WorldWideScience

Sample records for msr abril 5b-1

  1. [Various report forms and letters regarding MSR Abril 5B-1

    Energy Technology Data Exchange (ETDEWEB)

    Various

    2007-08-16

    The documents described here and the following may be found at the Website of the State of California Department of Conservation, Division of Oil, Gas & Geothermal Resources, http://www.consrv.ca.gov/DOG/geothermal/unit_15/Unit15.htm. GEO Operator Corporation (formerly Thermogenics, Inc. and Geothermal Resources International Operator Corporation) drilled steam production and injection wells in the northwestern portion of The Geysers geothermal field from 1967 to 1985. These wells produced steam that was sold to PG&E's power plant 15. In 1989, the plant stopped operating so the wells stopped producing and GEO Operator Corporation went bankrupt. In 1997-1998, the U.S. Environmental Protection Agency and the Division of Oil, Gas, and Geothermal Resources, with funding from the California Energy Commission, plugged and abandoned most of these idle wells because of severe wellhead corrosion. Technical data and well cuttings were salvaged from an abandoned warehouse on the GEO Operator Corporation lease. These data have recently been scanned and added to the Division's existing scanned well records. The data are unique because GEO Operator Corporation performed an unusually high number of studies, well tests, and analyses. A total of over 10,300 pages and over 340 logs are included in the scans. The reservoir engineering section alone contains over 3,300 pages of reservoir characterization, well testing, and related studies. These data will be useful to the operators at The Geysers Geothermal field, as well as the public and researchers worldwide.

  2. 34 CFR 5b.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... maintained by the Department, including but not limited to the individual's education, financial transactions... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 5b.1 Section 5b.1 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.1 Definitions. As used in this part: (a...

  3. MSR implementation and progress

    Energy Technology Data Exchange (ETDEWEB)

    McKensey, B.; Ellicott, C.; Webb, N. [NSW Department of Mineral Resources, Sydney, NSW (Australia). Coal Mining Inspectorate and Engineering

    1998-12-31

    In November 1996 the NSW Minister for Mineral Resources, commissioned a review of safety within the New South Wales mining industry, as a response to a disturbing number of fatalities during the Minister`s term of office together with a number of alarming near misses. ACiL were given the following terms of reference for the Mine Safety Review (MSR): identify key issues which need to be addressed before a significant and measurable improvement in mine safety performance can be expected; explore options for addressing these key issues, through consultation; consider how the findings of the Warden`s Court Inquiry into the 1994 Moura Mine disaster should be applied in New South Wales; evaluate the role, activities, structure, employment conditions, and resourcing of the State`s Mines Inspectorates; evaluate existing legislative provisions in the light of the identified key issues; and provide Government with recommendations on how mine safety in New South Wales could be enhanced, with particular regard to the Inspectorates. The ACiL report titled `Review of Mine Safety in NSW` was tabled in Parliament by the Ministry in April 1997. The review considered industry safety performance and its measurement through considering available statistics, drawing on submissions and, predominantly seeking the views of a broad cross section of industry and Government personnel. This included mine managers, inspectors, union officials and the workforce. In its report, the MSR makes numerous observations concerning issues of safety and the mining industry. Arising from those observations the review made 44 recommendations for either consideration or action to address the issues identified. 2 refs., 1 fig.

  4. 17 CFR 270.5b-1 - Definition of “total assets.”

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.5b-1 Definition of “total assets... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âtotal assets.â..., shall mean the gross assets of the company with respect to which the computation is made, taken as of...

  5. A NEW CELL CLONE DERIVED FROM TRICHOPLUSIA NI TN5B1-4 CELLS

    Institute of Scientific and Technical Information of China (English)

    Jian-xiaoTian; Chang-youLi; Gui-lingZheng; Guo-xunLi; PingWang; Granados

    2004-01-01

    The characteristics of a cultured cell line do not always remain stable and may change upon continuous passage. Most continuous cell lines, even after cloning, possess several genotypes that are constantly changing. There are numerous selective and adaptive culture processes, in addition to genetic instability, that may improve phenotypic change in cell growth, virus susceptibility, gene expression, and production of virus. Similar detrimental effects of long term passaging of insect cells have also been reported for continuous cell lines, for example, Tn5B 1-4 cells, which are the most widely used for the baculovirus expression vector system (BEVS), provide superior production of recombinant proteins,however, this high productivity may be more evident in low passage cells. In this paper, we describe the isolation of a cell clone, Tn5B-40, from low passage Tn5B 1-4 cells. The growth characteristics,productions of virus, and high level of recombinant protein productions were determined. The results showed the susceptibility of both clone and Tn5B 1-4 cells to wild-type AcNPV was approximately the same rate with over 95% of infection; when the cloned cells were infected with recombinant baculoviruses expressing β-galactosidase and secreted alkaline phosphatase (SEAP), expression of the recombinant proteins from the cloned cells exceeded that from the parental Tn5B 1-4 