O objetivo deste trabalho foi avaliar as respostas fotossintéticas da cana‑de‑açúcar aos efeitos simultâneos e isolados de baixa temperatura noturna (TN e deficiência hídrica (DH. Após 128 dias do plantio, as plantas da cultivar IACSP94-2094 foram submetidas aos tratamentos: controle, sem DH e com TN de 20°C (TN20; com DH e TN de 20°C (DH/TN20; sem DH e com TN de 12°C (TN12; e com DH e TN de 12°C (DH/TN12 por cinco dias. Após o período de tratamento, as plantas foram irrigadas e submetidas à TN de 20°C por mais quatro dias, para recuperação. Houve decréscimos na assimilação de CO2 em todos os tratamentos. A recuperação total da assimilação de CO2 foi observada apenas nas plantas do tratamento TN12. A ocorrência simultânea da baixa temperatura noturna e da deficiência hídrica causou dano acentuado e persistente na condutância estomática, na capacidade máxima da ribulose‑1,5‑bisfosfato carboxilase, no transporte aparente de elétrons, no fator de eficiência e na eficiência operacional do fotossistema II, o que resultou em limitações difusivas, bioquímicas e fotoquímicas da fotossíntese das plantas de cana‑de‑açúcar.

  1. Folding model analyses of 12C-12C and 16O-16O elastic scattering using the density-dependent LOCV-averaged effective interaction

    Science.gov (United States)

    Rahmat, M.; Modarres, M.

    2018-03-01

    The averaged effective two-body interaction (AEI), which can be generated through the lowest order constrained variational (LOCV) method for symmetric nuclear matter (SNM) with the input [Reid68, Ann. Phys. 50, 411 (1968), 10.1016/0003-4916(68)90126-7] nucleon-nucleon potential, is used as the effective nucleon-nucleon potential in the folding model to describe the heavy-ion (HI) elastic scattering cross sections. The elastic scattering cross sections of 12C-12C and 16O-16O systems are calculated in the above framework. The results are compared with the corresponding calculations coming from the fitting procedures with the input finite range D D M 3 Y 1 -Reid potential and the available experimental data at different incident energies. It is shown that a reasonable description of the elastic 12C-12C and 16O-16O scattering data at the low and medium energies can be obtained by using the above LOCV AEI, without any need to define a parametrized density-dependent function in the effective nucleon-nucleon potential, which is formally considered in the typical D D M 3 Y 1 -Reid interactions.

  2. Non-observation of 12C cluster decay of 114Ba

    International Nuclear Information System (INIS)

    Guglielmetti, A.; Bonetti, R.; Poli, G.; Collatz, R.; Hu, Z.; Kirchner, R.; Roeckl, E.; Gunn, N.; Price, P.B.; Weaver, B.A.; Westphal, A.; California Univ., Berkeley, CA; Szerypo, J.

    1997-10-01

    By means of the on-line mass separator at Gesellschaft fuer Schwerionenforschung, Darmstadt, we produced 114 Ba through the 58 Ni( 58 Ni,2n) reaction, separated it as a 114 Ba 19 F + beam, and implanted it into a stopper foil positioned in the center of an array of track detectors, which were used to search for 12 C radioactivity of 114 Ba. A total number of (5.4±1.7).10 4 114 Ba atoms were implanted. No 12 C event was found after a total exposure time of 116 hours, corresponding to a 58 Ni beam dose of 1.3.10 17 . The resulting upper limit of 3.4.10 -5 (84% c. 1.) for the branching ratio for 12 C decay of 114 Ba is considerably lower than the limits obtained in previous experiments, which represents an inconsistency at levels of more than 90%. A semiempirical estimate of 19.3 MeV for the upper limit of the Q-value for 12 C decay of 114 Ba is derived. (orig.)

  3. Emprego da submucosa de intestino delgado na correção de estenose esofágica em cães Small intestinal submucosa for reconstruction of esophageal stricture in a dog model

    OpenAIRE

    Zacarias Alves de Souza Filho; Fernando Hintz Greca; João Ricardo Duda; Guilherme Zicarelli Cravo; Sérgio Ossamu Ioshii

    2004-01-01

    OBJETIVO: Pesquisar a eficácia da Submucosa de lntestino Delgado (SID) porcina na correção de estenoses esofágicas cervicais em cães. MÉTODOS: Para produzir estenose, 12 animais foram submetidos a ressecções de porção elíptica de 3,5X2,0 cm, na parede anterior do esôfago cervical, suturado por pontos de fio de algodão. O processo evolui por 90 dias, atingindo a estenose desejada e comprovada por esofagograma. Na seqüência, a lesão cicatricial produzida foi ressecada e substituída por enxerto ...

  4. Reaction 12C(16O,α)24Mg leading to nuclear molecular resonances

    International Nuclear Information System (INIS)

    Nagatani, K.; Shimoda, T.; Tanner, D.; Tribble, R.; Yamaya, T.

    1979-01-01

    The reactions 12 C( 16 O,α) 24 Mg and 13 C( 16 O,α) 25 Mg were investigated at an incident energy of 145 MeV. In the reaction with the 12 C target, broad peaks are observed at forward angles which correspond to the molecular resonance states of the 12 C+ 12 C system, while the spectra with 13 C target show only a smooth continuum

  5. First intron of nestin gene regulates its expression during C2C12 myoblast ifferentiation

    Institute of Scientific and Technical Information of China (English)

    Hua Zhong; Zhigang Jin; Yongfeng Chen; Ting Zhang; Wei Bian; Xing Cui; Naihe Jing

    2008-01-01

    Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200031, China Nestin is an intermediate filament protein expressed in neural progenitor cells and in developing skeletal muscle. Nestin has been widely used as a neural progenitor cell marker. It is well established that the specific expression of the nestin gene in neural progenitor cells is conferred by the neural-specific enhancer located in the second intron of the nestin gene. However, the transcriptional mechanism of nestin expression in developing muscle is still unclear. In this study, we identified a muscle cell-specific enhancer in the first intron of mouse nestin gene in mouse myoblast C2C12 cells.We localized the core enhancer activity to the 291-661 region of the first intron, and showed that the two E-boxes in the core enhancer region were important for enhancer activity in differentiating C2C12 cells. We also showed that MyoD protein was involved in the regulation of nestin expression in the myogenic differentiation of C2C12 cells.

  6. Synthesis, crystal structure, and properties of Na{sub 2}RbAuO{sub 2}; Synthese, Kristallstruktur und Eigenschaften von Na{sub 2}RbAuO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Mudring, A.V.; Jansen, M. [Max-Planck-Inst. fuer Festkoerperforschung, Stuttgart (Germany)

    2001-02-01

    Single phase samples of Na{sub 2}RbAuO{sub 2} were prepared by reacting RbAu with Na{sub 2}O{sub 2} in an equimolar ratio in sealed silver cylinders (placed under argon in glas tubes) at 400 C for two weeks. The colourless single crystals of needle shaped habitus decompose immediately when exposed to air. Na{sub 2}RbAuO{sub 2} (Pearsoncode oP12, Pnnm, a = 992.76(6), b = 559.03(3), c = 408.64(3) pm, Z = 2, 414 reflections with I{sub o} > 2{sigma}(I), R{sub 1} = 0.0363, wR{sub 2} = 0.1057) crystallizes isotypic with Na{sub 2}KAuO{sub 2}. Besides linear [O-Au-O] units, which are characteristic for oxoaurate(I), the structure reveals uncommon low coordination numbers for the alkali metal cations. (orig.)

  7. Prevalencia del déficit de vitamina B12 en mayores de 60 años hospitalizados. Estudio del polimorfismo C677T de la enzima 5-10 MTHFR en pacientes con déficit de vitamina B12

    OpenAIRE

    Alonso Ortiz, María Belén

    2014-01-01

    Programa de doctorado: Avances en Medicina Interna. [ES] El déficit de Vitamina B12 es frecuente en los pacientes mayores. Sin embargo, son escasos los trabajos realizados en el ámbito hospitalario. Este déficit se asocia frecuentemente con elevación de la homocisteína plasmática, conocido factor de riesgo cardiovascular. Además la mutación C677T del gen de la enzima MTHFR se relaciona con hiperhomocistenemia, que puede coexistir con déficit de Vitamina B12, cuya frecuencia y consecuencias...

  8. Electron paramagnetic resonance of Na, [(FeEDTA){sub 2}oJ-12H{sub 2}0] crystal electrons; Ressonancia paramagnetica de eletrons de cristais de Na, [(FeEDTA){sub 2}oJ-12H{sub 2}0

    Energy Technology Data Exchange (ETDEWEB)

    Esquivel, Darci Motta de Souza

    1974-07-01

    Crystals of Na [(Fe EDTA){sub 2}o] {center_dot}12H{sub 2}0 were investigated by means of electron paramagnetic resonance spectroscopy. The spectra were obtained at various temperatures and crystals orientations. These spectra are very complex with many absorption bands. As the crystal orientation with respect to the magnetic field was changed the variations of the intensity and number of bands were recorded. The antiferromagnetic coupling between the iron atoms in the bridge Fe - 0 - Fe gives rise to states with total spin quantum number S= 0, 1, 2, 3, 4 and 5. Analyses of the EPR spectra as a function of temperature provided a means for the identification of the EPR absorption bands attributed to the states with S = 2. It was also possible to calculate the exchange parameter value J = 300 K. From the study of bands angular dependence in relation to the crystal orientation in the magnetic field it was found that the magnetic crystal axes X, Y, Z and the crystals axes a, b, c are related as (a, b, c) = (Y, Z, X) {exclamation_point} with a precision of 5 deg. Also the crystalline distortion parameters were calculated D = 0.21 {+-} 0.02 cm{sup 1}; E = 0.015 {+-} 0.005 cm{sup 1}. (author)

  9. THE GALACTIC R CORONAE BOREALIS STARS: THE C2 SWAN BANDS, THE CARBON PROBLEM, AND THE 12C/13C RATIO

    International Nuclear Information System (INIS)

    Hema, B. P.; Pandey, Gajendra; Lambert, David L.

    2012-01-01

    Observed spectra of R Coronae Borealis (RCB) and hydrogen-deficient carbon (HdC) stars are analyzed by synthesizing the C 2 Swan bands (1, 0), (0, 0), and (0, 1) using our detailed line list and the Uppsala model atmospheres. The (0, 1) and (0, 0) C 2 bands are used to derive the 12 C abundance, and the (1, 0) 12 C 13 C band to determine the 12 C/ 13 C ratios. The carbon abundance derived from the C 2 Swan bands is about the same for the adopted models constructed with different carbon abundances over the range 8.5 (C/He = 0.1%) to 10.5 (C/He = 10%). Carbon abundances derived from C I lines are about a factor of four lower than the carbon abundance of the adopted model atmosphere over the same C/He interval, as reported by Asplund et al., who dubbed the mismatch between adopted and derived C abundance as the 'carbon problem'. In principle, the carbon abundances obtained from C 2 Swan bands and that assumed for the model atmosphere can be equated for a particular choice of C/He that varies from star to star. Then, the carbon problem for C 2 bands is eliminated. However, such C/He ratios are in general less than those of the extreme helium stars, the seemingly natural relatives to the RCB and HdC stars. A more likely solution to the C 2 carbon problem may lie in a modification of the model atmosphere's temperature structure. The derived carbon abundances and the 12 C/ 13 C ratios are discussed in light of the double degenerate and the final flash scenarios.

  10. Synthesis of (9Z, 12E-, (9E, 12Z-[1-14C]-linoleic acid, (9Z, 12Z, 15E-, (9E, 12Z, 15Z-[1-14C]-linolenic acid and (5Z, 8Z, 11Z, 14E-[1-14C]-arachidonic acid

    Directory of Open Access Journals (Sweden)

    Enard, Thierry

    1996-04-01

    Full Text Available Trans polyunsaturated fatty acids are produced in vegetable oils during heat treatment (240-250 °C.ln order to study the metabolic pathway of 9c, 12t and 9t, 12c linoleic acid and 9c, 12c, 15t and 9t, 12c, 15c linolenic acid, these products were prepared labelled with carbon 14 in the carboxylic position. 5c, 8c, 11c, 14t-Arachidonic acid was also labelled on the carboxylic position with carbon 14 in order to study its physiological effects. To introduce the labelling (E-bromo precursors with a 17 carbons chain or a 19 carbon chain were needed. The different syntheses were done by elongation steps and creation of cis double bonds via highly stereospecific Wittig reactions. The radioactive carbon atom was introduced from [14C]-potassium cyanide. The final radioactive fatty acids had a specific activity greater than 50 mCi/mmol and a radioactive purity better than 99 % for linoleic and linolenic and better than 98.6 % for arachidonic acid.

  11. Differential cross sections for neutrino scattering on 12C

    International Nuclear Information System (INIS)

    Kolbe, E.

    1996-01-01

    Differential cross sections for neutrino scattering on 12 C are calculated within the (continuum) random phase approximation model. The charged current (ν e ,e - ) and (ν μ ,μ - ) capture reactions on 12 C are measured by the LSND Collaboration at LAMPF. We investigate and discuss the merits of such studies, especially the information that can be extracted from data for differential neutrino scattering cross sections. copyright 1996 The American Physical Society

  12. Estrategias experimentales para el estudio de las propiedades de la proteína Core del virus de la hepatitis C

    Directory of Open Access Journals (Sweden)

    Gonzálo Correa Arango

    2004-03-01

    , del estado replicativo viral y del nivel de expresión de la proteína Core del VHC, en tejido hepático proveniente de pacientes con diagnóstico de HCC asociado a la infección por el VHC.

    Aunque se logró la producción de la proteína Core en el sistema Baculovirus, algunos inconvenientes se presentaron en la purificación de la proteína con las técnicas de isoelectroenfoque y electroelusión. Ensayos preliminares de la capacidad inmunomoduladora de la proteína Core obtenida en el sistema de Baculovirus, se realizaron en cultivos de células dendríticas obtenidas por diferenciación de monocitos.

    De otra parte, se demostró la eficiencia del sistema del SFV para la expresión transitoria de altos niveles de proteína heteróloga en células HepG2; contrario a lo observado con la proteína reportera GFP, la eficacia del sistema SFV para la expresión de la proteína Core fue menor en la línea HepG2, comparado con el resultado obtenido en BHK-21.

    Un análisis preliminar se realizó mediante la técnica de DD-PCR, para la identificación de transcritos con expresión diferencial en células HepG2 con expresión transitoria de Core, comparado con células control o con expresión transitoria de la proteína reportera, GFP. Por último, la detección por inmunohistoquímica de la proteína Core del VHC en cortes de tejido hepático, se logró en condiciones de pH ácido con el anticuerpo monoclonal humano anti-Core B12.F8.

     

    REFERENCIAS

    1. HENAO F, ALVAREZ C, RUBIO I, BALCÁZAR N, NAVAS MC. Expression of heterologous

  13. Perfil epidemiológico de pacientes na fila de transplante de córnea no estado de Pernambuco - Brasil

    Directory of Open Access Journals (Sweden)

    Hirlana Gomes Almeida

    2014-01-01

    Full Text Available Objetivo: Descrever o perfil epidemiológico de pacientes na fila de transplante de córnea no estado de Pernambuco, Brasil. Métodos: Estudo transversal e retrospectivo realizado no período 01/06/2011 a 31/05/2012, com 871 pacientes cadastrados na fila de espera para transplante de córnea na Central de Notificação, Captação e Distribuição de Órgãos de Pernambuco (CNCDO/PE. Os dados foram coletados por meio de protocolos baseados nas fichas de cadastro de receptor de córnea. Resultados: Em relação à frequência, obteve-se 54% do gênero feminino, 35% na faixa etária de 61 a 80 anos; 60% transplantados; 52% provenientes da região Metropolitana do Recife; 57% que aguardaram 1 a 6 meses o transplante; 82% com indicação de transplante óptico; 5% com prioridade na fila de espera (destes 48% por perfuração ocular e 37% cujo centro transplantador era a Fundação Altino Ventura (FAV. As principais indicações para transplante de córnea foram leucoma (33%, ceratocone (22% e ceratopatia bolhosa (18%. Conclusão: Verificou-se que a maioria dos pacientes encontra-se na faixa etária de 61 a 80 anos; era da Mesorregião Metropolitana de Recife; foi submetida ao transplante de córnea; aguardou de um a seis meses para realizar o transplante; teve como diagnóstico o leucoma, seguido por ceratocone e ceratopatia bolhosa; teve como indicação o transplante óptico e teve como centro transplantador a FAV.

  14. Elimination of the 12 C and 16 O in the elastic scattering of 14 C by polarized protons

    International Nuclear Information System (INIS)

    Avila A, O.L.; Ramirez T, J.J.; Murillo O, G.; Fernandez B, M.

    1991-04-01

    The study of the elastic scattering of 14 C for polarized protons it provides information on the nuclear structure of 15 N. In the Tandem accelerator of the Nuclear Center in collaboration with the University of Notre Dame is carrying out this study to energy between 5.0 and 9.0 MeV in steps of 10 keV. The measures of differential section and vectorial analyzer power are subjected to shift analysis of phase being able to determine the parameters of the excited levels of 15 N that are it angular momentum, parity, level width and elastic width. The details of this experiment are presented in the ACEL-9102 technical report while in this work it was discussed the way in that contributions of 12 C and 16 O are eliminated that are present as impurities in our target of 14 C. At small angles the elastic components of these impurities are shoveled with the elastic of 14 C. In the experiment carried out in the Nuclear Center were take measures of differential section for 6 angles; 35, 45, 55, 65, 145 and 165 using surface barrier detectors. It is observed that it exists shovels at 35, 45, 55 and 65 while at 145 and 165 the 12 C, the 14 C and the 16 O are totally separate. With the purpose of being able to subtract of the elastic of 14 C the proportion of 12 C, it was decided to bombard a target of 12 C leaving the same geometry that had been used to bombard 14 C. With this also carried out the reaction 12 C (p,p) 12 C between 5.0 and 9.0 MeV in steps of 50 keV. Starting from these spectra are the integration (yield) of the elastic of 12 C. (Author)

  15. Percepção monocular da profundidade ou relevo na ilusão da máscara côncava na esquizofrenia

    Directory of Open Access Journals (Sweden)

    Arthur Alves

    2014-03-01

    Full Text Available Este trabalho foi desenvolvido com o propósito de investigar a percepção monocular da profundidade ou relevo da máscara côncava por 29 indivíduos saudáveis, sete indivíduos com esquizofrenia sob uso de antipsicótico por um período inferior ou igual a quatro semanas e 29 sob uso de antipsicótico por um período superior a quatro semanas. Os três grupos classificaram o reverso de uma máscara policromada em duas situações de iluminação, por cima e por baixo. Os resultados indicaram que a maioria dos indivíduos com esquizofrenia inverteu a profundidade da máscara côncava na condição de observação monocular e perceberam-na como convexa, sendo, portanto, suscetíveis à ilusão da máscara côncava. Os indivíduos com esquizofrenia sob uso de medicação antipsicótica pelo período superior a quatro semanas estimaram a convexidade da máscara côncava iluminada por cima em menor comprimento comparados aos indivíduos saudáveis.

  16. Induction of system A amino acid transport activity through long-term treatment with ouabain: possible correlation with enhanced (Na+/K+)ATPase activity

    International Nuclear Information System (INIS)

    Schenerman, M.A.; Leister, K.J.; Wang, S.Y.; Racker, E.

    1987-01-01

    Mouse embryo fibroblast cells (C3H-10T1/2) and the methylcholanthrene-transformed derivative (MCA-10T1/2) were treated with basal modified Eagles medium at varying ouabain concentrations ranging from 0.05 mM to 0.5 mM for 16 h in culture. After replacing the ouabain-containing medium with BME, System A ( 3 H-AlB uptake) and the (Na + /K + )ATPase pump activity (ouabain-sensitive 86 Rb + uptake) was increased 10-fold and 3-fold, respectively (at 0.4 mM ouabain) in confluent C3H-10T1/2 cells. System A and the (Na + /K + )ATPase activity was increased 15-fold and 5-fold, respectively in confluent MCA-10T1/2 cells but the increase was maximal at 0.2 mM ouabain. This treatment with ouabain increased the [Na + ]/sub i//[K + ]/sub i/ as measured by atomic absorption, and thereby decreased the Na + and K + electrochemical gradients. Their data show that the transformed cells were more sensitive to the internal ion inversion by ouabain than the C3H-10T1/2 cells. It appears, from data on hypertonicity and lipophilic cations that neither the chemical Na + gradient nor the negative membrane potential are the primary driving forces of System A transport

  17. The effect of Na vapor on the Na content of chondrules

    Science.gov (United States)

    Lewis, R. Dean; Lofgren, Gary E.; Franzen, Hugo F.; Windom, Kenneth E.

    1993-01-01

    Chondrules contain higher concentrations of volatiles (Na) than expected for melt droplets in the solar nebula. Recent studies have proposed that chondrules may have formed under non-canonical nebular conditions such as in particle/gas-rich clumps. Such chondrule formation areas may have contained significant Na vapor. To test the hypothesis of whether a Na-rich vapor would minimize Na volatilization reaction rates in a chondrule analog and maintain the Na value of the melt, experiments were designed where a Na-rich vapor could be maintained around the sample. A starting material with a melting point lower that typical chondrules was required to keep the logistics of working with Na volatilization from NaCl within the realm of feasibility. The Knippa basalt, a MgO-rich alkali olivine basalt with a melting temperature of 1325 +/- 5 C and a Na2O content of 3.05 wt%, was used as the chondrule analog. Experiments were conducted in a 1 atm, gas-mixing furnace with the fO2 controlled by a CO/CO2 gas mixture and fixed at the I-W buffer curve. To determine the extent of Na loss from the sample, initial experiments were conducted at high temperatures (1300 C - 1350 C) for duration of up to 72 h without a Na-rich vapor present. Almost all (up to 98%) Na was volatilized in runs of 72 h. Subsequent trials were conducted at 1330 C for 16 h in the presence of a Na-rich vapor, supplied by a NaCl-filled crucible placed in the bottom of the furnace. Succeeding Knudsen cell weight-loss mass-spectrometry analysis of NaCl determined the P(sub Na) for these experimental conditions to be in the 10(exp -6) atm range. This value is considered high for nebula conditions but is still plausible for non-canonical environments. In these trials the Na2O content of the glass was maintained or in some cases increased; Na2O values ranged from 2.62% wt to 4.37% wt. The Na content of chondrules may be controlled by the Na vapor pressure in the chondrule formation region. Most heating events capable

  18. Pion production in 12C-nucleus interactions at 86 MeV/nucleon

    International Nuclear Information System (INIS)

    Chiavassa, E.; Costa, S.; Dellacasa, G.; De Marco, N.; Gallio, M.; Musso, A.; Aslanides, E.; Fassnacht, P.; Hibou, F.; Bressani, T.; Caria, M.; Serci, S.; Cagliari Univ.; Iazzi, F.; Minetti, B.; Politecnico di Torino

    1984-01-01

    Inclusive π - spectra due to the ( 12 C, πX) reaction were measured at 0 0 using 12 C ions of 1032 MeV and 6 Li, 12 C, 27 Al, Cd and Pb targets. π + measurements were carried out using a 12 C target. The cross sections show a saturation effect as a function of the target mass. The present results are compared to theoretical predictions of the hard-scattering model and of the statistical model and analysed following the quasi-two-body scaling hypothesis. (orig.)

  19. Glass dissolution at 20, 40, 70 and 90 C: Short-term effects of solution chemistry and long-term Na release

    International Nuclear Information System (INIS)

    Bakel, A.J.; Ebert, W.L.; Strachan, D.M.

    1996-01-01

    The corrosion behavior of a borosilicate glass containing 20 mass 5 Na 2 O was assessed using static dissolution tests. This glass (LD6-5412) is representative of high Na glasses that may be used to stabilize Hanford low-level radioactive waste. The normalized mass loss (NL) decreases as NL(Na) ∼ NL(B) > NL(Si) in 20 and 40 C for tests conducted at glass surface area to leachant volume (S/V) ratio of 10 m -1 , and decreases as NL(Na) > NL(B) ∼ NL(Si) in 90 C tests conducted at 10 m -1 and in all tests conducted at higher S/V. The difference in the corrosion behavior is probably caused by the influence of dissolved glass components in the leachates. The NL(Na) is greater than the NL(B) or NL(Si) in all the tests conducted. Results from long-term tests at 2,000 m -1 show that the preferential release of Na persists for longer than one year at all temperatures and indicate that Na is released from this glass by an ion exchange process

  20. Observation of double-well potential of NaH C 1Σ+ state: Deriving the dissociation energy of its ground state.

    Science.gov (United States)

    Chu, Chia-Ching; Huang, Hsien-Yu; Whang, Thou-Jen; Tsai, Chin-Chun

    2018-03-21

    Vibrational levels (v = 6-42) of the NaH C 1 Σ + state including the inner and outer wells and the near-dissociation region were observed by pulsed optical-optical double resonance fluorescence depletion spectroscopy. The absolute vibrational quantum number is identified by comparing the vibrational energy difference of this experiment with the ab initio calculations. The outer well with v up to 34 is analyzed using the Dunham expansion and a Rydberg-Klein-Rees (RKR) potential energy curve is constructed. A hybrid double-well potential combined with the RKR potential, the ab initio calculation, and a long-range potential is able to describe the whole NaH C 1 Σ + state including the higher vibrational levels (v = 35-42). The dissociation energy of the NaH C 1 Σ + state is determined to be D e (C) = 6595.10 ± 5 cm -1 and then the dissociation energy of the NaH ground state D e (X) = 15 807.87 ± 5 cm -1 can be derived.

  1. Fragment emission in reactions of 18.5-GeV 12C ions with complex nuclei

    International Nuclear Information System (INIS)

    Porile, N.T.; Cole, G.D.

    1982-01-01

    The emission of fragments ranging from 24 Na to 52 Mn in reactions of 18.5 GeV 12 C ions with Cu, Ag, Gd, Ta, Au, and U targets has been studied by means of activation techniques. The experiments involved determination of the fragment production cross sections and thick-target recoil properties. The latter were used to obtain mean fragment kinetic energies and values of β/sub parallel to/, the forward velocity component of the struck nucleus (in units of c). The results are compared with similar data for incident protons of the same total kinetic energy. The data may be used to assess the importance of central collisions in fragment production. Such collisions lead to the near total destruction of both interacting nuclei and the resulting fragments are emitted by a system of intermediate rapidity. In such a process, the factorization hypothesis, which has been shown to be valid for target and projectile fragmentation reactions, should not be obeyed. A test for factorization is performed by means of a relation which states that the ratio of the cross sections for producing fragment /sup A/Z in 12 C reactions to that for producing the same fragment in proton reactions with the same target is unity, provided both cross sections are reduced by the values of the corresponding total reaction cross sections sigma/sub R/, and evaluated for the same total kinetic energy of the projectile. The results of this comparison for the targets studied are presented and discussed

  2. Three-component synthesis of C2F5-substituted pyrazoles from C2F5CH2NH2·HCl, NaNO2 and electron-deficient alkynes

    Directory of Open Access Journals (Sweden)

    Pavel K. Mykhailiuk

    2015-01-01

    Full Text Available A one-pot reaction between C2F5CH2NH2·HCl, NaNO2 and electron-deficient alkynes gives C2F5-substituted pyrazoles in excellent yields. The transformation smoothly proceeds in dichloromethane/water, tolerates the presence of air, and requires no purification of products by column chromatography. Mechanistically, C2F5CH2NH2·HCl and NaNO2 react first in water to generate C2F5CHN2, that participates in a [3 + 2] cycloaddition with electron-deficient alkynes in dichloromethane.

  3. Synthesis and structural characterization of inorganic luminescent materials of Cs2NaErBr6 and Cs2NaHoBr6

    International Nuclear Information System (INIS)

    Poblete, V.H; Fack, G

    2003-01-01

    The synthesis and structural characterization is described of two luminescent materials, with technological [1] and spectroscopic [2] interest, whose crystallographic charts have not been published in the literature. The synthesis of both systems: Cs 2 NaErBr 6 and CS 2 NaHoBr 6 , was done using solid state reactions in a controlled environment. The thermal analyses DTA/TGA, applied with a temperature gradient of 10 o C/min., established crystallization ranges of 490,4 o C to 545,4 o C, for the elpasolite CS 2 NaHoBr 6 and 501 o C to 556 o C, for the structure CS 2 NaErBr 6 .. The heat vacuum treatments were carried out at 505 o C and 526 o C respectively, obtaining optimum crystallization. The structural characterization was performed with powdered X-ray diffraction (XRD). The range between 12 o and 80 o (2θ), was analyzed for 3352 points, measured steps of 0.02 o (2θ using the Rietveld profile refining program. The following crystallographic parameters were established: a 0 = 11,279(1), and 11,293(4) Angstroms, for the two structures analyzed, respectively. The relationship R exp wp in both cases is highly accurate for the 32 test lines that were analyzed. The structures present cubic closed packing Cs 1+ 3 Cl 1- , with Ho 3+ and Er 3+ atoms, filling the octahedral holes. The test data obtained will be very useful for completing the mass of experimental data needed to develop the design engineering, with specific applications for luminescent devices (au)

  4. Yolk-shell structured Sb@C anodes for high energy Na-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Song, Junhua; Yan, Pengfei; Luo, Langli; Qi, Xingguo; Rong, Xiaohui; Zheng, Jianming; Xiao, Biwei; Feng, Shuo; Wang, Chongmin; Hu, Yong-Sheng; Lin, Yuehe; Sprenkle, Vincent L.; Li, Xiaolin

    2017-10-01

    Despite great advances in sodium-ion battery developments, the search for high energy and stable anode materials remains a challenge. Alloy or conversion-typed anode materials are attractive candidates of high specific capacity and low voltage potential, yet their applications are hampered by the large volume expansion and hence poor electrochemical reversibility and fast capacity fade. Here, we use antimony (Sb) as an example to demonstrate the use of yolk-shell structured anodes for high energy Na-ion batteries. The Sb@C yolk-shell structure prepared by controlled reduction and selective removal of Sb2O3 from carbon coated Sb2O3 nanoparticles can accommodate the Sb swelling upon sodiation and improve the structural/electrical integrity against pulverization. It delivers a high specific capacity of ~554 mAh•g-1, good rate capability (315 mhA•g-1 at 10C rate) and long cyclability (92% capacity retention over 200 cycles). Full-cells of O3-Na0.9[Cu0.22Fe0.30Mn0.48]O2 cathodes and Sb@C-hard carbon composite anodes demonstrate a high specific energy of ~130 Wh•kg-1 (based on the total mass of cathode and anode) in the voltage range of 2.0-4.0 V, ~1.5 times energy of full-cells with similar design using hard carbon anodes.

  5. Structure of 12C and the triple-α process

    DEFF Research Database (Denmark)

    Fynbo, H.O.U.; Diget, C.Aa.

    2014-01-01

    We review experiments at IGISOL and associated work at ISOLDE and KVI on the use of the β-decays of 12N and 12B for the study of the structure of 12C and the consequences for the rate of the triple-α reaction in stars.......We review experiments at IGISOL and associated work at ISOLDE and KVI on the use of the β-decays of 12N and 12B for the study of the structure of 12C and the consequences for the rate of the triple-α reaction in stars....

  6. Sub-coulombian fusion of {sup 12} C + {sup 12} C measured with the {gamma} rays improved technique; Fusion sub-coulombiana de {sup 12} C + {sup 12} C medida con la tecnica de rayos- {gamma} mejorada

    Energy Technology Data Exchange (ETDEWEB)

    Rosales M, P

    2005-07-01

    In this work we report the measurements carried out in the National Institute of Nuclear Research of Mexico (ININ) for the absolute section of fusion of the system {sup 12} C + {sup 12} C in an interval of energy of E{sub c.m.} 4.5-6.5 MeV with fine steps of 75 keV. The objective of measuring in fine steps is to register all the existent resonances. To be able to obtain an absolute normalization of the cross section, it was applied a method that allows to measure simultaneously the one number of projectiles that arrive to the target, as well as the numbers of nuclei in the target, even when this doesn't stay constant. In the chapter 2 the experimental procedure it is described, it is carried out with detail the analysis of the data and the results are shown. Later on the chapter 3 it is described with detail the method used for the absolute normalization, that is to say the form of obtaining the quantities N{sub p} and {eta}{sub T} of the equation is explained and the obtained results are presented. Additionally in the chapter 4 it was carried out a theoretical analysis applying models as that of barrier penetration and the optical model combined with the Breit-Wigner theory with the purpose of being able to reproduce the resonances of the excitation function. In the chapter 5 the concept of S-Astrophysicist factor it is introduced and this value is calculated for our data. Finally in the chapter 6 the conclusions of this work are presented. (Author)

  7. Differential cross section measurement of elastic scattering 12C(p,p)12C in the astrophysical range of energy

    International Nuclear Information System (INIS)

    Baktibayev, M.K.; Burminskii, V.P.; Burtebaev, N.; Dzazairov -Kakhramanov, V.; Hassan, S.F.; Satpaev, N.K.; Zazulin, D.M.

    2004-01-01

    Full text: The fulfillment of planned works on measurements of differential cross sections of elastic scattering of protons on nuclear 12 C at the energy region of 350†1050 keV suggests the preparation of thin self - supporting carbon target. The self - supporting target is necessary in order to perform investigations in the total angular range. In the future last data will be used in order to determine optical potentials and scattering phases for this nuclear in the energy range of astrophysical interest. There was prepared target layer of the 12 C with natural composition of carbon and of thickness of 17.4 μg/cm 2 . The spraying was conducted in the vacuum evaporation installation (VUP - 4) by an electron bombardment method. Carbon was sprayed on a glass plate with previously deposited of layer salt. After a heating during 12 hours at the temperature of 150 o C the film of carbon was floated from glass plate and self - supporting target has been picked up on the specially prepared target frame. In order to determine thickness of target there was used the resonance chamber, installed in the protons channel of the accelerator RAC - 2 - 1 (INP NNC RK), with the help of which there was measured energy loss of the protons beam during the passage through target, disposed in the central chamber. For this purpose there was used the reaction 27 Al(p,γ) 28 Si with narrow resonance with E R = 992 keV and with detection of gamma-quanta with E γ = 1779 keV. On shift of the resonance E R =992 keV in the reaction 27 Al(p,γ) 28 Si, which takes place owing to protons energy loss in the thickness of carbon film, and using table values of brake quantities S(E p )[MeV·cm 2 /g] [1], there was determined thickness of this fine film. Such the method allows to determine thicknesses of films in the interval of (10 † 100) mcg/cm 2 with the accuracy of not worse than 5%. In the present work there were carried out measurements of angular distributions of cross sections of the

  8. Scattering of alpha particles from /sup 12/C and the /sup 12/C(. cap alpha. ,. gamma. )/sup 16/O stellar reaction rate

    Energy Technology Data Exchange (ETDEWEB)

    Plaga, R.; Becker, H.W.; Redder, A.; Rolfs, C.; Trautvetter, H.P.; Langanke, K.

    1987-04-06

    The elastic scattering of alpha particles from /sup 12/C has been investigated for 35 angles in the range theta/sub lab/ = 22/sup 0/ to 163/sup 0/ and for 51 energies at E/sub ..cap alpha../ = 1.0 to 6.6 MeV. The extracted phase shifts for l=0 to 6 partial waves have been parametrized in terms of the multilevel R-matrix formalism. Information on the deduced parameters of states in /sup 16/O is reported. The data reveal reduced ..cap alpha..-particle widths for the 6.92 and 7.12 MeV subthreshold states consistent with recent work. The implications for the stellar reaction rate of /sup 12/C(..cap alpha..,..gamma..)/sup 16/O are discussed.

  9. Simulation of 200-400 MeV/u "1"2C + "1"2C elastic scattering on SHARAQ spectrometer

    International Nuclear Information System (INIS)

    Yu Lei; Zhang Gaolong; Terashima, S.; Le Xiaoyun; Tanihata, I.

    2015-01-01

    In order to further obtain the information of three-body force (TBF) from 200-400 MeV/u "1"2C + "1"2C elastic scattering, we plan to perform this experiment on a SHARAQ spectrometer. Based on the experimental condition of the Radioactive Ion Beam Factory (RIBF)-SHARAQ facility, a simulation is given to find a compromise between the better energy and angular resolutions, and higher yield by optimizing the target thickness, beam transport mode, beam intensity and angular step. From the simulation, we found that the beam quality mainly limits the improvements of energy and angular resolutions. A beam tracking system as well as a lateral and angular dispersion-matching technique are adopted to reduce the influence of beam quality. According to the two angular settings of SHARAQ as well as the expected cross sections on the basis of the theoretical model, the energy and angular resolutions, and statistical accuracy are estimated. (authors)

  10. Histiocitose das células de Langerhans na região anogenital Langerhans cell histiocytosis of the anogenital region

    Directory of Open Access Journals (Sweden)

    M. S. Neto

    1998-12-01

    Full Text Available A Histiocitose das células de Langerhans (HCL acometendo o trato genital tem uma incidência rara com apenas 48 casos relatados na literatura1-5 . Considerando somente as lesões da região anogenital, esse número cai para dois casos descritos1,2. Reportamos o 3º caso de HCL anogenital em uma paciente de 31 anos, branca, cuja comprovação diagnóstica foi feita através de microscopia eletrônica. O tratamento realizado foi quimioterapia sistêmica e excisão cirúrgica local.The Langerhans cell histiocytosis (LCH of the genital tract is rare, with only 48 cases related in the literature1-5. There were reported only 2 cases in the anogenital region1,2. We reported the third case of LCH in the anogenital region; patient was female, 31 years-old, caucasian and the diagnosis was confirmed by electron microscopic magnification. The treatment was local surgical excision and systemic chemotherapy.

  11. Synthesis and Characterization of the Quaternary Thio-aluminogermanates A(AlS2)(GeS2) (A = Na, K)

    KAUST Repository

    Al-Bloushi, Mohammed; Davaasuren, Bambar; Emwas, Abdul-Hamid M.; Rothenberger, Alexander

    2015-01-01

    The quaternary thioaluminogermanates Na(AlS2)(GeS2) (1) and K(AlS2)(GeS2) (2) crystallize in the tetragonal space group I4/mcm (no. 140) with unit cell parameters a = 7.4274(11) Å, c = 5.8560(12) Å for Na(AlS2)(GeS2) and a = 7.8826(2) Å, c = 5

  12. Na insertion into nanocrystalline Li4Ti5O12 spinel: An electrochemical study

    Czech Academy of Sciences Publication Activity Database

    Zukalová, Markéta; Pitňa Lásková, Barbora; Klementová, Mariana; Kavan, Ladislav

    2017-01-01

    Roč. 245, AUG 2017 (2017), s. 505-511 ISSN 0013-4686 R&D Projects: GA ČR GA15-06511S; GA MŠk LM2015087 Institutional support: RVO:61388955 ; RVO:68378271 Keywords : Na insertion * Li4Ti5O12 * nanocrystalline Subject RIV: CG - Electrochemistry; BM - Solid Matter Physics ; Magnetism (FZU-D) OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis); Condensed matter physics (including formerly solid state physics, supercond.) (FZU-D) Impact factor: 4.798, year: 2016

  13. Energy transfer and tunable luminescence of Na{sub 2}(Y,Eu)Mg{sub 2}V{sub 3}O{sub 12} phosphors for white LED applications

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Zhang; Wanjun, Tang, E-mail: tangmailbox@126.com

    2016-01-15

    Highlights: • Iso-structural garnet-type Na{sub 2}(Y,Eu)Mg{sub 2}V{sub 3}O{sub 12} solid solution were synthesized. • Efficient energy transfer from [VO{sub 4}]{sup 3−} to Eu{sup 3+} ions in this phosphor is observed obviously. • Tuning the Y/Eu ratio generates the varied hues from yellowish-green to reddish-orange. • This kind of phosphor can be potentially used in UV pumped LEDs. - Abstract: A series of solid-solution phosphors Na{sub 2}(Y,Eu)Mg{sub 2}V{sub 3}O{sub 12} were prepared using solution combustion reaction. X-ray diffraction studies verified the formation of single phase Na{sub 2}(Y,Eu)Mg{sub 2}V{sub 3}O{sub 12} with garnet structure. Na{sub 2}(Y,Eu)Mg{sub 2}V{sub 3}O{sub 12} phosphors show not only a broad emission band with a maximum at 510 nm due to the [VO{sub 4}]{sup 3−} group but also several sharp emission lines due to the Eu{sup 3+} ions. The energy transfer from [VO{sub 4}]{sup 3−} to Eu{sup 3+} was discussed on the base of the spectral analysis. The color-tunable emissions of the Na{sub 2}(Y,Eu)Mg{sub 2}V{sub 3}O{sub 12} phosphor as a function of Y/Eu ratio are realized by continuously generating the varied hues from yellowish-green to reddish-orange. This indicates that the obtained phosphor may have potential applications in the field of UV-based white LEDs.

  14. Experimental investigation on the combined use of C1O2 and NaC1O for drinking water treatment

    International Nuclear Information System (INIS)

    Sani, B.; Rossi, L.; Santianni, D.; Anichini, B.; Caretti, C.; Lubello, C.

    2005-01-01

    In Italy, most of the plants producing water for human consumption, use Chlorine Dioxide (C1O 2 ) and Sodium Hypochlorite (NaC1O) for the oxidation and disinfection treatments. These chemical disinfectants, which are very effective as regards the oxidation power, the disinfection capability and the bacteriostatic action, produce by-products harmful for human health: Chlorite and Trihalomethanes (THMs) respectively. The Italian Regulations (D.Lgs. 31/2001) sets very restrictive limits for the maximum concentration of these by-products in drinking water. Moreover, from December 2006, the limit for chlorite will be even more restrictive and, with present treatment process, the compliance with the regulation will be very difficult. Therefore the experimentation of alternative treatment techniques and products is of great interest. This article presents an experimental investigation on the combined use of C1O 2 and NaC1O in the treatment of final water from two different plants producing drinking water in Florence. The main objective of this investigation was to evaluate the use of these two products in combination so as to keep the advantages (disinfection efficiency and stability in water) and to minimize the disadvantages (by-products formation) present when using this products separately. Positive results achieved in the experimental phase were used to evaluate the possible applications on real drinking water treatment conditions [it

  15. Different NaCl-Induced Calcium Signatures in the Arabidopsis thaliana Ecotypes Col-0 and C24

    KAUST Repository

    Schmöckel, Sandra M.

    2015-02-27

    A common feature of stress signalling pathways are alterations in the concentration of cytosolic free calcium ([Ca2+]cyt), which allow the specific and rapid transmission of stress signals through a plant after exposure to a stress, such as salinity. Here, we used an aequorin based bioluminescence assay to compare the NaCl-induced changes in [Ca2+]cyt of the Arabidopsis ecotypes Col-0 and C24. We show that C24 lacks the NaCl specific component of the [Ca2+]cyt signature compared to Col-0. This phenotypic variation could be exploited as a screening methodology for the identification of yet unknown components in the early stages of the salt signalling pathway.

  16. Different NaCl-Induced Calcium Signatures in the Arabidopsis thaliana Ecotypes Col-0 and C24

    KAUST Repository

    Schmö ckel, Sandra M.; Garcia, Alexandre F.; Berger, Bettina; Tester, Mark A.; Webb, Alex A. R.; Roy, Stuart J.

    2015-01-01

    A common feature of stress signalling pathways are alterations in the concentration of cytosolic free calcium ([Ca2+]cyt), which allow the specific and rapid transmission of stress signals through a plant after exposure to a stress, such as salinity. Here, we used an aequorin based bioluminescence assay to compare the NaCl-induced changes in [Ca2+]cyt of the Arabidopsis ecotypes Col-0 and C24. We show that C24 lacks the NaCl specific component of the [Ca2+]cyt signature compared to Col-0. This phenotypic variation could be exploited as a screening methodology for the identification of yet unknown components in the early stages of the salt signalling pathway.

  17. Vitamin C-linker-conjugated tripeptide AHK stimulates BMP-2-induced osteogenic differentiation of mouse myoblast C2C12 cells.

    Science.gov (United States)

    Jung, Jung-Il; Park, Kyeong-Yong; Lee, Yura; Park, Mira; Kim, Jiyeon

    2018-03-15

    Vitamin C-linker-conjugated Ala-His-Lys tripeptide (Vit C-AHK) is a derivative of Vitamin C-conjugated tripeptides, which were originally developed as a component of a product for collagen synthesis enhancement or human dermal fibroblast growth. Here, we investigated the effect of Vit C-AHK on bone morphogenetic protein (BMP)-2-induced osteoblast differentiation in a cell culture model. Vit C-AHK enhanced proliferation of C2C12 cells and induction of BMP-2-induced alkaline phosphatase, a typical marker of osteoblast differentiation. Vit C-AHK also stimulated the phosphorylation and translocation of Smad1/5/8 to the nucleus and phosphorylation of mitogen-activated protein kinases (MAPKs) including ERK1/2 and p38. In addition, Vit C-AHK enhanced the BMP-2-induced mRNA expression of osteoblast differentiation-related genes such as ALP, BMP-2, Osteocalcin, and Runx2. Our results suggest that Vit C-AHK exerts an enhancing effect on osteoblast proliferation and differentiation through activation of Smad1/5/8 and MAPK ERK1/2 and p38 signaling and without significant cytotoxicity. These results provide important data for the development of peptide-based bone-regenerative agents and treatment of bone-related disorders. Copyright © 2018 International Society of Differentiation. Published by Elsevier B.V. All rights reserved.

  18. C-12/C-13 isotope ratio of the interstellar medium in the neighborhood of the sun

    International Nuclear Information System (INIS)

    Hawkins, I.; Jura, M.

    1987-01-01

    Data from observations of Xi Per, P Cyg, 20 Tau, and 23 Tau, obtained at 4232 and 3957 A using a coude spectrograph and a 1872-element reticon on the 3-m Shane telescope at Lick Observatory during 1984-1985, are combined with data on Zeta Oph (Hawkins et al., 1985) and used to estimate the C isotope ratio of the ISM near the sun. The results are presented in extensive tables and graphs and characterized in detail. The (C-12)H(+)/(C-13)H(+) abundance ratios toward the five stars are found to agree to within 12 percent and shown to be representative of the C-12/C-13 ratios in the gas, strongly indicating that the local ISM is homogeneous. The difference between the ISM ratio (43 + or - 4) and the solar-system value (89) is attributed to the chemical evolution of the ISM in the 4.9 Gyr since the formation of the sun. 78 references

  19. Neurological disease mutations compromise a C-terminal ion pathway in the Na(+)/K(+)-ATPas

    DEFF Research Database (Denmark)

    Poulsen, Hanne; Khandelia, Himanshu; Morth, Jens Preben

    2010-01-01

    severe neurological diseases. This novel model for ion transport by the Na(+)/K(+)-ATPase is established by electrophysiological studies of C-terminal mutations in familial hemiplegic migraine 2 (FHM2) and is further substantiated by molecular dynamics simulations. A similar ion regulation is likely...

  20. Neurological disease mutations compromise a C-terminal ion pathway in the Na(+)/K(+)-ATPase

    DEFF Research Database (Denmark)

    Poulsen, Hanne; Khandelia, Himanshu; Morth, J Preben

    2010-01-01

    severe neurological diseases. This novel model for ion transport by the Na(+)/K(+)-ATPase is established by electrophysiological studies of C-terminal mutations in familial hemiplegic migraine 2 (FHM2) and is further substantiated by molecular dynamics simulations. A similar ion regulation is likely...

  1. Induction of system A amino acid transport activity through long-term treatment with ouabain: possible correlation with enhanced (Na/sup +//K/sup +/)ATPase activity

    Energy Technology Data Exchange (ETDEWEB)

    Schenerman, M.A.; Leister, K.J.; Wang, S.Y.; Racker, E.

    1987-05-01

    Mouse embryo fibroblast cells (C3H-10T1/2) and the methylcholanthrene-transformed derivative (MCA-10T1/2) were treated with basal modified Eagles medium at varying ouabain concentrations ranging from 0.05 mM to 0.5 mM for 16 h in culture. After replacing the ouabain-containing medium with BME, System A (/sup 3/H-AlB uptake) and the (Na/sup +//K/sup +/)ATPase pump activity (ouabain-sensitive /sup 86/Rb/sup +/ uptake) was increased 10-fold and 3-fold, respectively (at 0.4 mM ouabain) in confluent C3H-10T1/2 cells. System A and the (Na/sup +//K/sup +/)ATPase activity was increased 15-fold and 5-fold, respectively in confluent MCA-10T1/2 cells but the increase was maximal at 0.2 mM ouabain. This treatment with ouabain increased the (Na/sup +/)/sub i//(K/sup +/)/sub i/ as measured by atomic absorption, and thereby decreased the Na/sup +/ and K/sup +/ electrochemical gradients. Their data show that the transformed cells were more sensitive to the internal ion inversion by ouabain than the C3H-10T1/2 cells. It appears, from data on hypertonicity and lipophilic cations that neither the chemical Na/sup +/ gradient nor the negative membrane potential are the primary driving forces of System A transport.

  2. Perovskites Ba/sub 2/Bsub(1/2)sup(I)Bsub(1/2)sup(III)Usup(VI)O/sub 6/

    Energy Technology Data Exchange (ETDEWEB)

    Roller, H; Kemmler-Sack, S [Tuebingen Univ. (Germany, F.R.). Inst. fuer Chemie

    1978-11-01

    Compounds of type Ba/sub 2/Lisub(1/2)Bsub(1/2)sup(III)Usup(VI)O/sub 6/ and Ba/sub 2/Nasub(1/2)Bsub(1/2)sup(III)Usup(VI)O/sub 6/ are formed with Bsup(III) = La, Nd, Sm, Gd, Y, In as red to reddish brown perovskites. They are for Bsup(III) = La, Nd and Sm polymorphic. With Bsup(III) = La both HT-forms crystallize cubic. In the Li series the HT-modifications with Bsup(III) = Nd, Sm are monoclinic (a < c/..sqrt..2 < b) and in the Na series rhombic (c/..sqrt..2 < a < b); the corresponding Gd, Y, and In compounds have the same structure. The transformation HT ..-->.. TT is reversible. The TT modifications crystallize monoclinic (a < b < c/..sqrt..2). Unlike the HT forms an increase of c and a decrease of a and b is observed, the cell volumina rested nearly unchanged. The origin for the transformation are order disorder phenomena.

  3. 11 CFR 100.11 - State (2 U.S.C. 431(12)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false State (2 U.S.C. 431(12)). 100.11 Section 100.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) General Definitions § 100.11 State (2 U.S.C. 431(12)). State means each State of the United States, the District of...

  4. Leucine Modulates Mitochondrial Biogenesis and SIRT1-AMPK Signaling in C2C12 Myotubes

    Directory of Open Access Journals (Sweden)

    Chunzi Liang

    2014-01-01

    Full Text Available Previous studies from this laboratory demonstrate that dietary leucine protects against high fat diet-induced mitochondrial impairments and stimulates mitochondrial biogenesis and energy partitioning from adipocytes to muscle cells through SIRT1-mediated mechanisms. Moreover, β-hydroxy-β-methyl butyrate (HMB, a metabolite of leucine, has been reported to activate AMPK synergistically with resveratrol in C2C12 myotubes. Therefore, we hypothesize that leucine-induced activation of SIRT1 and AMPK is the central event that links the upregulated mitochondrial biogenesis and fatty acid oxidation in skeletal muscle. Thus, C2C12 myotubes were treated with leucine (0.5 mM, alanine (0.5 mM, valine (0.5 mM, EX527 (SIRT1 inhibitor, 25 μM, and Compound C (AMPK inhibitor, 25 μM alone or in combination to determine the roles of AMPK and SIRT1 in leucine-modulation of energy metabolism. Leucine significantly increased mitochondrial content, mitochondrial biogenesis-related genes expression, fatty acid oxidation, SIRT1 activity and gene expression, and AMPK phosphorylation in C2C12 myotubes compared to the controls, while EX527 and Compound C markedly attenuated these effects. Furthermore, leucine treatment for 24 hours resulted in time-dependent increases in cellular NAD+, SIRT1 activity, and p-AMPK level, with SIRT1 activation preceding that of AMPK, indicating that leucine activation of SIRT1, rather than AMPK, is the primary event.

  5. Phase-shift-analysis approach to elastic neutron scattering from 12C between 9 and 12 MeV

    International Nuclear Information System (INIS)

    Tornow, W.

    1985-01-01

    The excitation energy, spin and parity of levels in 13 C have been determined for excitation energies between 13 and 16 MeV via a phase-shift analysis of the measured total cross section, elastic differential cross section and analysing power for n + 12 C in the neutron energy range from 8.9 to 12.0 MeV. New analysing power measurements are reported for this energy range. The present and previous experimental data are well described by the phase shifts obtained. The non-elastic cross section for n + 12 C predicted from the phase shifts is in good agreement with the ENDF/B-V evaluation. The need for further experimental data is pointed out. (author)

  6. Glucose-assisted synthesis of Na3V2(PO4)3/C composite as an electrode material for high-performance sodium-ion batteries

    Science.gov (United States)

    Li, Guangqiang; Jiang, Danlu; Wang, Hui; Lan, Xinzheng; Zhong, Honghai; Jiang, Yang

    2014-11-01

    A novel electrode material for sodium-ion batteries (NIBs), Na3V2(PO4)3 with a rhombohedral, Na+ superionic conductor (NASICON)-type structure, was synthesised via a solid-state carbon-thermal reduction reaction assisted by mechanochemical activation. Electron microscopy analysis showed that the synthesised Na3V2(PO4)3 particles had an average size of 300 nm, being coated with a uniform layer of carbon 3 nm in thickness. As a cathode material, Na3V2(PO4)3/C exhibited an initial specific discharge capacity of 98.17 mAh g-1 at 0.1C for potentials ranging from 2.5 to 3.8 V. This was owing to the V3+/V4+ redox couple, which corresponded to the two-phase transition between Na3V2(PO4)3 and NaV2(PO4)3. The cathode lost 4.92% of its discharge specific capacity after 50 cycles. As an anode material, Na3V2(PO4)3/C exhibited an initial specific discharge capacity of 63.2 mAh g-1 at 0.1C for potentials ranging from 1.0 to 2.5 V. This was owing to the V2+/V3+ redox couple, which corresponded to the two-phase transition between Na3V2(PO4)3 and Na4V2(PO4)3. The anode lost approximately 5.41% of its discharge specific capacity after 50 cycles. The three-dimensional channel structure of NaV2(PO4)3 and the changes induced in its lattice parameters during the charge/discharge processes were simulated on the basis of density functional theory.

  7. Fusion hindrance for the positive Q -value system 12C+30Si

    Science.gov (United States)

    Montagnoli, G.; Stefanini, A. M.; Jiang, C. L.; Hagino, K.; Galtarossa, F.; Colucci, G.; Bottoni, S.; Broggini, C.; Caciolli, A.; Čolović, P.; Corradi, L.; Courtin, S.; Depalo, R.; Fioretto, E.; Fruet, G.; Gal, A.; Goasduff, A.; Heine, M.; Hu, S. P.; Kaur, M.; Mijatović, T.; Mazzocco, M.; Montanari, D.; Scarlassara, F.; Strano, E.; Szilner, S.; Zhang, G. X.

    2018-02-01

    Background: The fusion reaction 12C+30Si is a link between heavier cases studied in recent years, and the light heavy-ion systems, e.g., 12C+12C , 16O+16O that have a prominent role in the dynamics of stellar evolution. 12C+30Si fusion itself is not a relevant process for astrophysics, but it is important to establish its behavior below the barrier, where couplings to low-lying collective modes and the hindrance phenomenon may determine the cross sections. The excitation function is presently completely unknown below the barrier for the 12C+30Si reaction, thus no reliable extrapolation into the astrophysical regime for the C+C and O+O cases can be performed. Purpose: Our aim was to carry out a complete measurement of the fusion excitation function of 12C+30Si from well below to above the Coulomb barrier, so as to clear up the consequence of couplings to low-lying states of 30Si, and whether the hindrance effect appears in this relatively light system which has a positive Q value for fusion. This would have consequences for the extrapolated behavior to even lighter systems. Methods: The inverse kinematics was used by sending 30Si beams delivered from the XTU Tandem accelerator of INFN-Laboratori Nazionali di Legnaro onto thin 12C (50 μ g /cm2 ) targets enriched to 99.9 % in mass 12. The fusion evaporation residues (ER) were detected at very forward angles, following beam separation by means of an electrostatic deflector. Angular distributions of ER were measured at Ebeam=45 , 59, and 80 MeV, and they were angle integrated to derive total fusion cross sections. Results: The fusion excitation function of 12C+30Si was measured with high statistical accuracy, covering more than five orders of magnitude down to a lowest cross section ≃3 μ b . The logarithmic slope and the S factor have been extracted and we have convincing phenomenological evidence of the hindrance effect. These results have been compared with the calculations performed within the model that

  8. Observation of. lambda. -hypernuclei in the reaction /sup 12/C(. pi. /sup +/,K/sup +/)/sub. lambda. //sup 12/C

    Energy Technology Data Exchange (ETDEWEB)

    Milner, E.C.

    1985-12-01

    The observation of ..lambda..-hypernuclear levels in /sub ..lambda..//sup 12/C by associated production through the (..pi../sup +/,K/sup +/) reaction is reported. Spectrometers used in the measurements are discussed. The /sub ..lambda..//sup 12/C excitation energy spectra were recorded at laboratory scattering angles of 5.6/sup 0/, 10.3/sup 0/, and 15.2/sup 0/. The spectra show two major peaks - one attributed to the ground state, and one about 11 MeV higher in excitation. The peak near 11 MeV excitation energy is believed to be almost entirely composed of a multiplet of three J/sup ..pi../ = 2/sup +/ states. Relativistic DWBA calculations imply support for the expectation that higher spin states are preferentially populated in the (..pi../sup +/,K/sup +/) reaction, compared to the (K/sup -/,..pi../sup -/) reaction in which lower spin states are excited. 29 refs., 40 figs.

  9. Effects of strong electron correlations in Ti8C12 Met-Car

    International Nuclear Information System (INIS)

    Varganov, Sergey A.; Gordon, Mark S.

    2006-01-01

    The results of multireference configuration interaction (MRCI) with single and double excitations and single reference coupled cluster (CCSD(T)) calculations on Ti 8 C 12 metallocarbohedryne (Met-Car) are reported. The distortions of the T d structure to D 2d and C 3v structures due to the Jahn-Teller effect are studied. It is shown that the Ti 8 C 12 wave function has significant multireference character. The choice of the active space for multireference self-consistent field (MCSCF) calculations is discussed. The failure of multireference perturbation theory with a small active space is attributed to multiple intruder states. A new, novel type of MCSCF calculation, ORMAS (occupation restricted multiple active spaces) with a large active space are carried out for several electronic states of Ti 8 C 12 . The Jahn-Teller distorted D 2d 1 A 1 (nearly T d ) structure is predicted to be the Ti 8 C 12 ground state. Predictions of the Ti 8 C 12 ionization potential with different ab initio methods are presented

  10. The analyzing power Asub(y)[(theta) for 12C(n,nsub(0,1))12C betwen 8.9 and] 14.9 MeV neutron energy

    International Nuclear Information System (INIS)

    Woye, E.; Tornow, W.; Mack, G.; Clegg, T.B.; Wylie, W.

    1983-01-01

    The analyzing power Asub(#betta#)(theta) for 12 C(n,n) 12 C elastic scattering and for inelastic scattering to the first excited state (Jsup(π) = 2 + , Q = -4.44 MeV) of 12 C was measured in the energy range from 8.9 to 14.9 MeV in 1 MeV steps. A pulsed polarized neutron beam was produced via the 2 H(d vector,n vector) 3 He polarization transfer reaction. Monte Carlo simulations were used to correct the data for finite geometry and multiple scattering effects. The Asub(#betta#) data, together with publsihed cross-section data, were analyzed in the framework of the spherical optical model and in the coupled-channels formalism. A good description of the data has been achieved. (orig.)

  11. Stabilized antiferroelectric phase in lanthanum-doped (Na1/2Bi1/2)TiO3

    Science.gov (United States)

    Yi, Jae Yun; Lee, Jung-Kun

    2011-10-01

    Phase transition behaviour of La-modified sodium bismuth titanate ceramics [(Na0.5Bi0.5)1-1.5xV0.5xLax]TiO3 (NBLT) was investigated. The two anomalies in ɛr(T) and DSC analysis indicated that lower temperature phase transitions below 200 °C became pronounced with La additions. The polarization relaxation of ɛr(T) and double hysteresis loops showed that the intermediate region between two dielectric anomalies was the antiferroelectric modulated phase. The origin of the modulated antiferroelectric state was discussed in terms of disordering effects of the La ions and cation vacancies. With increasing La content, the long-range symmetry of the dipoles in the ferroelectric phase was disturbed in the intermediate region. The competition between rhombohedral ferroelectric phase and tetragonal paraelectric phase contributed to the formation of a modulated antiferroelectric phase in NBLT ceramics.

  12. Stabilized antiferroelectric phase in lanthanum-doped (Na1/2Bi1/2)TiO3

    International Nuclear Information System (INIS)

    Yi, Jae Yun; Lee, Jung-Kun

    2011-01-01

    Phase transition behaviour of La-modified sodium bismuth titanate ceramics [(Na 0.5 Bi 0.5 ) 1-1.5x V 0.5x La x ]TiO 3 (NBLT) was investigated. The two anomalies in ε r (T) and DSC analysis indicated that lower temperature phase transitions below 200 deg. C became pronounced with La additions. The polarization relaxation of ε r (T) and double hysteresis loops showed that the intermediate region between two dielectric anomalies was the antiferroelectric modulated phase. The origin of the modulated antiferroelectric state was discussed in terms of disordering effects of the La ions and cation vacancies. With increasing La content, the long-range symmetry of the dipoles in the ferroelectric phase was disturbed in the intermediate region. The competition between rhombohedral ferroelectric phase and tetragonal paraelectric phase contributed to the formation of a modulated antiferroelectric phase in NBLT ceramics.

  13. Synthesis and structural characterization of luminescent inorganic materials of the type CS2NaErBr6 and CS2NaHoBr6

    International Nuclear Information System (INIS)

    Poblete, V.H.; Fack, G.

    2001-01-01

    The synthesis and structural characterization is described of two luminescent materials, with technological [1] and spectroscopic [2] interest, whose crystallographic charts have not been published in the literature. The synthesis of both systems: Cs 2 NaErBr 6 and CS 2 NaHoBr 6 , was done using solid state reactions in a controlled environment. The thermal analyses DTA/TGA, applied with a temperature gradient of 10 o C/min., established crystallization ranges of 490,4 o C to 545,4 o C, for the elpasolite CS 2 NaHoBr 6 and 501 o C to 556 o C, for the structure CS 2 NaErBr 6 .. The heat vacuum treatments were carried out at 505 o C and 526 o C respectively, obtaining optimum crystallization. The structural characterization was performed with powdered X-ray diffraction (XRD). The range between 12 o and 80 o (2θ), was analyzed for 3352 points, measured steps of 0.02 o (2θ using the Rietveld profile refining program. The following crystallographic parameters were established: a 0 = 11,279(1), and 11,293(4) Angstroms, for the two structures analyzed, respectively. The relationship R exp wp in both cases is highly accurate for the 32 test lines that were analyzed. The structures present cubic closed packing Cs 1+ 3 Cl 1- , with Ho 3+ and Er 3+ atoms, filling the octahedral holes. The test data obtained will be very useful for completing the mass of experimental data needed to develop the design engineering, with specific applications for luminescent devices

  14. A P2-Type Layered Superionic Conductor Ga-Doped Na2 Zn2 TeO6 for All-Solid-State Sodium-Ion Batteries.

    Science.gov (United States)

    Li, Yuyu; Deng, Zhi; Peng, Jian; Chen, Enyi; Yu, Yao; Li, Xiang; Luo, Jiahuan; Huang, Yangyang; Zhu, Jinlong; Fang, Chun; Li, Qing; Han, Jiantao; Huang, Yunhui

    2018-01-24

    Here, a P2-type layered Na 2 Zn 2 TeO 6 (NZTO) is reported with a high Na + ion conductivity ≈0.6×10 -3  S cm -1 at room temperature (RT), which is comparable to the currently best Na 1+n Zr 2 Si n P 3-n O 12 NASICON structure. As small amounts of Ga 3+ substitutes for Zn 2+ , more Na + vacancies are introduced in the interlayer gaps, which greatly reduces strong Na + -Na + coulomb interactions. Ga-substituted NZTO exhibits a superionic conductivity of ≈1.1×10 -3  S cm -1 at RT, and excellent phase and electrochemical stability. All solid-state batteries have been successfully assembled with a capacity of ≈70 mAh g -1 over 10 cycles with a rate of 0.2 C at 80 °C. 23 Na nuclear magnetic resonance (NMR) studies on powder samples show intra-grain (bulk) diffusion coefficients D NMR on the order of 12.35×10 -12  m 2  s -1 at 65 °C that corresponds to a conductivity σ NMR of 8.16×10 -3  S cm -1 , assuming the Nernst-Einstein equation, which thus suggests a new perspective of fast Na + ion conductor for advanced sodium ion batteries. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Nano-jewellery: C5Au12--a gold-plated diamond at molecular level.

    Science.gov (United States)

    Naumkin, F

    2006-06-07

    A mixed carbon-metal cluster is designed by combining the tetrahedral C(5) radical (with a central atom-the skeleton of the C(5)H(12) molecule) and the spherical Au(12) layer (the external atomic shell of the Au(13) cluster). The C(5)Au(12) cluster and its negative and positive ionic derivatives, C(5)Au(12)(+/-), are investigated ab initio (DFT) in terms of optimized structures and relative energies of a few spin-states, for the icosahedral-like and octahedral-like isomers. The cluster is predicted to be generally more stable in its octahedral shape (similar to C(5)H(12)) which prevails for the negative ion and may compete with the icosahedral shape for the neutral system and positive ion. Adiabatic ionization energies (AIE) and electron affinities (AEA) of C(5)Au(12), vertical electron-detachment (VDE) energies of C(5)Au(12)(-), and vertical ionization and electron-attachment energies (VIE, VEA) of C(5)Au(12) are calculated as well, and compared with those for the corresponding isomers of the Au(13) cluster. The AIE and VIE values are found to be close for the two systems, while the AEA and VDE values are significantly reduced for the radical-based species. A simple fragment-based model is proposed for the decomposition of the total interaction into carbon-gold and gold-gold components.

  16. The mobility of Nb in rutile-saturated NaCl- and NaF-bearing aqueous fluids from 1–6.5 GPa and 300–800 °C

    Energy Technology Data Exchange (ETDEWEB)

    Tanis, Elizabeth A.; Simon, Adam; Tschauner, Oliver; Chow, Paul; Xiao, Yuming; Burnley, Pamela; Cline II, Christopher J.; Hanchar, John M.; Pettke, Thomas; Shen, Guoyin; Zhao, Yusheng (MUN); (Michigan); (CIW); (UNLV); (Bern)

    2015-08-26

    Rutile (TiO₂) is an important host phase for high field strength elements (HFSE) such as Nb in metamorphic and subduction zone environments. The observed depletion of Nb in arc rocks is often explained by the hypothesis that rutile sequesters HFSE in the subducted slab and overlying sediment, and is chemically inert with respect to aqueous fluids evolved during prograde metamorphism in the forearc to subarc environment. However, field observations of exhumed terranes, and experimental studies, indicate that HFSE may be soluble in complex aqueous fluids at high pressure (i.e., >0.5 GPa) and moderate to high temperature (i.e., >300 °C). In this study, we investigated experimentally the mobility of Nb in NaCl- and NaF-bearing aqueous fluids in equilibrium with Nb-bearing rutile at pressure-temperature conditions applicable to fluid evolution in arc environments. Niobium concentrations in aqueous fluid at rutile saturation were measured directly by using a hydrothermal diamond-anvil cell (HDAC) and synchrotron X-ray fluorescence (SXRF) at 2.1 to 6.5 GPa and 300–500 °C, and indirectly by performing mass loss experiments in a piston-cylinder (PC) apparatus at ~1 GPa and 700–800 °C. The concentration of Nb in a 10 wt% NaCl aqueous fluid increases from 6 to 11 μg/g as temperature increases from 300 to 500 °C, over a pressure range from 2.1 to 2.8 GPa, consistent with a positive temperature dependence. The concentration of Nb in a 20 wt% NaCl aqueous fluid varies from 55 to 150 μg/g at 300 to 500 °C, over a pressure range from 1.8 to 6.4 GPa; however, there is no discernible temperature or pressure dependence. The Nb concentration in a 4 wt% NaF-bearing aqueous fluid increases from 180 to 910 μg/g as temperature increases from 300 to 500 °C over the pressure range 2.1 to 6.5 GPa. The data for the F-bearing fluid indicate that the Nb content of the fluid exhibits a dependence on temperature between 300 and 500 °C at ≥2 GPa, but there is no observed

  17. MicroRNA, miR-374b, directly targets Myf6 and negatively regulates C2C12 myoblasts differentiation

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Zhiyuan; Sun, Xiaorui; Xu, Dequan; Xiong, Yuanzhu; Zuo, Bo, E-mail: zuobo@mail.hzau.edu.cn

    2015-11-27

    Myogenesis is a complex process including myoblast proliferation, differentiation and myotube formation and is controlled by myogenic regulatory factors (MRFs), MyoD, MyoG, Myf5 and Myf6 (also known as MRF4). MicroRNA is a kind of ∼22 nt-long non-coding small RNAs, and act as key transcriptional or post-transcriptional regulators of gene expression. Identification of miRNAs involved in the regulation of muscle genes could improve our understanding of myogenesis process. In this study, we investigated the regulation of Myf6 gene by miRNAs. We showed that miR-374b specifically bound to the 3'untranslated region (UTR) of Myf6 and down-regulated the expression of Myf6 gene at both mRNA and protein level. Furthermore, miR-374b is ubiquitously expressed in the tissues of adult C57BL6 mouse, and the mRNA abundance increases first and then decreases during C2C12 myoblasts differentiation. Over-expression of miR-374b impaired C2C12 cell differentiation, while inhibiting miR-374b expression by 2′-O-methyl antisense oligonucleotides promoted C2C12 cell differentiation. Taken together, our findings identified miR-374b directly targets Myf6 and negatively regulates myogenesis. - Highlights: • MiR-374b directly targets 3′UTR of Myf6. • MiR-374b negatively regulates Myf6 in C2C12 cells. • MiR-374b abundance significiently changes during C2C12 cells differentiation. • MiR-374b negatively regulates C2C12 cells differentiation.

  18. Cyclic electric field response of morphotropic Bi{sub 1/2}Na{sub 1/2}TiO{sub 3}-BaTiO{sub 3} piezoceramics

    Energy Technology Data Exchange (ETDEWEB)

    Hinterstein, M. [School of Materials Science and Engineering, UNSW Australia, 2052 Sydney (Australia); Institute for Applied Materials, Karlsruhe Institute of Technology, P.O. Box 3640, 76021 Karlsruhe (Germany); Schmitt, L. A. [Institute for Applied Materials, Karlsruhe Institute of Technology, P.O. Box 3640, 76021 Karlsruhe (Germany); Department of Materials and Geoscience, Technische Universität Darmstadt, 64287 Darmstadt (Germany); Hoelzel, M. [Heinz Maier Leibnitz Zentrum (MLZ), Technische Universität München, 85747 Garching (Germany); Jo, W. [School of Materials Science and Engineering, Ulsan National Institute of Science and Technology, Ulsan 689-798 (Korea, Republic of); Rödel, J.; Kleebe, H.-J. [Department of Materials and Geoscience, Technische Universität Darmstadt, 64287 Darmstadt (Germany); Hoffman, M. [School of Mechanical and Manufacturing Engineering, UNSW Australia, 2052 Sydney (Australia)

    2015-06-01

    In this study, the evolution of field induced mechanisms in lead-free piezoelectric ceramics (1−x)Bi{sub 1/2}Na{sub 1/2}TiO{sub 3}-xBaTiO{sub 3} with x = 0.06 and 0.07 was investigated by transmission electron microscopy, neutron, and X-ray diffraction. Preliminary investigations revealed a strong degradation of macroscopic electromechanical properties within the first 100 bipolar electric cycles. Therefore, this structural investigation focuses on a comparative diffraction study of freshly prepared, poled, and fatigued specimens. Transmission electron microscopy and neutron diffraction of the initial specimens reveal the coexistence of a rhombohedral and a tetragonal phase with space group R3c and P4bm, respectively. In situ electric field X-ray diffraction reveals a pronounced field induced phase transition from a pseudocubic state to a phase composition of significantly distorted phases upon poling with an external electric field of 4 kV/mm. Although the structures of the two compositions are pseudocubic and almost indistinguishable in the unpoled virgin state, the electric field response shows significant differences depending on composition. For both compositions, the application of an electric field results in a field induced phase transition in the direction of the minority phase. Electric cycling has an opposite effect on the phase composition and results in a decreased phase fraction of the minority phase in the fatigued remanent state at 0 kV/mm.

  19. A lower limit on the surface C-12/C-13 ratio in Alpha Orionis

    Science.gov (United States)

    Gautier, T. N., III; Fink, U.; Larson, H. P.; Thompson, R. I.

    1976-01-01

    The second overtone CO bands near 1.6 microns were analyzed in Alpha Ori using synthetic spectra. No firm identification of (C-13)O was made, which allowed a lower limit of 20 to be set on the C-12/C-13 ratio. A rather low microturbulent velocity of 2 km/s was found to match the spectrum of Alpha Ori best.

  20. Phase equilibria in the NaF-CdO-NaPO{sub 3} system at 873 K and crystal structure and physico-chemical characterizations of the new Na{sub 2}CdPO{sub 4}F fluorophosphate

    Energy Technology Data Exchange (ETDEWEB)

    Aboussatar, Mohamed [Université Clermont Auvergne, Université Blaise Pascal, Institut de Chimie de Clermont-Ferrand, UMR 6296 CNRS, BP 10448, F-63000 Clermont-Ferrand (France); Laboratoire de Physico-Chimie de l’État Solide, Faculté des Sciences de Sfax, Université de Sfax, BP 1171, 3000 Sfax (Tunisia); Mbarek, Aïcha [Laboratoire de Chimie Industrielle, Ecole Nationale d’Ingénieurs de Sfax, Université de Sfax, BP W3038, 3000 Sfax (Tunisia); Naili, Houcine [Laboratoire de Physico-Chimie de l’État Solide, Faculté des Sciences de Sfax, Université de Sfax, BP 1171, 3000 Sfax (Tunisia); El-Ghozzi, Malika [Université Clermont Auvergne, Université Blaise Pascal, Institut de Chimie de Clermont-Ferrand, UMR 6296 CNRS, BP 10448, F-63000 Clermont-Ferrand (France); Chadeyron, Geneviève [Université Clermont Auvergne, Institut de Chimie de Clermont-Ferrand, UMR 6296 CNRS/UBP/SIGMA, BP 10448, F-63000 Clermont-Ferrand (France); Avignant, Daniel [Université Clermont Auvergne, Université Blaise Pascal, Institut de Chimie de Clermont-Ferrand, UMR 6296 CNRS, BP 10448, F-63000 Clermont-Ferrand (France); Zambon, Daniel, E-mail: Daniel.Zambon@univ-bpclermont.fr [Université Clermont Auvergne, Université Blaise Pascal, Institut de Chimie de Clermont-Ferrand, UMR 6296 CNRS, BP 10448, F-63000 Clermont-Ferrand (France)

    2017-04-15

    Isothermal sections of the diagram representing phase relationships in the NaF-CdO-NaPO{sub 3} system have been investigated by solid state reactions and powder X-ray diffraction. This phase diagram investigation confirms the polymorphism of the NaCdPO{sub 4} side component and the structure of the ß high temperature polymorph (orthorhombic, space group Pnma and unit cell parameters a=9.3118(2), b=7.0459(1), c=5.1849(1) Å has been refined. A new fluorophosphate, Na{sub 2}CdPO{sub 4}F, has been discovered and its crystal structure determined and refined from powder X-ray diffraction data. It exhibits a new 3D structure with orthorhombic symmetry, space group Pnma and unit cell parameters a=5.3731(1), b=6.8530(1), c=12.2691(2) Å. The structure is closely related to those of the high temperature polymorph of the nacaphite Na{sub 2}CaPO{sub 4}F and the fluorosilicate Ca{sub 2}NaSiO{sub 4}F but differs essentially in the cationic repartition since the structure is fully ordered with one Na site (8d) and one Cd site (4c). Relationships with other Na{sub 2}M{sup II}PO{sub 4}F (M{sup II}=Mg, Ca, Mn, Fe, Co, Ni) have been examined and the crystal-chemical and topographical analysis of these fluorophosphates is briefly reviewed. IR, Raman, optical and {sup 19}F, {sup 23}Na, {sup 31}P MAS NMR characterizations of Na{sub 2}CdPO{sub 4}F have been investigated. - Graphical abstract: The structure of the compound Na{sub 2}CdPO{sub 4}F, discovered during the study of the phase relationships in the NaF-CdO-NaPO{sub 3} system, has been determined and compared with other Na{sub 2}M{sup II}PO{sub 4}F fluorophosphates. - Highlights: • XRD analysis of the isothermal section of the NaF-CdO-NaPO{sub 3} system at 923 K. • Rietveld refinement of the high temperature polymorph β-NaCdPO{sub 4}. • Crystal structure of the new Na{sub 2}CdPO{sub 4}F fluorophosphate determined from powder XRD. • Crystal structure - composition relationships of Na{sub 2}M{sup II}PO{sub 4}F compounds

  1. CO2 and 12C:13C Isotopic Ratios on Phoebe and Iapetus

    Science.gov (United States)

    Clark, R. N.; Brown, R. H.; Cruikshank, D. P.

    2016-12-01

    Cassini VIMS has obtained spatially resolved 0.35 to 5.1 micron reflectance spectra of Saturn's satellites beginning with the Phoebe fly-by in 2004 and a close fly-by of Iapetus in 2007. Both surfaces contain relatively abundant CO2. The new (2016 RC19) calibration of VIMS has provided a significant increase in the data quality, such that isotopic absorption bands in CO2 are now well defined. CO2 on Saturn's icy satellites is trapped (Cruikshank et al., 2010, Icarus v206 p561; Pinilla-Alonso et al. 2011, Icarus v211, p75i), predominantly in the dark material (Clark et al. 2012, Icarus v218 p831). Clark et al. modeled the CO2 abundance as 2.8% on Iapetus and 3.7% on Phoebe. The main 12CO2 band in VIMS spectra on Iapetus occurs at 4.253 microns and Phoebe at 4.266 microns. The 13CO2 absorption is strong on Phoebe at 4.367 microns and weak on Iapetus at 4.387 microns. Converting the Phoebe, Iapetus, and a lab reflectance spectrum (of trace H2O-CO2 mixture on a diffuse substrate), we derive preliminary values for the ratio of the equivalent widths of the 12C and 13C absorptions as 19±2 on Phoebe, 82±8 on Iapetus, and 98±10 for the laboratory spectrum. These ratios are related to the 12C/13C ratio, but there may be effects due to intra-molecular and inter-molecular coupling that will contribute to systematic errors in the isotopic abundances derived using equivalent-width measurements that we've yet to quantify. We Believe the effects are small, and will be attempting to quantify them in the future. For comparison, the terrestrial value of the 12C/13C ratio is 90.17, and vibrational coupling may explain the slightly high lab mixture result. The local interstellar medium is 69±15 (Boogert et al., 2000, A&A). Because the CO2 bands on Phoebe and Iapetus dark material have different positions, and because the observed 13C absorption strengths are so different, the surface evolutions must be different. The large enrichment in 13C on Phoebe argues for significant

  2. Na5NbO5 and Na5TaO5 phases

    International Nuclear Information System (INIS)

    Darriet, J.; Maazaz, A.; Bouloux, J.C.; Delmas, C.

    1982-01-01

    New ternary oxides of formulas Na 5 NbO 5 and Na 5 TaO 5 have been prepared. They crystallize in the monoclinic system (space group C2/c). The crystal structure of Na 5 NbO 5 has been determined. It derives from a NaCl-type structure by ordering of the cations and of the oxygen vacancies in the anionic sublattice, the corresponding formula being Nasub(5/6)Nbsub(1/6)Osub(5/6)vacant sub(1/6). Sodium and niobium have a distorted square-pyramidal surrounding. (author)

  3. Dicty_cDB: Contig-U16300-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 632 ) 95999.1 Cold Sweetening C Solanum tuberosum cDNA ... 62 2e-14 3 ( CK280013 ) EST726091 potato abiotic stress cDNA library...(Normalize... 72 6e-18 4 ( CK277106 ) EST723184 potato abiotic stress cDNA library Sola... 56 7e-18 4 ( CK25...na cDNA 5', ... 74 5e-14 4 ( CX082679 ) EHAB017TR E. histolytica Normalized cDNA library ... 52...( CX089904 ) EHAE563TR E. histolytica Normalized cDNA library ... 52 7e-14 4 ( EB...a strain T4 cDNA library. 56 1e-12 4 ( AB077052 ) Nicotiana tabacum NtCK2a3 mRNA for casein kina

  4. Papel de la proteína C reactiva en las enfermedades cardiovasculares

    Directory of Open Access Journals (Sweden)

    Fernando Manzur, MD., FACC

    2011-08-01

    Full Text Available La proteína C-reactiva (PCR, un marcador sensible de inflamación, es un predictor independiente de enfermedad cardiovascular futura (ECV, que es una de las principales causas de muerte en todo el mundo. El papel de la inflamación en esta entidad ha sido bien documentado en la última década, y se ha demostrado inflamación en todas las fases de la aterosclerosis, desde el inicio y el crecimiento, hasta la ruptura de la placa. La PCR es una proteína de fase aguda, altamente sensible como marcador de inflamación general. En estudios experimentales, se ha determinado la presencia de PCR en arterias que presentan lesiones ateroscleróticas. También se ha demostrado que, en forma directa, la PCR induce la producción de otras células inflamatorias y que disminuye la expresión de la óxido nítrico sintetasa. Es decir, desde el punto de vista biológico, la PCR participa en el proceso aterogénico. En adultos, la PCR, detectada con técnicas ultrasensibles (PCRus, se asocia con los factores de riesgo tradicionales y su concentración predice eventos cardiovasculares.

  5. Expert Oracle RAC 12c

    CERN Document Server

    Shamsudeen, Riyaj; Yu, Kai; Farooq, Tariq

    2013-01-01

    Expert Oracle RAC 12c is a hands-on book helping you understand and implement Oracle Real Application Clusters (RAC), and to reduce the total-cost-of-ownership (TCO) of a RAC database. As a seasoned professional, you are probably aware of the importance of understanding the technical details behind the RAC stack. This book provides deep understanding of RAC concepts and implementation details that you can apply toward your day-to-day operational practices. You'll be guided in troubleshooting and avoiding trouble in your installation. Successful RAC operation hinges upon a fast-performing netwo

  6. Study of the excited levels of 11C and 12C by the analysis of protons induced reactions

    International Nuclear Information System (INIS)

    Rihet, Y.

    1984-07-01

    The present work is a study of 11 and 12 C excited states by reactions of non polarised protons on 10 B and 11 B. R-matrix analysis of the 10 B excitation curves in the range E p = 0 to 8 MeV was used to establish parameters of 41 levels in 11 C. Isobaric multiplets of T = 1/2 and T = 3/2 states in A = 11 nuclei are deduced. Analysis of 11 B excitation curves in the E p = 0.5 to 7.4 MeV range led to parameter values of 60 levels in 12 C. T = 1 states in A = 12 isobaric nuclei are discussed [fr

  7. Characteristics of arterial Na-K-ATPase in WKY and SHR

    International Nuclear Information System (INIS)

    Veit, E.I.; Cox, R.H.; Moisey, D.M.

    1986-01-01

    Segments of carotid and tail arteries and thoracic aorta from 12-week old male WKY and SHR were used to study Na-pump activity by 86 Rb-uptake method. Contiguous segments were used for the determination of cell Na content by ion substitution. The ouabain-dependence of maximum Na-pump activity was determined. The EC 50 value of ouabain (approximately 0.1 mM) was not significantly different for WKY and SHR arteries or at any of the three arterial sites. The maximum value of 86 Rb-uptake was significantly larger of all SHR arteries compared to WKY. No significant differences in ouabain-insensitive 86 Rb-uptake was found. No significant differences exist in estimates of cell Na in arteries from the two groups. Segments of arteries were stored in K-free PSS overnight at 2 0 C, and allowed to recover in normal PSS at 37 0 C for varying periods of time. Ouabain-sensitive 86 Rb-uptake and estimates of cell Na were determined during recovery from cold storage. There were no significant differences in the EC 50 value of Na, which produced a half-maximal ouabain-sensitive 86 Rb-uptake between WKY and SHR. The only difference observed in these studies was a larger turnover rate of the Na-pump in arteries from the SHR

  8. Synthesis of 14C analogue of 1,2-diaryl-[2-14C]-pyrroles

    International Nuclear Information System (INIS)

    Saemian, N.; Shirvani, G.; Matloubi, H.

    2007-01-01

    Three 1,2-diaryl pyrroles selective COX-2 inhibitors, 2-(4-fluorophenyl)-5-methyl-1-(4-methylsulfonyl-phenyl)-1H pyrrole, 2-(4-fluorophenyl)-1- [4-(methylsulfonyl) phenyl]-1H-pyrrole and 4-[2-(4-fluorophenyl)-1H-pyrrol-1-yl]benzenesulfon-amide, all three labeled with 14 C in the 2-position were prepared from para-fluoro-benzaldehyde-[carbonyl- 14 C]. (author)

  9. Synthesis and superstructure of La sub(2/3) (Mg sub(1/2)W sub(1/2))O/sub 3/

    Energy Technology Data Exchange (ETDEWEB)

    Torii, Y [Government Industrial Research Inst., Nagoya (Japan)

    1979-10-01

    A new perovskite La sub(2/3)(Mg sub(1/2)W sub(1/2))O/sub 3/ having an orthorhombic multiple-cell was synthesized. The lattice constants were a = 7.8157(5) A, b = 7.8344(6) A and c = 2 x 7.9067(6) A. The superstructure was found to be due to a NaCl-type ordering of B ions as well as an ordering of A-site vacancies.

  10. Activation of cAMP-dependent signaling induces oxidative modification of the cardiac Na+-K+ pump and inhibits its activity.

    Science.gov (United States)

    White, Caroline N; Liu, Chia-Chi; Garcia, Alvaro; Hamilton, Elisha J; Chia, Karin K M; Figtree, Gemma A; Rasmussen, Helge H

    2010-04-30

    Cellular signaling can inhibit the membrane Na(+)-K(+) pump via protein kinase C (PKC)-dependent activation of NADPH oxidase and a downstream oxidative modification, glutathionylation, of the beta(1) subunit of the pump alpha/beta heterodimer. It is firmly established that cAMP-dependent signaling also regulates the pump, and we have now examined the hypothesis that such regulation can be mediated by glutathionylation. Exposure of rabbit cardiac myocytes to the adenylyl cyclase activator forskolin increased the co-immunoprecipitation of NADPH oxidase subunits p47(phox) and p22(phox), required for its activation, and increased superoxide-sensitive fluorescence. Forskolin also increased glutathionylation of the Na(+)-K(+) pump beta(1) subunit and decreased its co-immunoprecipitation with the alpha(1) subunit, findings similar to those already established for PKC-dependent signaling. The decrease in co-immunoprecipitation indicates a decrease in the alpha(1)/beta(1) subunit interaction known to be critical for pump function. In agreement with this, forskolin decreased ouabain-sensitive electrogenic Na(+)-K(+) pump current (arising from the 3:2 Na(+):K(+) exchange ratio) of voltage-clamped, internally perfused myocytes. The decrease was abolished by the inclusion of superoxide dismutase, the inhibitory peptide for the epsilon-isoform of PKC or inhibitory peptide for NADPH oxidase in patch pipette solutions that perfuse the intracellular compartment. Pump inhibition was also abolished by inhibitors of protein kinase A and phospholipase C. We conclude that cAMP- and PKC-dependent inhibition of the cardiac Na(+)-K(+) pump occurs via a shared downstream oxidative signaling pathway involving NADPH oxidase activation and glutathionylation of the pump beta(1) subunit.

  11. High stability of the goldalloy fullerenes: A density functional theory investigation of M12@Au20 (M = Na, Al, Ag, Sc, Y, La, Lu, and Au) clusters

    International Nuclear Information System (INIS)

    Zhang Meng; Feng Xiao-Juan; Zhao Li-Xia; Zhang Hong-Yu; Luo You-Hua

    2012-01-01

    Discovering highly stable metal fullerenes such as the celebrated C 60 is interesting in cluster science as they have potential applications as building blocks in new nanostructures. We here investigated the structural and electronic properties of the fullerenes M 12 @Au 20 (M = Na, Al, Ag, Sc, Y, La, Lu, and Au), using a first-principles investigation with the density functional theory. It is found that these compound clusters possess a similar cage structure to the icosahedral Au 32 fullerene. La 12 @Au 20 is found to be particularly stable among these clusters. The binding energy of La 12 @Au 20 is 3.43 eV per atom, 1.05 eV larger than that in Au 32 . The highest occupied molecular orbital-lowest unoccupied molecular orbital (HOMO-LUMO) gap of La 12 @Au 20 is only 0.31 eV, suggesting that it should be relatively chemically reactive. (condensed matter: structural, mechanical, and thermal properties)

  12. Uso de resíduos industriais na remediação de solo contaminado com cádmio e zinco

    Directory of Open Access Journals (Sweden)

    Marcio Osvaldo Lima Magalhães

    2011-06-01

    Full Text Available Este trabalho teve como objetivo avaliar a utilização de dois resíduos industriais na redução de disponibilidade de zinco e cádmio em solo contaminado. O experimento foi conduzido em casa de vegetação na Universidade Federal Rural do Rio de Janeiro por 225 dias, utilizando-se um substrato contaminado com zinco e cádmio, coletado no pátio de minério do Porto de Itaguaí, e próximo ao local de disposição de resíduo perigoso da Cia Mercantil e Industrial Ingá em Itaguaí, RJ. O substrato foi tratado com dois agentes inertizantes, assim descritos: um resíduo industrial com característica alcalina (Escória de Aciaria em duas doses 4 e 6%, e outro com alto teor de óxido de ferro como adsorvente (Carepa de Laminação, em dose única de 1%. Após o plantio das mudas de Eucalyptus urophylla, foram feitas coletas do substrato em cada unidade experimental para determinação das frações biodisponíveis (extraído com MgCl2 e a não disponível. O substrato não tratado apresentava alto teor de cádmio e zinco na fração biodisponível. Os tratamentos causaram uma redução na disponibilidade desses elementos no solo, evidenciado na absorção diferenciada pelas plantas. Por causa da maior disponibilidade do cádmio e zinco no solo sem adição dos inertizantes, as plantas não resistiram aos altos teores desses elementos e morreram 30 dias após a implantação do experimento. A produção de massa seca foi influenciada positivamente pela aplicação dos agentes inertizantes, apresentando melhor resposta na maior dose de escória de aciaria. A maior dose também propiciou as menores concentrações dos elementos nas plantas, sem provocar deficiência do micronutriente zinco e mantendo o cádmio a níveis não tóxicos para as espécies de eucalipto. Apesar de apresentar menores concentrações de cádmio na dose de 6% de Escória de Aciaria,essa dose resultou na maior extração desse elemento pelas plantas.

  13. A novel energy transfer inducing strong enhancement of electric dipole transition in Na3Mo12PO40:xEu3+ phosphors

    Science.gov (United States)

    Long, Jinqiao; Wang, Tianman; Luo, Zhirong; Gao, Yong; Song, Baoling; Liang, Jing; Liao, Sen; Huang, Yingheng; Zhang, Huaxin

    2017-08-01

    A series of Na3Mo12PO40:xEu3+ phosphors have been successfully synthesized by a solid-state method, and characterized by powder x-ray diffraction (PXRD). The PXRD results confirm that the samples have crystal phases of Na3Mo12PO40. For PL spectra of Na3Mo12PO40:2.0Eu3+ excited by 394 and 465 nm, R (R is the peak area ratio of 5D0  →  7F2 to 5D0  →  7F1) is only 1.46 with an excitation of 394 nm, but increases to 3.03 with an excitation of 465 nm. Furthermore, a new enhancement of electric dipole transition is observed. Emission spectrum (PL) intensity at 617 nm excited by 465 nm is 1.95 times as high as the excitation spectrum (PLE) intensity at 465 nm. Thus, cooperative energy transfers from the magnetic dipole (MD) Eu3+ center to the electric dipole (ED) Eu3+ center when excited by 465 nm is demonstrated for the new fluorescent behavior.

  14. Modification of NaK (Na and K) dissolution device at the L.E.C.I

    International Nuclear Information System (INIS)

    Mansard, Bernard; Ducas, Serge; Riviere, Michel

    1969-12-01

    As three NaK dissolution devices had been operated since 1965 and as irradiation assemblies with a greater capacity (2 to 3 times) are now to be used, the modification of these dissolution devices is addressed. This requires a better control of the dissolution reaction (the NaK + alcohol reaction is highly exothermic and results in an effervescence which requires a greater volume). The objectives are therefore to delay the dissolution, to trigger it, to stop it, to control it at will, and to release heat. The new device is then described with its vessel, its cap, its ball valve, and its two tight sleeves. The operation principle is described, as well as the NaK draining process, and the NaK dissolution. Safety, time saving and raw matter saving issues are finally outlined

  15. HeLa DNA damage response induced by 12C6+ ions

    International Nuclear Information System (INIS)

    Chen Jidong; Li Ning; Zhang Hong; Wu Zhenhua

    2009-01-01

    The aim of this study is to explore the DNA damage response of HeLa irradiated by 12 C 6+ beam and the mechanism of the p53 activation change in this response.In our present study, double strands break(DSB)of HeLa cells irradiated with 12 C 6+ beam were detected through neutral single cell gel electrophoresis, and AO/EB staining was used to detect the apoptosis of irradiated HeLa in 24h irradiation. Moreover, HeLa was pre-treated with caffeine (ATM and ATR inhibiting) or wormannin with certain concentrations (20 μmol/L, ATM and DNA-PK inhibiting) and irradiated with 1Gy of 12 C 6+ beam,and the expression of p53 was detected with Western blot analysis. The results show that DSB of HeLa caused by 12 C 6+ beam increases with absorbed doses and decreases with the time after irradiation. The apoptosis percentage of irradiated HeLa increases with absorbed doses. It has been found that the p53 expression increases after irradiation, but has not significant increment with caffeine or wortmannin pre-treatment in cells.It can be deduced that the p53 activation is ATM-dependent, but not ATR and DNA-PK-dependent in HeLa DNA damage response induced by 12 C 6+ beam. (authors)

  16. Particle-gamma coincidence measurements in /sup 12/C+/sup 12/C and /sup 12/C+Pb collisions at 2. 1 GeV/nucleon incident energy

    Energy Technology Data Exchange (ETDEWEB)

    Roche, G.; Koontz, R.; Mulera, T.; Pugh, H.G.; Schroeder, L.S. (Lawrence Berkeley Lab., CA (USA)); Hallman, T.; Madansky, L. (Johns Hopkins Univ., Baltimore, MD (USA)); Carroll, J. (California Univ., Los Angeles (USA)); Chang, C.C. (Maryland Univ., College Park (USA)); Kirk, P.N.

    1985-06-24

    A particle-gamma coincidence experiment has been performed with a 2.1 GeV per nucleon /sup 12/C beam from the Bevalac. Data were taken with C and Pb targets. The ..gamma..-ray spectra are almost independent of the energy or the kind of charged particles detected in coincidence, mainly protons and deuterons. These ..gamma..-ray spectra are interpreted as resulting from ..pi../sup 0/ decay, and are consistent with known ..pi../sup 0/ production rates. A search for a possible decay of singly-charged anomalons into a gamma and a deuteron (or unbound proton-neutron system) has been done by studying the ..gamma..p and ..gamma..d invariant mass distributions. The upper limits for such a process are found to be 2 to 20% of the deuteron production rate, for anomalon masses for 200 to 400 MeV above the deuteron mass, with an anomalon mean lifetime of up to 10/sup -9/ s, depending on which kind of decay process is considered.

  17. Na,K-ATPase regulates intercellular communication in the vascular wall via cSrc kinase dependent connexin43 phosphorylation

    DEFF Research Database (Denmark)

    Hangaard, Lise; Bouzinova, Elena; Stæhr, Christian Albeck

    2017-01-01

    Communication between vascular smooth muscle cells (VSMCs) is dependent on gap junctions and is regulated by the Na-K-ATPase. The Na-K-ATPase is therefore important for synchronized VSMC oscillatory activity, i.e., vasomotion. The signaling between the Na-K-ATPase and gap junctions is unknown. We...... coupling in rat mesenteric small arteries in vitro. Phosphorylation of cSrc kinase and connexin43 (Cx43) were semiquantified by Western blotting. Micromole concentration of ouabain reduced the amplitude of norepinephrine-induced vasomotion and desynchronized Ca2+ transients in VSMC in the arterial wall...

  18. AB INITIO INVESTIGATION OF 12-CROWN-4 AND BENZO-12-CROWN-4 COMPLEXES WITH Li+, Na+, K+, Zn2+, Cd2+, AND Hg2+

    Directory of Open Access Journals (Sweden)

    Yahmin Yahmin

    2010-06-01

    Full Text Available The structure and binding energies of 12-crown-4 and benzo-12-crown-4 complexes with Li+, Na+, K+, Zn2+, Cd2+, and Hg2+were investigated with ab initio calculations using Hartree-Fock approximation and second-order perturbation theory. The basis set used in this study is lanl2mb. The structure optimization of cation-crown ether complexes was evaluated at HF/lanl2mb level of theory and interaction energy of the corresponding complexes was calculated at MP2/lanl2mb level of theory (MP2/lanl2mb//HF/lanl2mb. Interactions of the crown ethers and the cations were discussed in term of the structure parameter of crown ether. The binding energies of the complexes show that all complex formed from transition metal cations is more stable than the complexes formed from alkali metal cations.   Keywords: 12-crown-4, benzo-12-crown-4, alkali metals, transition metals

  19. Current and Future Tests of the Algebraic Cluster Model of12C

    Science.gov (United States)

    Gai, Moshe

    2017-07-01

    A new theoretical approach to clustering in the frame of the Algebraic Cluster Model (ACM) has been developed. It predicts, in12C, rotation-vibration structure with rotational bands of an oblate equilateral triangular symmetric spinning top with a D 3h symmetry characterized by the sequence of states: 0+, 2+, 3-, 4±, 5- with a degenerate 4+ and 4- (parity doublet) states. Our newly measured {2}2+ state in12C allows the first study of rotation-vibration structure in12C. The newly measured 5- state and 4- states fit very well the predicted ground state rotational band structure with the predicted sequence of states: 0+, 2+, 3-, 4±, 5- with almost degenerate 4+ and 4- (parity doublet) states. Such a D 3h symmetry is characteristic of triatomic molecules, but it is observed in the ground state rotational band of12C for the first time in a nucleus. We discuss predictions of the ACM of other rotation-vibration bands in12C such as the (0+) Hoyle band and the (1-) bending mode with prediction of (“missing 3- and 4-”) states that may shed new light on clustering in12C and light nuclei. In particular, the observation (or non observation) of the predicted (“missing”) states in the Hoyle band will allow us to conclude the geometrical arrangement of the three alpha particles composing the Hoyle state at 7.6542 MeV in12C. We discuss proposed research programs at the Darmstadt S- DALINAC and at the newly constructed ELI-NP facility near Bucharest to test the predictions of the ACM in isotopes of carbon.

  20. A practical synthesis of long-chain iso-fatty acids (iso-C12C19 and related natural products

    Directory of Open Access Journals (Sweden)

    Mark B. Richardson

    2013-09-01

    Full Text Available A gram-scale synthesis of terminally-branched iso-fatty acids (iso-C12C19 was developed commencing with methyl undec-10-enoate (methyl undecylenate (for iso-C12C14 or the C15 and C16 lactones pentadecanolide (for iso-C15–C17 and hexadecanolide (for iso-C18–C19. Central to the approaches outlined is the two-step construction of the terminal isopropyl group through addition of methylmagnesium bromide to the ester/lactones and selective reduction of the resulting tertiary alcohols. Thus, the C12, C17 and C18 iso-fatty acids were obtained in three steps from commercially-available starting materials, and the remaining C13–C16 and C19 iso-fatty acids were prepared by homologation or recursive dehomologations of these fatty acids or through intercepting appropriate intermediates. Highlighting the synthetic potential of the iso-fatty acids and various intermediates prepared herein, we describe the synthesis of the natural products (S-2,15-dimethylpalmitic acid, (S-2-hydroxy-15-methylpalmitic acid, and 2-oxo-14-methylpentadecane.

  1. Combined use of EPR and 23Na MAS NMR spectroscopy for assessing the properties of the mixed cobalt-nickel-manganese layers of P3-NayCo1-2xNixMnxO2.

    Science.gov (United States)

    Kalapsazova, M; Ivanova, S; Kukeva, R; Simova, S; Wegner, S; Zhecheva, E; Stoyanova, R

    2017-10-11

    Knowledge on the formation of mixed transition metal layers on lithium and sodium transition metal oxides, Li/Na(Co,Ni,Mn,)O 2 , determines the ability to control their electrochemical properties as electrode materials in alkaline ion batteries. Taking this into account, herein we combine the EPR and 23 Na MAS NMR spectroscopic techniques to gain insights into the structural peculiarities of the mixed cobalt-nickel-manganese layers of Na y Co 1-2x Ni x Mn x O 2 with a three-layer stacking (P3-type) structure. Two types of compositions are examined where diamagnetic Co 3+ and paramagnetic Ni 3+ and Mn 4+ are stabilized: Na 2/3 Co 1/3 Ni 1/3 Mn 1/3 O 2 and Na 1/2 Ni 1/2 Mn 1/2 O 2 . EPR spectroscopy operating in the X- and Q-band region is applied with an aim to improve the spectra resolution and, on the other hand, to provide straightforward information on the coordination of the transition metal ions inside the layers. The analysis of EPR spectra is based on the reference for the Mn 4+ and Ni 2+ ions occurring simultaneously in oxides with two layer stacking, P2-Na 2/3 Ni 1/3 Mn 2/3 O 2 . Complementary to EPR, 23 Na MAS NMR spectroscopy at high spinning rates is undertaken to assess the local structure of the Na nucleus in the layered P3-Na y Co 1-2x Ni x Mn x O 2 oxides. All results are discussed taking into account the EPR and NMR data for the well-known lithium analogues O3-LiCo 1/3 Ni 1/3 Mn 1/3 O 2 and O3-LiNi 1/2 Mn 1/2 O 2 . Finally, the structure peculiarities of the transition metal layers extracted from the EPR and NMR methods are demonstrated by electrochemical intercalation of Li + ions into P3-Na y Co 1-2x Ni x Mn x O 2 .

  2. Importância da resitência insulínica na hepatite C crônica Insulin resistance in chronic hepatitits C

    Directory of Open Access Journals (Sweden)

    Edison Roberto Parise

    2007-06-01

    Full Text Available OBJETIVO: Revisar a importância da resistência insulínica no desenvolvimento da hepatite C crônica e sua interferência na resposta ao tratamento antiviral de pacientes infectados pelo vírus da hepatite C. FONTE DE DADOS: Revisão bibliográfica de trabalhos publicados pelo MEDLINE e dados dos próprios autores. SÍNTESE DE DADOS: Nos últimos anos, grande número de publicações tem demonstrado importante associação entre resistência insulínica e hepatite C crônica. Aumento na prevalência de diabetes mellitus tipo 2, desenvolvimento de esteatose hepática (principalmente nos pacientes com infecção pelo genótipo não-3, progressão mais rápida da doença e redução na taxa de resposta virológica sustentada ao tratamento com interferon peguilado e ribavirina, têm sido todos associados à presença de resistência insulínica nos pacientes infectados pelo vírus da hepatite C. A produção aumentada de fator de necrose tumoral pelo core do vírus da hepatite C é o principal mecanismo responsável pelo aparecimento da resistência insulínica. O fator de necrose tumoral afetaria a fosforilação do substrato do receptor de insulina diminuindo a captação de glicose e acarretando hiperinsulinemia compensatória. Aumento da siderose hepática e alterações dos níveis circulantes das adipocitocinas podem ter efeito adicional sobre a sensibilidade à insulina na hepatite C crônica. CONCLUSÕES: O diagnóstico e o tratamento da resistência insulínica nesses pacientes podem não só evitar o aparecimento das complicações, mas também prevenir a progressão da doença e, possivelmente, aumentar a taxa de resposta virológica sustentada ao tratamento com interferon peguilado e ribavirina.OBJECTIVE: To revise the importance of insulin resistance in the development of chronic hepatitis C and its interference in the response to the antiviral treatment of these patients. DATA SOURCE: Bibliographic revision of published papers in the

  3. Phase Equilibria Study in the TeO2-Na2O-SiO2 System in Air Between 723 K (500 °C) and 1473 K (1200 °C)

    Science.gov (United States)

    Santoso, Imam; Taskinen, Pekka

    2016-08-01

    Knowledge of phase equilibria in the TeO2-Na2O-SiO2 system at elevated temperatures is important for ceramic and glass industries and for improving the operation of the smelting process of tellurium-containing materials. A review of previous investigations has indicated, however, that there are omissions in the available datasets on the liquidus temperatures of the molten TeO2-Na2O-SiO2 mixtures. The employed experimental method included equilibration of mixtures made from high purity oxides, rapid quenching of the equilibrated samples in water and followed by compositional analysis of the phases using an electron probe X-ray microanalyzer. The liquidus and phase equilibria in the TeO2-SiO2, TeO2-Na2O, and SiO2-TeO2-Na2O systems have been studied for a wide range of compositions between 723 K (500 °C) and 1473 K (1200 °C) at TeO2, SiO2, and Na2SiO3 saturations. New data have been generated in the SiO2-TeO2-Na2O system at SiO2 saturation. The liquidus compositions in the TeO2-Na2O system at TeO2 saturation have been compared with the previous data and an assessed phase diagram.

  4. Modelling of phase equilibria in CH4–C2H6–C3H8–nC4H10–NaCl–H2O systems

    International Nuclear Information System (INIS)

    Li, Jun; Zhang, Zhigang; Luo, Xiaorong; Li, Xiaochun

    2015-01-01

    Highlights: • A new model was established for the phase equilibria of C1–C2–C3–nC4–brine systems. • The model can reproduce of hydrocarbon–brine equilibria to high T&P and salinity. • The model can well predict H 2 O solubility in light hydrocarbon rich phases. - Abstract: A thermodynamic model is presented for the mutual solubility of CH 4 –C 2 H 6 –C 3 H 8 –nC 4 H 10 –brine systems up to high temperature, pressure and salinity. The Peng–Robinson model is used for non-aqueous phase fugacity calculations, and the Pitzer model is used for aqueous phase activity calculations. The model can accurately reproduce the experimental solubilities of CH 4 , C 2 H 6 , C 3 H 8 and nC 4 H 10 in water or NaCl solutions and H 2 O solubility in the non-aqueous phase. The experimental data of mutual solubility for the CH 4 –brine subsystem are sufficient for temperatures exceeding 250 °C, pressures exceeding 1000 bar and NaCl molalities greater than 6 molal. Compared to the CH 4 –brine system, the mutual solubility data of C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine are not sufficient. Based on the comparison with the experimental data of H 2 O solubility in C 2 H 6 -, C 3 H 8 - or nC 4 H 10 -rich phases, the model has an excellent capability for the prediction of H 2 O solubility in hydrocarbon-rich phases, as these experimental data were not used in the modelling. Predictions of hydrocarbon solubility (at temperatures up to 200 °C, pressures up to 1000 bar and NaCl molalities greater than 6 molal) were made for the C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine systems. The predictions suggest that increasing pressure generally increases the hydrocarbon solubility in water or brine, especially in the lower-pressure region. Increasing temperature usually decreases the hydrocarbon solubility at lower temperatures but increases the hydrocarbon solubility at higher temperatures. Increasing water salinity dramatically decreases

  5. Clostridium tyrobutyricum strains show wide variation in growth at different NaCl, pH, and temperature conditions.

    Science.gov (United States)

    Ruusunen, Marjo; Surakka, Anu; Korkeala, Hannu; Lindström, Miia

    2012-10-01

    Outgrowth from Clostridium tyrobutyricum spores in milk can lead to butyric acid fermentation in cheeses, causing spoilage and economical loss to the dairy industry. The aim of this study was to investigate the growth of 10 C. tyrobutyricum strains at different NaCl, pH, and temperature conditions. Up to 7.5-fold differences among the maximum growth rates of different strains in the presence of 2.0% NaCl were observed. Five of 10 strains were able to grow in the presence of 3.0% NaCl, while a NaCl concentration of 3.5% was completely inhibitory to all strains. Seven of 10 strains were able to grow at pH 5.0, and up to 4- and 12.5-fold differences were observed among the maximum growth rates of different strains at pH 5.5 and 7.5, respectively. The maximum growth temperatures varied from 40.2 to 43.3°C. The temperature of 10°C inhibited the growth of all strains, while 8 of 10 strains grew at 12 and 15°C. Despite showing no growth, all strains were able to survive at 10°C. In conclusion, wide variation was observed among different C. tyrobutyricum strains in their ability to grow at different stressful conditions. Understanding the physiological diversity among the strains is important when designing food control measures and predictive models for the growth of spoilage organisms in cheese.

  6. Existující útoky na SSL/TLS

    OpenAIRE

    Lysoněk, Milan

    2017-01-01

    SSL/TLS je moderní kryptografický protokol, který zabezpečuje komunikaci mezi klientem a serverem. Avšak na tento protokol existují útoky, které mohou ohrozit komunikaci buď odposloucháváním nebo jejím narušením. Obrana proti těmto útokům a testování zranitelností protokolů je ale značně náročný proces. Tato práce popisuje zranitelnosti SSL/TLS protokolu a implementuje vybrané útoky v tlsfuzzeru --- nástroj pro testování SSL/TLS implementací. Výsledná implementace útoků je demonstrována na tř...

  7. Dicty_cDB: VHE642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA clone GR__Ea43H12 3', mRNA sequence. 58 6e-17 4 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle s...unflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 72 2e-16 4 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle

  8. Phase-shift-analysis approach to elastic neutron scattering from /sup 12/C between 9 and 12 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Tornow, W. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Walter, R.L.; Byrd, R.C. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))

    1985-03-01

    The excitation energy, spin and parity of levels in /sup 13/C have been determined for excitation energies between 13 and 16 MeV via a phase-shift analysis of the measured total cross section, elastic differential cross section and analysing power for n + /sup 12/C in the neutron energy range from 8.9 to 12.0 MeV. New analysing power measurements are reported for this energy range. The present and previous experimental data are well described by the phase shifts obtained. The non-elastic cross section for n + /sup 12/C predicted from the phase shifts is in good agreement with the ENDF/B-V evaluation. The need for further experimental data is pointed out.

  9. Changes in vegetation phenology are not reflected in atmospheric CO2 and 13 C/12 C seasonality.

    Science.gov (United States)

    Gonsamo, Alemu; D'Odorico, Petra; Chen, Jing M; Wu, Chaoyang; Buchmann, Nina

    2017-10-01

    Northern terrestrial ecosystems have shown global warming-induced advances in start, delays in end, and thus increased lengths of growing season and gross photosynthesis in recent decades. The tradeoffs between seasonal dynamics of two opposing fluxes, CO 2 uptake through photosynthesis and release through respiration, determine the influence of the terrestrial ecosystem on the atmospheric CO 2 and 13 C/ 12 C seasonality. Here, we use four CO 2 observation stations in the Northern Hemisphere, namely Alert, La Jolla, Point Barrow, and Mauna Loa Observatory, to determine how changes in vegetation productivity and phenology, respiration, and air temperature affect both the atmospheric CO 2 and 13 C/ 12 C seasonality. Since the 1960s, the only significant long-term trend of CO 2 and 13 C/ 12 C seasonality was observed at the northern most station, Alert, where the spring CO 2 drawdown dates advanced by 0.65 ± 0.55 days yr -1 , contributing to a nonsignificant increase in length of the CO 2 uptake period (0.74 ± 0.67 days yr -1 ). For Point Barrow station, vegetation phenology changes in well-watered ecosystems such as the Canadian and western Siberian wetlands contributed the most to 13 C/ 12 C seasonality while the CO 2 seasonality was primarily linked to nontree vegetation. Our results indicate significant increase in the Northern Hemisphere soil respiration. This means, increased respiration of 13 C depleted plant materials cancels out the 12 C gain from enhanced vegetation activities during the start and end of growing season. These findings suggest therefore that parallel warming-induced increases both in photosynthesis and respiration contribute to the long-term stability of CO 2 and 13 C/ 12 C seasonality under changing climate and vegetation activity. The summer photosynthesis and the soil respiration in the dormant seasons have become more vigorous which lead to increased peak-to-through CO 2 amplitude. As the relative magnitude of the increased

  10. 12 CFR Appendix C to Part 360 - Deposit File Structure

    Science.gov (United States)

    2010-01-01

    .... • STATE = State government. • COMM = Commercial. • CORP = Corporate. • BANK = Bank Owned. • DUE TO = Other... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Deposit File Structure C Appendix C to Part 360... RESOLUTION AND RECEIVERSHIP RULES Pt. 360, App. C Appendix C to Part 360—Deposit File Structure This is the...

  11. Measurement of the natural variation of 13C/12C isotope ratio in organic samples

    International Nuclear Information System (INIS)

    Ducatti, C.

    1977-01-01

    The isotopic ratio analysis for 13 C/ 12 C by mass spectrometry using a 'Working standard' allows the study of 13 C natural variation in organic material, with a total analytical error of less than 0,2%. Equations were derived in order to determine 13 C/ 12 C and 18 O/ 16 O ratios related to the 'working standard' CENA-std and to the international standard PDB. Isotope ratio values obtained with samples prepared in two different combustion apparatus were compared; also the values obtained preparing samples by acid decomposition of carbonaceous materials were compared with the values obtained in different international laboratories. Utilizing the methodology proposed, several leaves collected at different heights of different vegetal species, found 'inside' and 'outside' of the Ducke Forest Reserve, located in the Amazon region, are analysed. It is found that the 13 C natural variation depends upon metabolic process and environmental factors, both being factors which may be qualified as parcial influences on the CO 2 cycle in the forest. (author) [pt

  12. Absence of PDGF-induced, PKC-independent c-fos expression in a chemically transformed C3H/10T1/2 cell clone.

    Science.gov (United States)

    Vassbotn, F S; Skar, R; Holmsen, H; Lillehaug, J R

    1992-09-01

    The effect of platelet-derived growth factor (PDGF) on c-fos mRNA transcription was studied in the immortalized mouse embryo fibroblast C3H/10T1/2 Cl 8 (10T1/2) cells and the chemically transformed, tumorigenic subclone C3H/10T1/2 Cl 16 (Cl 16). In the 10T1/2 cells as well as the Cl 16 subclone, the dose-dependent PDGF stimulation of c-fos mRNA synthesis was similar in both logarithmically growing and confluent cultures. c-fos mRNA was induced severalfold by 12-O-tetradecanoylphorbol-13-acetate (TPA) in both 10T1/2 and Cl 16. Down-regulation of protein kinase C (PKC) activity by TPA pretreatment inhibited PDGF-stimulated c-fos mRNA expression in Cl 16 cells but did not affect this induction in the 10T1/2 cells. This inhibition was not a general phenomenon of 3-methylcholanthrene-mediated transformation of 10T1/2 cells since experiments with another transformed 10T1/2 cell clone, C3H/10T1/2 TPA 482, gave qualitatively the same results as the 10T1/2 cells. Receptor binding experiments showed that the nontransformed and transformed cells had a comparable number of PDGF receptors, 1.3 x 10(5) and 0.7 x 10(5) receptors per cell, respectively. Furthermore, cAMP-induced c-fos expression induced by forskolin is formerly shown to be independent of PKC down-regulation. In our experiments, forskolin induced c-fos expression in both clones. However, PKC down-regulation inhibited the forskolin-induced c-fos expression in Cl 16 cells. This apparently demonstrates cross talk between PKC and PKA in the c-fos induction pathway. The present results provide evidence for an impaired mechanism for activating c-fos expression through PKC-independent, PDGF-induced signal transduction in the chemically transformed Cl 16 fibroblasts compared to that in nontransformed 10T1/2 cells.

  13. Study of the 23Na EFG (Electrostatic Field Gradient) tensor on single crystals of Na2S.9H2O by wideline NMR

    International Nuclear Information System (INIS)

    Miksche, G.

    1982-01-01

    The quadrupole coupling constant |e 2 qQ/n| if 23 Na has been determined by measuring single crystals of Na 2 S.9H 2 O at room temperature. A value of 687.5 +- 1.2 kHz was found. The asymmetry parameter eta = (qsub(x'x') - qsub(y'y')) / qsub(z'z') of the efg-tensor is zero, there is axial symmetry. The principle axis of the efg-tensor runs parallel to the main crystallographic axis c, the value of the main component of the efg-tensor in c-direction is 171.875 +- 0.6 kHz. The longitudinal relaxation time T 1 has been evaluated as 1.8 s. On this account, the mean distance between two Na-atoms has been determined by measuring the splitting of the central line due to dipole-dipole interaction. The Na-Na distance was found with 0.36 +- 0.007 nm. This value is in good agreement with results from neutron diffraction studies. It was not possible to determine direction and length of hydrogen bonds by NMR-results. A method of growing single crystals of Na 2 S.9H 2 O of demanded size and purity has been described. Constructional details and technical data of a self-made wideline-NMR-spectrometer are added in an appendix. (Author)

  14. Isotopic signatures (13C/12C; 15N/14N) of blue penguin burrow soil invertebrates : carbon sources and trophic relationships

    International Nuclear Information System (INIS)

    Hawke, D.J.; Clark, J.M.

    2010-01-01

    Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.

  15. Activity of NaOH buffered by silicate solids in molten sodium acetate-water at 3170C

    International Nuclear Information System (INIS)

    Weres, O.; Tsao, L.

    1988-01-01

    Silica and sodium acetate are present in the steam generator tube sheet crevices of many nuclear power plants. Trace solutes in the condensate are tremendously concentrated in the crevices by boiling. Sparingly soluble sodium silicates and other solids precipitate from the crevice liquid leaving an extremely concentrated molten mixture of water, sodium acetate and other salts. The precipitates buffer the activity of sodium hydroxide in the superheated liquid that remains. The activity of NaOH corresponding to the buffers quartz/sodium disilicate and sodium disilicate/sodium metasilicate at 317 0 C has been determined experimentally. The sodium hydroxide content of a sodium acetate-water melt buffered by these reactions was determined by chemical analysis, and the corresponding activity of NaOH at temperature was calculated using the recently published Pitzer-Simonson Model of molten salt-water mixtures. The molten mixture of sodium acetate and water plays the role solvent in these experiments and calculations. The free energies of formation of solid sodium silicates at 317 0 C were also determined. The activity of NaOH corresponding to other silicate and phosphate buffers was calculated using published thermodynamic data and estimated from phase diagrams

  16. Níveis de cálcio e granulometrias do calcário para frangas de reposição no período de 3 a 12 semanas de idade Calcium levels and particle size of limestone for replacement pullets in the period from 3 to 12 weeks old

    Directory of Open Access Journals (Sweden)

    Adriano Geraldo

    2006-02-01

    Full Text Available Realizou-se um experimento com o objetivo de avaliar os efeitos dos níveis de cálcio e das granulometrias do calcário na ração sobre os desenvolvimentos corporal e morfométrico do trato digestório de frangas de reposição. Foram utilizadas 1.400 frangas de reposição da linhagem Lohmann LSL, em delineamento inteiramente casualizado, em esquema fatorial 5 x 2 (níveis de cálcio x granulometrias do calcário, com cinco repetições de 28 e 18 aves por parcela, respectivamente, nos períodos de 3 a 7 e de 8 a 12 semanas de idade. As dietas experimentais, à base de milho, farelo de soja e farelo de trigo (trigo somente na recria, foram formuladas para ser isoprotéicas, isocalóricas e isofosfóricas (fosfato monoamônio. Além da suplementação com minerais, vitaminas e fitase (500 FTU/kg, as dietas foram acrescidas de calcário em granulometrias fina (DGM=0,135 mm e grossa (DGM=0,899 mm para apresentar os níveis de 0,60; 0,75; 0,90; 1,05 e 1,20% de cálcio total na dieta. Avaliaram-se o desempenho no período de 3 a 12 semanas, a morfometria do trato digestório e os teores de cinzas e minerais na tíbia de aves de cada parcela. O consumo de ração aumentou de forma linear com a elevação dos níveis de cálcio. Não houve diferenças significativas no ganho de peso, na conversão alimentar, na porcentagem do trato digestório e no comprimento do metatarso. Maiores teores de cinzas foram obtidos em frangas que receberam o nível de 0,60% de Ca e maior comprimento do intestino delgado em aves recebendo a granulometria grossa. O nível de 0,60% de cálcio e o calcário na granulometria grossa (DGM=0,899 mm foram ideais para o melhor desenvolvimento esquelético, o menor consumo de ração e o maior comprimento do intestino delgado.The effects of feeding different calcium levels and limestone particle sizes on body and morphometric development of the digestive tract in replacement pullets were evaluated in this trial. One thousand and

  17. Search for aligned structure of /sup 12/C-. cap alpha. -/sup 12/C type at high excitation energy in /sup 28/Si. [46 MeV, J,. pi. , resonance, three-body problem

    Energy Technology Data Exchange (ETDEWEB)

    Burnereau, N

    1975-01-01

    The /sup 16/O+/sup 12/C..-->../sup 12/C+..cap alpha..+/sup 12/C reaction is studied mainly at 46MeV (at this energy a state of /sup 28/Si is presumably formed with a spin value of 14/sup +/; resonance of 19.7MeV c.m.). The motivation is to detect an ..cap alpha.. particle with a negligible energy in the c.m. system. This is the signature of the preformation of three aligned clusters in which the average location of the ..cap alpha.. particle is in between the two /sup 12/C's at the center of symmetry of the system. Such a detection is performed by detecting two /sup 12/C's in coincidence at specific angles. The data are understood by three-body calculations with a coupling of relative angular momenta governed by an unique J value. Experimentally, an ..cap alpha.. energy of 200keV is measured with good statistics, supporting the idea of aligned clusters as /sup 28/Si intrinsic shape, related to some highly excited states.

  18. Octahedral tilt transitions in the relaxor ferroelectric Na1/2Bi1/2TiO3

    International Nuclear Information System (INIS)

    Meyer, Kai-Christian; Gröting, Melanie; Albe, Karsten

    2015-01-01

    The kinetics of octahedral tilt transitions in the lead-free relaxor material sodium bismuth titanate Na 1/2 Bi 1/2 TiO 3 (NBT) is investigated by electronic structure calculations within density functional theory. Energy barriers for transitions between tetragonal, rhombohedral and orthorhombic tilts in cation configurations with [001]- and [111]-order on the A-sites are determined by nudged elastic band calculations. By tilting entire layers of octahedra simultaneously we find that the activation energy is lower for structures with 001-order compared to such with 111-order. The energetic coupling between differently tilted layers is, however, negligibly small. By introducing a single octahedral defect we create local tilt disorder and find that the deformation energy of the neighboring octahedra is less in a rhombohedral than in a tetragonal structure. By successively increasing the size of clusters of orthorhombic defects in a rhombohedral matrix with 001-order, we determine a critical cluster size of about 40 Å . Thus groups of about ten octahedra can be considered as nuclei for polar nanoregions, which are the cause of the experimentally observed relaxor behavior of NBT. - Graphical abstract: Nine orthorhombic oxygen octahedral tilt defects in a rhombohedral tilt configuration. - Highlights: • Chemical order influences energy barriers of octahedral tilt transitions. • The octahedral deformation energy is lower in rhombohedral phases. • Tilt defect clusters are more likely in rhombohedral structures. • Tilt defect clusters can act as nuclei for polar nanoregions

  19. Wnt/β-catenin signaling changes C2C12 myoblast proliferation and differentiation by inducing Id3 expression

    International Nuclear Information System (INIS)

    Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten

    2012-01-01

    Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.

  20. Oracle database 12c the complete reference

    CERN Document Server

    Bryla, Bob

    2014-01-01

    Maintain a scalable, highly available enterprise platform and reduce complexity by leveraging the powerful new tools and cloud enhancements of Oracle Database 12c. This authoritative Oracle Press guide offers complete coverage of installation, configuration, tuning, and administration. Find out how to build and populate Oracle databases, perform effective queries, design applications, and secure your enterprise data

  1. Delta Electroproduction in 12-C

    Energy Technology Data Exchange (ETDEWEB)

    McLauchlan, Steven [Univ. of Glasgow, Scotland (United Kingdom)

    2003-01-01

    The Δ-nucleus potential is a crucial element in the understanding of the nuclear system. Previous electroexcitation measurements in the delta region reported a Q2 dependence of the Δ mass indicating that this potential is dependent on the momentum of the Δ. Such a dependence is not observed for protons and neutrons in the nuclear medium. This thesis presents the experimental study of the electroexcitation of the Δ resonance in 12C, performed using the high energy electron beam at the Thomas Jefferson National Accelerator Facility, and the near 4π acceptance detector CLAS that enables the detection of the full reaction final state. Inclusive, semi inclusive, and exclusive cross sections were measured with an incident electron beam energy of 1.162GeV over the Q2 range 0.175-0.475 (GeV/c)2. A Q2 dependence of the Δ mass was only observed in the exclusive measurements indicating that the Δ-nucleus potential is affected by the momentum of the Δ.

  2. Recombinant myostatin reduces highly expressed microRNAs in differentiating C2C12 cells

    Directory of Open Access Journals (Sweden)

    Zachary A. Graham

    2017-03-01

    Full Text Available Myostatin is small glycopeptide that is produced and secreted by skeletal muscle. It is a potent negative regulator of muscle growth that has been associated with conditions of frailty. In C2C12 cells, myostatin limits cell differentiation. Myostatin acts through activin receptor IIB, activin receptor-like kinase (ALK and Smad transcription factors. microRNAs (miRNA are short, 22 base pair nucleotides that bind to the 3′ UTR of target mRNA to repress translation or reduce mRNA stability. In the present study, expression in differentiating C2C12 cells of the myomiRs miR-1 and 133a were down-regulated following treatment with 1 µg of recombinant myostatin at 1 d post-induction of differentiation while all myomiRs (miR-1, 133a/b and 206 were upregulated by SB431542, a potent ALK4/5/7 inhibitor which reduces Smad2 signaling, at 1 d and all, with the exception of miR-206, were upregulated by SB431542 at 3 d. The expression of the muscle-enriched miR-486 was greater following treatment with SB431542 but not altered by myostatin. Other highly expressed miRNAs in skeletal muscle, miR-23a/b and 145, were altered only at 1 d post-induction of differentiation. miR-27b responded differently to treatments at 1 d, where it was upregulated, as compared to 3 d, where it was downregulated. Neither myostatin nor SB431542 altered cell size or cell morphology. The data indicate that myostatin represses myomiR expression in differentiating C2C12 cells and that inhibition of Smad signaling with SB431542 can result in large changes in highly expressed miRNAs in differentiating myoblasts.

  3. Analyzing power Asub(y)((theta) for /sup 12/C(n,nsub(0,1))/sup 12/C betwen 8. 9 and) 14. 9 MeV neutron energy

    Energy Technology Data Exchange (ETDEWEB)

    Woye, E.; Tornow, W.; Mack, G. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Floyd, C.E.; Guss, P.P.; Murphy, K.; Byrd, R.C.; Wender, S.A.; Walter, R.L. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))

    1983-02-01

    The analyzing power Asub(..gamma..)(theta) for /sup 12/C(n,n)/sup 12/C elastic scattering and for inelastic scattering to the first excited state (Jsup(..pi..) = 2/sup +/, Q = -4.44 MeV) of /sup 12/C was measured in the energy range from 8.9 to 14.9 MeV in 1 MeV steps. A pulsed polarized neutron beam was produced via the /sup 2/H(d vector,n vector)/sup 3/He polarization transfer reaction. Monte Carlo simulations were used to correct the data for finite geometry and multiple scattering effects. The Asub(..gamma..) data, together with publsihed cross-section data, were analyzed in the framework of the spherical optical model and in the coupled-channels formalism. A good description of the data has been achieved.

  4. Proteína C reactiva e gravidade da bronquiolite aguda

    Directory of Open Access Journals (Sweden)

    S. Costa

    2009-01-01

    Full Text Available Resumo: O diagnóstico de bronquiolite aguda é essencialmente clínico. A utilidade de exames laboratoriais, em particular do doseamento da proteína C reactiva (PCR, não está bem estabelecida.O objectivo deste trabalho foi avaliar a relação entre o valor da PCR e os marcadores indirectos de gravidade em doentes com diagnóstico de bronquiolite.Foram incluídos no estudo todos os doentes admitidos no Serviço de Pediatria do HSJ durante o ano de 2006 e que tiveram como diagnóstico principal bronquiolite, tendo sido feita uma revisão retrospectiva do processo clínico desses doentes.Foram incluídos 176 doentes com idades compreendidas entre zero e 36 meses (mediana de 4 meses; 63,1% eram do sexo masculino. O doseamento da PCR tinha sido efectuado em 94,3% dos doentes, com valores compreendidos entre zero e 256 mg/L e com mediana de 11 mg/L.O valor da PCR, na população estudada, apresentou uma relação estatisticamente significativa com a admissão em unidade de cuidados intensivos (UCI (p=0,008, a duração do internamento hospitalar (p=0,025 e a necessidade de oxigenoterapia (p=0,022.Desta forma, este trabalho coloca a hipótese de o valor de PCR poder ser um marcador de gravidade e ter significado prognóstico em doentes com bronquiolite. Mais estudos são necessários para validar estes resultados e esclarecer se existe uma relação real entre as variáveis estudadas ou se esta é produzida pelo efeito confundidor de outras infecções.Rev Port Pneumol 2009; XV (1: 55-65 Abstract: A diagnosis of bronchiolitis is made clinically and the use of supportive laboratory examinations, including the quantification of C reactive protein (CRP, is not well established.The aim of this study was to evaluate the correlation between CRP value and indirect markers of disease severity in patients with bronchiolitis.This study included the patients diagnosed with bronchiolitis admitted to the Pediatrics Department of S. João Hospital in 2006. A

  5. Functional aspects of dexamethasone upregulated nicotinic acetylcholine receptors in C2C12 myotubes

    NARCIS (Netherlands)

    Maestrone, E; Lagostena, L; Henning, RH; DenHertog, A; Nobile, M

    Three days of treatment with the glucocorticoid dexamethasone (1 nM-mu M) induced a concentration-dependent up-regulation of muscle nicotinic acetylcholine receptor (nAChR) in C2C12 mouse myotubes (EC(50)=10+/-7.3 nM), as assessed by [H-3]alpha-BuTx binding. The maximum increase in binding amounted

  6. 12 CFR 563c.3 - Qualification of public accountant.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Qualification of public accountant. 563c.3... REQUIREMENTS Form and Content of Financial Statements § 563c.3 Qualification of public accountant. (See also 17 CFR 210.2-01.) The term “qualified public accountant” means a certified public accountant or licensed...

  7. Suplementação de vitaminas na prevenção de câncer

    OpenAIRE

    SILVA, Cyntia Rosa de Melo; NAVES, Maria Margareth Veloso

    2001-01-01

    Este trabalho constitui uma revisão de dados epidemiológicos sobre a relação entre o consumo de vitaminas e prevenção de câncer. Estudos observacionais evidenciam uma associação inversa consistente entre a ingestão de frutas e hortaliças e risco de câncer, e um efeito protetor das vitaminas C, E e dos carotenóides contra certos tipos de câncer. Resultados de estudos de intervenção, na prevenção primária de câncer, são contraditórios, sendo que em dois desses estudos o beta-caroteno, suplement...

  8. Spectroscopic information from (3He, 7Be) reaction on 12C and 24Mg

    International Nuclear Information System (INIS)

    Rahman, Md.A.; Sen Gupta, H.M.

    1986-01-01

    The reaction ( 3 He, 7 Be) on 12 C and 24 Mg has been analysed using four discrete potential families for 7 Be channel and one discrete potential family for 3 He channel to extract alpha spectroscopic factors. It is shown that the relative spectroscopic factors are reliable if they are calculated staying within one potential family (S( 24 Mg/ 12 C) approx. 0.12). But, changing the potential family between 12 C and 24 Mg, one obtains the extreme cases, such as S( 24 Mg/ 12 C) = 0.025 and 0.51, i.e. 1:20

  9. Interactions between ionic liquid surfactant [C12mim]Br and DNA in dilute brine.

    Science.gov (United States)

    He, Yunfei; Shang, Yazhuo; Liu, Zhenhai; Shao, Shuang; Liu, Honglai; Hu, Ying

    2013-01-01

    Interactions between ionic liquid surfactant [C(12)mim]Br and DNA in dilute brine were investigated in terms of various experimental methods and molecular dynamics (MD) simulation. It was shown that the aggregation of [C(12)mim]Br on DNA chains is motivated not only by electrostatic attractions between DNA phosphate groups and [C(12)mim]Br headgroups but also by hydrophobic interactions among [C(12)mim]Br alkyl chains. Isothermal titration calorimetry analysis indicated that the [C(12)mim]Br aggregation in the presence and absence of DNA are both thermodynamically favored driven by enthalpy and entropy. DNA undergoes size transition and conformational change induced by [C(12)mim]Br, and the charges of DNA are neutralized by the added [C(12)mim]Br. Various microstructures were observed such as DNA with loose coil conformation in nature state, necklace-like structures, and compact spherical aggregates. MD simulation showed that the polyelectrolyte collapses upon the addition of oppositely charged surfactants and the aggregation of surfactants around the polyelectrolyte was reaffirmed. The simulation predicted the gradual neutralization of the negatively charged polyelectrolyte by the surfactant, consistent with the experimental results. Copyright © 2012 Elsevier B.V. All rights reserved.

  10. A Ruddlesden-Popper-type layered perovskite, Na2Ca2Nb4O13

    International Nuclear Information System (INIS)

    Chiba, K.; Ishizawa, N.; Oishi, S.

    1999-01-01

    Single crystals of disodium dicalcium tetraniobium tridecaoxide, Na 2 Ca 2 Nb 4 O 13 , were grown by the flux method. The structure was determined in space group Bb2 1 m. Perovskite-type layers with the formula [(Ca 2 Na)Nb 4 O 13 ] - are concatenated by Na + cations near the interlayer, forming a Ruddlesden-Popper-type structure. The interlayer structure, composed of Na and O atoms, can be regarded as a rocksalt-type. NbO 6 octahedra are tilted about [010] and [001]. The off-centre displacement of Nb atoms suggests a ferroelectric nature along [010], with a calculated magnitude of polarization of 0.12 C m -2 . (orig.)

  11. Evolving morphotropic phase boundary in lead-free (Bi1/2Na1/2)TiO3-BaTiO3 piezoceramics

    Science.gov (United States)

    Jo, Wook; Daniels, John E.; Jones, Jacob L.; Tan, Xiaoli; Thomas, Pamela A.; Damjanovic, Dragan; Rödel, Jürgen

    2011-01-01

    The correlation between structure and electrical properties of lead-free (1-x)(Bi1/2Na1/2)TiO3-xBaTiO3 (BNT-100xBT) polycrystalline piezoceramics was investigated systematically by in situ synchrotron diffraction technique, combined with electrical property characterization. It was found that the morphotropic phase boundary (MPB) between a rhombohedral and a tetragonal phase evolved into a morphotropic phase region with electric field. In the unpoled material, the MPB was positioned at the transition from space group R3m to P4mm (BNT-11BT) with optimized permittivity throughout a broad single-phase R3m composition regime. Upon poling, a range of compositions from BNT-6BT to BNT-11BT became two-phase mixture, and maximum piezoelectric coefficient was observed in BNT-7BT. It was shown that optimized electrical properties are related primarily to the capacity for domain texturing and not to phase coexistence.

  12. Evolving morphotropic phase boundary in lead-free (Bi1/2Na1/2)TiO3-BaTiO3 piezoceramics

    International Nuclear Information System (INIS)

    Jo, Wook; Roedel, Juergen; Daniels, John E.; Jones, Jacob L.; Tan Xiaoli; Thomas, Pamela A.; Damjanovic, Dragan

    2011-01-01

    The correlation between structure and electrical properties of lead-free (1-x)(Bi 1/2 Na 1/2 )TiO 3 -xBaTiO 3 (BNT-100xBT) polycrystalline piezoceramics was investigated systematically by in situ synchrotron diffraction technique, combined with electrical property characterization. It was found that the morphotropic phase boundary (MPB) between a rhombohedral and a tetragonal phase evolved into a morphotropic phase region with electric field. In the unpoled material, the MPB was positioned at the transition from space group R3m to P4mm (BNT-11BT) with optimized permittivity throughout a broad single-phase R3m composition regime. Upon poling, a range of compositions from BNT-6BT to BNT-11BT became two-phase mixture, and maximum piezoelectric coefficient was observed in BNT-7BT. It was shown that optimized electrical properties are related primarily to the capacity for domain texturing and not to phase coexistence.

  13. Independent AMP and NAD signaling regulates C2C12 differentiation and metabolic adaptation.

    Science.gov (United States)

    Hsu, Chia George; Burkholder, Thomas J

    2016-12-01

    The balance of ATP production and consumption is reflected in adenosine monophosphate (AMP) and nicotinamide adenine dinucleotide (NAD) content and has been associated with phenotypic plasticity in striated muscle. Some studies have suggested that AMPK-dependent plasticity may be an indirect consequence of increased NAD synthesis and SIRT1 activity. The primary goal of this study was to assess the interaction of AMP- and NAD-dependent signaling in adaptation of C2C12 myotubes. Changes in myotube developmental and metabolic gene expression were compared following incubation with 5-aminoimidazole-4-carboxamide ribonucleotide (AICAR) and nicotinamide mononucleotide (NMN) to activate AMPK- and NAD-related signaling. AICAR showed no effect on NAD pool or nampt expression but significantly reduced histone H3 acetylation and GLUT1, cytochrome C oxidase subunit 2 (COX2), and MYH3 expression. In contrast, NMN supplementation for 24 h increased NAD pool by 45 % but did not reduce histone H3 acetylation nor promote mitochondrial gene expression. The combination of AMP and NAD signaling did not induce further metabolic adaptation, but NMN ameliorated AICAR-induced myotube reduction. We interpret these results as indication that AMP and NAD contribute to C2C12 differentiation and metabolic adaptation independently.

  14. Crystal structures and magnetic properties of iron (III)-based phosphates: Na4NiFe(PO4)3 and Na2Ni2Fe(PO4)3

    International Nuclear Information System (INIS)

    Essehli, Rachid; Bali, Brahim El; Benmokhtar, Said; Bouziane, Khalid; Manoun, Bouchaib; Abdalslam, Mouner Ahmed; Ehrenberg, Helmut

    2011-01-01

    Graphical abstract: A perspective view of the Na 2 Ni 2 Fe(PO 4 ) 3 structure along the [0 0 1] direction. Both compounds seem to exibit antiferromagnetic interactions between magnetic entities at low temperature. Display Omitted Research highlights: → Nasicon and Alluaudite compounds, Iron(III)-based phosphates, Crystal structures of Na 4 NiFe(PO 4 ) 3 and Na 2 Ni 2 Fe(PO 4 ) 3 . → Magnetism behaviours of Na 4 NiFe(PO 4 ) 3 and Na 2 Ni 2 Fe(PO 4 ) 3 . → Antiferromagnetism interactions. → Mossbauer spectroscopy. - Abstract: Crystal structures from two new phosphates Na 4 NiFe(PO 4 ) 3 (I) and Na 2 Ni 2 Fe(PO 4 ) 3 (II) have been determined by single crystal X-ray diffraction analysis. Compound (I) crystallizes in a rhombohedral system (S. G: R-3c, Z = 6, a = 8.7350(9) A, c = 21.643(4) A, R 1 = 0.041, wR 2 =0.120). Compound (II) crystallizes in a monoclinic system (S. G: C2/c, Z = 4, a = 11.729(7) A, b = 12.433(5) A, c = 6.431(2) A, β = 113.66(4) o , R 1 = 0.043, wR 2 =0.111). The three-dimensional structure of (I) is closely related to the Nasicon structural type, consisting of corner sharing [(Ni/Fe)O 6 ] octahedra and [PO 4 ] tetrahedra forming [NiFe(PO 4 ) 3 ] 4+ units which align in chains along the c-axis. The Na + cations fill up trigonal antiprismatic sites within these chains. The crystal structure of (II) belongs to the alluaudite type. Its open framework results from [Ni 2 O 10 ] units of edge-sharing [NiO 6 ] octahedra, which alternate with [FeO 6 ] octahedra that form infinite chains. Coordination of these chains yields two distinct tunnels in which site Na + . The magnetization data of compound (I) reveal antiferromagnetic (AFM) interactions by the onset of deviations from a Curie-Weiss behaviour at low temperature as confirmed by Moessbauer measurements performed at 4.2 K. The corresponding temperature dependence of the reciprocal susceptibility χ -1 follows a typical Curie-Weiss behaviour for T > 105 K. A canted AFM state is proposed for

  15. 12 CFR 7.5009 - Location under 12 U.S.C. 85 of national banks operating exclusively through the Internet.

    Science.gov (United States)

    2010-01-01

    ... operating exclusively through the Internet. 7.5009 Section 7.5009 Banks and Banking COMPTROLLER OF THE... under 12 U.S.C. 85 of national banks operating exclusively through the Internet. For purposes of 12 U.S.C. 85, the main office of a national bank that operates exclusively through the Internet is the...

  16. Systems of Na/sup +/NO/sub 3/, Na/sub 2/SO/sub 4/, RbNO/sub 3/, Rb/sub 2/SO/sub 4/-H/sub 2/O and NaNO/sub 3/, Na/sub 2/SO/sub 4/, CsNO/sub 3/, Cs/sub 2/SO/sub 4/-H/sub 2/O at 25 and 75 deg C

    Energy Technology Data Exchange (ETDEWEB)

    Poletaev, I F; Krasnenkova, L V

    1975-08-01

    Quaternary Na/sup +/, Rb/sup +///NO/sub 3/-, SO/sub 4//sup 2 -/-H/sub 2/O and Nsub(+), Cs/sup +///NO/sub 3/-, SO/sub 4//sup 2 -/-H/sub 2/O mutual systems have been studied isothermally. The following six fields of crystallization have been revealed in these systems at 25 deg C: Cs/sub 2/SO/sub 4/, Na/sub 2/SO/sub 4/, Na/sub 2/SO/sub 4/x10H/sub 2/O, NaNO/sub 3/xNa/sub 2/SO/sub 4/x2H/sub 2/O, NaNO/sub 3/, and CsNO/sub 3/.

  17. Integral measurement of the $^{12}$C(n,p)$^{12}$B reaction up to 10 GeV

    CERN Document Server

    Žugec, P; Bosnar, D; Ventura, A; Mengoni, A; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Brugger, M; Calviani, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Cortés, G; Cortés-Giraldo, M.A; Cosentino, L; Diakaki, M; Domingo-Pardo, C; Dressler, R; Duran, I; Eleftheriadis, C; Ferrari, A; Finocchiaro, P; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Guerrero, C; Gunsing, F; Gurusamy, P; Heinitz, S; Jenkins, D G; Jericha, E; Käppeler, F; Karadimos, D; Kivel, N; Kokkoris, M; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Meo, S Lo; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Massimi, C; Mastinu, P; Mastromarco, M; Mendoza, E; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Musumarra, A; Paradela, C; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T

    2016-01-01

    The integral measurement of the $^{12}$C(n,p)$^{12}$B reaction was performed at the neutron time of flight facility n_TOF at CERN. The total number of $^{12}$B nuclei produced per neutron pulse of the n_TOF beam was determined using the activation technique in combination with a time of flight technique. The cross section is integrated over the n_TOF neutron energy spectrum from reaction threshold at 13.6 MeV to 10 GeV. Having been measured up to 1 GeV on basis of the $^{235}$U(n,f) reaction, the neutron energy spectrum above 200 MeV has been reevaluated due to the recent extension of the cross section reference for this particular reaction, which is otherwise considered a standard up to 200 MeV. The results from the dedicated GEANT4 simulations have been used to evaluate the neutron flux from 1 GeV up to 10 GeV. The experimental results related to the $^{12}$C(n,p)$^{12}$B reaction are compared with the evaluated cross sections from major libraries and with the predictions of different GEANT4 models, which m...

  18. Risbjerg: Historisk stemmeskred med NA

    DEFF Research Database (Denmark)

    Thomsen, Søren Risbjerg

    2007-01-01

    ANALYSE: NA flytter 12,3 pct. af stemmerne i majs meningsmålinger - historisk mange vælgere på en måned, skriver professor Risbjerg. Udgivelsesdato: 3. juni 2007......ANALYSE: NA flytter 12,3 pct. af stemmerne i majs meningsmålinger - historisk mange vælgere på en måned, skriver professor Risbjerg. Udgivelsesdato: 3. juni 2007...

  19. Reactivity of 12-tungstophosphoric acid and its inhibitor potency toward Na+/K+-ATPase: A combined 31P NMR study, ab initio calculations and crystallographic analysis.

    Science.gov (United States)

    Bošnjaković-Pavlović, Nada; Bajuk-Bogdanović, Danica; Zakrzewska, Joanna; Yan, Zeyin; Holclajtner-Antunović, Ivanka; Gillet, Jean-Michel; Spasojević-de Biré, Anne

    2017-11-01

    Influence of 12-tungstophosphoric acid (WPA) on conversion of adenosine triphosphate (ATP) to adenosine diphosphate (ADP) in the presence of Na + /K + -ATPase was monitored by 31 P NMR spectroscopy. It was shown that WPA exhibits inhibitory effect on Na + /K + -ATPase activity. In order to study WPA reactivity and intermolecular interactions between WPA oxygen atoms and different proton donor types (D=O, N, C), we have considered data for WPA based compounds from the Cambridge Structural Database (CSD), the Crystallographic Open Database (COD) and the Inorganic Crystal Structure Database (ICSD). Binding properties of Keggin's anion in biological systems are illustrated using Protein Data Bank (PDB). This work constitutes the first determination of theoretical Bader charges on polyoxotungstate compound via the Atom In Molecule theory. An analysis of electrostatic potential maps at the molecular surface and charge of WPA, resulting from DFT calculations, suggests that the preferred protonation site corresponds to WPA bridging oxygen. These results enlightened WPA chemical reactivity and its potential biological applications such as the inhibition of the ATPase activity. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Variação na temperatura do solo em três sistemas de manejo na cultura do feijão Soil temperature variation in three different systems of soil management in blackbeans crop

    Directory of Open Access Journals (Sweden)

    Vanderlei Rodrigues da Silva

    2006-06-01

    Full Text Available A temperatura do solo é uma propriedade que afeta diretamente o crescimento das plantas e é influenciada pelo balanço de energia na superfície do solo. Dessa maneira, os sistemas de manejo do solo têm efeito na temperatura, visto que alteram as condições da superfície do solo. O objetivo deste estudo foi determinar o efeito de três sistemas de manejo na temperatura do solo durante todo o ciclo do feijoeiro. O delineamento experimental foi de blocos ao acaso, com os seguintes preparos do solo: plantio direto há sete anos (PD; plantio direto revolvido por uma aração e uma gradagem (PDar e plantio direto revolvido por escarificador (PDesc, distribuídos em quatro blocos. O solo do experimento é classificado como Argissolo Vermelho-Amarelo distrófico arênico. A temperatura do solo foi determinada durante todo o ciclo do feijoeiro, realizando-se leituras a cada 10 min, em um sistema automatizado de coleta de dados, com sensores do tipo termopar (cobre-constantan, instalados na profundidade de 0,025 m e a 0,10 m. Foram determinadas a densidade do solo e a produtividade do feijoeiro. Durante todo o ciclo do feijoeiro, o PD apresentou a menor temperatura máxima e a menor amplitude diária entre os sistemas de manejo. Na profundidade de 0,025 m, o PDar apresentou temperatura máxima de 42,2 °C, o PDesc de 43,7 °C e o PD de 36,1 °C. A variação diária da temperatura do solo num dia com 12 h de sol, no início do desenvolvimento das plantas (02/12/2002, indicou que a maior temperatura ocorreu próximo às 15 h, com valores de 40 ºC, no PDar, e 30 ºC, no PD, na profundidade de 0,025 m. Quando as plantas sombreavam o solo, não houve diferenças na temperatura do solo entre os sistemas de manejo. As diferenças na temperatura do solo não provocaram diferenças na produtividade de grãos do feijoeiro, haja vista que os maiores efeitos da temperatura do solo ocorrem na germinação e emergência das plântulas.Soil temperature is a

  1. Effects of chlorides on the hydration of 12CaO{center_dot}7Al2O3 solid solution

    Energy Technology Data Exchange (ETDEWEB)

    Sango, H.; Miyakawa, T.; Yasue, T.; Arai, Y. [Nihon Univ., Tokyo (Japan). Faculty of Science and Engineering

    1995-01-01

    The purpose of this paper was to compare the hydration rate of C12A7ss and to study the effects of chlorides on the hydration products and the hydration rate of C12A7ss. In this paper, `C12A7ss` is a general term for C11A7{center_dot}Ca(OH)2, 11CaO{center_dot}7Al2O3{center_dot}CaF2 and 11CaO{center_dot}7Al2O3{center_dot}CaCl2. The hydration process and the hydration rate of 12CaO{center_dot}7Al2O3 solution (C12A7ss) with and without various chlorides (CaCl2, MgCl2, NaCl, NH4Cl and AlCl3) has been determined at 25{degree}C. Various C12A7ss were prepared in burning method. When C12A7ss with various chlorides are hydrated, 3CaO{center_dot} Al2O3{center_dot}CaCl2{center_dot}10H2O(Friedel`s salt) is formed as the primary hydrate. The hydration rate of C12A7ss is decreased by the coexistence of CaCl2, MgCl2, NaCl or NH4Cl except AlCl3. As a result, the setting time of C12A7ss is extended and the unhydrate exists for a long time comparatively. 14 refs., 7 figs., 1 tab.

  2. Relationship between intracellular Na+ concentration and reduced Na+ affinity in Na+,K+-ATPase mutants causing neurological disease

    DEFF Research Database (Denmark)

    Toustrup-Jensen, Mads Schak; Einholm, Anja P.; Schack, Vivien

    The neurological disorders familial hemiplegic migraine type 2 (FHM2), alternating hemiplegia of childhood (AHC), and rapid-onset dystonia parkinsonism (RDP) are caused by mutations of Na+,K+-ATPase α2 and α3 isoforms, expressed in glial and neuronal cells, respectively. Although these disorders......, addressing the question to what extent they cause a change of the intracellular Na+ and K+ concentrations ([Na+]i and [K+]i) in COS cells. C-terminal extension mutants generally showed dramatically reduced Na+ affinity without disturbance of K+ binding, as did other RDP mutants. No phosphorylation from ATP...

  3. Um monstro nas minas ilustradas: O diabo na livraria do cônego

    Directory of Open Access Journals (Sweden)

    Késia Rodrigues de Oliveira

    2011-03-01

    Full Text Available A figura mitológica do diabo é elemento recorrente tanto no imaginário popular quanto em personagens da literatura ocidental sendo atribuída a ele a representação da maldade. Entretanto, é no período colonial mineiro que tal figura aparecerá, para além da conjuntura religiosa, simbolizando na forma de livros, as ideias iluministas franceses. Este artigo pretende a partir de uma leitura crítica do ensaio "ʺO diabo na livraria do cônego"ʺ, de Eduardo Frieiro, e do conto "ʺ1789-­1790"ʺ, de Maria José de Queiroz, analisar, sob o contexto histórico da Inconfidência Mineira, as referências aos livros e ao diabo, alegoria das ideias libertárias, e sua relação com o espaço da biblioteca.

  4. Double-step processes in the 12C(p,d)11C reaction at 45 MeV

    International Nuclear Information System (INIS)

    Couvert, Pierre.

    1974-01-01

    12 C(p,d) 11 C pick-up reaction was performed with a 45 MeV proton beam. A 130keV energy resolution was obtained and angular distributions of nine of the ten first levels of 11 C have been extracted within a large angular range. Assuming only neutron direct transfert, the strong relative excitation of high spin levels cannot be reproduced by a DWBA analysis. The double-step process assumption seems to be verified by a systematical analysis of the (p,d) reaction mechanisms. This analysis is done in the coupled-channel formalism for the five first negative parity states of 11 C. The 3/2 - ground state is essentially populated by the direct transfer of a Psub(3/2) neutron. The contribution of a double-step process, via the 2 + inelastic excitation of 12 C, is important for the four other states. A mechanism which assumes a deuteron inelastic scattering on the 11 C final nucleus after the neutron transfer cannot be neglected and improves the fits when it is taken into account [fr

  5. In situ AFM study on barite (0 0 1) surface dissolution in NaCl solutions at 30 °C

    International Nuclear Information System (INIS)

    Kuwahara, Yoshihiro; Makio, Masato

    2014-01-01

    Highlights: • We examined barite surface dissolution behavior in NaCl solutions by AFM. • Step retreat and step splitting behavior changed with the NaCl concentration. • Etch pit formation and development differed in each NaCl solution. • Step retreat and etch pit growth rates increased with the NaCl concentration. • We assessed the effects of temperature and NaCl concentration on these rates. - Abstract: This paper reports in situ observations on barite (0 0 1) surface dissolution behavior in 0.1–0.001 M NaCl solutions at 30 °C using atomic force microscopy (AFM). The step retreating on barite (0 0 1) surfaces changed with increasing NaCl solution concentrations. In solutions with a higher NaCl concentration (⩾0.01 M), many steps showed curved or irregular fronts during the later experimental stage, while almost all steps in solutions with a lower NaCl concentration exhibited straight or angular fronts, even during the late stage. The splitting phenomenon of the initial 〈h k 0〉 one-layer steps (7.2 Å) into two half-layer steps (3.6 Å) occurred in all NaCl solutions, while that of the initial [0 1 0] one-layer steps observed only in the 0.1 M NaCl solution. The step retreat rates increased with an increasing NaCl solution concentration. We observed triangular etch pit and deep etch pit formation in all NaCl solutions, which tended to form late in solutions with lower NaCl concentrations. The deep etch pit morphology changed with increasing NaCl solution concentrations. A hexagonal form elongated in the [0 1 0] direction was bounded by the {1 0 0}, {3 1 0}, and (0 0 1) faces in a 0.001 M NaCl solution, and a rhombic form was bounded by the {5 1 0} and (0 0 1) faces in 0.01 M and 0.1 M NaCl solutions. An intermediate form was observed in a 0.005 M NaCl solution, which was defined by {1 0 0}, a curved face tangent to the [0 1 0] direction, {3 1 0}, and (0 0 1) faces: the intermediate form appeared between the hexagonal and rhombic forms in

  6. Measurements of fusion cross section for 12C +63,65 Cu systems

    International Nuclear Information System (INIS)

    Rocha, C.A. da.

    1987-01-01

    Cross-section measurements for nuclear fusion in the 12 C+ 63.65 Cu system, at 12 C energy range from 0.9 to 1.8 times the Coulomb barrier are presented. In order to detect and to obtain the mass identification of the evaporation residues following the fusion process, the time of flight method was adopted in conjunction with an eletrostatic deflector capable of separating the evaporation residues from the beam particles. The limitation and advantadges of this method of measurement are discussed. The excitation functions were analysed using the unidimensional barrier penetration model with different nuclear potentials. Theoretical fusion cross-section values obtained from this analysis were systematically smaller than our measured values, in the energy region below the Coulomb barrier. In order to discover which channel enhances the fusion cross-section in this region, a coupled channel calculation was performed, with the CCFUS code. The experimental data for the above reactions were compared with the systems 16.18 O+ 63.65 Cu, measured by our group. In this comparison, it was noted that the systems 12 C+ 63.65 Cu, have greater fusion cross section below the Coulomb barrier. The comparison of velocity spectra of the evaporated residues for the two systems shows that 12 C+ 63 Cu has a strong reaction channel that was not present in the 12 C+ 65 Cu system. (author) [pt

  7. Long-Range Effects of Na(+) Binding in Na,K-ATPase Reported by ATP.

    Science.gov (United States)

    Middleton, David A; Fedosova, Natalya U; Esmann, Mikael

    2015-12-01

    This paper addresses the question of long-range interactions between the intramembranous cation binding sites and the cytoplasmic nucleotide binding site of the ubiquitous ion-transporting Na,K-ATPase using (13)C cross-polarization magic-angle spinning (CP-MAS) solid-state nuclear magnetic resonance. High-affinity ATP binding is induced by the presence of Na(+) as well as of Na-like substances such as Tris(+), and these ions are equally efficient promoters of nucleotide binding. CP-MAS analysis of bound ATP with Na,K-ATPase purified from pig kidney membranes reveals subtle differences in the nucleotide interactions within the nucleotide site depending on whether Na(+) or Tris(+) is used to induce binding. Differences in chemical shifts for ATP atoms C1' and C5' observed in the presence of Na(+) or Tris(+) suggest alterations in the residues surrounding the bound nucleotide, hydrogen bonding, and/or conformation of the ribose ring. This is taken as evidence of a long-distance communication between the Na(+)-filled ion sites in the membrane interior and the nucleotide binding site in the cytoplasmic domain and reflects the first conformational change ultimately leading to phosphorylation of the enzyme. Stopped-flow fluorescence measurements with the nucleotide analogue eosin show that the dissociation rate constant for eosin is larger in Tris(+) than in Na(+), giving kinetic evidence of the difference in structural effects of Na(+) and Tris(+). According to the recent crystal structure of the E1·AlF4(-)·ADP·3Na(+) form, the coupling between the ion binding sites and the nucleotide side is mediated by, among others, the M5 helix.

  8. Regulation of Epithelial Sodium Transport via Epithelial Na+ Channel

    Science.gov (United States)

    Marunaka, Yoshinori; Niisato, Naomi; Taruno, Akiyuki; Ohta, Mariko; Miyazaki, Hiroaki; Hosogi, Shigekuni; Nakajima, Ken-ichi; Kusuzaki, Katsuyuki; Ashihara, Eishi; Nishio, Kyosuke; Iwasaki, Yoshinobu; Nakahari, Takashi; Kubota, Takahiro

    2011-01-01

    Renal epithelial Na+ transport plays an important role in homeostasis of our body fluid content and blood pressure. Further, the Na+ transport in alveolar epithelial cells essentially controls the amount of alveolar fluid that should be kept at an appropriate level for normal gas exchange. The epithelial Na+ transport is generally mediated through two steps: (1) the entry step of Na+ via epithelial Na+ channel (ENaC) at the apical membrane and (2) the extrusion step of Na+ via the Na+, K+-ATPase at the basolateral membrane. In general, the Na+ entry via ENaC is the rate-limiting step. Therefore, the regulation of ENaC plays an essential role in control of blood pressure and normal gas exchange. In this paper, we discuss two major factors in ENaC regulation: (1) activity of individual ENaC and (2) number of ENaC located at the apical membrane. PMID:22028593

  9. Synthesis and piezoelectric properties of KxNa1-xNbO3 ceramic by molten salt method

    International Nuclear Information System (INIS)

    Li Yueming; Wang Jinsong; Liao Runhua; Huang Dan; Jiang Xiangping

    2010-01-01

    K x Na 1-x NbO 3 ceramic powder with perovskite structure was synthesized in molten salt with a Na 2 CO 3 /K 2 CO 3 molar ratio of 1:1, under different salt-to-oxide weight ratios of 1:10, 1:5, 1:3, 1:2.5 and 1:2 in the temperatures range of 650-900 o C. It is found that the synthesizing temperature and salt-to-oxide ratios had significant effects on the morphology of K x Na 1-x NbO 3 powder. The X-ray diffraction analysis indicated that a pure perovskite structure of K x Na 1-x NbO 3 powder could be synthesized at 650 o C. The microstructure observation revealed that the crystal morphology of K x Na 1-x NbO 3 powder changed from spheroid to cube, and then became irregular after further increasing temperature. The grain size of the synthesized powder increased by an increment of the molten salt content. The K x Na 1-x NbO 3 ceramics were prepared at x = 0.345 by adding 1.0 mol% ZnO as sintering aid, and the optimized dielectric and piezoelectric properties are obtained as following: d 33 = 120 pC/N, T c = 406 o C, Q m = 126 and k p = 0.302.

  10. Neutron yield of thick {sup 12}C and {sup 13}C targets with 20 and 30 MeV deuterons

    Energy Technology Data Exchange (ETDEWEB)

    Lhersonneau, G.; Fadil, M. [GANIL, Caen (France); Malkiewicz, T. [CSC - IT Center for Science Ltd., Espoo (Finland); Gorelov, D.; Sorri, J.; Trzaska, W.H. [University of Jyvaskyla, Department of Physics, Jyvaskyla (Finland); Jones, P.; Ngcobo, P.Z. [iThemba Laboratory for Accelerator Based Science, Western Cape (South Africa)

    2016-12-15

    The neutron yield of thick targets of carbon, natural and enriched in {sup 13}C, bombarded by deuterons of 20 and 30 MeV has been measured by the activation method. The gain with respect to a {sup 12}C target is the same as with protons beams. The yield ratio is about 1.2 only and hardly can justify the use of a {sup 13}C target with deuteron beams. The data, apart from being of interest for the design of facilities where secondary neutron beams are used, provide a test case for calculations where both beam and target have a weakly bound neutron. The MCNPx code version 2.6.0, despite failing to reproduce some details of the experimental distributions, describes their global properties fairly well, especially the relative yields of the {sup 12}C and {sup 13}C targets. (orig.)

  11. Macroscopic folded form factors for 12C + 12C inelastic scattering

    International Nuclear Information System (INIS)

    Rickertsen, L.D.; Satchler, G.R.; Stokstad, R.G.; Wieland, R.M.

    1976-01-01

    The angular distributions for the scattering of carbon-12 from carbon-12 at 117.1 MeV are shown as is also the result of coupled-channel calculations for the elastic and inelastic scattering using these folded form factors

  12. Densities and apparent molar volumes of atmospherically important electrolyte solutions. 1. The solutes H2SO4, HNO3, HCl, Na2SO4, NaNO3, NaCl, (NH4)2SO4, NH4NO3, and NH4Cl from 0 to 50 °C, including extrapolations to very low temperature and to the pure liquid state, and NaHSO4, NaOH, and NH3 at 25 °C.

    Science.gov (United States)

    Clegg, S L; Wexler, A S

    2011-04-21

    Calculations of the size and density of atmospheric aerosols are complicated by the fact that they can exist at concentrations highly supersaturated with respect to dissolved salts and supercooled with respect to ice. Densities and apparent molar volumes of solutes in aqueous solutions containing the solutes H(2)SO(4), HNO(3), HCl, Na(2)SO(4), NaNO(3), NaCl, (NH(4))(2)SO(4), NH(4)NO(3), and NH(4)Cl have been critically evaluated and represented using fitted equations from 0 to 50 °C or greater and from infinite dilution to concentrations saturated or supersaturated with respect to the dissolved salts. Using extrapolated densities of high-temperature solutions and melts, the relationship between density and concentration is extended to the hypothetical pure liquid solutes. Above a given reference concentration of a few mol kg(-1), it is observed that density increases almost linearly with decreasing temperature, and comparisons with available data below 0 °C suggest that the fitted equations for density can be extrapolated to very low temperatures. As concentration is decreased below the reference concentration, the variation of density with temperature tends to that of water (which decreases as temperature is reduced below 3.98 °C). In this region below the reference concentration, and below 0 °C, densities are calculated using extrapolated apparent molar volumes which are constrained to agree at the reference concentrations with an equation for the directly fitted density. Calculated volume properties agree well with available data at low temperatures, for both concentrated and dilute solutions. Comparisons are made with literature data for temperatures of maximum density. Apparent molar volumes at infinite dilution are consistent, on a single ion basis, to better than ±0.1 cm(3) mol(-1) from 0 to 50 °C. Volume properties of aqueous NaHSO(4), NaOH, and NH(3) have also been evaluated, at 25 °C only. In part 2 of this work (ref 1 ) an ion interaction (Pitzer

  13. Chromatin plasticity as a differentiation index during muscle differentiation of C2C12 myoblasts

    International Nuclear Information System (INIS)

    Watanabe, Tomonobu M.; Higuchi, Sayaka; Kawauchi, Keiko; Tsukasaki, Yoshikazu; Ichimura, Taro; Fujita, Hideaki

    2012-01-01

    Highlights: ► Change in the epigenetic landscape during myogenesis was optically investigated. ► Mobility of nuclear proteins was used to state the epigenetic status of the cell. ► Mobility of nuclear proteins decreased as myogenesis progressed in C2C12. ► Differentiation state diagram was developed using parameters obtained. -- Abstract: Skeletal muscle undergoes complicated differentiation steps that include cell-cycle arrest, cell fusion, and maturation, which are controlled through sequential expression of transcription factors. During muscle differentiation, remodeling of the epigenetic landscape is also known to take place on a large scale, determining cell fate. In an attempt to determine the extent of epigenetic remodeling during muscle differentiation, we characterized the plasticity of the chromatin structure using C2C12 myoblasts. Differentiation of C2C12 cells was induced by lowering the serum concentration after they had reached full confluence, resulting in the formation of multi-nucleated myotubes. Upon induction of differentiation, the nucleus size decreased whereas the aspect ratio increased, indicating the presence of force on the nucleus during differentiation. Movement of the nucleus was also suppressed when differentiation was induced, indicating that the plasticity of chromatin changed upon differentiation. To evaluate the histone dynamics during differentiation, FRAP experiment was performed, which showed an increase in the immobile fraction of histone proteins when differentiation was induced. To further evaluate the change in the histone dynamics during differentiation, FCS was performed, which showed a decrease in histone mobility on differentiation. We here show that the plasticity of chromatin decreases upon differentiation, which takes place in a stepwise manner, and that it can be used as an index for the differentiation stage during myogenesis using the state diagram developed with the parameters obtained in this study.

  14. C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan [Hospital for Sick Children, Diagnostic Imaging, Toronto (Canada); Clarke, Howard [Hospital for Sick Children, Plastic Surgery, Toronto (Canada); Weksberg, Rosanna [Hospital for Sick Children, Clinical and Metabolic Genetics, Toronto (Canada)

    2008-07-15

    Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)

  15. C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome

    International Nuclear Information System (INIS)

    Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan; Clarke, Howard; Weksberg, Rosanna

    2008-01-01

    Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)

  16. Identification and Analysis of NaHCO3 Stress Responsive Genes in Wild Soybean (Glycine soja Roots by RNA-seq

    Directory of Open Access Journals (Sweden)

    Jinlong Zhang

    2016-12-01

    Full Text Available Soil alkalinity is a major abiotic constraint to crop productivity and quality. Wild soybean (Glycine soja is considered to be more stress-tolerant than cultivated soybean (G. max, and has considerable genetic variation for increasing alkalinity tolerance of soybean. In this study, we analyzed the transcriptome profile in the roots of an alkalinity tolerant wild soybean variety N24852 at 12 and 24 h after 90 mM NaHCO3 stress by RNA-sequencing. Compared with the controls, a total of 449 differentially expressed genes (DEGs were identified, including 95 and 140 up-regulated genes, and 108 and 135 down-regulated genes at 12 and 24 h after NaHCO3 treatment, respectively. Quantitative RT-PCR analysis of 14 DEGs showed a high consistency with their expression profiles by RNA-sequencing. Gene Ontology (GO terms related to transcription factors and transporters were significantly enriched in the up-regulated genes at 12 and 24 h after NaHCO3 stress, respectively. Nuclear Factor Y subunit A (NF-YA transcription factors were enriched at 12 h after NaHCO3 stress, and high percentages of basic helix-loop-helix (bHLH, ethylene-responsive factor (ERF, Trihelix and zinc finger (C2H2, C3H transcription factors were found at both 12 and 24 h after NaHCO3 stress. Genes related to ion transporters such as ABC transporter, aluminum activated malate transporter (ALMT, glutamate receptor (GLR, nitrate transporter (NRT / proton dependent oligopeptide (POT family, and S-type anion channel (SLAH were enriched in up-regulated DEGs at 24 h after NaHCO3 treatment, implying their roles in maintaining ion homeostasis in soybean roots under alkalinity. KEGG pathway enrichment analysis showed phenylpropanoid biosynthesis and phenylalanine metabolism pathways might participate in soybean response to alkalinity. This study provides a foundation to further investigate the functions of NaHCO3 stress-responsive genes and the molecular basis of soybean tolerance to alkalinity.

  17. Cluster Structure of 12C and 11Be

    International Nuclear Information System (INIS)

    Freer, M.; Fujita, H.; Buthelezi, Z.; Carter, J.; Fearick, R.W.; Foertsch, S.V.; Neveling, R.; Perez, S.M.; Papka, P.; Smit, F.D.; Swartz, J.A.; Usman, I.; Haigh, P.J.; Ashwood, N.I.; Bloxham, T.; Curtis, N.; McEwan, P.; Bohlen, H.G.; Dorsch, T.; Kokalova, Tz.

    2010-01-01

    The structure of the nucleus 12 C is discussed, in particular the spectrum of states above the α-decay threshold. A search for the 2 + excitation of the Hoyle-state is reported. The structural link between halo-like states and molecular states is explored in the case of 11 Be.

  18. Electric-field-induced strain contributions in morphotropic phase boundary composition of (Bi{sub 1/2}Na{sub 1/2})TiO{sub 3}-BaTiO{sub 3} during poling

    Energy Technology Data Exchange (ETDEWEB)

    Khansur, Neamul H.; Daniels, John E. [School of Materials Science and Engineering, UNSW Australia, New South Wales 2052 (Australia); Hinterstein, Manuel [School of Materials Science and Engineering, UNSW Australia, New South Wales 2052 (Australia); Institute for Applied Materials, Karlsruhe Institute for Technology, P.O. Box 3640, 76021 Karlsruhe (Germany); Wang, Zhiyang [School of Materials Science and Engineering, UNSW Australia, New South Wales 2052 (Australia); The Australian Synchrotron, Clayton, Victoria 3168 (Australia); Groh, Claudia [Institute of Materials Science, Technische Universität Darmstadt, Alarich-Weiss-Straße 2, 64287 Darmstadt (Germany); Jo, Wook [School of Materials Science and Engineering, Ulsan National Institute of Science and Technology, Ulsan 44919 (Korea, Republic of)

    2015-12-14

    The microscopic contributions to the electric-field-induced macroscopic strain in a morphotropic 0.93(Bi{sub 1/2}Na{sub 1/2}TiO{sub 3})−0.07(BaTiO{sub 3}) with a mixed rhombohedral and tetragonal structure have been quantified using full pattern Rietveld refinement of in situ high-energy x-ray diffraction data. The analysis methodology allows a quantification of all strain mechanisms for each phase in a morphotropic composition and is applicable to use in a wide variety of piezoelectric compositions. It is shown that during the poling of this material 24%, 44%, and 32% of the total macroscopic strain is generated from lattice strain, domain switching, and phase transformation strains, respectively. The results also suggest that the tetragonal phase contributes the most to extrinsic domain switching strain, whereas the lattice strain primarily stems from the rhombohedral phase. The analysis also suggests that almost 32% of the total strain is lost or is a one-time effect due to the irreversible nature of the electric-field-induced phase transformation in the current composition. This information is relevant to on-going compositional development strategies to harness the electric-field-induced phase transformation strain of (Bi{sub 1/2}Na{sub 1/2})TiO{sub 3}-based lead-free piezoelectric materials for actuator applications.

  19. Vitamin B12-catalyzed synthesis of some peracetylated alkyl b-D-xylopyranosides

    Directory of Open Access Journals (Sweden)

    LJILJANA STEVANOVIC

    2003-10-01

    Full Text Available The vitamin B12-catalyzed glycosylation reaction of brominated b-D-xylose peracetate with alkanols ROH (C1-C8 has been studied. The catalytically active species in this reaction was cob(Ialamin, obtained by chemical reduction of Vitamin B12 with NaBH4 (Co(III to Co(I. The reaction was carried out with 2 mol% of vitamin B12, with respect to xylosyl bromide 1, under argon at room temperature. Under these conditions, peracetylated C1-C8-alkyl b-D-xylopyranosides (3a–3f were obtained in moderate yield (55–70 %. In all cases 3,4-di-O-acetyl-D-xylal (4 was obtained, as the product of reductive elimination of peracetylated xylosyl bromide (15–25 %.

  20. Energy dependence of the 16O + 12C potential of interaction

    Directory of Open Access Journals (Sweden)

    O. A. Ponkratenko

    2013-09-01

    Full Text Available The 16O + 12C scattering data originating from various measurements in the energy range from 1 to 100 MeV/nucleon have been analyzed within optical model (OM. As a result the global energy dependent 16O + 12C - OM-potential has been obtained. Satisfactory description of experimental data is achieved. While analyzing differential cross sections of the elastic scattering and fusion cross sections were calculated using var-ious types of optical potentials.

  1. The effect of BW12C on radiosensitivity and necrosis of murine tissues and tumours

    International Nuclear Information System (INIS)

    Stevens, G.; Hill, S.A.; Joiner, M.C.; Joiner, B.; Johns, H.; Williams, K.; Denekamp, J.

    1994-01-01

    BW12C is a drug that has the potential to induce normal tissue and tumour hypoxia by binding to haemoglobin, increasing its affinity for oxygen and thereby reducing oxygen availability to tissues. Initial results suggested that BW12C administration caused significant radioprotection of normal tissues and induced tumour necrosis, but variable results have been reported subsequently. This work was carried to extend the range of observations concerning the ability of BW12C to radioprotect normal tissues and tumours and to induce necrosis of tumours of the mouse. BW12C was administered as 70 mg/kg intravenous 15 min before irradiation of jejunum in CBA mice and of foot skin in WHT mice with single doses of 240 kVp X-rays while mice breathed gases of varying oxygen tensions. The radiosensitivities of these tissues were assessed by the crypt survival assay and the acute skin reaction, respectively. The radiosensitivity of CaNT tumours to single fraction irradiation was assessed by the regrowth delay assay following administration of single or multiple does of BW12C at varying times to air-breathing CBA mice. The radiation response was compared to the radiosensitivity of clamped tumours. The effect of BW12C alone on tumours was assessed by regrowth delay and histological examination for necrosis. Single or multiple doses of BW12C did not influence the radiosensitivity of CaNT tumours, although marked radioprotection could be induced by clamping the tumours during irradiation. Multiple doses of BW12C alone led to a slight increase in necrosis of the CaNT tumour but did not alter its growth rate. BW12C alone did not induce necrosis of the murine JT lymphoma. The results shown that BW12C did not have a significant effect as a radioprotective or necrotizing agent in these experimental systems. The reported differences in the radiomodifying effects of BW12C are probably tissue-specific and relate to complex biochemical and physiological interactions. 18 refs., 4 figs

  2. Ultrasonic-assisted solution combustion synthesis of porous Na{sub 3}V{sub 2}(PO{sub 4}){sub 3}/C: formation mechanism and sodium storage performance

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Qiuyun; Liu, Qing [Huazhong University of Science and Technology, State Key Laboratory of Materials Processing and Die and Mould Technology (China); Chu, Xiangcheng; Zhang, Yiling [Tsinghua University, State Key Laboratory of New Ceramic and Fine Processing (China); Yan, Youwei; Xue, Lihong, E-mail: xuelh@hust.edu.cn; Zhang, Wuxing, E-mail: zhangwx@hust.edu.cn [Huazhong University of Science and Technology, State Key Laboratory of Materials Processing and Die and Mould Technology (China)

    2017-04-15

    Solution combustion synthesis (SCS) is an effective and rapid method for synthesizing nanocrystalline materials. However, the control over size, morphology, and microstructure are rather limited in SCS. Here, we develop a novel ultrasonic-assisted solution combustion route to synthesize the porous and nano-sized Na{sub 3}V{sub 2}(PO{sub 4}){sub 3}/C composites, and reveal the effects of ultrasound on the structural evolution of NVP/C. Due to the cavitation effects generated from ultrasonic irradiation, the ultrasonic-assisted SCS can produce honeycomb precursor, which can be further transformed into porous Na{sub 3}V{sub 2}(PO{sub 4}){sub 3}/C with reticular and hollow structures after thermal treatment. When used as cathode material for Na-ion batteries, the porous Na{sub 3}V{sub 2}(PO{sub 4}){sub 3}/C delivers an initial discharge capacity of 118 mAh g{sup −1} at 0.1 C and an initial coulombic efficiency of 85%. It can retain 93.8% of the initial capacity after 120 cycles at 0.2 C. The results demonstrate that ultrasonic-assisted SCS can be a new strategy to design crystalline nanomaterials with tunable microstructures.

  3. A comparative structural and electrochemical study of monoclinic Li3V2(PO4)3/C and rhombohedral Li2.5Na0.5V(2−2x/3)Nix(PO4)3/C

    International Nuclear Information System (INIS)

    Wang, Wenhui; Chen, Zhenyu; Zhang, Jiaolong; Dai, Changsong; Li, Jiajie; Ji, Dalong

    2013-01-01

    In order to synthesize pure derivative of rhombohedral Li 3 V 2 (PO 4 ) 3 (LVP), lithium-ion batteries materials Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C (x = 0.03, 0.06, 0.09) and its control, monoclinic Li 3 V 2 (PO 4 ) 3 /C (LVP/C), were prepared by sol–gel method. The samples were investigated by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) spectroscopy, scanning electron microscopy (SEM), Raman spectroscopy, and electrochemical methods. The XRD patterns of Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C are in good agreement with that of rhombohedral LVP, which indicates that the Na + –Ni 2+ composite doping can change the structure of monoclinic LVP. All the composite doping samples displayed a single flat plateau at 3.7 V in the charge/discharge voltage profile, which is caused by transformation of multi-phase mechanism to single-phase mechanism. For Li 2.5 Na 0.5 V 1.98 Ni 0.03 (PO 4 ) 3 /C, a specific discharge capacity of 108 mAh g −1 was achieved at a 0.5 C charge rate and a 1 C discharge rate, and a 99.0% retention rate of the initial capacity was obtained after 50 cycles

  4. Crystal and molecular structure of 6,9-bis(trimethylamine)-nido-decarborane(12) B10H12[N(CH3)3]2

    International Nuclear Information System (INIS)

    Polyanskaya, T.M.; Volkov, V.V.

    1989-01-01

    The spatial structure of 6.9-bis(trimethylamine)-nido-decarborane (12) is established on the basis of X-ray diffraction analysis. Crystals are rhombic, a = 12.619, b = 11.804, c = 11.058A, Z=4, sp. gr. P na 2 1 . The structure is of molecular type. Main geometrical parameters of the molecule are: symmetry - C1, interatomic distances - B-B 1.66-1.90, B-N 1.61, N-C 1.50 A, angles - BBB 55.0-66.5, CNC 108, BBN 119.5 deg. The (B 10 H 12 ) cluster size between B(6) and B(9) is 3.30 A. Increase approximately by 0.1 A of lengths of external bonds B-B in comparison with internal ones and tightening approximately by 3 deg of valent angles BBB at external atoms of boron also in comparison with internal ones are observed

  5. Effect of alpha states in the 16O+12C scattering and in the 12C +α → 16O capture reaction of astrophysical interest

    International Nuclear Information System (INIS)

    Morais, M.C.; Lichtenthaele, R.; Arazi, A.; Hojman, D.; Cardona, M.A.; Fimiani, L.; Carnelli, P.F.; Marti, G.V.; Pacheco, A.J.; Martinez Heimann, D.; Negri, A.E.; Capurro, O.A.; Niello, Fernandez; Montero, P.

    2011-01-01

    Full text: The 16 O+ 12 C elastic scattering was investigated considering the effect of exchange of an alpha particle between projectile and target leading to the same nuclei of the entrance channel (elastic transfer). Angular distributions were analyzed in an energy range from 8.55 MeV to 56.57 MeV in the center of mass frame. The Coulomb barrier is around 11MeV for this system. Measurements of angular distributions of elastic and inelastic transfer reactions to states of the 16 O in the 16 O+ 12 C system were performed at the TANDAR Laboratory in Buenos Aires, using an 16 O beam of E lab = 46; 26 MeV. The transfer angular distributions were analyzed by DWBA using the computer code FRESCO. Those measurements provided the spectroscopic factors of 12 C + α → 16 O for the ground state and for J π = 2 + and J π = 1 - 16 O excited states, both just below the α-threshold at 7.16 MeV. The Asymptotic Normalization Coefficient (ANC) for the J π = 2 + state was obtained (1.05 ±0,13(10 5 fm -1/2 )) and used to calculate the reduced width of this state, with this value a R-matrix calculation was performed to determine the astrophysical S-factor in energies around the Gamow peak, S(E2)=37keVb. (author)

  6. Photobiomodulation Protects and Promotes Differentiation of C2C12 Myoblast Cells Exposed to Snake Venom.

    Directory of Open Access Journals (Sweden)

    Luciana Miato Gonçalves Silva

    Full Text Available Snakebites is a neglected disease and in Brazil is considered a serious health problem, with the majority of the snakebites caused by the genus Bothrops. Antivenom therapy and other first-aid treatments do not reverse local myonecrose which is the main sequel caused by the envenomation. Several studies have shown the effectiveness of low level laser (LLL therapy in reducing local myonecrosis induced by Bothropic venoms, however the mechanism involved in this effect is unknown. In this in vitro study, we aimed to analyze the effect of LLL irradiation against cytotoxicity induced by Bothrops jararacussu venom on myoblast C2C12 cells.C2C12 were utilized as a model target and were incubated with B. jararacussu venom (12.5 μg/mL and immediately irradiated with LLL at wavelength of red 685 nm or infrared 830 nm with energy density of 2.0, 4.6 and 7.0 J/cm2. Effects of LLL on cellular responses of venom-induced cytotoxicity were examined, including cell viability, measurement of cell damage and intra and extracellular ATP levels, expression of myogenic regulatory factors, as well as cellular differentiation.In non-irradiated cells, the venom caused a decrease in cell viability and a massive release of LDH and CK levels indicating myonecrosis. Infrared and red laser at all energy densities were able to considerably decrease venom-induced cytotoxicity. Laser irradiation induced myoblasts to differentiate into myotubes and this effect was accompanied by up regulation of MyoD and specially myogenin. Moreover, LLL was able to reduce the extracellular while increased the intracellular ATP content after venom exposure. In addition, no difference in the intensity of cytotoxicity was shown by non-irradiated and irradiated venom.LLL irradiation caused a protective effect on C2C12 cells against the cytotoxicity caused by B. jararacussu venom and promotes differentiation of these cells by up regulation of myogenic factors. A modulatory effect of ATP synthesis may

  7. Analysis of the 12C (e,e'pd) Reaction at High Energy Transfer

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, Neil [Univ. of Glasgow, Scotland (United Kingdom)

    2011-03-31

    The Jefferson Lab Hall A experiment E01015 measured the differential cross sections of the 12C (e,e'pd) reaction with low yields for kinematics of w = 0.865 GeV , Q2 = 2 (GeV/c)2, xB = 1.2 at three kinematic settings of 12C (e,e'p) missing momentum of 300, 400 and 500 MeV/c. The main objective of the experiment was to measure the 12C (e, e0p) cross section and the cross section ratios of 12C (e,e'pp) and 12C (e,e'pn) to investigate Short Range Correlations. The 12C (e,e'pd) reaction was investigated to find out what its magnitude of cross section. The very low yields and differential cross sections of 12C (e,e'pd) reaction measured at the three different kinematic settings suggests that the contribution of many of the different reaction mechanisms, including three nucleon forces, may be suppressed at the kinematics of this experiment.

  8. A critical review of atmospheric 14 C activities

    International Nuclear Information System (INIS)

    Krajcar Bronic, I.; Horvatincic, N.; Baresic, J.; Obelic, B.; Vreca, P.

    2006-01-01

    14 C activity of atmospheric CO 2 has been measured at the Rudjer Boskovi Institute as a part of environmental monitoring in order to determine possible differences between clean-air sites, industrialized city and sites in the vicinity of nuclear power plant. Samples of CO 2 from the atmosphere have been collected by absorption of CO 2 on the saturated carbonate-free NaOH solution for a period of 1 month under stationary conditions. The obtained Na 2 CO 3 has been dissolved in HCl and the produced CO 2 used for CH 4 preparation by catalytic reaction with H 2 at 450 degrees Celsius. A gas proportional counter filled with CH 4 has been used for 14 C activity measurement. The method of collection of CO 2 does not require any power source and can be therefore used for sampling at the remote sites, such as mountains or forests. However,due to the lack of mixing of the Na OH solution, the absorption process is limited on the surface of the solution, and there exists the possibility of fractionation of carbon isotopes due to different reaction rate constants of 12 C and 13 C. A continuous record of atmospheric 14 CO 2 activity exists for the city of Zagreb (1986 to 2005), while shorter records (1-2 years) exist for several other sites of various characteristics: two clean-air sites (Mt. Medvednica, altitude about 1000 m a.s.l., for period 1995 to 1996, and the Plitvice National Park for period 2003 to 2005), and a site close to the Nuclear Power Plant Krsko (1984 to 1986).Within the bilateral Croatian-Slovene project we have recently measured also the stable isotope composition (δ13 C) of Na 2 CO 3 collected at two different sampling sites in order to determine seasonal fluctuations in both 14 C and 13 C isotope composition. Unexpectedly low δ13 C values have been obtained about (-25±2)0/00 instead of expected (-7±1)0/00. Such low values have been attributed to the carbon isotope fractionation during the CO 2 absorption on the highly alkaline medium because of

  9. Carbon Incorporation and Anion Dynamics as Synergistic Drivers for Ultrafast Diffusion in Superionic LiCB11H12 and NaCB11H12

    Energy Technology Data Exchange (ETDEWEB)

    Dimitrievska, Mirjana [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Shea, Patrick [Lawrence Livermore National Laboratory; Kweon, Kyoung E. [Lawrence Livermore National Laboratory; Bercx, Marnik [University of Antwerp; Varley, Joel B. [Lawrence Livermore National Laboratory; Tang, Wan Si [National Institute of Standards and Technology; University of Maryland; Skripov, Alexander V. [Ural Division of the Russian Academy of Sciences; Stavila, Vitalie [Sandia National Laboratories; Udovic, Terrence J. [National Institute of Standards and Technology; Wood, Brandon C. [Lawrence Livermore National Laboratory

    2018-02-02

    The disordered phases of LiCB11H12 and NaCB11H12 possess superb superionic conductivities that make them suitable as solid electrolytes. In these materials, cation diffusion correlates with high orientational mobilities of the CB11H12- anions; however, the precise relationship has yet to be demonstrated. In this work, ab initio molecular dynamics and quasielastic neutron scattering are combined to probe anion reorientations and their mechanistic connection to cation mobility over a range of timescales and temperatures. It is found that anions do not rotate freely, but rather transition rapidly between orientations defined by the cation sublattice symmetry. The symmetry-breaking carbon atom in CB11H12- also plays a critical role by perturbing the energy landscape along the instantaneous orientation of the anion dipole, which couples fluctuations in the cation probability density directly to the anion motion. Anion reorientation rates exceed 3 x 1010 s-1, suggesting the underlying energy landscape fluctuates dynamically on diffusion-relevant timescales. Furthermore, carbon is found to modify the orientational preferences of the anions and aid rotational mobility, creating additional symmetry incompatibilities that inhibit ordering. The results suggest that synergy between the anion reorientational dynamics and the carbon-modified cation-anion interaction accounts for the higher ionic conductivity in CB11H12- salts compared with B12H122-.

  10. Y{sub 3}Fe{sub 5}O{sub 12}/Na,Bi,Sr-doped PZT particulate magnetoelectric composites

    Energy Technology Data Exchange (ETDEWEB)

    Lisnevskaya, I.V., E-mail: liv@sfedu.ru; Bobrova, I.A.; Lupeiko, T.G.; Agamirzoeva, M.R.; Myagkaya, K.V.

    2016-05-01

    Magnetoelectric (ME) composites of Na, Bi, Sr substituted lead zirconate titanate (PZT) and yttrium iron garnet having representative formula (100−x) wt% Na,Bi,Sr-doped PZT (PZTNB-1)+x wt% Y{sub 3}Fe{sub 5}O{sub 12} (YIG) with x=10–90 were manufactured using powdered components obtained through sol–gel processes. It is shown that the decrease in sintering temperature provided by the use of finely dispersed PZTNB-1 and YIG powders allows to significantly reduce content of fluorite-like foreign phase based on zirconium oxide, which forms due to the interfacial interaction during heat treatment and becomes stabilized by yttrium oxide. Connectivity has considerable effect on the value of ME coefficient of composite ceramics. With the same x value, ΔE/ΔH characteristic decreases when changing from 0–3-type structured composites (PZT grains embedded in ferrite matrix) to 3-3-(interpenetrating network of two phases) and especially 3-0-type samples (YIG grains embedded in PZT matrix); in the last case this can be attributed to the substrate clamping effect when ferrite grains are clamped with piezoelectric matrix. ΔE/ΔH value of 0–3 composites with x=40–60 wt% was found to be ∼1.6 mV/(cm Oe). - Highlights: • Y{sub 3}Fe{sub 5}O{sub 12}/Na,Bi,Sr-doped PZT particulate magnetoelectric composites were prepared. • The decrease in sintering temperature reduces the content of foreign phase of ZrO{sub 2}. • Connectivity pattern is important factor for magnetoelectric response. • The value of ME coefficient reaches ~1,6 mV/(cm Oe) in 0–3 composites.

  11. Neutron scattering from 12C between 15.6 and 17.3 MeV

    International Nuclear Information System (INIS)

    Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L.

    1993-01-01

    The differential cross section σ(θ) for neutron elastic scattering from 12 C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The σ(θ) data, together with published analysing power A y (θ) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present 12 C(n,n) 12 C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in 11 C via an iterative-moment approach or a dispersive optical-model analysis. (author)

  12. Estudios estructurales de la proteína mayoritaria de la cápsida de lentivirus

    OpenAIRE

    Yélamos López, María Belén

    1998-01-01

    Los Lentivirus son un grupo de virus, subfamilia de los Retrovirus. Incluyen virus de gran importancia tanto veterinaria, como el virus de la anemia infecciosa equina (EIAV) o el virus de la inmunodeficiencia felina (FIV), como clínica como el virus de la inmunodeficiencia humana (HIV). Nuestro sistema de estudio es la proteína mayoritaria de la cápsida de lentivirus. Las proteínas de las cápsidas lentivirales tienen una gran homología de secuencia. Este alto grado de similitud, junto con la ...

  13. Existe diferença no estadiamento entre doentes operados de câncer colorretal no sistema previdenciário e na clinica privada?

    Directory of Open Access Journals (Sweden)

    Rodrigo Cuiabano Paes Leme

    Full Text Available OBJETIVO: Avaliar se existe diferença no estadiamento de doentes submetidos à ressecção intestinal por câncer colorretal no sistema previdenciário e na clínica privada. MÉTODO: Foram estudados de forma retrospectiva 41 doentes (16 homens e 25 mulheres com idade média de 59,4 anos operados no sistema previdenciário (SP e 33 doentes (18 homens e 15 mulheres com idade média de 60,8 anos operados na clínica privada (CP. Foram avaliados o estadiamento TNM, a frequência de operações de urgência, de operações paliativas e do uso de colostomia. RESULTADOS: Não se observou diferença entre o estadiamento dos dois grupos. A frequência de operações de urgência foi 26,8% no SP e 12,1% na CP (p=0,100. As operações paliativas ( 19,5% SP x 6,1% CP e o uso de colostomia ( 26,8 SP X 15,2 CP foram maiores no sistema previdenciário porém os valores não foram estatisticamente significantes, valores de p=0,087 e p=0,352 respectivamente. CONCLUSÃO: Não há diferença significante entre o estadiamento TNM de doentes operados no sistema previdenciário e privado.

  14. Where have all the Na+ channels gone? In search of functional ENaC in exocrine pancreas

    DEFF Research Database (Denmark)

    Novak, Ivana; Hansen, Mette R

    2002-01-01

    was to investigate if pancreatic ducts express functional ENaC. Membrane voltages (V) of ducts isolated from rat pancreas were measured with microelectrodes or whole-cell patch-clamp technique. Amiloride and benzamil given from bath or luminal sides did not hyperpolarize V. Lowering of extracellular Na...... with glucocorticoids had no effect on pancreatic fluid secretion evoked from ducts, or from acini. Hence, our study shows that pancreas especially pancreatic ducts do not express functional ENaC....

  15. Determination of reaction cross sections with the aid of α decay in the 12C, 14C + 209Bl reactions

    International Nuclear Information System (INIS)

    Hick, H.

    1980-01-01

    For the reactions 14 C + 209 Bi and 12 C + 209 Bi excitation functions at energies in the range between 57 MeV and 76 MeV are measured. Radiative capture and particle evaporation cross sections were determined by means of α-spectroscopy, and fission cross sections were determined by the measurement of the γ-radiation after the β-decay of the fission products. For the radiative capture for the reaction 14 C + 209 Bi upper limits for the cross section from 21 nbarn to 178 nbarn in the energy interval 61-74 MeV were determined. The fission cross sections were 80 +- 30 mbarn at 490 +- 200 mbarn at 76 MeV. For the reaction 12 C + 209 Bi three new α-lines were found. They were due to the slope at their excitation functions assigned to the decay of isomeric states of following nuclei: 219 Ac Esub(α) = 9419 +- 4 keV Tsub(1/2) = 830 +- 100/μsec, 218 Ac Esub(α) = 9271 +- 4 keV Tsub(1/2) = 810 +- 70/μsec, 217 Ac Eα = 9730 +- 5 keV Tsub(1/2) = 970 +- 190/μsec. For the reactions respectively 12 C + 209 Bi calculations using the statistical model code Grogi of J. Gilat are performed. The calculated branchings of the evaporation channels were compared with the experiment. (orig./HSI) [de

  16. Nuclear critical opalescence and the M1 form factors of 12C and 13C

    International Nuclear Information System (INIS)

    Delorme, J.; Figureau, A.; Guichon, P.

    1981-01-01

    It is shown that core polarization by the nuclear pion field has opposite effects on the M1 form factors of 12 C(15.11 MeV) and 13 C(g.s.). New data on 13 C are found to agree with this prediction and a common interpretation of the experiments is shown to be possible for the two nuclei in terms of critical opalescence. Discrimination from alternative explanations of the observed anomalies should await further experiments, especially photopion reactions. (orig.)

  17. A new cell-based assay to evaluate myogenesis in mouse myoblast C2C12 cells

    Energy Technology Data Exchange (ETDEWEB)

    Kodaka, Manami [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Yang, Zeyu [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Department of Ultrasound, Shengjing Hospital of China Medical University, Shenyang (China); Nakagawa, Kentaro; Maruyama, Junichi [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Xu, Xiaoyin [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Department of Breast Surgery, The Second Affiliated Hospital of Wenzhou Medical University, Wenzhou (China); Sarkar, Aradhan; Ichimura, Ayana [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Nasu, Yusuke [Department of Breast Surgery, The Second Affiliated Hospital of Wenzhou Medical University, Wenzhou (China); Ozawa, Takeaki [Department of Chemistry, School of Science, The University of Tokyo, Tokyo (Japan); Iwasa, Hiroaki [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Ishigami-Yuasa, Mari [Chemical Biology Screening Center, Tokyo Medical and Dental University, Tokyo (Japan); Ito, Shigeru [Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental University, Tokyo (Japan); Kagechika, Hiroyuki [Chemical Biology Screening Center, Tokyo Medical and Dental University, Tokyo (Japan); Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental University, Tokyo (Japan); and others

    2015-08-15

    The development of the efficient screening system of detecting compounds that promote myogenesis and prevent muscle atrophy is important. Mouse C2C12 cells are widely used to evaluate myogenesis but the procedures of the assay are not simple and the quantification is not easy. We established C2C12 cells expressing the N-terminal green fluorescence protein (GFP) and the C-terminal GFP (GFP1–10 and GFP11 cells). GFP1–10 and GFP11 cells do not exhibit GFP signals until they are fused. The signal intensity correlates with the expression of myogenic markers and myofusion. Myogenesis-promoting reagents, such as insulin-like growth factor-1 (IGF1) and β-guanidinopropionic acid (GPA), enhance the signals, whereas the poly-caspase inhibitor, z-VAD-FMK, suppresses it. GFP signals are observed when myotubes formed by GFP1–10 cells are fused with single nuclear GFP11 cells, and enhanced by IGF1, GPA, and IBS008738, a recently-reported myogenesis-promoting reagent. Fusion between myotubes formed by GFP1–10 and GFP11 cells is associated with the appearance of GFP signals. IGF1 and GPA augment these signals, whereas NSC23766, Rac inhibitor, decreases them. The conditioned medium of cancer cells suppresses GFP signals during myogenesis and reduces the width of GFP-positive myotubes after differentiation. Thus the novel split GFP-based assay will provide the useful method for the study of myogenesis, myofusion, and atrophy. - Highlights: • C2C12 cells expressing split GFP proteins show GFP signals when mix-cultured. • The GFP signals correlate with myogenesis and myofusion. • The GFP signals attenuate under the condition that muscle atrophy is induced.

  18. A new cell-based assay to evaluate myogenesis in mouse myoblast C2C12 cells

    International Nuclear Information System (INIS)

    Kodaka, Manami; Yang, Zeyu; Nakagawa, Kentaro; Maruyama, Junichi; Xu, Xiaoyin; Sarkar, Aradhan; Ichimura, Ayana; Nasu, Yusuke; Ozawa, Takeaki; Iwasa, Hiroaki; Ishigami-Yuasa, Mari; Ito, Shigeru; Kagechika, Hiroyuki

    2015-01-01

    The development of the efficient screening system of detecting compounds that promote myogenesis and prevent muscle atrophy is important. Mouse C2C12 cells are widely used to evaluate myogenesis but the procedures of the assay are not simple and the quantification is not easy. We established C2C12 cells expressing the N-terminal green fluorescence protein (GFP) and the C-terminal GFP (GFP1–10 and GFP11 cells). GFP1–10 and GFP11 cells do not exhibit GFP signals until they are fused. The signal intensity correlates with the expression of myogenic markers and myofusion. Myogenesis-promoting reagents, such as insulin-like growth factor-1 (IGF1) and β-guanidinopropionic acid (GPA), enhance the signals, whereas the poly-caspase inhibitor, z-VAD-FMK, suppresses it. GFP signals are observed when myotubes formed by GFP1–10 cells are fused with single nuclear GFP11 cells, and enhanced by IGF1, GPA, and IBS008738, a recently-reported myogenesis-promoting reagent. Fusion between myotubes formed by GFP1–10 and GFP11 cells is associated with the appearance of GFP signals. IGF1 and GPA augment these signals, whereas NSC23766, Rac inhibitor, decreases them. The conditioned medium of cancer cells suppresses GFP signals during myogenesis and reduces the width of GFP-positive myotubes after differentiation. Thus the novel split GFP-based assay will provide the useful method for the study of myogenesis, myofusion, and atrophy. - Highlights: • C2C12 cells expressing split GFP proteins show GFP signals when mix-cultured. • The GFP signals correlate with myogenesis and myofusion. • The GFP signals attenuate under the condition that muscle atrophy is induced

  19. Osmotic and activity coefficients of aqueous NaTcO4 and NaReO4 solutions at 250C

    International Nuclear Information System (INIS)

    Boyd, G.E.

    1978-01-01

    Isopiestic vapor-pressure comparison experiments were performed with aqueous binary sodium perchlorate, pertechnetate, and perrhenate solutions to concentrations of approximately 8.5 m. Osmotic coefficients for these solutions and mean molal ionic activity coefficients for NaTcO 4 and NaReO 4 were derived from the isotonic molalities. Pitzer's treatment was applied to describe the concentration dependence of the osmotic coefficients of NaClO 4 , NaTcO 4 , and NaReO 4 , and the implications of the parameters derived from a least-squares fit are discussed in terms of solvent structure and interionic forces. 4 tables, 1 figure

  20. Generation of particles with large transverse momenta in π--p- and π-12C-interactions at 40 GeV/c

    International Nuclear Information System (INIS)

    Jordanova, Yu.; Lyubimov, V.; Mitova, S.; Penev, V.N.; Shklovskaya, A.

    1981-01-01

    The generation of a particle with transverse momenta Psub(transverse)>0.8 GeV/c in π - -p- and π - - 12 C-interactions with a π - -meson beam at a momentum Psub(π)=40 GeV/c in a two-meter propan chamber is investigated. Analyses of the secondary particle correlations produced in the interactions, in which the emitted hadron or group of hadrons have large transverse momenta, are carried out. In the investigated interactions the secondary particle momenta are measured with an accuracy not less than 30%. In the experimental data treatment of the π - - 12 C-collisions the interactions of π - -mesons with the quasifree nucleons of 12 C-nucleus are taken into account on the basis of the multiperipherical model. The experimental data analyses indicate that: 1) In the events with one or more secondary particles having large momenta Psub(transverse)>0.8 GeV/c the asymmetric correlations increase for both π - -p- and π - - 12 C-interactions; 2) Most correlated pairs of secondary particles having Psub(transverse)>0.8 GeV/c are produced with an almost equal rapidity and transverse momenta; 3) The presence of the secondary particles with large transverse momenta does not influence the resonance formation (in particular rho 0 -meson); 4) The effective mass distribution of the two secondary particles with Psub(transverse)>0.8 GeV/c has a broad peak at about 2 GeV/c

  1. Y3Fe5O12/Na,Bi,Sr-doped PZT particulate magnetoelectric composites

    Science.gov (United States)

    Lisnevskaya, I. V.; Bobrova, I. A.; Lupeiko, T. G.; Agamirzoeva, M. R.; Myagkaya, K. V.

    2016-05-01

    Magnetoelectric (ME) composites of Na, Bi, Sr substituted lead zirconate titanate (PZT) and yttrium iron garnet having representative formula (100-x) wt% Na,Bi,Sr-doped PZT (PZTNB-1)+x wt% Y3Fe5O12 (YIG) with x=10-90 were manufactured using powdered components obtained through sol-gel processes. It is shown that the decrease in sintering temperature provided by the use of finely dispersed PZTNB-1 and YIG powders allows to significantly reduce content of fluorite-like foreign phase based on zirconium oxide, which forms due to the interfacial interaction during heat treatment and becomes stabilized by yttrium oxide. Connectivity has considerable effect on the value of ME coefficient of composite ceramics. With the same x value, ΔE/ΔH characteristic decreases when changing from 0-3-type structured composites (PZT grains embedded in ferrite matrix) to 3-3-(interpenetrating network of two phases) and especially 3-0-type samples (YIG grains embedded in PZT matrix); in the last case this can be attributed to the substrate clamping effect when ferrite grains are clamped with piezoelectric matrix. ΔE/ΔH value of 0-3 composites with x=40-60 wt% was found to be ∼1.6 mV/(cm Oe).

  2. Synthesis and fluorescence of new 3-biphenylpyrrolo[1,2-c]pyrimidines

    Directory of Open Access Journals (Sweden)

    Marian-Laurentiu Tatu

    2017-07-01

    Full Text Available New pyrrolo[1,2-c]pyrimidines derivates having a biphenyl moiety at position 3 have been synthesized by 1,3-dipolar cycloaddition of their corresponding N-ylides with activated alkynes. FTIR, 1H and 13C NMR spectroscopy and elemental analysis have been used to characterize the structures of the new nine pyrrolo[1,2-c]pyrimidine derivates. Absorption and fluorescence spectra have been recorded. The appropriate solvent for the photoluminescence properties of the studied compounds has been found to be chloroform:acetonitrile mixture (1:1. The main spectral features such as molar extinction coefficients (ε, Stokes shifts, quantum yields using quinine sulphate as standard, fluorescence quenching in the presence of benzoquinone and Stern-Volmer constants have been calculated. The substituent effects on intensity of absorption, maximum absorbance wavelengths and fluorescence parameters have been discussed. The highest quantum yield value was found for ethyl 3-(4-biphenylyl-7-(3,4-dimethoxybenzoylpyrrolo[1,2-c]pyrimidine-5-carboxylate (0.55. The obtained results suggest that the studied compounds are promising candidates for future study in order to evaluate their use in practical applications in fluorescent chemical sensors.

  3. A frogspawn-inspired hierarchical porous NaTi2(PO4)3-C array for high-rate and long-life aqueous rechargeable sodium batteries

    Science.gov (United States)

    Zhao, Baidan; Lin, Bo; Zhang, Sen; Deng, Chao

    2015-11-01

    Hollow micro/nano-arrays have attracted tremendous attention in the field of energy conversion and storage, but such structures usually compromise the volumetric energy density of the electrode materials. Frogspawn consists of a spawn core and a transparent jelly shell organized in a hierarchical porous array, which exhibits superior mechanical strength and high-efficiency oxygen permeability. It can be used as a model for designing a new high-performance electrode material, which has advantages such as a high surface area, fast mass transport and superior durability. Herein, we report a frogspawn-like NaTi2(PO4)3/C array prepared by a facile preform impregnation strategy. The framework is formed by a hollow carbon sphere connected by the NaTi2(PO4)3/C skeleton, and its hollow is filled with the NaTi2(PO4)3 nanospheres. The whole hierarchical porous three-dimensional array copies the structure of a frogspawn. This unique structure not only enables easy electrolyte percolation and fast electron/ion transport, but also enhances the reversible capacity and cycling durability. When it is applied as an anode of the aqueous sodium ion battery, it exhibits favorable high rate capability and superior cycling stability, and retains 89% of the initial capacity after two thousand cycles at 20 C. Moreover, the full cell using the frogspawn-inspired NaTi2(PO4)3-C as the anode and Na0.44MnO2 as the cathode is capable of ultralong cycling up to one thousand cycles at alternate 10 and 60 C, which is among the best of state-of-the-art aqueous sodium ion systems. Therefore, the frogspawn-inspired architecture provides a new strategy to the tailored design of polyanion materials for high-power applications.Hollow micro/nano-arrays have attracted tremendous attention in the field of energy conversion and storage, but such structures usually compromise the volumetric energy density of the electrode materials. Frogspawn consists of a spawn core and a transparent jelly shell organized in

  4. Tissue quantification of neutral and acid mucins in the mucosa of the colon with and without fecal stream in rats Quantificação tecidual de mucinas neutras e ácidas na mucosa do cólon com e sem trânsito intestinal em ratos

    Directory of Open Access Journals (Sweden)

    Ronaldo Nonose

    2009-08-01

    Full Text Available PURPOSE: To quantify the intensity of the expression of neutral and acids mucins in mucosa of the colon with and without fecal stream and to correlate this with the duration of fecal transit diversion. METHODS: Thirty male Wistar rats were subjected to fecal transit deviation in the left colon by a proximal colostomy and a distal mucous fistula. The animals were divided into three experimental groups, according to whether sacrificing would be performed six, 12 or 18 weeks after surgery. The expression of neutral and acid mucins was evaluated using the histochemical techniques of Periodic Acid Schiff and Alcian Blue, respectively. The tissue mucins expression was quantified by computer-assisted image analysis software (NIS-Elements in the segments with and without fecal stream. Student's paired t test was used to compare the quantities of mucins in colon with or without fecal stream and variance between the experimental groups by ANOVA and Newman-Keuls post-test, establishing level of signification of 5% (pOBJETIVO: Quantificar a intensidade de expressão de mucinas neutras e ácidas na mucosa cólica provida e desprovida de trânsito intestinal relacionando-a ao tempo de exclusão fecal. MÉTODOS: Trinta ratos Wistar machos foram submetidos à derivação do trânsito no cólon esquerdo por colostomia proximal e fístula mucosa distal. Os animais foram divididos em três grupos experimentais segundo o sacrifício ter sido realizado seis, 12 e 18 semanas após a cirurgia. A avaliação da expressão de mucinas neutras e ácidas na mucosa cólica foi realizada com as técnicas histoquímicas do Periódico Ácido de Schiff e Azul de Alcian, respectivamente. A quantificação da expressão tecidual das mucinas foi com auxílio de programa de análise de imagem assistida por computador (NIS-Elements nos segmentos providos e desprovidos de trânsito fecal. Utilizou-se o teste t de Student pareado na comparação da expressão de mucinas nos segmentos

  5. Electrical analysis of inter-growth structured Bi4Ti3O12-Na0.5Bi4.5Ti4O15 ceramics

    Science.gov (United States)

    Jiang, Xiangping; Jiang, Yalin; Jiang, Xingan; Chen, Chao; Tu, Na; Chen, Yunjing

    2017-06-01

    Inter-growth bismuth layer-structured ferroelectrics (BLSFs), Bi4Ti3O12-Na0.5Bi4.5Ti4O15 (BIT-NBT), were successfully synthesized using the traditional solid-state reaction method. X-ray diffraction (XRD) Rietveld refinements were conducted using GSAS software. Good agreement and low residual are obtained. The XRD diffraction peaks can be well indexed into I2cm space group. The inter-growth structure was further observed in the high-resolution TEM image. Dielectric and impedance properties were measured and systematically analyzed. At the temperature range 763-923 K (below {T}{{c}}), doubly ionized oxygen vacancies (OVs) are localized and the short-range hopping leads to the relaxation processes with an activation energy of 0.79-1.01 eV. Above {T}{{c}}, the doubly charged OVs are delocalized and become free ones, which contribute to the long-range dc conduction. The reduction in relaxation species gives rise to a higher relaxation activation energy ˜1.6  eV. Project supported by the National Natural Science Foundation of China (Grant Nos. 51562014, 51262009, and 51602135).

  6. New results from the NA49 experiment on hadron production in p+p and p+C interactions and survey of backward hadrons in p+C collisions

    Directory of Open Access Journals (Sweden)

    Makariev M.

    2013-06-01

    Full Text Available Recent results on proton, anti-proton, neutron and charged kaon production in proton-proton and proton, anti-proton, neutron, deuteron and triton production in proton-carbon collisions at 158 GeV/c beam momentum are presented. Data samples of 4.8 million and 385 734 inelastic events in p+p and p+C, respectively, are obtained with the NA49 detector at the CERN SPS accelerator. The charged particles are identified by energy loss measurement in a system of four TPC chambers, while the neutrons are detected in a forward hadronic calorimeter. The data cover a major fraction of the phase space, ranging from 0 to 1.9 GeV in pT and in Feynman x variable from -0.8 to 0.95 for protons, from -0.2 to 0.3 for anti-protons, from 0.1 to 0.95 for neutrons and from 0 to 0.5 for kaons. The comparison of the results on proton and neutron production in p+p interactions and deep inelastic e+p collisions at HERA reveals an independence of target fragmentation on the projectile type. Using the charged kaon data in p+p collisions as a reference, a new evaluation of the energy dependence of kaon production, including neutral kaons, is conducted over a range from 3 GeV to p+p− collider energies. A survey of backward production of protons and pions in p+C collisions in the range of lab angles from 10 to 180 degrees, from 0.2 to 1.2 GeV/c in lab momentum and from 1 to 400 GeV/c in projectile momentum has been performed.

  7. Topotactic redox chemistry of NaFeAs in water and air and superconducting behavior with stoichiometry change.

    Energy Technology Data Exchange (ETDEWEB)

    Todorov, I.; Chung, D. Y.; Claus, H.; Malliakas, C. D.; Douvalis, A. P.; Bakas, T.; He, J.; Dravid, V. P.; Kanatzidis, M. G.; Materials Science Division; Northwestern Univ.; Univ. of Ioannina

    2010-07-13

    We report experimental evidence that shows superconductivity in NaFeAs occurs when it is Na deficient. The oxidation of NaFeAs progresses differently in water and in air. In water the material oxidizes slowly and slightly retaining the original anti-PbFCl structure. In air NaFeAs oxidizes topotactically quickly and extensively transforming to the ThCr{sub 2}Si{sub 2} structure type. Water acts as a mild oxidizing agent on the FeAs layer by extracting electrons and Na{sup +} cations from the structure, while oxidation in air is more extensive and leads to change in structure type from NaFeAs to NaFe{sub 2}As{sub 2}. The superconducting transition temperature moves dramatically during the oxidation process. Exposed to water for an extended time period NaFeAs shows a substantial increase in T{sub c} up to 25 K with contraction of unit cell volume. NaFe{sub 2}As{sub 2}, the air oxidized product, shows T{sub c} of 12 K. We report detailed characterization of the redox chemistry and transformation of NaFeAs in water and air using single crystal and powder X-ray diffraction, magnetization studies, transmission electron microscopy, Moessbauer spectroscopy, pOH and elemental analysis.

  8. Investigation of the 9Be(a,n)12C reaction. Pt. 2

    International Nuclear Information System (INIS)

    Schmidt, D.; Boettger, R.; Klein, H.; Nolte, R.

    1992-04-01

    Differential cross sections of the 9 Be(α,n) 12 C reaction have been measured at 19 alpha energies between 7 MeV and 16 MeV. Besides the differential cross sections from the 9 Be(α,n) 12 C(g.s.) reaction, also those of the 9 Be(α,n) 12 C(E ex ) reactions were derived for excitation energies E ex = 4.439, 7.654, 9.641, 10.84, 11.83 and 12.71 MeV. Possible sources of uncertainties have been extensively investigated and the corresponding results have been published in part 1. All partial and integrated cross sections from the 9 Be(α,n) 12 C(g.s.) reaction were determined with uncertainties of less than 5%. The angular distributions were fitted to Legendre polynomial expansions by the least-squares method. A comparison of the measured cross sections with data from other authors and with an evaluation shows considerable deviations in some cases. Tests were also carried out to ascertain how well an interpolation of the Legendre coefficients reproduces the magnitude and shape of the experimentally determined angular distributions. All angular distributions are presented in figures, together with their Legendre polynomial expansions and data from the literature if available. The a l coefficients of the Legendre polynomial expansions are given in the Appendix. (orig.) [de

  9. Effect of alkyl glycerophosphate on the activation of peroxisome proliferator-activated receptor gamma and glucose uptake in C2C12 cells

    Energy Technology Data Exchange (ETDEWEB)

    Tsukahara, Tamotsu, E-mail: ttamotsu@shinshu-u.ac.jp [Department of Integrative Physiology and Bio-System Control, Shinshu University School of Medicine, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Haniu, Hisao [Department of Orthopedic Surgery, Shinshu University School of Medicine, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Matsuda, Yoshikazu [Clinical Pharmacology Educational Center, Nihon Pharmaceutical University, Ina-machi, Saitama 362-0806 (Japan)

    2013-04-12

    Highlights: •Alkyl-LPA specifically interacts with PPARγ. •Alkyl-LPA treatments induces lipid accumulation in C2C12 cells. •Alkyl-LPA enhanced glucose uptake in C2C12 cells. •Alkyl-LPA-treated C2C12 cells express increased amounts of GLUT4 mRNA. •Alkyl-LPA is a novel therapeutic agent that can be used for the treatment of obesity and diabetes. -- Abstract: Studies on the effects of lipids on skeletal muscle cells rarely examine the effects of lysophospholipids. Through our recent studies, we identified select forms of phospholipids, such as alkyl-LPA, as ligands for the intracellular receptor peroxisome proliferator-activated receptor gamma (PPARγ). PPARγ is a nuclear hormone receptor implicated in many human diseases, including diabetes and obesity. We previously showed that alkyl-LPA is a specific agonist of PPARγ. However, the mechanism by which the alkyl-LPA–PPARγ axis affects skeletal muscle cells is poorly defined. Our objective in the present study was to determine whether alkyl-LPA and PPARγ activation promotes glucose uptake in skeletal muscle cells. Our findings indicate that PPARγ1 mRNA is more abundant than PPARγ2 mRNA in C2C12 cells. We showed that alkyl-LPA (3 μM) significantly activated PPARγ and increased intracellular glucose levels in skeletal muscle cells. We also showed that incubation of C2C12 cells with alkyl-LPA led to lipid accumulation in the cells. These findings suggest that alkyl-LPA activates PPARγ and stimulates glucose uptake in the absence of insulin in C2C12 cells. This may contribute to the plasma glucose-lowering effect in the treatment of insulin resistance.

  10. Effect of alkyl glycerophosphate on the activation of peroxisome proliferator-activated receptor gamma and glucose uptake in C2C12 cells

    International Nuclear Information System (INIS)

    Tsukahara, Tamotsu; Haniu, Hisao; Matsuda, Yoshikazu

    2013-01-01

    Highlights: •Alkyl-LPA specifically interacts with PPARγ. •Alkyl-LPA treatments induces lipid accumulation in C2C12 cells. •Alkyl-LPA enhanced glucose uptake in C2C12 cells. •Alkyl-LPA-treated C2C12 cells express increased amounts of GLUT4 mRNA. •Alkyl-LPA is a novel therapeutic agent that can be used for the treatment of obesity and diabetes. -- Abstract: Studies on the effects of lipids on skeletal muscle cells rarely examine the effects of lysophospholipids. Through our recent studies, we identified select forms of phospholipids, such as alkyl-LPA, as ligands for the intracellular receptor peroxisome proliferator-activated receptor gamma (PPARγ). PPARγ is a nuclear hormone receptor implicated in many human diseases, including diabetes and obesity. We previously showed that alkyl-LPA is a specific agonist of PPARγ. However, the mechanism by which the alkyl-LPA–PPARγ axis affects skeletal muscle cells is poorly defined. Our objective in the present study was to determine whether alkyl-LPA and PPARγ activation promotes glucose uptake in skeletal muscle cells. Our findings indicate that PPARγ1 mRNA is more abundant than PPARγ2 mRNA in C2C12 cells. We showed that alkyl-LPA (3 μM) significantly activated PPARγ and increased intracellular glucose levels in skeletal muscle cells. We also showed that incubation of C2C12 cells with alkyl-LPA led to lipid accumulation in the cells. These findings suggest that alkyl-LPA activates PPARγ and stimulates glucose uptake in the absence of insulin in C2C12 cells. This may contribute to the plasma glucose-lowering effect in the treatment of insulin resistance

  11. Near-UV and blue wavelength excitable Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} high efficiency red phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Khanna, A. [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Dutta, P.S., E-mail: duttap@rpi.edu [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)

    2015-05-15

    Red phosphors with narrow emission around 615 nm (with FWHM~5–10 nm) having chemical compositions of A{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} (A=Mg, Sr) have been found to exhibit the highest luminescence amongst the molybdate–tungstate family when excited by sources in the 380–420 nm wavelength range. Thus they are most suitable for enhancing color rendering index and lowering color temperature in phosphor converted white LEDs (pc-WLEDs) with near-UV/blue LED excitation sources. The excitation band edge in the near UV/blue wavelength in the reported phosphor has been attributed to the coordination environment of the transition metal ion (Mo{sup 6+}, W{sup 6+}) and host crystal structure. Furthermore the quantum efficiency of the phosphors has been enhanced by adjusting activator concentration, suitable compositional alloying using substitutional alkaline earth metal cations and charge compensation mechanisms. - Graphical abstract: The charge transfer excitation of orthorhombic Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} is significantly higher than tetragonal CaMoO{sub 4}: Eu{sup 3+} phosphors making Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} prime candidates for fabrication of warm white phosphor-converted LEDs. - Highlights: • LED excitable Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} phosphors were synthesized. • These phosphors are 10 times more intense than CaMoO{sub 4}: Eu{sup 3+} red phosphors. • Their intensity and efficiency were enhanced by materials optimization techniques. • Such techniques include compositional alloying, charge compensation, etc.

  12. Grafting C8-C16 alkyl groups altered the self-assembly and curcumin -loading properties of sodium caseinate in water.

    Science.gov (United States)

    Zhang, Yaqiong; Yang, Puyu; Yao, Fangyi; Liu, Jie; Yu, Liangli Lucy

    2018-02-01

    The data presented here are related to the research article entitled "Synthesis and characterization of alkylated caseinate, and its structure-curcumin loading property relationship in water" (Zhang et al., 2018) [1]. This data article reports the detailed spectra information for 1 H NMR, 13 C NMR and UPLC-Q-TOF MS of the N-succinimidyl fatty acid esters with various alkyl chain lengths (Cn-NHSs, n = 8, 12, 14 and 16). 1 H NMR, 13 C NMR and UPLC-Q-TOF MS spectra for C16-NHS are shown as an example. Then the stacked 1 H NMR spectra of the obtained alkylated caseinates (Cn-caseinates, n = 8, 12, 14 and 16) are provided. The surface hydrophobicity index (S 0 ) of Cn-caseinates with different substitution degrees (SD) of alkyl groups is shown. Additionally, Visual appearances for the formed aqueous dispersions of curcumin-loaded native caseinate (NaCas) and Cn-caseinates self-assemblies are shown. X-ray diffraction patterns of curcumin, C16-caseinate, its physical mixture and curcumin-loaded C16-caseinate self-assemblies are examined. The re-dispersibility and short-term storage stability of the curcumin-loaded NaCas and C16-caseinate self-assemblies are also studied.

  13. Molecular dynamic simulation of the self-assembly of DAP12-NKG2C activating immunoreceptor complex.

    Directory of Open Access Journals (Sweden)

    Peng Wei

    Full Text Available The DAP12-NKG2C activating immunoreceptor complex is one of the multisubunit transmembrane protein complexes in which ligand-binding receptor chains assemble with dimeric signal-transducing modules through non-covalent associations in their transmembrane (TM domains. In this work, both coarse grained and atomistic molecular dynamic simulation methods were applied to investigate the self-assembly dynamics of the transmembrane domains of the DAP12-NKG2C activating immunoreceptor complex. Through simulating the dynamics of DAP12-NKG2C TM heterotrimer and point mutations, we demonstrated that a five-polar-residue motif including: 2 Asps and 2 Thrs in DAP12 dimer, as well as 1 Lys in NKG2C TM plays an important role in the assembly structure of the DAP12-NKG2C TM heterotrimer. Furthermore, we provided clear evidences to exclude the possibility that another NKG2C could stably associate with the DAP12-NKG2C heterotrimer. Based on the simulation results, we proposed a revised model for the self-assembly of DAP12-NKG2C activating immunoreceptor complex, along with a plausible explanation for the association of only one NKG2C with a DAP12 dimer.

  14. Proteína C-reativa: marcador inflamatório com valor prognóstico em pacientes com insuficiência cardíaca descompensada C-reactive protein: an inflammatory marker with prognostic value in patients with decompensated heart failure

    Directory of Open Access Journals (Sweden)

    Humberto Villacorta

    2007-05-01

    Full Text Available FUNDAMENTO: A inflamação vem sendo implicada na fisiopatologia de uma série de doenças cardiovasculares. A proteína C-reativa (PCR titulada é um marcador de inflamação de fácil obtenção na sala de emergência. OBJETIVO: Estudar o valor prognóstico da PCR em pacientes admitidos por insuficiência cardíaca (IC descompensada. MÉTODOS: Coorte prospectiva de 119 pacientes com IC descompensada, atendidos na sala de emergência, com média de idade de 74 ± 11 anos, dos quais 76 (64% eram do sexo masculino. Todos estavam em classe funcional III ou IV da New York Heart Association. A dosagem da PCR foi realizada por ocasião da admissão na sala de emergência, pelo método de nefelometria. Os pacientes foram acompanhados, após a alta hospitalar, por um tempo médio de 12 ± 9,7 meses e o desfecho analisado foi a mortalidade cardiovascular. RESULTADOS: Houve 44 (36,9% óbitos, todos por causa cardiovascular. Indivíduos com PCR > 3 mg/dl apresentaram maior mortalidade que indivíduos com valores inferiores a esse (p=0,018. A análise multivariada pelo modelo proporcional de Cox destacou como fator independente para prognóstico mais importante a PCR (razão de chances de 0,0916 [intervalo de confiança de 95% = 0,0341 a 0,1490] para aumentos de uma unidade na PCR. CONCLUSÃO: A PCR é um preditor independente de mortalidade cardiovascular em pacientes com IC descompensada, indicando que a inflamação representa componente importante na fisiopatologia da doença.BACKGROUND: Inflammation has been implicated in the pathophysiology of a series of cardiovascular diseases. C-reactive protein (CRP is a marker of inflammation easily obtained in the emergency room. OBJECTIVE: To study the prognostic value of CRP in patients admitted for acute decompensated heart failure (ADHF. METHODS: A prospective cohort of 119 patients with ADHF treated in the emergency room. Mean age was 74±11 years and 76 (64% of patients were male. All were New York Heart

  15. Study of 12C interactions at HISS

    International Nuclear Information System (INIS)

    Crawford, H.J.

    1982-12-01

    Single-particle inclusive measurements in high-energy nuclear physics have provided the foundation for a number of models of interacting nuclear fluids. Such measurements yield information on the endpoints of the evolution of highly excited nuclear systems. However, they suffer from the fact that observed particles can be formed in a large number of very different evolutionary paths. To learn more about how interactions proceed we have performed a series of experiments in which all fast nuclear fragments are analyzed for each individual interaction. These experiments were performed at the LBL Bevalac HISS (Heavy Ion Spectrometer System) facility where we studied the interaction of 1 GeV/nuc 12C nuclei with targets of C, CH 2 , Cu, and U. In this paper we describe HISS and present some preliminary results of the experiment

  16. Measurements of π±, K±, p and p spectra in proton-proton interactions at 20, 31, 40, 80 and 158 GeV/c with the NA61/SHINE spectrometer at the CERN SPS

    International Nuclear Information System (INIS)

    Aduszkiewicz, A.; Dominik, W.; Kuich, M.; Matulewicz, T.; Podlaski, P.; Posiadala, M.; Walewski, M.; Ali, Y.; Brzychczyk, J.; Larsen, D.; Planeta, R.; Richter-Was, E.; Staszel, P.; Wyszynski, O.; Andronov, E.; Feofilov, G.A.; Igolkin, S.; Kondratiev, V.P.; Kovalenko, V.; Merzlaya, A.; Seryakov, A.; Vechernin, V.V.; Vinogradov, L.; Anticic, T.; Kadija, K.; Susa, T.; Baatar, B.; Bunyatov, S.A.; Kireyeu, V.A.; Kolesnikov, V.I.; Krasnoperov, A.; Lyubushkin, V.V.; Malakhov, A.I.; Matveev, V.; Melkumov, G.L.; Tereshchenko, V.; Baszczyk, M.; Dorosz, P.; Kucewicz, W.; Mik, L.; Bhosale, S.; Davis, N.; Kielbowicz, M.; Marcinek, A.; Ozvenchuk, V.; Rybicki, A.; Blondel, A.; Bravar, A.; Damyanova, A.; Haesler, A.; Korzenev, A.; Ravonel, M.; Bogomilov, M.; Kolev, D.; Tsenov, R.; Brandin, A.; Selyuzhenkov, I.; Strikhanov, M.; Taranenko, A.; Busygina, O.; Golubeva, M.; Guber, F.; Ivashkin, A.; Kurepin, A.; Sadovsky, A.; Cherif, H.; Deveaux, M.; Klochkov, V.; Koziel, M.; Renfordt, R.; Snoch, A.; Stroebele, H.; Toia, A.; Cirkovic, M.; Knezevic, N.; Manic, D.; Puzovic, J.; Czopowicz, T.; Grebieszkow, K.; Mackowiak-Pawlowska, M.; Maksiak, B.; Slodkowski, M.; Tefelska, A.; Tefelski, D.; Dembinski, H.; Engel, R.; Herve, A.E.; Mathes, H.J.; Roth, M.; Szuba, M.; Ulrich, R.; Unger, M.; Veberic, D.; Dumarchez, J.; Ereditato, A.; Francois, C.; Pistillo, C.; Wilkinson, C.; Fodor, Z.; Garibov, A.; Gazdzicki, M.; Hylen, J.; Lundberg, B.; Marchionni, A.; Rameika, R.; Zwaska, R.; Johnson, S.R.; Marino, A.D.; Nagai, Y.; Rumberger, B.T.; Zimmerman, E.D.; Kaptur, E.; Kowalski, S.; Lysakowski, B.; Pulawski, S.; Schmidt, K.; Kowalik, K.; Rondio, E.; Stepaniak, J.; Laszlo, A.; Marton, K.; Vesztergombi, G.; Lewicki, M.; Naskret, M.; Turko, L.; Messerly, B.; Paolone, V.; Wickremasinghe, A.; Mills, G.B.; Morozov, S.; Petukhov, O.; Mrowczynski, S.; Rybczynski, M.; Seyboth, P.; Stefanek, G.; Wlodarczyk, Z.; Wojtaszek-Szwarc, A.; Pavin, M.; Popov, B.A.; Rauch, W.; Roehrich, D.; Rustamov, A.; Zambelli, L.

    2017-01-01

    Measurements of inclusive spectra and mean multiplicities of π ± , K ± , p and p produced in inelastic p + p interactions at incident projectile momenta of 20, 31, 40, 80 and 158 GeV/c (√(s) = 6.3, 7.7, 8.8, 12.3 and 17.3 GeV, respectively) were performed at the CERN Super Proton Synchrotron using the large acceptance NA61/SHINE hadron spectrometer. Spectra are presented as function of rapidity and transverse momentum and are compared to predictions of current models. The measurements serve as the baseline in the NA61/SHINE study of the properties of the onset of deconfinement and search for the critical point of strongly interacting matter. (orig.)

  17. Implementation of a Novel Laser System for Simultaneous Measurement of 13C/12C and D/H to Food Provenance

    Science.gov (United States)

    Saad, N.; Hoffnagle, J.

    2012-04-01

    Olive oil samples were analyzed using the world's first simultaneous δ13C + δD instrument, the 13C+D Combustion Module-Cavity Ringdown Spectroscopy (CM-CRDS) Isotope Analyzer. Simultaneous measurements of δ13C and δD of the whole oil have been performed on commercially available olive oils produced in Greece, Spain, Italy, California, Lebanon, Israel, Australia and Turkey. Together, the measurements of isotopic ratios of carbon (13C/12C) and hydrogen (D/H) produce statistically significant differentiation between olive oils from different locations around the globe. Stable isotope ratios are exquisitely sensitive to the biochemistry of plant species and the nutrients available to them in a particular geographical location. Isotope ratios provide detailed knowledge useful for forensic applications through a combination of stable-isotope measurements of carbon (13C/12C) and hydrogen (D/H) isotopes of organic matter and can help the associations among specific geographic areas through the measurement of these dual isotopes. We report here on the development of a novel laser spectroscopy based system for the simultaneous analysis of the stable isotope ratios of carbon (13C/12C) and hydrogen (D/H) that is robust, easy-to-use, and is the first stable isotope ratio analysis system to combine the measurement of 13C/12C and D/H in one simple analysis from a bulk organic sample. The system comprises a combustion module to convert the organic sample into CO2 and H2O and a Cavity Ring-Down Spectrometer (CRDS) that analyzes the combustion species inside an optical cavity based on the molecular absorption of individual isotopomers. The CRDS uses dual lasers to target the four isotpomers of interest: 12CO2, 13CO2, H2O and HDO. The system delivers a typical precision of 0.1permil for δ13C and 1.5 permil for δD that parallels that achieved by IRMS, but with an unprecedented simplicity that allows scientists to leverage the science and map out the provenance of the analyzed

  18. Probing the Statistical Decay and α-clustering effects in 12C + 12C and 14N + 10B reactions

    Directory of Open Access Journals (Sweden)

    Morelli L.

    2014-03-01

    Full Text Available An experimental campaign has been undertaken at Laboratori Nazionali di Legnaro (LNL INFN, Italy, in order to progress in our understanding of the statistical properties of light nuclei at excitation energies above particle emission threshold, by measuring exclusive data from fusion-evaporation reactions. On the experimental side, a first reaction: 12C+12C at 95 MeV beam energy has been measured, using the GARFIELD + Ring Counter (RCo apparatuses. Fusion-evaporation events have been exclusively selected out of the entire data set. The comparison to a dedicated Hauser-Feshbach calculation allows us to give constraints on the nuclear level density at high excitation energy for light systems ranging from C up to Mg. Out-of-equilibrium aα emission has been evidenced and attributed both to an entrance channel effect (favoured by the cluster nature of reaction partners, and, in more dissipative events, to the persistence of cluster correlations well above the 24Mg threshold for 6 α’s decay. In order to study the same 24Mg compound nucleus at similar excitation energy with respect to this first reaction a new measurement, 14N + 10B at 5.7 A.MeV, was performed at LNL laboratories with the same experimental setup. The comparison between the two systems would allow us to further constrain the level density of light nuclei in the mass-excitation energy range of interest. In this perspective, deviations from a statistical behaviour can be used as a tool to get information on nuclear clustering, both in the ground-state for projectile and target and in the hot source formed in the collision.

  19. Multi-cluster dynamics in CΛ13 and analogy to clustering in 12C

    Directory of Open Access Journals (Sweden)

    Y. Funaki

    2017-10-01

    Full Text Available We investigate structure of CΛ13 and discuss the difference and similarity between the structures of C12 and CΛ13 by answering the questions if the linear-chain and gaslike cluster states, which are proposed to appear in C12, survives, or new structure states appear or not. We introduce a microscopic cluster model called, Hyper-Tohsaki–Horiuchi–Schuck–Röpke (H-THSR wave function, which is an extended version of the THSR wave function so as to describe Λ hypernuclei. We obtained two bound states and two resonance (quasi-bound states for Jπ=0+ in CΛ13, corresponding to the four 0+ states in C12. However, the inversion of level ordering between the spectra of C12 and CΛ13, i.e. that the 03+ and 04+ states in CΛ13 correspond to the 04+ and 03+ states in C12, respectively, is shown to occur. The additional Λ particle reduces sizes of the 02+ and 03+ states in CΛ13 very much, but the shrinkage of the 04+ state is only a half of the other states, in spite of the fact that attractive Λ-N interaction makes nucleus contracted so much when the Λ particle occupies an S-orbit. In conclusion, the Hoyle state becomes quite a compact object with BeΛ9+α configuration in CΛ13 and is no more gaslike state composed of the 3α clusters. Instead, the 04+ state in CΛ13, coming from the C12(03+ state, appears as a gaslike state composed of α+α+Λ5He configuration, i.e. the Hoyle analog state. A linear-chain state in a Λ hypernucleus is for the first time predicted to exist as the 03+ state in CΛ13 with more shrunk arrangement of the 3α clusters along z-axis than the 3α linear-chain configuration realized in the C12(04+ state. All the excited states are shown to appear around the corresponding cluster-decay threshold, reflecting the threshold rule.

  20. Solubility and hydrolysis of Np(V) in dilute to concentrated alkaline NaCl solutions. Formation of Na-Np(V)-OH solid phases at 22 C

    Energy Technology Data Exchange (ETDEWEB)

    Petrov, Vladimir G. [Lomonosov Moscow State Univ. (Russian Federation). Dept. of Chemistry; Fellhauer, David; Gaona, Xavier; Dardenne, Kathy; Rothe, Joerg; Altmaier, Marcus [Karlsruhe Institute of Technology (Germany). Inst. for Nuclear Waste Disposal; Kalmykov, Stepan N. [Lomonosov Moscow State Univ. (Russian Federation). Dept. of Chemistry; NRC Kurchatov Institute, Moscow (Russian Federation)

    2017-03-01

    The solubility of Np(V) was investigated at T=22±2 C in alkaline NaCl solutions of different ionic strength (0.1-5.0 M). The solid phases controlling the solubility at different -log{sub 10} m{sub H{sup +}}(pH{sub m}) and NaCl concentration were characterized by XRD, quantitative chemical analysis, SEM-EDS and XAFS (both XANES and EXAFS). Aqueous phases in equilibrium with Np(V) solids were investigated for selected samples within 8.9≤pH{sub m}≤10.3 by UV-vis/NIR absorption spectroscopy. In 0.1 M NaCl, the experimental solubility of the initial greenish NpO{sub 2}OH(am) solid phase is in good agreement with previous results obtained in NaClO{sub 4} solutions, and is consistent with model calculations for fresh NpO{sub 2}OH(am) using the thermodynamic data selection in NEA-TDB. Below pH{sub m}∝11.5 and for all NaCl concentrations studied, Np concentration in equilibrium with the solid phase remained constant during the timeframe of this study (∝2 years). This observation is in contrast to the aging of the initial NpO{sub 2}OH(am) into a more crystalline modification with the same stoichiometry, NpO{sub 2}OH(am, aged), as reported in previous studies for concentrated NaClO{sub 4} and NaCl. Instead, the greenish NpO{sub 2}OH(am) transforms into a white solid phase in those systems with [NaCl]≥1.0 M and pH{sub m}≥11.5, and into two different pinkish phases above pH{sub m}∝13.2. The solid phase transformation is accompanied by a drop in Np solubility of 0.5-2 log{sub 10}-units (depending upon NaCl concentration). XANES analyses of green, white and pink phases confirm the predominance of Np(V) in all cases. Quantitative chemical analysis shows the incorporation of Na{sup +} in the original NpO{sub 2}OH(am) material, with Na:Np ≤ 0.3 for the greenish solids and 0.8 ≤ Na:Np ≤ 1.6 for the white and pinkish phases. XRD data confirms the amorphous character of the greenish phase, whereas white and pink solids show well-defined but discrepant XRD patterns

  1. Prevalência e gravidade da cárie dentária e necessidade de tratamento em crianças de 12 anos de município de pequeno porte inserido no contexto amazônico Prevalence of dental caries and treatment needs among 12-year-old children in a small-sized municipality in the Amazon region

    Directory of Open Access Journals (Sweden)

    Rodrigo Tobias

    2008-12-01

    Full Text Available O conhecimento da prevalência da cárie dentária em municípios inseridos no contexto amazônico é pouco observado na literatura científica. O presente estudo visa investigar a prevalência e necessidade de tratamento da população de crianças de 12 anos de Rio Preto da Eva, Amazonas no ano de 2007, segundo o sexo e o tipo de localidade (rural e urbana. O estudo transversal foi de natureza descritiva e exploratória com a coleta de dados primários da doença, cujo desenho teve como base o levantamento epidemiológico SB-Brasil 2003. A amostra foi constituída por 344 crianças nas residências e escolas na zona rural e urbana do município. O índice CPO-D geral encontrado foi de 3,73 (+0,17 com predomínio do componente cariado. O percentual de crianças livres de cárie nas zonas urbana e rural foi de 12,5 e 13,6, respectivamente. Não houve diferença estatisticamente significante entre os sexos e os tipos de localidade. Na zona rural existem cerca de duas vezes mais dentes com necessidade de tratamento do que na zona urbana. O tratamento restaurador representou a maior necessidade de tratamento desta população (86,2%. A prevalência de cárie na população de 12 anos de idade, em Rio Preto da Eva-AM, é moderada e o CPO-D médio encontrado está acima da meta estabelecida para o ano 2.000 pela FDI/OMS. Os dados evidenciam a necessidade de implementação de medidas de atenção à saúde bucal que sejam capazes de intervir nos determinantes da cárie dentária na população estudada.Scientific literature encloses little knowledge on the prevalence of dental caries in municipalities in the Amazon region. The present study aimed to investigate the prevalence and treatment needs in the population of 12-year-old children in the municipality of Rio Preto da Eva, Amazonas, in the year 2007, according to gender and type of locality (rural or urban. This was a cross-sectional study of descriptive and exploratory nature with collection of

  2. The {sup 12}C/{sup 13}C Ratio in Sgr B2(N): Constraints for Galactic Chemical Evolution and Isotopic Chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Halfen, D. T.; Ziurys, L. M. [Department of Chemistry and Biochemistry, University of Arizona, 1305 E. 4th Street, Tucson, AZ 85719 (United States); Woolf, N. J., E-mail: halfend@email.arizona.edu [Department of Astronomy, Arizona Radio Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States)

    2017-08-20

    A study has been conducted of {sup 12}C/{sup 13}C ratios in five complex molecules in the Galactic center. H{sub 2}CS, CH{sub 3}CCH, NH{sub 2}CHO, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN and their {sup 13}C-substituted species have been observed in numerous transitions at 1, 2, and 3 mm, acquired in a spectral-line survey of Sgr B2(N), conducted with the telescopes of the Arizona Radio Observatory (ARO). Between 22 and 54 individual, unblended lines for the {sup 12}C species and 2–54 for {sup 13}C-substituted analogs were modeled in a global radiative transfer analysis. All five molecules were found to consistently exhibit two velocity components near V {sub LSR} ∼ 64 and 73 km s{sup −1}, with column densities ranging from N {sub tot} ∼ 3 × 10{sup 14} − 4 × 10{sup 17} cm{sup −2} and ∼2 × 10{sup 13} − 1 × 10{sup 17} cm{sup −2} for the {sup 12}C and {sup 13}C species, respectively. Based on 14 different isotopic combinations, ratios were obtained in the range {sup 12}C/{sup 13}C = 15 ± 5 to 33 ± 13, with an average value of 24 ± 7, based on comparison of column densities. These measurements better anchor the {sup 12}C/{sup 13}C ratio at the Galactic center, and suggest a slightly revised isotope gradient of {sup 12}C/{sup 13}C = 5.21(0.52) D {sub GC} + 22.6(3.3). As indicated by the column densities, no preferential {sup 13}C enrichment was found on the differing carbon sites of CH{sub 3}CCH, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN. Because of the elevated temperatures in Sgr B2(N), {sup 13}C isotopic substitution is effectively “scrambled,” diminishing chemical fractionation effects. The resulting ratios thus reflect stellar nucleosynthesis and Galactic chemical evolution, as is likely the case for most warm clouds.

  3. Efeito da morfina epidural na atividade eletromiográfica do cólon esquerdo durante a recuperação do íleo paralítico pós-operatório

    OpenAIRE

    SILVEIRA, Raquel Kelner

    1997-01-01

    A autora investigou os efeitos da morfina administrada por via epidural sobre as alterações eletromiográficas do cólon esquerdo durante o período de recuperação do íleo paralítico pós-operatório utilizando eletrodos bipolares implantados na camada seromuscular do cólon. Realizou-se um ensaio clínico controlado para fatores de confusão em pacientes com diagnóstico de mioma uterino e indicação cirúrgica (histerectomia total abdominal). O grupo experimental (n = 12) foi submetido à anestesia com...

  4. The (gas + liquid) critical properties and phase behaviour of some binary alkanol (C2-C5) + alkane (C5-C12) mixtures

    International Nuclear Information System (INIS)

    Morton, David W.; Lui, Matthew P.W.; Young, Colin L.

    2003-01-01

    Previously, the investigation of the (gas + liquid) critical properties of (alkanol + alkane) mixtures has focussed on (primary alkanol + straight chain alkane) mixtures. The experimental data available for (alkanol + alkane) mixtures, which include secondary or tertiary alcohols and/or branched chain alkanes, are extremely limited. This work extends the existing body of data on (alkanol + alkane) mixtures to include mixtures containing these components. Here the (gas + liquid) critical temperatures of 29 {alkanol (C 2 -C 5 ) + alkane (C 5 -C 12 )} mixtures are reported. All the (gas + liquid) critical lines for the binary mixtures studied are continuous, indicating they obey either Type I or Type II phase behaviour

  5. ANALIZA EKSPLOATACYJNA INSTALACJI SŁONECZNEJ PRACUJĄCEJ NA POTRZEBY PRZYGOTOWANIA C.W.U. DLA BUDYNKU WIELORODZINNEGO

    Directory of Open Access Journals (Sweden)

    Bożena BABIARZ

    Full Text Available Celem niniejszej pracy jest przeprowadzenie analizy instalacji słonecznych pod kątem eksploatacyjnym. Zasadniczą część opracowania stanowi analiza istniejącej od 2005 r. instalacji słonecznej pracującej dla potrzeb przygotowania ciepłej wody użytkowej dla mieszkańców budynku wielorodzinnego. W pracy wykorzystano rzeczywiste dane eksploatacyjne z dziesięciu lat działania instalacji, udostępnione przez Spółdzielnię Mieszkaniową „ZODIAK” w Rzeszowie. Przeanalizowano koszty przygotowania ciepłej wody użytkowej oraz koszty serwisowe instalacji. Na koszty eksploatacyjne instalacji słonecznych składają się m.in.: koszty zużycia i przygotowania c.w.u., koszty zużycia energii elektrycznej przez pompy obiegowe instalacji słonecznych, oraz koszty serwisowania instalacji. Na podstawie niniejszej analizy można wysnuć szereg wniosków możliwych do wykorzystania w analizach techniczno-finansowych na etapie projektowania inwestycji w odnawialne źródła energii. Przeprowadzona analiza wykazała, iż instalacja słoneczna w znacznym stopniu obniża koszty przygotowania ciepłej wody użytkowej. Koszt przygotowania 1 m3 ciepłej wody użytkowej w analizowanym budynku wielorodzinnym w 2015 r. przy udziale instalacji słonecznej stanowił 67% kosztów podgrzewu ciepłej wody w budynku o podobnej kubaturze wykorzystującym ciepło z miejskiej sieci ciepłowniczej. Pompy obiegowe zastosowane w instalacjach słonecznych charakteryzują się stosunkowo małym zużyciem energii elektrycznej. Koszty serwisowe instalacji są niewielkie i zależą od wielkości instalacji, jej lokalizacji oraz budowy.

  6. Influência de temperatura, luz e giberelina na germinação de sementes de Thlaspi caerulescens J. Presl & C. Presl (Brassicaceae

    Directory of Open Access Journals (Sweden)

    Marcelo de Almeida Guimarães

    2010-06-01

    Full Text Available Thlaspi caerulescens é espécie hiperacumuladora de metais como Cd2+, Ni2+ e Zn2+, considerada como uma plantamodelo para estudar a acumulação e tolerância a metais pesados. No entanto, a baixa produção de sementes em nossas condições climáticas tornam necessária a determinação de condições que possam maximizar a germinação e o vigor de suas sementes. Para identificar as melhores condições para a germinação, sementes de T. caerulescens foram colocadas na presença (15 mmol.m-2.s-1, 8 h luz/16 h escuro ou ausência de luz nas temperaturas de 10, 15, 20 e 25 ºC, em papel germitest previamente umedecido com solução de ácido giberélico (GA3 a 0,05% ou água destilada. Foram avaliados a porcentagem de germinação (%G e o índice de velocidade de germinação (IVG. Maior porcentagem de germinação (66% foi observada nos tratamentos com GA3 e temperaturas de 15 e 20 ºC, na presença de luz. Maiores valores do IVG foram obtidos com a utilização de GA3 nas temperaturas de 15 e 20 ºC, tanto na presença quanto na ausência de luz. Maiores germinação e IVG de T. caerulescens foram observados com uso de GA3 na presença de luz nas temperaturas de 15 e 20 ºC.

  7. Vertebral artery variations at the C1-2 level diagnosed by magnetic resonance angiography

    Energy Technology Data Exchange (ETDEWEB)

    Uchino, Akira; Saito, Naoko; Watadani, Takeyuki; Okada, Yoshitaka; Kozawa, Eito; Nishi, Naoko; Mizukoshi, Waka; Inoue, Kaiji; Nakajima, Reiko; Takahashi, Masahiro [Saitama Medical University International Medical Center, Department of Diagnostic Radiology, Hidaka, Saitama (Japan)

    2012-01-15

    The craniovertebral junction is clinically important. The vertebral artery (VA) in its several variations runs within this area. We report the prevalence of these VA variations on magnetic resonance angiography (MRA). We retrospectively reviewed MRA images, obtained using two 1.5-T imagers, of 2,739 patients, and paid special attention to the course and branching of the VA at the level of the C1-2 vertebral bodies. There were three types of VA variation at the C1-2 level: (1) persistent first intersegmental artery (FIA), (2) VA fenestration, and (3) posterior inferior cerebellar artery (PICA) originating from the C1/2 level. The overall prevalence of these three variations was 5.0%. There was no laterality in frequency, but we found female predominance (P < 0.05). We most frequently observed the persistent FIA (3.2%), which was sometimes bilateral. We found VA fenestration (0.9%) and PICA of C1/2 origin (1.1%) with almost equal frequency. Two PICAs of C1/2 origin had no normal VA branch. We frequently observed VA variations at the C1-2 level and with female predominance. The persistent FIA was most prevalent and sometimes seen bilaterally. Preoperative identification of these variations in VA is necessary to avoid complications during surgery at the craniovertebral junction. (orig.)

  8. lin-12 Notch functions in the adult nervous system of C. elegans

    Directory of Open Access Journals (Sweden)

    Tucey Tim M

    2005-07-01

    Full Text Available Abstract Background Notch signaling pathways are conserved across species and traditionally have been implicated in cell fate determination during embryonic development. Notch signaling components are also expressed postdevelopmentally in the brains of adult mice and Drosophila. Recent studies suggest that Notch signaling may play a role in the physiological, rather than developmental, regulation of neurons. Here, we investigate a new non-developmental role for Caenorhabditis elegans lin-12 Notch signaling in neurons regulating the spontaneous reversal rate during locomotion. Results The spontaneous reversal rate of C. elegans during normal locomotion is constant. Both lin-12 gain and loss of function mutant animals had significantly increased reversal rates compared to wild type controls. These defects were caused by lin-12 activity, because the loss of function defect could be rescued by a wild type lin-12 transgene. Furthermore, overexpression of lin-12 recapitulated the gain-of-function defect. Increasing or decreasing lin-12 activity in the postdevelopmental adult animal was sufficient to rapidly and reversibly increase reversals, thereby excluding a developmental role for lin-12. Although lin-12 is expressed in the vulval and somatic gonad lineages, we find that these tissues play no role in regulating reversal rates. In contrast, altering lin-12 activity specifically in the nervous system was sufficient to increase reversals. These behavioral changes require components of the canonical lin-12 signaling cascade, including the ligand lag-2 and the transcriptional effector lag-1. Finally, the C. elegans AMPA/kainate glutamate receptor homolog glr-1 shows strong genetic interactions with lin-12, suggesting that glr-1 and/or other glutamate gated channels may be targets of lin-12 regulation. Conclusion Our results demonstrate a neuronal role for lin-12 Notch in C. elegans and suggest that lin-12 acutely regulates neuronal physiology to

  9. Differential cross section measurement of radiative capture of protons by nuclei 12C

    International Nuclear Information System (INIS)

    Burtebayev, N.; Zazulin, D.M.; Buminskii, V.P.; Zarifov, R.A.; Tohtarov, R.N.; Sagindykov, Sh.Sh.; Baktibayev, M.K.

    2003-01-01

    Measurements of differential cross sections of nuclear reaction 12 C(p, γ) 13 N at 0, 45, 90, 135 Deg. to beam direction of flying protons in the field of E p = 350-1100 KeV with an error it is not worse than 10 % have been carried out. Most important was studied, from the astrophysical point of view, process of capture of protons by nucleuses 12 C on the ground state of a nucleus 13 N. It is experimentally shown isotropy of angular distribution of differential cross sections of reaction 12 C(p, γ) 13 N, in the given field energy of protons

  10. Spin alignment and density matrix measurement in 28Si + 12C orbiting reaction

    International Nuclear Information System (INIS)

    Ray, A.; Shapira, D.; Halbert, M.L.; Gomez del Campo, J.; Kim, H.J.; Sullivan, J.P.; Shivakumar, B.; Mitchell, J.

    1990-01-01

    Gamma-ray angular correlations have been measured for the strongly damped reactions 12 C( 28 Si, 12 C) 28 Si between θ cm = (120 degree - 160 degree) for E cm = 43.5 and 48 MeV. We find that the density matrices for the 12 C(2 1 + ) and 28 Si states are almost diagonal with respect to the direction of motion of the outgoing particle. The measured density matrices and spin alignments are consistent with the picture of formation of a long-lived dinuclear complex undergoing orbiting, bending and wriggling motions, but not with those obtained from statistical compound nucleus or sticking model calculations. 17 refs., 2 figs., 1 tab

  11. Inhibitory effect of 12C6+ ion and X-ray on angiogenesis in HMEC-1

    International Nuclear Information System (INIS)

    Liu Yuanyuan; Zhang Hong; Liu Yang; Wu Zhenhua; Sun Chao; Li Hongyan

    2013-01-01

    The study aims to explore the effect of 12 C 6+ ion and X-ray on proliferation, migration, tube formation and MMPS of human microvascular endothelial cells (HMEC-1). Transwell migration experiment showed that the radiation could inhibit the migration of HMEC-1 in sub-lethal dose 24 h after irradiation. Furthermore, the inhibition ability of 12 C 6+ ion was stronger than that of X-ray. Matrigel experiment indicated that 12 C 6+ ion suppressed the tube formation of HMEC-1 spontaneously. However, the inhibitory effect of X-ray had no significance. Meanwhile, Gelatin Zymography showed the expression of MMP-2 was inhibited obviously by 12 C 6+ ion, while X-ray had little effect on the expression of MMP-2. In conclusion, 12 C 6+ ion is superior to X-ray in radiotherapy of tumor. (authors)

  12. Probing the possibility of a 12C13C abundance gradient from observations of interstellar CH+

    International Nuclear Information System (INIS)

    Hawkins, I.

    1987-01-01

    I have performed high signal-to-noise (SN /equals/ 300 to 500) observations of interstellar CH/sup /plus// at Lick Observatory and at CTIO of the reddened, early-type stars HD 183143, HD 24432, and HD 157038 in an effort to probe the existence of a 12 C 13 C abundance gradient in our Galaxy

  13. Receptores de estrógenos (ER E ER) e proteínas envolvidas no transporte transepitelial de cálcio na litíase epididimária de galos domésticos

    OpenAIRE

    Andre Gustavo de Oliveira

    2012-01-01

    A litíase epididimária é uma anomalia caracterizada pela presença de cálculos ricos em cálcio na região epididimária de galos. Esta disfunção causa redução na fertilidade, tendo impacto negativo na avicultura. A causa da litíase não é conhecida, mas sabe-se que a formação de cálculos acomete principalmente os dúctulos eferentes, responsáveis pela reabsorção do fluido testicular e de cálcio. O transporte transepitelial de cálcio ocorre em etapas distintas que envolvem a entrada de cálcio na cé...

  14. Grafting C8-C16 alkyl groups altered the self-assembly and curcumin –loading properties of sodium caseinate in water

    Directory of Open Access Journals (Sweden)

    Yaqiong Zhang

    2018-02-01

    Full Text Available The data presented here are related to the research article entitled “Synthesis and characterization of alkylated caseinate, and its structure-curcumin loading property relationship in water” (Zhang et al., 2018 [1]. This data article reports the detailed spectra information for 1H NMR, 13C NMR and UPLC-Q-TOF MS of the N-succinimidyl fatty acid esters with various alkyl chain lengths (Cn-NHSs, n = 8, 12, 14 and 16. 1H NMR, 13C NMR and UPLC-Q-TOF MS spectra for C16-NHS are shown as an example. Then the stacked 1H NMR spectra of the obtained alkylated caseinates (Cn-caseinates, n = 8, 12, 14 and 16 are provided. The surface hydrophobicity index (S0 of Cn-caseinates with different substitution degrees (SD of alkyl groups is shown. Additionally, Visual appearances for the formed aqueous dispersions of curcumin-loaded native caseinate (NaCas and Cn-caseinates self-assemblies are shown. X-ray diffraction patterns of curcumin, C16-caseinate, its physical mixture and curcumin-loaded C16-caseinate self-assemblies are examined. The re-dispersibility and short-term storage stability of the curcumin-loaded NaCas and C16-caseinate self-assemblies are also studied. Keywords: Caseinate, Alkylated caseinate, Self-assembly, Curcumin-loading property

  15. Differential regulation of iPLA2beta splice variants by in vitro ischemia in C2C12 myotubes

    DEFF Research Database (Denmark)

    Poulsen, K. A.; Kolko, M.; Lambert, I. H.

    2006-01-01

    In this study we investigated the activity, expression and regulation of iPLA2 during ischemia in mouse C2C12 myotubes. Here, we show that in vitro ischemia, i.e. oxygen deprivation and glucose starvation, induces an iPLA2 activity that is totally reversed by siRNA knock down of iPLA2£], indicating...... preferential activation of iPLA2£]. The activity of the native iPLA2£] tetramer has in humans been proposed to be negatively regulated by interactions with catalytic inactive splice variants of the full-length protein. These variants, characterized by the presence exon 9a, have however not been identified...... of this transcript would be a C-terminally truncated î50 kDa protein lacking the catalytic site. qPCR indicated that, while the total iPLA2£] mRNA level in C2C12 myotubes increased weakly within 1-2 hours of in vitro ischemia, the transcript containing the mouse exon 9a was rapidly down regulated. In addition...

  16. Plant Defensins NaD1 and NaD2 Induce Different Stress Response Pathways in Fungi

    Directory of Open Access Journals (Sweden)

    Peter M. Dracatos

    2016-09-01

    Full Text Available Nicotiana alata defensins 1 and 2 (NaD1 and NaD2 are plant defensins from the ornamental tobacco that have antifungal activity against a variety of fungal pathogens. Some plant defensins interact with fungal cell wall O-glycosylated proteins. Therefore, we investigated if this was the case for NaD1 and NaD2, by assessing the sensitivity of the three Aspergillus nidulans (An O-mannosyltransferase (pmt knockout (KO mutants (An∆pmtA, An∆pmtB, and An∆pmtC. An∆pmtA was resistant to both defensins, while An∆pmtC was resistant to NaD2 only, suggesting NaD1 and NaD2 are unlikely to have a general interaction with O-linked side chains. Further evidence of this difference in the antifungal mechanism was provided by the dissimilarity of the NaD1 and NaD2 sensitivities of the Fusarium oxysporum f. sp. lycopersici (Fol signalling knockout mutants from the cell wall integrity (CWI and high osmolarity glycerol (HOG mitogen-activated protein kinase (MAPK pathways. HOG pathway mutants were sensitive to both NaD1 and NaD2, while CWI pathway mutants only displayed sensitivity to NaD2.

  17. Bipolaron formation in B/sub 12/ and (B/sub 11/C)/sup +/ icosahedra

    International Nuclear Information System (INIS)

    Howard, I.A.; Beckel, C.L.; Emin, D.

    1987-01-01

    Boron carbides, B/sub 1-x/C/sub x/ with 0.085 ≤ x ≤ 0.200, generally contain both B/sub 12/ and B/sub 11/C icosahedra. However, the electronic transport with 0.1 ≤ x ≤ 0.2 is believed to occur by means of bipolaron hopping between only B/sub 11/C icosahedra. The authors have calculated the changes in energy, atomic positions and charge distribution when a pair of electrons is added to the isoelectronic icosahedral clusters B/sub 12/ and (B/sub 11/C)/sup +/. They simulate an icosahedron in a neutral lattice by bonding the icosahedral atoms to hydrogenic atoms which the authors constrain to be neutral. The computations are performed with a self-consistent molecular-orbital method, PRDDO. They find a total energy reduction of -- 3.7 eV for two electrons added to a B/sub 12/ icosahedron. Of this, -- 2.7 eV arises from the electrons filling the icosahedron's bonding orbitals. The remaining -- 1.0 eV comes from the contraction of the icosahedron's radius by -- 0.09 A. For two electrons added to a (B/sub 11/C)/sup +/ icosahedron the authors find a total energy reduction of -- 18.2 eV. Of this, -- 16.5 eV arises from filling the icosahedron's bonding orbitals. The remainder arises from a -- 0.09 A contraction of the icosahedron's radius. Thus, the authors find (B/sub 11/C)/sup +/ icosahedra to be strongly energetically favored over B/sub 12/ icosahedra as bipolaron sites. The positive charge associated with a (B/sub 11/C)/sup +/ icosahedron is distributed over the eleven boron atoms. Concomitantly, they find the added two electrons of the bipolaron to be distributed over all twelve sites of the B/sub 11/C icosahedron. They find the energy difference between an electron pair added to B/sub 12/ and (B/sub 11/C)/sup +/ icosahedra to arise principally from the increased Coulombic attraction provided by the extra positive charge of the (B/sub 11/C)/sup +/ icosahedron

  18. Deformation effects in the 20Ne+12C reaction

    International Nuclear Information System (INIS)

    Dey, A.; Bhattacharya, C.; Banerjee, K.; Kundu, S.; Mukhopadhyay, S.; Gupta, D.; Saha, R.; Bhattacharya, S.

    2004-01-01

    The present work has been performed with the aim to investigate the possible occurrence of highly deformed configurations of the 32 S di-nuclear systems which may be formed in the 20 Ne+ 12 C reaction by studying the properties of emitted light charged particles

  19. Measurement of the /sup 12/C(n,γ0)/sup 13/C cross section in the giant dipole resonance region

    International Nuclear Information System (INIS)

    August, R.A.; Weller, H.R.; Tilley, D.R.

    1987-01-01

    The /sup 12/C(n,γ 0 ) /sup 13/C excitation function at 90 0 has been measured for neutron energies from 6.5 to 18.5 MeV. Whereas previous measurements disagreed at the lower energies with a direct-semidirect capture calculation based on /sup 12/C(p,γ 0 ) /sup 13/N data, the present results, especially when the uncertainty in absolute cross section is considered, indicate reasonable qualitative agreement with the calculation

  20. Importância da vitamina B12 na avaliação clínica do paciente idoso = Importance of vitamin B12 screening in clinical evaluation of elderly patient

    Directory of Open Access Journals (Sweden)

    Futterleib, Alexandre

    2005-01-01

    Conclusão: A investigação da deficiência de vitamina B12 é um procedimento importante na avaliação clínica do paciente idoso, já que o diagnóstico precoce pode evitar distúrbios neurológicos e hematológicos, bem como proporcionar melhor qualidade de vida ao paciente

  1. Hydrogen storage property of alkali and alkaline-earth metal atoms decorated C24 fullerene: A DFT study

    Science.gov (United States)

    Zhang, Yafei; Cheng, Xinlu

    2018-04-01

    The hydrogen storage behavior of alkali and alkaline-earth metal (AM = Li, Na, K, Mg, Ca) atoms decorated C24 fullerene was investigated by using density functional theory (DFT) study. Our results indicate that the AM atoms prefer to adsorb atop the center of tetragon of C24 fullerene with the largest binding energy than other possible adsorption sites. Moreover, the hydrogen storage gravimetric density of 24H2/6Li/C24, 24H2/6Na/C24 and 36H2/6Ca/C24 configurations reaches up to 12.7 wt%, 10.1 wt% and 12 wt%, higher than the year 2020 target from the US department of energy (DOE). Also, the average adsorption energies of H2 molecules of the 24H2/6Li/C24, 24H2/6Na/C24 and 36H2/6Ca/C24 configurations are -0.198 eV/H2, -0.164 eV/H2 and -0.138 eV/H2, locate the desirable range under the physical adsorption at near ambient conditions. These findings will have important implications on designing new hydrogen storage materials in the future.

  2. Effect of ciguatoxin 3C on voltage-gated Na+ and K+ currents in mouse taste cells.

    Science.gov (United States)

    Ghiaroni, Valeria; Fuwa, Haruhiko; Inoue, Masayuki; Sasaki, Makoto; Miyazaki, Keisuke; Hirama, Masahiro; Yasumoto, Takeshi; Rossini, Gian Paolo; Scalera, Giuseppe; Bigiani, Albertino

    2006-09-01

    The marine dinoflagellate Gambierdiscus toxicus produces highly lipophilic, polycyclic ether toxins that cause a seafood poisoning called ciguatera. Ciguatoxins (CTXs) and gambierol represent the two major causative agents of ciguatera intoxication, which include taste alterations (dysgeusiae). However, information on the mode of action of ciguatera toxins in taste cells is scarce. Here, we have studied the effect of synthetic CTX3C (a CTX congener) on mouse taste cells. By using the patch-clamp technique to monitor membrane ion currents, we found that CTX3C markedly affected the operation of voltage-gated Na(+) channels but was ineffective on voltage-gated K(+) channels. This result was the exact opposite of what we obtained earlier with gambierol, which inhibits K(+) channels but not Na(+) channels. Thus, CTXs and gambierol affect with high potency the operation of separate classes of voltage-gated ion channels in taste cells. Our data suggest that taste disturbances reported in ciguatera poisoning might be due to the ability of ciguatera toxins to interfere with ion channels in taste buds.

  3. Disintegration of {sup 12}C nuclei by 700–1500 MeV photons

    Energy Technology Data Exchange (ETDEWEB)

    Nedorezov, V. [Institute for Nuclear Research, Russian Academy of Sciences, Prospekt 60-letiya Oktyabrya 7a, 117312 Moscow (Russian Federation); D' Angelo, A.; Bartalini, O. [Dipartimento di Fisica – Università degli Studi di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); INFN – Sezione di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); Bellini, V. [Dipartimento di Fisica – Università degli Studi di Catania, via Santa Sofia 64, I-95123 Catania (Italy); INFN – Sezione di Catania, via Santa Sofia 64, I-95123 Catania (Italy); Capogni, M. [Dipartimento di Fisica – Università degli Studi di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); INFN – Sezione di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); Casano, L.E. [INFN – Sezione di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); Castoldi, M. [Dipartimento di Fisica – Università degli Studi di Genova, via Dodecaneso 33, I-16146 Genova (Italy); Curciarello, F.; De Leo, V. [Dipartimento di Fisica e di Scienze della Terra, Università di Messina, salita Sperone 31, I-98166 Messina (Italy); INFN – Sezione di Catania, via Santa Sofia 64, I-95123 Catania (Italy); Didelez, J.-P. [IN2P3, Institut de Physique Nucléaire, Rue Georges Clemenceau, F-91406 Orsay (France); and others

    2015-08-15

    Disintegration of {sup 12}C nuclei by tagged photons of 700–1500 MeV energy at the GRAAL facility has been studied by means of the LAGRANγE detector with a wide angular acceptance. The energy and momentum distributions of produced neutrons and protons as well as their multiplicity distributions were measured and compared with corresponding distributions calculated with the RELDIS model based on the intranuclear cascade and Fermi break-up models. It was found that eight fragments are created on average once per about 100 disintegration events, while a complete fragmentation of {sup 12}C into 12 nucleons is observed typically only once per 2000 events. Measured multiplicity distributions of produced fragments are well described by the model. The measured total photoabsorption cross section on {sup 12}C in the same energy range is also reported.

  4. The relation between aging, aortic NaF avidity and coronary artery NaF avidity: A NaF PET CT study

    DEFF Research Database (Denmark)

    Blomberg, Björn; Thomassen, Anders; Hildebrandt, Malene

    2013-01-01

    volunteers without traditional cardiovascular risk factors were prospectively assessed by Sodium 18-Fluoride (Na-18F) PET CT imaging. Global aortic uptake of Na-18F was determined by calculating the average aortic blood pool subtracted maximum standardized uptake value (cSUV) [maximum SUVaorta - mean...

  5. C-X-C motif chemokine 12 influences the development of extramedullary hematopoiesis in the spleens of myelofibrosis patients.

    Science.gov (United States)

    Wang, Xiaoli; Cho, Sool Yeon; Hu, Cing Siang; Chen, Daniel; Roboz, John; Hoffman, Ronald

    2015-02-01

    Myelofibrosis (MF) is characterized by the constitutive mobilization of hematopoietic stem cells (HSC) and hematopoietic progenitor cells (HPC) and the establishment of extramedullary hematopoiesis. The mechanisms underlying this abnormal HSC/HPC trafficking pattern remain poorly understood. We demonstrated that both splenic and peripheral blood (PB) MF CD34(+) cells equally share a defective ability to home to the marrow, but not to the spleens, of NOD/LtSz-Prkdc(scid) mice. This trafficking pattern could not be attributed to discordant expression of integrins or chemokine receptors other than the downregulation of C-X-C chemokine receptor type 4 by both PB and splenic MF CD34(+) cells. The number of both splenic MF CD34(+) cells and HPCs that migrated toward splenic MF plasma was, however, significantly greater than the number that migrated toward PB MF plasma. The concentration of the intact HSC/HPC chemoattractant C-X-C motif chemokine 12 (CXCL12) was greater in splenic MF plasma than PB MF plasma, as quantified using mass spectrometry. Functionally inactive truncated products of CXCL12, which are the product of proteolytic degradation by serine proteases, were detected at similar levels in both splenic and PB MF plasma. Treatment with an anti-CXCL12 neutralizing antibody resulted in a reduction in the degree of migration of splenic MF CD34(+) cells toward both PB and splenic MF plasma, validating the role of CXCL12 as a functional chemoattractant. Our data indicate that the MF splenic microenvironment is characterized by increased levels of intact, functional CXCL12, which contributes to the localization of MF CD34(+) cells to the spleen and the establishment of extramedullary hematopoiesis. Copyright © 2015 ISEH - International Society for Experimental Hematology. Published by Elsevier Inc. All rights reserved.

  6. Proportional Counter Calibration and Analysis for 12C + p Resonance Scattering

    Science.gov (United States)

    Nelson, Austin; Rogachev, Grigory; Uberseder, Ethan; Hooker, Josh; Koshchiy, Yevgen

    2014-09-01

    Light exotic nuclei provide a unique opportunity to test the predictions of modern ab initio theoretical calculations near the drip line. In ab initio approaches, nuclear structure is described starting from bare nucleon-nucleon and three-nucleon interactions. Calculations are very heavy and can only be performed for the lightest nuclei (A objective of this project was to test the performance and perform position calibration of this proportional counter array. The test was done using 12C beam. The excitation function for 12C + p elastic scattering was measured and calibration of the proportional counter was performed using known resonances in 13N. The method of calibration, including solid angle calculations, normalization corrections, and position calibration will be presented. Light exotic nuclei provide a unique opportunity to test the predictions of modern ab initio theoretical calculations near the drip line. In ab initio approaches, nuclear structure is described starting from bare nucleon-nucleon and three-nucleon interactions. Calculations are very heavy and can only be performed for the lightest nuclei (A objective of this project was to test the performance and perform position calibration of this proportional counter array. The test was done using 12C beam. The excitation function for 12C + p elastic scattering was measured and calibration of the proportional counter was performed using known resonances in 13N. The method of calibration, including solid angle calculations, normalization corrections, and position calibration will be presented. Funded by DOE and NSF-REU Program; Grant No. PHY-1263281.

  7. High Lithium Insertion Voltage Single-Crystal H2 Ti12 O25 Nanorods as a High-Capacity and High-Rate Lithium-Ion Battery Anode Material.

    Science.gov (United States)

    Guo, Qiang; Chen, Li; Shan, Zizhao; Lee, Wee Siang Vincent; Xiao, Wen; Liu, Zhifang; Liang, Jingjing; Yang, Gaoli; Xue, Junmin

    2018-01-10

    H 2 Ti 12 O 25 holds great promise as a high-voltage anode material for advanced lithium-ion battery applications. To enhance its electrochemical performance, control of the crystal orientation and morphology is an effective way to cope with slow Li + -ion diffusion inside H 2 Ti 12 O 25 with severe anisotropy. In this report, Na 2 Ti 6 O 13 nanorods, prepared from Na 2 CO 3 and anatase TiO 2 in molten NaCl medium, were used as a precursor in the synthesis of long single-crystal H 2 Ti 12 O 25 nanorods with reactive facets. The as-prepared H 2 Ti 12 O 25 nanorods with a diameter of 100-200 nm showed higher charge (extraction) specific capacity and better rate performance than previously reported systems. The reversible capacity of H 2 Ti 12 O 25 was 219.8 mAh g -1 at 1C after 100 cycles, 172.1 mAh g -1 at 10C, and 144.4 mAh g -1 at 20C after 200 cycles; these values are higher than those of H 2 Ti 12 O 25 prepared by the conventional soft-chemical method. Moreover, the as-prepared H 2 Ti 12 O 25 nanorods exhibited superior cycle stability with more than 94 % retention of capacity with nearly 100 % coulombic efficiency after 100 cycles at 1C. On the basis of the above results, long single-crystal H 2 Ti 12 O 25 nanorods synthesized in molten NaCl with outstanding electrochemical characteristics hold a significant amount of promise for hybrid electric vehicles and energy-storage systems. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Study of the Particle Production in $^{12}$C Induced Heavy Ion Reactions at 86 MeV/N

    CERN Multimedia

    2002-01-01

    The aim of this experiment is to study various characteristics of light and heavy particle production in |1|2C induced reactions if possible over the whole unexplored energy region 50-86~MeV/N. In particular we want to investigate how the correlations in the multiparticle events can help us to distinguish bet existing models. \\\\ \\\\ Two-proton large-angle correlations and correlations between two heavier (Z~=~1 or 2) particles are studied with scintillator +~NaI and range telescopes, complemented with a 24 telescope scintillator wall for projectile fragments. Thereby we receive information about the reaction plane and the impact parameter in coincidence with the two-particle correlation spectra. Small @Dp correlations can also be studied. The inclusive @p|+ and @p|- production has been followed far below the nucleon-nucleon threshold. Pions are thereby identified from @DE-E correlations and the @p|+ decay in plastic range telescopes. These results are now followed up by @p-projectile fragment and @p-p correlat...

  9. Na+-stimulated ATPase of alkaliphilic halotolerant cyanobacterium Aphanothece halophytica translocates Na+ into proteoliposomes via Na+ uniport mechanism

    Directory of Open Access Journals (Sweden)

    Soontharapirakkul Kanteera

    2010-08-01

    Full Text Available Abstract Background When cells are exposed to high salinity conditions, they develop a mechanism to extrude excess Na+ from cells to maintain the cytoplasmic Na+ concentration. Until now, the ATPase involved in Na+ transport in cyanobacteria has not been characterized. Here, the characterization of ATPase and its role in Na+ transport of alkaliphilic halotolerant Aphanothece halophytica were investigated to understand the survival mechanism of A. halophytica under high salinity conditions. Results The purified enzyme catalyzed the hydrolysis of ATP in the presence of Na+ but not K+, Li+ and Ca2+. The apparent Km values for Na+ and ATP were 2.0 and 1.2 mM, respectively. The enzyme is likely the F1F0-ATPase based on the usual subunit pattern and the protection against N,N'-dicyclohexylcarbodiimide inhibition of ATPase activity by Na+ in a pH-dependent manner. Proteoliposomes reconstituted with the purified enzyme could take up Na+ upon the addition of ATP. The apparent Km values for this uptake were 3.3 and 0.5 mM for Na+ and ATP, respectively. The mechanism of Na+ transport mediated by Na+-stimulated ATPase in A. halophytica was revealed. Using acridine orange as a probe, alkalization of the lumen of proteoliposomes reconstituted with Na+-stimulated ATPase was observed upon the addition of ATP with Na+ but not with K+, Li+ and Ca2+. The Na+- and ATP-dependent alkalization of the proteoliposome lumen was stimulated by carbonyl cyanide m - chlorophenylhydrazone (CCCP but was inhibited by a permeant anion nitrate. The proteoliposomes showed both ATPase activity and ATP-dependent Na+ uptake activity. The uptake of Na+ was enhanced by CCCP and nitrate. On the other hand, both CCCP and nitrate were shown to dissipate the preformed electric potential generated by Na+-stimulated ATPase of the proteoliposomes. Conclusion The data demonstrate that Na+-stimulated ATPase from A. halophytica, a likely member of F-type ATPase, functions as an electrogenic Na

  10. Microstructure and microwave dielectric properties of Na1/2Sm1/2TiO3 filled PTFE, an environmental friendly composites

    Science.gov (United States)

    Luo, Fuchuan; Tang, Bin; Yuan, Ying; Fang, Zixuan; Zhang, Shuren

    2018-04-01

    A study on Na1/2Sm1/2TiO3 filled and glassfiber reinforced polytetrafluoroethylene (PTFE) composites was described. The GF content was a fixed value of 4 wt%, and the NST content in the composite matrix changed from 26 to 66 wt%. The paper consisted of the manufactural process of the composite and the effects of filler content on the properties of the substrate, such as morphology, moisture absorption, density, dielectric properties and temperature coefficient of dielectric constant. As NST filler loading increased from 26 to 66 wt%, the dielectric constant and loss tangent experienced a continuously increase while the development in τε was opposite. X-Ray Diffraction, FTIR and XPS were used to analyze the microstructure of modified ceramic powder. It was proved that the silane coupling agent has been grafted on the NST surface successfully. At last, the NST/GF filled PTFE composites exhibited good dielectric constant (εr = 4.95), low dielectric loss (tan δ = 0.00147), acceptable water absorption (0.036) and temperature coefficient of dielectric constant (τε = -164) at filler loading of 4 wt% GF and 46 wt% NST.

  11. Metabolic profiling of heat or anoxic stress in mouse C2C12 myotubes using multinuclear magnetic resonance spectroscopy

    DEFF Research Database (Denmark)

    Straadt, Ida K; Young, Jette F; Petersen, Bent O

    2010-01-01

    to anaerobic metabolism due to inhibition of the aerobic pathway in the mitochondria. Conversely, lower levels of unlabeled ((12)C) lactate were apparent at increasing severity of stress, which indicate that lactate is released from the myotubes to the medium. In conclusion, the metabolites identified......In the present study, the metabolic effects of heat and anoxic stress in myotubes from the mouse cell line C2C12 were investigated by using a combination of (13)C, (1)H, and (31)P nuclear magnetic resonance (NMR) spectroscopy and enrichment with [(13)C]-glucose. Both the (13)C and the (1)H NMR...... spectra showed reduced levels of the amino acids alanine, glutamate, and aspartate after heat or anoxic stress. The decreases were smallest at 42 degrees C, larger at 45 degrees C, and most pronounced after anoxic conditions. In addition, in both the (1)H and the (31)P NMR spectra, decreases in the high...

  12. Amino acids and insulin act additively to regulate components of the ubiquitin-proteasome pathway in C2C12 myotubes

    Directory of Open Access Journals (Sweden)

    Lomax Michael A

    2007-03-01

    Full Text Available Abstract Background The ubiquitin-proteasome system is the predominant pathway for myofibrillar proteolysis but a previous study in C2C12 myotubes only observed alterations in lysosome-dependent proteolysis in response to complete starvation of amino acids or leucine from the media. Here, we determined the interaction between insulin and amino acids in the regulation of myotube proteolysis Results Incubation of C2C12 myotubes with 0.2 × physiological amino acids concentration (0.2 × PC AA, relative to 1.0 × PC AA, significantly increased total proteolysis and the expression of 14-kDa E2 ubiquitin conjugating enzyme (p Conclusion In a C2C12 myotube model of myofibrillar protein turnover, amino acid limitation increases proteolysis in a ubiquitin-proteasome-dependent manner. Increasing amino acids or leucine alone, act additively with insulin to down regulate proteolysis and expression of components of ubiquitin-proteasome pathway. The effects of amino acids on proteolysis but not insulin and leucine, are blocked by inhibition of the mTOR signalling pathway.

  13. The level structure of 13C around Esub(x)=20 MeV studied by polarised neutron scattering from 12C

    International Nuclear Information System (INIS)

    Tornow, W.; Woye, E.

    1987-01-01

    Analysing-power data for elastic scattering of neutrons from 12 C have been obtained at selected angles in small energy steps between incident energies of 15.55 and 17.35 MeV. The excitation energy, spin and parity of levels in 13 C have been determined for excitation energies around 20 MeV via a phase-shift analysis of these data and of previously measured n- 12 C total cross section data. In addition, an auxiliary phase-shift analysis has been performed in the neutron energy range from 12 to 15 MeV. All experimental data are well reproduced by the phase shifts obtained. The need for further experimental data is pointed out. (author)

  14. Interaction of low-expansion NZP ceramics with Na{sub 2}SO{sub 4} at 1000{degrees}C

    Energy Technology Data Exchange (ETDEWEB)

    Lee, W.Y.; Cooley, K.M.; Stinton, D.P.; Joslin, D.L. [Oak Ridge National Lab., TN (United States)

    1996-08-01

    The interaction between several low-expansion NZP materials and Na{sub 2}SO{sub 4} at 1000{degrees}C in pure O{sub 2} was studied. Ba{sub 1.25}Zr{sub 4}P{sub 5.5}Si{sub 0.5}O{sub 24} experienced extensive cracking and delamination upon reaction with Na{sub 2}SO{sub 4}. On the other hand, Ca{sub 0.5}Sr{sub 0.5}Zr{sub 4}P{sub 6}O{sub 24} remained intact in terms of visual appearance, and had no significant weight loss or gain. However, the ion exchange between Na{sup +} ions and Ca{sup +2} ions was observed to be sufficiently rapid to allow the penetration of the Na{sup +} ions into the test specimens in 100h. The segregation of Ca to the specimen surface was observed due to the ion exchange. Ca{sub 0.6}Mg{sub 0.4}Zr{sub 4}P{sub 6}O{sub 24} was also tested, but its stability could not properly be assessed because the as-received specimens contained a significant amount of MgZr{sub 4}P{sub 6}O{sub 24} as an impurity phase.

  15. Quasielastic C-12(e,e ' p) reaction at high momentum transfer

    NARCIS (Netherlands)

    Morrison, JH; Baghaei, H; Bertozzi, W; Gilad, S; Glickman, J; Hyde-Wright, CE; Kalantar-Nayestanaki, N; Lourie, RW; Penn, S; Ulmer, PE; Weinstein, LB; Cottman, BH; Ghedira, L; Winhold, EJ; Calarco, J.R.; Wise, J; Boberg, P; Chang, CC; Zhang, D; Aniol, K; Epstein, MB; Margaziotis, DJ; Finn, JM; Perdrisat, C; Punjabi, P.

    We measured the C-12(e,e'p) cross section as a function of missing energy in parallel kinematics for (q,omega)=(970 MeV/c, 330 MeV) and (990 MeV/c, 475 MeV). At omega=475 MeV, at the maximum of the quasielastic peak, there is a large continuum (E-m>50 MeV) cross section extending out to the deepest

  16. C2C12 myotubes inhibit the proliferation and differentiation of 3T3-L1 preadipocytes by reducing the expression of glucocorticoid receptor gene

    Energy Technology Data Exchange (ETDEWEB)

    Chu, Weiwei; Wei, Wei; Yu, Shigang; Han, Haiyin; Shi, Xiaoli [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China); Sun, Wenxing [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China); College of Public Health, Nantong University, Nantong 226019 (China); Gao, Ying [College of Veterinary Medicine, Nanjing Agricultural University, Nanjing 210095 (China); Zhang, Lifan [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China); Chen, Jie, E-mail: jiechen@njau.edu.cn [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China)

    2016-03-25

    Obesity is a well-established risk factor to health for its relationship with insulin resistance, diabetes and metabolic syndrome. Myocyte-adipocyte crosstalk model plays a significant role in studying the interaction of muscle and adipose development. Previous related studies mainly focus on the effects of adipocytes on the myocytes activity, however, the influence of myotubes on the preadipocytes development remains unclear. The present study was carried out to settle this issue. Firstly, the co-culture experiment showed that the proliferation, cell cycle, and differentiation of 3T3-L1 preadipocytes were arrested, and the apoptosis was induced, by differentiated C2C12 myotubes. Next, the sensitivity of 3T3-L1 preadipocytes to glucocorticoids (GCs), which was well known as cell proliferation, differentiation, apoptosis factor, was decreased after co-cultured with C2C12 myotubes. What's more, our results showed that C2C12 myotubes suppressed the mRNA and protein expression of glucocorticoid receptor (GR) in 3T3-L1 preadipocytes, indicating the potential mechanism of GCs sensitivity reduction. Taken together, we conclude that C2C12 myotubes inhibited 3T3-L1 preadipocytes proliferation and differentiation by reducing the expression of GR. These data suggest that decreasing GR by administration of myokines may be a promising therapy for treating patients with obesity or diabetes. - Highlights: • C2C12 myotubes inhibited proliferation and differentiation of 3T3-L1 preadipocytes. • C2C12 myotubes arrested cell cycle of 3T3-L1 preadipocytes. • C2C12 myotubes induced apoptosis of 3T3-L1 preadipocytes. • C2C12 inhibit 3T3-L1 cells by reducing the expression of glucocorticoid receptor gene.

  17. Evaluation of n-{sup 12}C scattering between 7 and 26 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Z P; Tornow, W [Department of Physics, Duke University, Durham, NC 27708-0308 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708-0308 (United States)

    2005-11-01

    The existing n-{sup 12}C elastic differential cross-section, analysing power and total cross-section data in the energy range from 7 to 26 MeV were analysed via a phase-shift analysis. A very good description of the uniquely large database has been achieved. The level parameters of 40 states or resonances in {sup 13}C were deduced. The values obtained for the n-{sup 12}C reaction cross section are larger than those given in the ENDF/B-VI evaluation.

  18. BPN, a marine-derived PTP1B inhibitor, activates insulin signaling and improves insulin resistance in C2C12 myotubes.

    Science.gov (United States)

    Xu, Qi; Luo, Jiao; Wu, Ning; Zhang, Renshuai; Shi, Dayong

    2018-01-01

    Insulin resistance is a key feature of type 2 diabetes mellitus (T2DM) and is characterized by defects in insulin signaling. Protein tyrosine phosphatase 1B (PTP1B) is a major negative regulator of insulin signaling cascade and has attracted intensive investigation in recent T2DM therapy study. BPN, a marine-derived bromophenol compound, was isolated from the red alga Rhodomela confervoides. This study investigated the effects of BPN on the insulin signaling pathway in insulin-resistant C2C12 myotubes by inhibiting PTP1B. Molecular docking study and analysis of small- molecule interaction with PTP1B all showed BPN inhibited PTP1B activity via binding to the catalytic site through hydrogen bonds. We then found that BPN permeated into C2C12 myotubes, on the one hand, activated insulin signaling in an insulin-independent manner in C2C12 cells; on the other hand, ameliorated palmitate-induced insulin resistance through augmenting insulin sensitivity. Moreover, our studies also showed that PTP1B inhibition by BPN increased glucose uptake in normal and insulin-resistant C2C12 myotubes through glucose transporter 4 (GLUT4) translocation. Taken together, BPN activates insulin signaling and alleviates insulin resistance and represents a potential candidate for further development as an antidiabetic agent. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Helicobacter spp. infection in dogs is not associated with changes in epithelial proliferation or E-cadherin expression in gastric mucosaInfecção por Helicobacter spp. em cães não está associada com alterações na proliferação epitelial ou na expressão de E-caderina na mucosa gástrica

    Directory of Open Access Journals (Sweden)

    Ana Paula Bracarense

    2012-02-01

    Full Text Available Helicobacter pylori infection causes gastritis and can induce gastric adenocarcinoma and MALT lymphoma in humans. The aim of this study was to determine in dogs whether there is an association between Helicobacter spp. infection in gastric mucosa, histological lesions, including epithelial cell proliferation and cell adhesion. Gastric biopsies of 12 dogs with gastric disturbances and 25 healthy dogs were evaluated. Warthin-Starry staining (WS and PCR assay were performed to confirm the presence of helicobacteria. The Helicobacter species were determined by PCR assay with speciesspecific primers for H. heilmannii, H. bizzozeronii or H. salomonis, H. felis and H. pylori. Mucosal lesions were evaluated by haematoxylin and eosin (HE and epithelial proliferation was determined by AgNOR and PCNA methods. Cell adhesion was evaluated by the expression of E-cadherin by epithelial cells. Helicobacter spp. was confirmed in 75.7% (28/37 and 73.0% (27/37 of the samples by WS and PCR, respectively. H. bizzozeronii was the species most frequently detected (37%; co-infection was observed in six (22% dogs. Histological changes in the lamina propria included mild chronic gastritis, fibrosis, glandular degeneration, and presence of lymphoid aggregates. There was a significant association between H. heilmannii infection and the presence of lymphoid follicles (p Infecção por Helicobacter pylori provoca gastrite e pode induzir adenocarcinoma gástrico e linfoma tipo MALT em seres humanos. O objetivo deste estudo foi determinar se existe associação entre infecção por Helicobacter spp. na mucosa gástrica de cães e lesões histológicas, incluindo proliferação epitelial e adesão celular. Foram avaliadas biópsias de 12 cães com distúrbios gástricos e de 25 cães saudáveis. A coloração de Warthin-Starry (WS e o método de PCR foram utilizados para confirmar a presença de helicobactérias. As espécies de Helicobacter foram determinadas por PCR com

  20. Neutron scattering from [sup 12]C between 15. 6 and 17. 3 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L. (Duke Univ., Durham, NC (United States). Dept. of Physics Triangle Universities Nuclear Lab., Durham, NC (United States))

    1993-06-01

    The differential cross section [sigma]([theta]) for neutron elastic scattering from [sup 12]C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The [sigma]([theta]) data, together with published analysing power A[sub y]([theta]) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present [sup 12]C(n,n)[sup 12]C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in [sup 11]C via an iterative-moment approach or a dispersive optical-model analysis. (author).

  1. Secondary particle multiplicity depending on the collisions of π--mesons with 12C nucleons at p=40 GeV/c

    International Nuclear Information System (INIS)

    Angelov, N.S.; Grishin, V.G.; Nad', Yu.; Kanarek, T.; Batskovich, S.

    1978-01-01

    The multiplicities of secondary charged particles in π -12 C-interactions with ν-protons of carbon nucleus at p=40 GeV/c (ν=1-5) is presented. It is shown that the dependence of the average values of particle multiplicities on ν approximately equals the dependence on initial pion energy in π - p-interactions in the range from 40 to 200 GeV. KNO scaling and the Wroblewski empirical law for interactions with several nucleons of 12 C nucleus are observed

  2. 13C NMR and relaxation studies of the nanomagnet Mn12-acetate

    Science.gov (United States)

    Achey, Randall M.; Kuhns, Philip L.; Reyes, Arneil P.; Moulton, William G.; Dalal, Naresh S.

    2001-08-01

    The nanomagnet [Mn12O12(CH3COO)16(H2O)4].2CH3COOH.4H2O, also known as Mn12, has been synthesized with 13C labeling at the CH3 groups, and investigated by 13C NMR at fields up to 23 T. Using oriented samples, it is possible to resolve four distinct 13C peaks at room temperature, located on both sides of the unshifted Larmor frequency. These peaks were assigned to the four hyperfine-shifted, magnetically inequivalent sets of 13CH3 groups in the Mn12 lattice, based on a comparison with the crystal structure and point-dipole and spin-density calculations. These results establish that the unpaired electron spin density of the S=10 system in this cluster extends over the entire molecular framework, not just the core. These results are discussed in relationship to inelastic neutron scattering measurements. The temperature and field dependence of the 13C nuclear-spin-lattice-relaxation time T1 on the least shifted peak was measured. A single weakly field-dependent minimum at about 60 K is observed in the temperature dependence of the measured T1. The relaxation mechanism responsible for the T1 minimum is ascribed mainly to hindered rotation of the methyl group of the acetate ligand at higher temperature, and to electronic spin fluctuations at lower temperature.

  3. Perfil epidemiológico de cárie dentária em crianças de 12 anos de idade, residentes em cidades fluoretadas e não fluoretadas, na Região Centro-Oeste do Estado de São Paulo, Brasil An epidemiological profile of dental caries in 12-year-old children residing in cities with and without fluoridated water supply in the central western area of the State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Sílvia Helena de Carvalho Sales-Peres

    2002-10-01

    Full Text Available O objetivo deste estudo pautou em analisar o perfil epidemiológico de cárie dentária na Região Centro-Oeste do Estado de São Paulo, Brasil, em crianças de 12 anos de idade, segundo o gênero, comparando o índice CPOD em municípios fluoretados e não fluoretados. Foram utilizados os dados do Levantamento Epidemiológico do Estado de São Paulo - 1998, referentes à Direção Regional de Saúde - DIR X, representada por oito municípios. A amostra foi composta por 485 escolares, de ambos os gêneros, distribuídos pelos municípios. Os resultados demonstraram que na cidade de Pederneiras (médio porte, com flúor o CPOD foi igual a 7,06, valor maior do que o encontrado no Brasil em 1986. A maior prevalência de cárie dentária ocorreu nos meninos, quando comparados às meninas, demonstrando uma nova tendência à cárie dentária na região centro-oeste. Não houve diferença estatisticamente significante entre CPOD de municípios de mesmo porte, independente da presença ou ausência de flúor na água, sugerindo o fenômeno da convergência. Possivelmente, pela ação da ingestão de outras fontes de flúor e a presença do efeito "halo". A prevalência de cárie na região esteve "alta", com CPOD igual a 4,82, não atingindo as metas para o ano 2000.This study aimed to analyze the epidemiological profile of dental caries in the central western region of the State of São Paulo, Brazil, focusing on 12-year-old children by gender, comparing the DMFT index in fluoridated and non-fluoridated cities. The study used data from the Epidemiological Surveys in the State of São Paulo, 1998, pertaining to the 10th Regional Health Directorate, including 8 cities. The sample consisted of 485 schoolchildren, both boys and girls, distributed by city. In Pederneiras (a medium-sized city with a fluoridated water supply, DMFT was 7.06, higher than the Brazilian national mean for 1986. Boys showed a higher prevalence of dental caries than girls, showing

  4. Elastic and inelastic scattering of 800 MeV/c K+- mesons from 12C and 40Ca

    International Nuclear Information System (INIS)

    Marlow, D.R.

    1981-04-01

    Methods and results of an experiment to study the scattering of 800 MeV/c K +- mesons from 12 C and 40 Ca are presented. The reactions under study include: the four elastic scattering reactions 12 C(K +- ,K +- ) and 40 Ca(K +- ,K +- ), and the four inelastic scattering reactions, 12 C(K +- .K +- ') to the J/sup P/ = 2 + 4.43 MeV and J/sup P/ = 3 - states. The experimental data were obtained using the Hyper-Nuclear Spectrometer and the Low Energy Separated Beam (LESB I) at the Alternating Gradient Synchrotron (AGS) of Brookhaven Laboratory (BNL). Calculations using the program PIRK, an optical potential code, are compared to the elastic data. The results of a second set of calculations, using Glauber theory are also presented. Both sets of calculations use as input: the results of partial wave analyses of kaon nucleon scattering data, and nuclear shapes as determined from the results of electron nucleus scattering experiments. The agreement between the experimental data and the theoretical predictions is reasonable over the angular range of the data, with the exception of Glauber calculations of the K + elastic scattering. In those cases, the eikonal approximation proves to be a poor approximation. Smaller discrepancies are found in some other cases, indicating the possible need for more sophisticated calculations

  5. Towards highly stable storage of sodium ions: a porous Na(3)V(2)(PO(4))(3)/C cathode material for sodium-ion batteries.

    Science.gov (United States)

    Shen, Wei; Wang, Cong; Liu, Haimei; Yang, Wensheng

    2013-10-18

    A porous Na3 V2 (PO4 )3 cathode material coated uniformly with a layer of approximately 6 nm carbon has been synthesized by the sol-gel method combined with a freeze-drying process. The special porous morphology and structure significantly increases the specific surface area of the material, which greatly enlarges the contact area between the electrode and electrolyte, and consequently supplies more active sites for sodium ions. When employed as a cathode material of sodium-ion batteries, this porous Na3 V2 (PO4 )3 /C exhibits excellent rate performance and cycling stability; for instance, it shows quite a flat potential plateau at 3.4 V in the potential window of 2.7-4.0 V versus Na(+) /Na and delivers an initial capacity as high as 118.9 and 98.0 mA h g(-1) at current rates of 0.05 and 0.5 C, respectively, and after 50 cycles, a good capacity retention of 92.7 and 93.6 % are maintained. Moreover, even when the discharge current density is increased to 5 C (590 mA g(-1) ), an initial capacity of 97.6 mA h g(-1) can still be achieved, and an exciting capacity retention of 88.6 % is obtained after 100 cycles. The good cycle performance, excellent rate capability, and moreover, the low cost of Na3 V2 (PO4 )3 /C suggest that this material is a promising cathode for large-scale sodium-ion rechargeable batteries. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Dicty_cDB: SHE451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu

  7. Activation of protein kinase C alters the intracellular distribution and mobility of cardiac Na+ channels.

    Science.gov (United States)

    Hallaq, Haifa; Wang, Dao W; Kunic, Jennifer D; George, Alfred L; Wells, K Sam; Murray, Katherine T

    2012-02-01

    Na(+) current derived from expression of the cardiac isoform SCN5A is reduced by receptor-mediated or direct activation of protein kinase C (PKC). Previous work has suggested a possible role for loss of Na(+) channels at the plasma membrane in this effect, but the results are controversial. In this study, we tested the hypothesis that PKC activation acutely modulates the intracellular distribution of SCN5A channels and that this effect can be visualized in living cells. In human embryonic kidney cells that stably expressed SCN5A with green fluorescent protein (GFP) fused to the channel COOH-terminus (SCN5A-GFP), Na(+) currents were suppressed by an exposure to PKC activation. Using confocal microscopy, colocalization of SCN5A-GFP channels with the plasma membrane under control and stimulated conditions was quantified. A separate population of SCN5A channels containing an extracellular epitope was immunolabeled to permit temporally stable labeling of the plasma membrane. Our results demonstrated that Na(+) channels were preferentially trafficked away from the plasma membrane by PKC activation, with a major contribution by Ca(2+)-sensitive or conventional PKC isoforms, whereas stimulation of protein kinase A (PKA) had the opposite effect. Removal of the conserved PKC site Ser(1503) or exposure to the NADPH oxidase inhibitor apocynin eliminated the PKC-mediated effect to alter channel trafficking, indicating that both channel phosphorylation and ROS were required. Experiments using fluorescence recovery after photobleaching demonstrated that both PKC and PKA also modified channel mobility in a manner consistent with the dynamics of channel distribution. These results demonstrate that the activation of protein kinases can acutely regulate the intracellular distribution and molecular mobility of cardiac Na(+) channels in living cells.

  8. HCO3(-)-coupled Na+ influx is a major determinant of Na+ turnover and Na+/K+ pump activity in rat hepatocytes

    International Nuclear Information System (INIS)

    Fitz, J.G.; Lidofsky, S.D.; Weisiger, R.A.; Xie, M.H.; Cochran, M.; Grotmol, T.; Scharschmidt, B.F.

    1991-01-01

    Recent studies in hepatocytes indicate that Na(+)-coupled HCO3- transport contributes importantly to regulation of intracellular pH and membrane HCO3- transport. However, the direction of net coupled Na+ and HCO3- movement and the effect of HCO3- on Na+ turnover and Na+/K+ pump activity are not known. In these studies, the effect of HCO3- on Na+ influx and turnover were measured in primary rat hepatocyte cultures with 22Na+, and [Na+]i was measured in single hepatocytes using the Na(+)-sensitive fluorochrome SBFI. Na+/K+ pump activity was measured in intact perfused rat liver and hepatocyte monolayers as Na(+)-dependent or ouabain-suppressible 86Rb uptake, and was measured in single hepatocytes as the effect of transient pump inhibition by removal of extracellular K+ on membrane potential difference (PD) and [Na+]i. In hepatocyte monolayers, HCO3- increased 22Na+ entry and turnover rates by 50-65%, without measurably altering 22Na+ pool size or cell volume, and HCO3- also increased Na+/K+ pump activity by 70%. In single cells, exposure to HCO3- produced an abrupt and sustained rise in [Na+]i from approximately 8 to 12 mM. Na+/K+ pump activity assessed in single cells by PD excursions during transient K+ removal increased congruent to 2.5-fold in the presence of HCO3-, and the rise in [Na+]i produced by inhibition of the Na+/K+ pump was similarly increased congruent to 2.5-fold in the presence of HCO3-. In intact perfused rat liver, HCO3- increased both Na+/K+ pump activity and O2 consumption. These findings indicate that, in hepatocytes, net coupled Na+ and HCO3- movement is inward and represents a major determinant of Na+ influx and Na+/K+ pump activity. About half of hepatic Na+/K+ pump activity appears dedicated to recycling Na+ entering in conjunction with HCO3- to maintain [Na+]i within the physiologic range

  9. 12 CFR 563c.1 - Form and content of financial statements.

    Science.gov (United States)

    2010-01-01

    ... ACCOUNTING REQUIREMENTS Form and Content of Financial Statements § 563c.1 Form and content of financial... statements shall: (1) Be prepared and presented in accordance with generally accepted accounting principles... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Form and content of financial statements. 563c...

  10. Changes in the corneal Na-K ATPase levels in eyes stored in moist chamber at 4°C

    Directory of Open Access Journals (Sweden)

    Devi B

    1996-01-01

    Full Text Available This report deals with a chronological measurement of Na-K ATPase enzyme activity in human and bovine corneas stored in a moist chamber at 4°C. Paired human and bovine eyes were sterilized by the standard eye bank procedure and stored up to 6 days. At the desired time, the corneal endothelium was assayed for Na-K ATPase activity. The protein content of each tissue sample was also determined. In a parallel set of experiments, the viability of identical stored corneas was determined by trypan blue and alizarin red staining technique, and morphometric analysis was done to quantify the extent of the corneal endothelial damage. The human corneas showed that there was a significant progressive decrease in the Na-K ATPase activity as the storage time increased. The decrease was related to morphological endothelial damage.

  11. Oxidative stress-induced metabolic changes in mouse C2C12 myotubes studied with high-resolution 13C, 1H, and 31P NMR spectroscopy

    DEFF Research Database (Denmark)

    Straadt, Ida K; Young, Jette F; Petersen, Bent O

    2010-01-01

    In this study, stress in relation to slaughter was investigated in a model system by the use of (13)C, (1)H, and (31)P nuclear magnetic resonance (NMR) spectroscopy for elucidating changes in the metabolites in C2C12 myotubes exposed to H(2)O(2)-induced stress. Oxidative stress resulted in lower...... to lower levels of the unlabeled ((12)C) lactate were identified in the (1)H spectra after stress exposure. These data indicate an increase in de novo synthesis of alanine, concomitant with a release of lactate from the myotubes to the medium at oxidative stress conditions. The changes in the metabolite...

  12. Synthesis of zeolites Na-A and Na-X from tablet compressed and calcinated coal fly ash

    Science.gov (United States)

    Hu, Tao; Gao, Wenyan; Liu, Xin; Zhang, Yifu; Meng, Changgong

    2017-10-01

    Zeolites Na-A and Na-X are important synthetic zeolites widely used for separation and adsorption in industry. It is of great significance to develop energy-efficient routines that can synthesize zeolites Na-A and Na-X from low-cost raw materials. Coal fly ash (CFA) is the major residue from the combustion of coal and biomass containing more than 85% SiO2 and Al2O3, which can readily replace the conventionally used sodium silicate and aluminate for zeolite synthesis. We used Na2CO3 to replace the expensive NaOH used for the calcination of CFA and showed that tablet compression can enhance the contact with Na2CO3 for the activation of CFA through calcination for the synthesis of zeolites Na-A and Na-X under mild conditions. We optimized the control variables for zeolite synthesis and showed that phase-pure zeolite Na-A can be synthesized with CFA at reactant molar ratio, hydrothermal reaction temperature and reaction time of 1.3Na2O: 0.6Al2O3: 1SiO2: 38H2O at 80°C for 6 h, respectively, while phase-pure zeolite Na-X can be synthesized at 2.2Na2O: 0.2Al2O3: 1SiO2: 88H2O at 100°C for 8 h, respectively. The composition, morphology, specific surface area, vibration spectrum and thermogravimetry of synthesized Na-A and Na-X were further characterized.

  13. Integral measurement of the {sup 12}C(n, p){sup 12}B reaction up to 10 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Zugec, P.; Bosnar, D. [University of Zagreb, Department of Physics, Faculty of Science, Zagreb (Croatia); Colonna, N.; Barbagallo, M.; Mastromarco, M.; Tagliente, G.; Variale, V. [Istituto Nazionale di Fisica Nucleare, Bari (Italy); Ventura, A. [Istituto Nazionale di Fisica Nucleare, Bologna (Italy); Mengoni, A. [ENEA, Bologna (Italy); Altstadt, S.; Langer, C.; Lederer, C.; Reifarth, R.; Schmidt, S.; Weigand, M. [Johann-Wolfgang-Goethe Universitaet, Frankfurt (Germany); Andrzejewski, J.; Marganiec, J.; Perkowski, J. [Uniwersytet Lodzki, Lodz (Poland); Audouin, L.; Leong, L.S.; Tassan-Got, L. [Centre National de la Recherche Scientifique/IN2P3 - IPN, Orsay (France); Becares, V.; Cano-Ott, D.; Garcia, A.R.; Gonzalez-Romero, E.; Martinez, T.; Mendoza, E. [Centro de Investigaciones Energeticas Medioambientales y Tecnologicas (CIEMAT), Madrid (Spain); Becvar, F.; Krticka, M.; Kroll, J.; Valenta, S. [Charles University, Prague (Czech Republic); Belloni, F.; Mondalaers, W.; Plompen, A.; Schillebeeckx, P. [European Commission JRC, Institute for Reference Materials and Measurements, Geel (Belgium); Berthoumieux, E.; Fraval, K.; Gunsing, F. [CEA/Saclay - IRFU, Gif-sur-Yvette (France); Billowes, J.; Ware, T.; Wright, T. [University of Manchester, Manchester (United Kingdom); Boccone, V.; Brugger, M.; Calviani, M.; Cerutti, F.; Chiaveri, E.; Chin, M.; Ferrari, A.; Guerrero, C.; Losito, R.; Roman, F.; Rubbia, C.; Tsinganis, A.; Versaci, R.; Vlachoudis, V.; Weiss, C. [CERN, Geneva (Switzerland); Calvino, F.; Cortes, G.; Gomez-Hornillos, M.B.; Riego, A. [Universitat Politecnica de Catalunya, Barcelona (Spain); Carrapico, C.; Goncalves, I.F.; Sarmento, R.; Vaz, P. [Universidade de Lisboa, C2TN-Instituto Superior Tecnico, Lisboa (Portugal); Cortes-Giraldo, M.A.; Praena, J.; Quesada, J. [Universidad de Sevilla, Sevilla (Spain); Cosentino, L.; Finocchiaro, P. [INFN - Laboratori Nazionali del Sud, Catania (Italy); Diakaki, M.; Karadimos, D.; Kokkoris, M.; Vlastou, R. [National Technical University of Athens (NTUA), Athens (Greece); Domingo-Pardo, C.; Giubrone, G.; Tain, J.L. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Dressler, R.; Heinitz, S.; Kivel, N.; Schumann, D. [Paul Scherrer Institut, Villigen (Switzerland); Duran, I.; Tarrio, D. [Universidade de Santiago de Compostela, Santiago de Compostela (Spain); Eleftheriadis, C.; Manousos, A. [Aristotle University of Thessaloniki, Thessaloniki (Greece); Ganesan, S.; Gurusamy, P.; Saxena, A. [Bhabha Atomic Research Centre (BARC), Mumbai (India); Griesmayer, E.; Jericha, E.; Leeb, H. [Atominstitut der Oesterreichischen Universitaeten, Technische Universitaet Wien, Wien (Austria); Jenkins, D.G.; Vermeulen, M.J. [University of York, York, Heslington (United Kingdom); Kaeppeler, F. [Karlsruhe Institute of Technology (KIT), Institut fuer Kernphysik, Karlsruhe (Germany); Lo Meo, S. [Istituto Nazionale di Fisica Nucleare, Bologna (Italy); ENEA, Bologna (Italy); Massimi, C.; Mingrone, F.; Vannini, G. [Dipartimento di Fisica, Universita di Bologna (IT); INFN, Bologna (IT); Mastinu, P. [Laboratori Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Legnaro (IT); Milazzo, P.M. [Istituto Nazionale di Fisica Nucleare, Trieste (IT); Mirea, M. [Horia Hulubei National Institute of Physics and Nuclear Engineering - IFIN HH, Magurele (RO); Musumarra, A. [Universita di Catania, Dipartimento di Fisica e Astronomia DFA, Catania (IT); INFN-Laboratori Nazionali del Sud, Catania (IT); Paradela, C. [European Commission JRC, Institute for Reference Materials and Measurements, Geel (BE); Universidade de Santiago de Compostela, Santiago de Compostela (ES); Pavlik, A. [Faculty of Physics, University of Vienna, Wien (AT); Rauscher, T. [University of Hertfordshire, Centre for Astrophysics Research, School of Physics, Astronomy and Mathematics, Hatfield (GB); University of Basel, Department of Physics, Basel (CH); Wallner, A. [Faculty of Physics, University of Vienna, Wien (AT); Australian National University, Research School of Physics and Engineering, Canberra (AU)

    2016-04-15

    The integral measurement of the {sup 12}C(n, p){sup 12}B reaction was performed at the neutron time-of-flight facility nTOF at CERN. The total number of {sup 12}B nuclei produced per neutron pulse of the nTOF beam was determined using the activation technique in combination with a time-of-flight technique. The cross section is integrated over the nTOF neutron energy spectrum from reaction threshold at 13.6 MeV to 10 GeV. Having been measured up to 1GeV on basis of the {sup 235}U(n, f) reaction, the neutron energy spectrum above 200 MeV has been re-evaluated due to the recent extension of the cross section reference for this particular reaction, which is otherwise considered a standard up to 200 MeV. The results from the dedicated GEANT4 simulations have been used to evaluate the neutron flux from 1 GeV up to 10 GeV. The experimental results related to the {sup 12}C(n, p){sup 12}B reaction are compared with the evaluated cross sections from major libraries and with the predictions of different GEANT4 models, which mostly underestimate the {sup 12}B production. On the contrary, a good reproduction of the integral cross section derived from measurements is obtained with TALYS-1.6 calculations, with optimized parameters. (orig.)

  14. Fotografia na Imprensa: conflitos na câmara escura

    Directory of Open Access Journals (Sweden)

    José Lúcio da Silva Menezes

    2014-07-01

    Full Text Available Este artigo recupera o teor ideológico do discurso que a Revista Veja elaborou sobre a classe trabalhadora que emergiu no cenário brasileiro, no final da década de 1970. O destaque dado aos trabalhadores como temática central resgatada, deve-se aos movimentos grevistas por eles encetados, após anos de ocultamento de sua resistência sob a repressão da ditadura civil-militar (1964-1985. Com a rebeldia operária, as matérias a respeito deste grupo, na Revista,foram se tornando mais constantes e visíveis, pois já não era mais possível, para a Revista Veja, ignorar a existência da classe operária que, com a força insurgente das greves, ocupava as ruas do Brasil.

  15. A intervenção da célula epitelial na asma

    Directory of Open Access Journals (Sweden)

    Anabela Mota Pinto

    2009-05-01

    Full Text Available Resumo: Faz-se uma revisão da intervenção da célula epitelial brônquica na fisiopatologia da asma. O epitélio que reveste as vias respiratórias actua como uma barreira física, separando o meio externo do meio interno pulmonar, controla a permeabilidade intercelular e transcelular, e, deste modo, a acessibilidade dos agressores inalantes às células apresentadoras de antigénio envolvidas na resposta imunoinflamatória. As células epiteliais unidas por tight junctions contribuem para a integridade das vias aéreas e expressam poliovirus receptor– related protein (PRR, toll like receptors (TLR e protease-activated receptors (PAR, que reconhecem agentes bacterianos e alergénios. A sua disfunção transforma-as em fonte de mediadores intervenientes na inflamação.A interacção bidireccional entre, por um lado, o epitélio e os elementos constitutivos do brônquio e por outro, as partículas inaladas, tem subjacente a formação de uma unidade, com identidade própria designada EMTU – epithelial mesenchymal trophic unit.Esta extensa intervenção coloca a célula epitelial no centro de acção da cronicidade e remodelação do processo asmático.As doenças infecciosas e o stress ambiental são capazes de induzir alterações a nível da célula epitelial susceptíveis de modificar a sua resposta a estimulações futuras, nomeadamente a ampliar a resposta a outras agressões infecciosas por acção sinérgica das vias de sinalização.O epitélio brônquico tem assim funções de barreira que lhe permite exercer uma permeabilidade selectiva, a nível intracelular e transcelular, é ainda metabolicamente activo pelas capacidade de produzir mediadores quimiotácticos e citocinas envolvidos no recrutamento e na activação celular, com repercussão na broncomotricidade e na remodelação da parede br

  16. Thermodynamic study of NaFe complex oxides. High temperature properties of Na sub 5 FeO sub 4 and Na sub 3 FeO sub 3

    CERN Document Server

    Furukawa, T

    2002-01-01

    In order to contribute the investigation into corrosion mechanism of the structural materials by leakage sodium, thermodynamic study of Na-Fe complex oxides formed by the reactions was carried out. Na sub 5 FeO sub 4 and Na sub 3 FeO sub 3 were used as the sample. Its high temperature properties (i.e. melting, solidification and transformation) were observed by Differential Scanning Calorimetry, DSC. Moreover, the original test named 'melting point confirmation test' was performed for the observation of traces of melting and solidification after the tests. Following contents have been obtained by this study. (1) Na sub 5 FeO sub 4 was stably as the solid without phase transformation and melting until 800degC. However, the compound was showing a tendency to change into Na sub 4 FeO sub 3 with temperature increasing under the low oxygen potential. (2) The stability of Na sub 3 FeO sub 3 is the same as that of Na sub 5 FeO sub 4 until 700degC. Over the temperature, the compound was changed differential compound ...

  17. 26 CFR 1.381(c)(12)-1 - Recovery of bad debts, prior taxes, or delinquency amounts.

    Science.gov (United States)

    2010-04-01

    ... delinquency amounts. 1.381(c)(12)-1 Section 1.381(c)(12)-1 Internal Revenue INTERNAL REVENUE SERVICE...(c)(12)-1 Recovery of bad debts, prior taxes, or delinquency amounts. (a) Carryover requirement. (1... corporation is entitled to the recovery of a bad debt, prior tax, or delinquency amount on account of which a...

  18. Metabolismo do cálcio na fenilcetonúria Calcium metabolism in phenilke

    Directory of Open Access Journals (Sweden)

    Fabiana Ferreira Martins

    2009-06-01

    Full Text Available A Fenilcetonúria é um erro inato do metabolismo do aminoácido fenilalanina. O tratamento é essencialmente dietético e envolve uma restrição severa no consumo de alimentos contendo aminoácido fenilalanina. Embora a alimentação seja complementada com fórmulas a fim de suprir as necessidades de vitaminas, minerais e aminoácidos essenciais, carências nutricionais ainda ocorrem. Isto se deve, principalmente, à restrição de fontes protéicas, que acarreta deficiência na ingestão de diversos nutrientes, dentre eles o cálcio. O cálcio possui importante relação com a formação mineral óssea. Estudos recentes demonstram que portadores de fenilcetonúria apresentam freqüentemente osteopenia e fraturas, sendo a maior incidência em crianças acima de 8 anos de idade. O rápido aumento da estatura, a dieta deficiente em cálcio e níveis de aminoácido fenilalanina elevados têm sido descritos como os principais fatores para a aquisição de massa óssea inadequada. A suplementação de cálcio em crianças saudáveis mostrou um efeito positivo sobre a aquisição de massa óssea na fase da pré-puberdade. Assim, torna-se relevante compreender a necessidade da suplementação de cálcio em pacientes fenilcetonúria, a fim de favorecer o desenvolvimento ósseo esperado.Phenylketonuria is an inborn error of the metabolism of the amino acid phenylalanine. The treatment is essentially dietetic and involves a severe restriction in the consumption of foods containing aminoacid phenylalanine. Although the diet is complemented with supplements in order to meet the vitamin, mineral and essential amino acid requirements, nutritional deficiencies still occur. This is mainly due to restricting the consumption of protein sources, which results in low intake of several nutrients, including calcium. Calcium is strongly related to bone mineral formation. Recent studies have demonstrated that patients with phenylketonuria often present osteopenia and

  19. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  20. DNA damage in isolated rat hepatocytes exposed to C.I. pigment orange 5 and C.I. pigment yellow 12 by the alkaline comet assay

    DEFF Research Database (Denmark)

    Møller, P; Wallin, Håkan; Grunnet, N

    1998-01-01

    The induction of DNA damage by commonly used printing ink pigments, C.I. pigment orange 5 (C.I. 12075) and C.I. pigment yellow 12 (C.I. 21090), was investigated in freshly isolated rat hepatocytes with the comet assay. C.I. pigment yellow 12 is a 3,3'-dichlorobenzidine-based diarylide pigment...

  1. O plágio, a cópia e a intertextualidade na produção acadêmica

    Directory of Open Access Journals (Sweden)

    Ivy Judensnaider

    2011-10-01

    Full Text Available 12pt; font-family: "Times New Roman"; mso-fareast-font-family: 'Times New Roman'; mso-ansi-language: PT-BR; mso-fareast-language: PT-BR; mso-bidi-language: AR-SA;">A ocorrência cada vez mais frequente do plágio nos trabalhos discentes enseja a discussão sobre a sua prática, em especial quando resultante da falta de compreensão sobre o real significado do caráter intertextual da produção acadêmica. Na investigação sobre os possíveis diálogos entre as várias camadas do texto cientifico, esse artigo procura estabelecer distância entre eles e a prática do plágio ou da cópia, assim o fazendo por meio da análise da construção de sentido a partir da leitura e da escrita como exercício da leitura de mundo e do processo dialógico entre discursos e sujeitos.

  2. Contribution to the study of {sup 12}C excited levels resulting from the reactions {sup 11}B (P/ {alpha}{sub 0}) and {sup 11}B (p, {alpha}{sub 1}); Contribution a l'etude des niveaux excites du {sup 12}C obtenus par les reactions {sup 11}B (p, {alpha}{sub 0}) et {sup 11}B (p, {alpha}{sub l})

    Energy Technology Data Exchange (ETDEWEB)

    Longequeue, J P [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1963-11-15

    This work is made up of two parts. In the first part the differential cross-sections have been determined of the reactions {sup 11}B (p,{alpha}) from 130 to 500 keV thus confirming, at the 163 keV resonance, the (2{sup +}) characteristics of the 16.11 MeV level of {sup 12}C. Furthermore, the experimental results in the neighbourhood of the 163 keV resonance can be explained by the interference of the {sup 12}C levels: 2{sup +} at 16.11 MeV and 1{sup -} at 17.23 MeV for the {alpha}{sub 0}, 2{sup +} at 16.11 MeV and 2{sup -} at 16.58 MeV for the {alpha}{sub 1}. In the second part the ({alpha}{sup -8Be}) disintegration process of {sup 12}C has been studied in the neighbourhood of the 16.11 MeV level. It is shown that, if the ({alpha}{sup -8Be}) mode of disintegration is preponderant outside the E{sub p} = 163 keV resonance, it is also preponderant at this same resonance; a direct disintegration of the {sup 12}C to 3 {alpha}, with an approximate magnitude of 40 per cent has however not been excluded. (author) [French] Ce travail comprend deux parties: Dans la premiere, on a determine la section efficace differentielle des reactions {sup 11}B (p,{alpha}) de 130 a 500 keV, confirmant, a la resonance de 163 keV, les caracteristiques (2{sup +}) du niveau de 16,11 MeV du {sup 12}C. En outre, les resultats experimentaux au voisinage de la resonance de 163 keV sont explicables par l'interference des niveaux du {sup 12}C: 2{sup +} a 16,11 MeV et 1{sup -} a 17,23 MeV pour les {alpha}{sub 0}, 2{sup +} a 16,11 MeV et 2{sup -} a 16,58 MeV pour les {alpha}{sub 1}. Dans la deuxieme partie, on a etudie le mode de desintegration ({alpha}{sup -8Be}) du {sup 12}C au voisinage du niveau de 16,11 MeV. On a montre que, si le mode de desintegration ({alpha}{sup -8Be}) est preponderant en dehors de la resonance E{sub p} = 163 keV, il est egalement preponderant a cette resonance; une desintegration directe en 3{alpha} du {sup 12}C, dont l'ordre de grandeur maximum serait de 40 pour cent, n'a

  3. Synthesis, structural and spectroscopic properties of acentric triple molybdate Cs{sub 2}NaBi(MoO{sub 4}){sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Savina, A.A. [Laboratory of Oxide Systems, Baikal Institute of Nature Management, SB RAS, Ulan-Ude 670047 (Russian Federation); Department of Chemistry, Buryat State University, Ulan-Ude 670000 (Russian Federation); Atuchin, V.V., E-mail: atuchin@isp.nsc.ru [Laboratory of Optical Materials and Structures, Rzhanov Institute of Semiconductor Physics, SB RAS, Novosibirsk 630090 (Russian Federation); Functional Electronics Laboratory, Tomsk State University, Tomsk 634050 (Russian Federation); Laboratory of Semiconductor and Dielectric Materials, Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Solodovnikov, S.F. [Laboratory of Crystal Chemistry, Nikolaev Institute of Inorganic Chemistry, SB RAS, Novosibirsk 630090 (Russian Federation); Department of Natural Sciences, Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Solodovnikova, Z.A. [Laboratory of Crystal Chemistry, Nikolaev Institute of Inorganic Chemistry, SB RAS, Novosibirsk 630090 (Russian Federation); Krylov, A.S. [Laboratory of Molecular Spectroscopy, Kirensky Institute of Physics, SB RAS, Krasnoyarsk 660036 (Russian Federation); Maximovskiy, E.A. [Laboratory of Epitaxial Layers, Nikolaev Institute of Inorganic Chemistry, SB RAS, Novosibirsk 630090 (Russian Federation); Laboratory of Research Methods of Composition and Structure of Functional Materials, Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Molokeev, M.S. [Laboratory of Crystal Structure, Kirensky Institute of Physics, SB RAS, Krasnoyarsk 660036 (Russian Federation); Oreshonkov, A.S [Laboratory of Molecular Spectroscopy, Kirensky Institute of Physics, SB RAS, Krasnoyarsk 660036 (Russian Federation); Department of Photonics and Laser Technology, Siberian Federal University, Krasnoyarsk 660079 (Russian Federation); Pugachev, A.M. [Laboratory of Condenced Matter Spectroscopy, Institute of Automation and Electrometry, SB RAS, Novosibirsk 90, 630090 (Russian Federation); and others

    2015-05-15

    New ternary molybdate Cs{sub 2}NaBi(MoO{sub 4}){sub 3} is synthesized in the system Na{sub 2}MoO{sub 4}–Cs{sub 2}MoO{sub 4}–Bi{sub 2}(MoO{sub 4}){sub 3}. The structure of Cs{sub 2}NaBi(MoO{sub 4}){sub 3} of a new type is determined in noncentrosymmetric space group R3c, a=10.6435(2), c=40.9524(7) Å, V=4017.71(13) Å{sup 3}, Z=12 in anisotropic approximation for all atoms taking into account racemic twinning. The structure is completely ordered, Mo atoms are tetrahedrally coordinated, Bi(1) and Bi(2) atoms are in octahedra, and Na(1) and Na(2) atoms have a distorted trigonal prismatic coordination. The Cs(1) and Cs(2) atoms are in the framework cavities with coordination numbers 12 and 10, respectively. No phase transitions were found in Cs{sub 2}NaBi(MoO{sub 4}){sub 3} up to the melting point at 826 K. The compound shows an SHG signal, I{sub 2w}/I{sub 2w}(SiO{sub 2})=5 estimated by the powder method. The vibrational properties are evaluated by Raman spectroscopy, and 26 narrow lines are measured. - Graphical abstract: - Highlights: • The crystal structure of Cs{sub 2}NaBi(MoO{sub 4}){sub 3} is defined. • The molybdate Cs{sub 2}NaBi(MoO{sub 4}){sub 3} is stable up to melting point at 826 K. • Vibrational properties of Cs{sub 2}NaBi(MoO{sub 4}){sub 3} are evaluated by Raman spectroscopy.

  4. Delineation of C12orf65-related phenotypes: a genotype-phenotype relationship.

    Science.gov (United States)

    Spiegel, Ronen; Mandel, Hanna; Saada, Ann; Lerer, Issy; Burger, Ayala; Shaag, Avraham; Shalev, Stavit A; Jabaly-Habib, Haneen; Goldsher, Dorit; Gomori, John M; Lossos, Alex; Elpeleg, Orly; Meiner, Vardiella

    2014-08-01

    C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis.We used whole-genome homozygosity mapping as well as exome sequencing and targeted gene sequencing to identify novel C12orf65 disease-causing mutations in seven affected individuals originating from two consanguineous families. In four family members affected with childhood-onset optic atrophy accompanied by slowly progressive peripheral neuropathy and spastic paraparesis, we identified a homozygous frame shift mutation c.413_417 delAACAA, which predicts a truncated protein lacking the C-terminal portion. In the second family, we studied three affected individuals who presented with early onset optic atrophy, peripheral neuropathy, and spastic gait in addition to moderate intellectual disability. Muscle biopsy in two of the patients revealed decreased activities of the mitochondrial respiratory chain complexes I and IV. In these patients, we identified a homozygous splice mutation, g.21043 T>A (c.282+2 T>A) which leads to skipping of exon 2. Our study broadens the phenotypic spectrum of C12orf65 defects and highlights the triad of optic atrophy, axonal neuropathy and spastic paraparesis as its key clinical features. In addition, a clear genotype-phenotype correlation is anticipated in which deleterious mutations which disrupt the GGQ-containing domain in the first coding exon are expected to result in a more severe phenotype, whereas down-stream C-terminal mutations may result in a more favorable phenotype, typically lacking cognitive impairment.

  5. Proton-induced $\\alpha$-cluster knockout from $^{12}$C

    CERN Document Server

    Cowley, A A; Förtsch, S V; Buthelezi, E Z; Neveling, R; Smit, F D; Steyn, G F; van Zyl, J J

    2010-01-01

    Results of a study of the (p, p ) reaction on 12C with polarized incident protons of 100 MeV are reviewed. Experimental cross section and analyzing power distributions are compared with predictions of a distorted wave impulse approximation (DWIA) theory. The theory reproduces the data reasonably well, suggesting that a quasifree knockout mechanism dominates the reaction. Spectroscopic information extracted from the cross section data is in agreement with a shell model prediction.

  6. Challenges of 13C/12C measurements by CF-IRMS of biochemical samples at sub-nanomolar levels

    International Nuclear Information System (INIS)

    Whiticar, M.J.; Eek, M.

    2001-01-01

    Recent refinements to instrumentation and methodology have facilitated measurement of 13 C/ 12 C of individual compounds within complex biogeochemical mixtures by CF-IRMS. Specific challenges such as instrument performance, effective compound partitioning, efficient combustion, effective water removal, and isotope effects during online preparation of gases are discussed and practical improvements are presented. (author)

  7. Development of positron emission tomography probe of 64Cu-labeled anti-C-kit 12A8 Fab to measure protooncogene C-kit expression

    International Nuclear Information System (INIS)

    Yoshida, Chisato; Tsuji, Atsushi B.; Sudo, Hitomi; Sugyo, Aya; Sogawa, Chizuru; Inubushi, Masayuki; Uehara, Tomoya; Fukumura, Toshimitsu; Koizumi, Mitsuru; Arano, Yasushi; Saga, Tsuneo

    2011-01-01

    Introduction: C-kit is an important diagnostic and therapeutic target molecule for several malignancies, and c-kit-targeted drugs have been used clinically. Because abundant c-kit expression in tumors is a prerequisite for successful c-kit-targeted therapy, imaging of c-kit expression is expected to play a pivotal role in the therapeutic decision for each patient. We evaluated 64 Cu-labeled Fab of anti-c-kit antibody 12A8 as a positron emission tomography (PET) imaging probe. Methods: 111 In- or 125 I-Labeled 12A8 Fab was evaluated in vitro by cell binding, competitive inhibition and cellular internalization assays, and in vivo by biodistribution in mice bearing c-kit-expressing and -non-expressing tumors. Next, Fab fragment was labeled with the positron emitter 64 Cu and evaluated by PET. Results: Radiolabeled 12A8 Fab showed specific binding to c-kit-expressing cells with high affinity and internalized into cells after binding to c-kit on cell surface. Although tumor accumulation of [ 111 In]Fab was lower than that of [ 111 In]IgG, the faster blood clearance of [ 111 In]Fab provided higher tumor-to-blood ratio at 6 h postinjection onwards. Blood clearance of 64 Cu-labeled 12A8 Fab was slower than that of [ 111 In]Fab, but PET using [ 64 Cu]Fab clearly visualized the tumor at 6 h postinjection onwards. Conclusion: The 64 Cu-labeled 12A8 Fab could be used for c-kit-specific PET imaging and might help in selecting appropriate patients for c-kit-targeted treatments.

  8. Bis-guanylhydrazone diimidazo[1,2-a:1,2-c]pyrimidine as a novel and specific G-quadruplex binding motif.

    Science.gov (United States)

    Sparapani, Silvia; Bellini, Stefania; Gunaratnam, Mekala; Haider, Shozeb M; Andreani, Aldo; Rambaldi, Mirella; Locatelli, Alessandra; Morigi, Rita; Granaiola, Massimiliano; Varoli, Lucilla; Burnelli, Silvia; Leoni, Alberto; Neidle, Stephen

    2010-08-21

    A bis-guanylhydrazone derivative of diimidazo[1,2-a:1,2-c]pyrimidine has unexpectedly been found to be a potent stabiliser of several quadruplex DNAs, whereas there is no significant interaction with duplex DNA. Molecular modeling suggests that the guanylhydrazone groups play an active role in quadruplex binding.

  9. An orthogonality condition model treatment of elastic and inelastic (α, 12C) scattering

    International Nuclear Information System (INIS)

    Suzuki, Y.; Imanishi, B.

    1981-02-01

    Elastic and inelastic scattering of α-particles on the deformed nucleus 12 C are investigated in the range of incident α-particle energies of 9 to 11 MeV by using the coupled-channel method with orthogonality condition. A doubly folded potential generated by the shell model wave functions of the α-particle and the deformed nucleus 12 C is employed for the relative motion between the α-particle and 12 C. Good agreement between theory and experiment is obtained for the elastic and inelastic angular distributions and the resonance structures. It is found, from the Born series expansion of the T-matrix, that the orthogonality constraint stresses the effects of the channel-coupling between the elastic and inelastic processes, and it indicates that the DWBA does not work well in this system. (author)

  10. Preparation of no-carrier-added [1-11C]ethylene and [1-11C]1,2-dibromoethane as new labelling agents

    International Nuclear Information System (INIS)

    Shah, F.; Pike, V.W.; Dowsett, K.

    1997-01-01

    A method is described for the preparation of NCA [1- 11 C] ethylene based on the passage of [1- 11 C]ethanol over heated (550 o C) quartz glass in a stainless steel tube (in preference to dehydration by catalysis on γ-alumina or pyrolysis). The [1- 11 C]ethanol is prepared from cyclotron-produced NCA [ 11 C]carbon dioxide by 11 C-carboxylation of methylmagnesium bromide, freshly prepared in dibutyl ether, and reduction of the adduct with lithium aluminium hydride in diglyme. The use of involatile solvents avoids the formation of carrier ethylene and radioactive and stable diethyl ether by cracking processes over the heated catalyst. The preparation takes 21 min from the end of radionuclide production and has a radiochemical yield of 44%, decay-corrected from [ 11 C]carbon dioxide. NCA [1- 11 C] ethylene is converted quantitatively into [1- 11 C]1,2-dibromoethane when collected in a solution of bromine in carbon tetrachloride. The NCA [1- 11 C]ethylene and [1- 11 C]1,2-dibromoethane may serve as new and useful labelling agents. (Author)

  11. Regulation of the Na(+)-K(+)-2Cl(-) cotransporter by cGMP/cGMP-dependent protein kinase I after furosemide administration.

    Science.gov (United States)

    Limmer, Franziska; Schinner, Elisabeth; Castrop, Hayo; Vitzthum, Helga; Hofmann, Franz; Schlossmann, Jens

    2015-10-01

    Sodium chloride reabsorption in the thick ascending limb of the loop of Henle is mediated by the Na(+)-K(+)-2Cl(-) cotransporter (NKCC2). The loop diuretic furosemide is a potent inhibitor of NKCC2. However, less is known about the mechanism regulating the electrolyte transporter. Considering the well-established effects of nitric oxide on NKCC2 activity, cGMP is likely involved in this regulation. cGMP-dependent protein kinase I (cGKI; PKGI) is a cGMP target protein that phosphorylates different substrates after activation through cGMP. We investigated the potential correlation between the cGMP/cGKI pathway and NKCC2 regulation. We treated wild-type (wt) and cGKIα-rescue mice with furosemide. cGKIα-rescue mice expressed cGKIα only under the control of the smooth muscle-specific transgelin (SM22) promoter in a cGKI deficient background. Furosemide treatment increased the urine excretion of sodium and chloride in cGKIα-rescue mice compared to that in wt mice. We analyzed the phosphorylation of NKCC2 by western blotting and immunostaining using the phosphospecific antibody R5. The administration of furosemide significantly increased the phosphorylated NKCC2 signal in wt but not in cGKIα-rescue mice. NKCC2 activation led to its phosphorylation and membrane translocation. To examine whether cGKI was involved in this process, we analyzed vasodilator-stimulated phosphoprotein, which is phosphorylated by cGKI. Furosemide injection resulted in increased vasodilator-stimulated phosphoprotein phosphorylation in wt mice. We hypothesize that furosemide administration activated cGKI, leading to NKCC2 phosphorylation and membrane translocation. This cGKI-mediated pathway could be a mechanism to compensate for the inhibitory effect of furosemide on NKCC2. © 2015 FEBS.

  12. Association between alcohol dehydrogenase 1C gene *1/*2 polymorphism and pancreatitis risk: a meta-analysis.

    Science.gov (United States)

    Fang, F; Pan, J; Su, G H; Xu, L X; Li, G; Li, Z H; Zhao, H; Wang, J

    2015-11-30

    Numerous studies have focused on the relationship be-tween alcohol dehydrogenase 1C gene (ADH1C) *1/*2 polymorphism (Ile350Val, rs698, also known as ADH1C *1/*2) and pancreatitis risk, but the results have been inconsistent. Thus, we conducted a meta-anal-ysis to more precisely estimate this association. Relevant publications were searched in several widely used databases and 9 eligible studies were included in the meta-analysis. Pooled odds ratios (ORs) and 95% confidence intervals (CIs) were calculated to evaluate the strength of the association. Significant associations between ADH1C *1/*2 poly-morphism and pancreatitis risk were observed in both overall meta-analysis for 12 vs 22 (OR = 1.53, 95%CI = 1.12-2.10) and 11 + 12 vs 22 (OR = 1.44, 95%CI = 1.07-1.95), and the chronic alcoholic pancre-atitis subgroup for 12 vs 22 (OR = 1.64, 95%CI = 1.17-2.29) and 11 + 12 vs 22 (OR = 1.53, 95%CI = 1.11-2.11). Significant pancreatitis risk variation was also detected in Caucasians for 11 + 12 vs 22 (OR = 1.45, 95%CI = 1.07-1.98). In conclusion, the ADH1C *1/*2 polymorphism is likely associated with pancreatitis risk, particularly chronic alcoholic pancreatitis risk, with the *1 allele functioning as a risk factor.

  13. Thermochemistry analyses for transformation of C6 glucose compound into C9, C12 and C15 alkanes using density functional theory

    Science.gov (United States)

    Verma, Anand Mohan; Kishore, Nanda

    2017-02-01

    The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.

  14. Measurements of π{sup ±}, K{sup ±}, p and p spectra in proton-proton interactions at 20, 31, 40, 80 and 158 GeV/c with the NA61/SHINE spectrometer at the CERN SPS

    Energy Technology Data Exchange (ETDEWEB)

    Aduszkiewicz, A.; Dominik, W.; Kuich, M.; Matulewicz, T.; Podlaski, P.; Posiadala, M.; Walewski, M. [University of Warsaw, Warsaw (Poland); Ali, Y.; Brzychczyk, J.; Larsen, D.; Planeta, R.; Richter-Was, E.; Staszel, P.; Wyszynski, O. [Jagiellonian University, Krakow (Poland); Andronov, E.; Feofilov, G.A.; Igolkin, S.; Kondratiev, V.P.; Kovalenko, V.; Merzlaya, A.; Seryakov, A.; Vechernin, V.V.; Vinogradov, L. [St. Petersburg State University, St. Petersburg (Russian Federation); Anticic, T.; Kadija, K.; Susa, T. [Ruder Boskovic Institute, Zagreb (Croatia); Baatar, B.; Bunyatov, S.A.; Kireyeu, V.A.; Kolesnikov, V.I.; Krasnoperov, A.; Lyubushkin, V.V.; Malakhov, A.I.; Matveev, V.; Melkumov, G.L.; Tereshchenko, V. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Baszczyk, M.; Dorosz, P.; Kucewicz, W.; Mik, L. [University of Science and Technology, Krakow (Poland); Bhosale, S.; Davis, N.; Kielbowicz, M.; Marcinek, A.; Ozvenchuk, V.; Rybicki, A. [H. Niewodniczanski Institute of Nuclear Physics of the Polish Academy of Sciences, Krakow (Poland); Blondel, A.; Bravar, A.; Damyanova, A.; Haesler, A.; Korzenev, A.; Ravonel, M. [University of Geneva, Geneva (Switzerland); Bogomilov, M.; Kolev, D.; Tsenov, R. [University of Sofia, Faculty of Physics, Sofia (Bulgaria); Brandin, A.; Selyuzhenkov, I.; Strikhanov, M.; Taranenko, A. [National Research Nuclear University (Moscow Engineering Physics Institute), Moscow (Russian Federation); Busygina, O.; Golubeva, M.; Guber, F.; Ivashkin, A.; Kurepin, A.; Sadovsky, A. [Institute for Nuclear Research, Moscow (Russian Federation); Cherif, H.; Deveaux, M.; Klochkov, V.; Koziel, M.; Renfordt, R.; Snoch, A.; Stroebele, H.; Toia, A. [University of Frankfurt, Frankfurt (Germany); Cirkovic, M.; Knezevic, N.; Manic, D.; Puzovic, J. [University of Belgrade, Belgrade (Serbia); Czopowicz, T.; Grebieszkow, K.; Mackowiak-Pawlowska, M.; Maksiak, B.; Slodkowski, M.; Tefelska, A.; Tefelski, D. [Warsaw University of Technology, Warsaw (Poland); Dembinski, H.; Engel, R.; Herve, A.E.; Mathes, H.J.; Roth, M.; Szuba, M.; Ulrich, R.; Unger, M.; Veberic, D. [Karlsruhe Institute of Technology, Karlsruhe (Germany); Dumarchez, J. [University of Paris VI and VII, LPNHE, Paris (France); Ereditato, A.; Francois, C.; Pistillo, C.; Wilkinson, C. [University of Bern, Bern (Switzerland); Fodor, Z. [Wigner Research Centre for Physics of the Hungarian Academy of Sciences, Budapest (Hungary); University of Wroclaw, Wroclaw (Poland); Garibov, A. [National Nuclear Research Center, Baku (Azerbaijan); Gazdzicki, M. [University of Frankfurt, Frankfurt (Germany); Jan Kochanowski University in Kielce, Kielce (Poland); Hylen, J.; Lundberg, B.; Marchionni, A.; Rameika, R.; Zwaska, R. [Fermilab, Batavia (United States); Johnson, S.R.; Marino, A.D.; Nagai, Y.; Rumberger, B.T.; Zimmerman, E.D. [University of Colorado, Boulder (United States); Kaptur, E.; Kowalski, S.; Lysakowski, B.; Pulawski, S.; Schmidt, K. [University of Silesia, Katowice (Poland); Kowalik, K.; Rondio, E.; Stepaniak, J. [National Centre for Nuclear Research, Warsaw (Poland); Laszlo, A.; Marton, K.; Vesztergombi, G. [Wigner Research Centre for Physics of the Hungarian Academy of Sciences, Budapest (Hungary); Lewicki, M.; Naskret, M.; Turko, L. [University of Wroclaw, Wroclaw (Poland); Messerly, B.; Paolone, V.; Wickremasinghe, A. [University of Pittsburgh, Pittsburgh (United States); Mills, G.B. [Los Alamos National Laboratory, Los Alamos (United States); Morozov, S.; Petukhov, O. [Institute for Nuclear Research, Moscow (Russian Federation); National Research Nuclear University (Moscow Engineering Physics Institute), Moscow (Russian Federation); Mrowczynski, S.; Rybczynski, M.; Seyboth, P.; Stefanek, G.; Wlodarczyk, Z.; Wojtaszek-Szwarc, A. [Jan Kochanowski University in Kielce, Kielce (Poland); Pavin, M. [Ruder Boskovic Institute, Zagreb (Croatia); University of Paris VI and VII, LPNHE, Paris (France); Popov, B.A. [University of Paris VI and VII, LPNHE, Paris (France); Joint Institute for Nuclear Research, Dubna (Russian Federation); Rauch, W. [Fachhochschule Frankfurt, Frankfurt (Germany); Roehrich, D. [University of Bergen, Bergen (Norway); Rustamov, A. [National Nuclear Research Center, Baku (Azerbaijan); University of Frankfurt, Frankfurt (Germany); Zambelli, L. [National Nuclear Research Center, Baku (Azerbaijan); University of Paris VI and VII, LPNHE, Paris (France); Collaboration: The NA61/SHINE Collaboration

    2017-10-15

    Measurements of inclusive spectra and mean multiplicities of π{sup ±}, K{sup ±}, p and p produced in inelastic p + p interactions at incident projectile momenta of 20, 31, 40, 80 and 158 GeV/c (√(s) = 6.3, 7.7, 8.8, 12.3 and 17.3 GeV, respectively) were performed at the CERN Super Proton Synchrotron using the large acceptance NA61/SHINE hadron spectrometer. Spectra are presented as function of rapidity and transverse momentum and are compared to predictions of current models. The measurements serve as the baseline in the NA61/SHINE study of the properties of the onset of deconfinement and search for the critical point of strongly interacting matter. (orig.)

  15. Nuclear Landau-Zener phenomena and the fusion cross sections in the system 13C + 16O → 12C + 17O

    International Nuclear Information System (INIS)

    Imanishi, B.; Oertzen, W. von.

    1990-07-01

    Reaction mechanism of the system 13 C+ 16 O- 12 C+ 17 O is investigated with the use of the nucleon molecular-orbital model in the framework of the orthogonalized coupled-reaction-channel (OCRC) theory. The adiabatic potentials obtained are quite different from the diagonal potentials of the original OCRC basis. The Landau-Zener radial coupling explains the backward enhancement of measured differential cross sections of the transfer reaction 13 C( 16 O, 17 O) 12 C. In the OCRC calculation the fusion cross sections of the channel 13 C+ 16 O is enhanced at low bombarding energies, in agreement with the experimental data. (author)

  16. Trends of 13C/12C ratios in pinyon tree rings of the American Southwest and the global carbon cycle

    International Nuclear Information System (INIS)

    Leavitt, S.W.; Long, A.

    1986-01-01

    An accurate atmospheric 13 C/ 12 C chronology can provide important constraints to models of the global carbon cycle. Trees accumulate carbon from atmospheric CO 2 into growth rings and offer potential for 13 C/ 12 C reconstructions, but results have not been reproducible. This paper presents δ 13 C curves from 5 sites, representing 20 pinyon (Pinus edulis) trees, where cores of 4 trees from each site have been pooled into a composite sample. Isotopic analysis of cellulose in 5-yr ring groups produces curves with a general trend of decreasing δ 13 C after 1800, but with pronounced short-term fluctuations superimposed upon the trend. Evidence indicates the fluctuations are strongly related to moisture availability (drought). A mean curve of the 5 δ 13 C chronologies from which the fossil-fuel component is subtracted suggests a substantial biospheric CO 2 contribution to the atmosphere since 1800

  17. Mineral-solution equilibria—III. The system Na 2OAl 2O 3SiO 2H 2OHCl

    Science.gov (United States)

    Popp, Robert K.; Frantz, John D.

    1980-07-01

    Chemical equilibrium between sodium-aluminum silicate minerals and chloride bearing fluid has been experimentally determined in the range 500-700°C at 1 kbar, using rapid-quench hydrothermal methods and two modifications of the Ag + AgCl acid buffer technique. The temperature dependence of the thermodynamic equilibrium constant ( K) for the reaction NaAlSi 3O 8 + HCl o = NaCl o + 1/2Al 2SiO 5, + 5/2SiO 2 + 1/2H 2O Albite Andalusite Qtz. K = (a NaCl o) /(a H 2O ) 1/2/(a HCl o) can be described by the following equation: log k = -4.437 + 5205.6/ T( K) The data from this study are consistent with experimental results reported by MONTOYA and HEMLEY (1975) for lower temperature equilibria defined by the assemblages albite + paragonite + quartz + fluid and paragonite + andalusite + quartz + fluid. Values of the equilibrium constants for the above reactions were used to estimate the difference in Gibbs free energy of formation between NaCl o and HCl o in the range 400-700°C and 1-2 kbar. Similar calculations using data from phase equilibrium studies reported in the literature were made to determine the difference in Gibbs free energy of formation between KCl o and HCl o. These data permit modelling of the chemical interaction between muscovite + kspar + paragonite + albite + quartz assemblages and chloride-bearing hydrothermal fluids.

  18. The 12C+α reaction rate from the elastic 16O breakup

    International Nuclear Information System (INIS)

    Kiener, J.; Kraus, L.; Lefebvre, A.; Mittig, W.; Motobayashi, T.; De Oliveira-Santos, F.; Stephan, C.; Thibaud, J.P.

    1997-01-01

    Evidence for direct elastic breakup of 16 O into the α- 12 C continuum with relative energies ranging from 900 to 1800 keV has been obtained in the scattering of 1527 MeV 16 O projectiles off 208 Pb. An interpretation of E2 breakup including nuclear and Coulomb contributions leads to reduced electromagnetic transition probabilities and astrophysical S E2 factors in reasonable agreement with direct measurements, showing that the method can be applied to extract the E2 part of the 12 C(α,γ) reaction rate. (orig.)

  19. High-lying 0+ and 3- levels in 12C

    International Nuclear Information System (INIS)

    Hanna, S.S.; Feldman, W.; Suffert, M.; Kurath, D.

    1982-01-01

    The γ decays of the levels at 17.77 and 18.36 MeV in 12 C are studied by proton capture and the assignments of (0 + ,1) and (3 - ,1), respectively, are confirmed. The very great strength of the decay of the (0 + ,1) level to the lower (1 + ,0) level at 12.71 MeV is consistent with a spin- and isospin-flip deuteronlike transition. The strong decay of the (3 - ,1) level to the lower (3 - 0,) level at 9.64 MeV is fairly typical of an analog to antianalog transition. The γ-decay widths of these levels are compared with shell-model calculations

  20. Effect of dietary salt intake on epithelial Na+ channels (ENaC) in vasopressin magnocellular neurosecretory neurons in the rat supraoptic nucleus.

    Science.gov (United States)

    Sharma, Kaustubh; Haque, Masudul; Guidry, Richard; Ueta, Yoichi; Teruyama, Ryoichi

    2017-09-01

    A growing body of evidence suggests that epithelial Na + channels (ENaCs) in the brain play a significant role in the regulation of blood pressure; however, the brain structures that mediate the effect are not well understood. Because vasopressin (VP) neurons play a pivotal role in coordinating neuroendocrine and autonomic responses to maintain cardiovascular homeostasis, a basic understanding of the regulation and activity of ENaC in VP neurons is of great interest. We show that high dietary salt intake caused an increase in the expression and activity of ENaC which resulted in the steady state depolarization of VP neurons. The results help us understand one of the mechanisms underlying how dietary salt intake affects the activity of VP neurons via ENaC activity. All three epithelial Na + channel (ENaC) subunits (α, β and γ) are located in vasopressin (VP) magnocellular neurons in the hypothalamic supraoptic (SON) and paraventricular nuclei. Our previous study demonstrated that ENaC mediates a Na + leak current that affects the steady state membrane potential in VP neurons. In the present study, we evaluated the effect of dietary salt intake on ENaC regulation and activity in VP neurons. High dietary salt intake for 7 days caused an increase in expression of β- and γENaC subunits in the SON and the translocation of αENaC immunoreactivity towards the plasma membrane. Patch clamp experiments on hypothalamic slices showed that the mean amplitude of the putative ENaC currents was significantly greater in VP neurons from animals that were fed a high salt diet compared with controls. The enhanced ENaC current contributed to the more depolarized basal membrane potential observed in VP neurons in the high salt diet group. These findings indicate that high dietary NaCl intake enhances the expression and activity of ENaCs, which augments synaptic drive by depolarizing the basal membrane potential close to the action potential threshold during hormonal demand. However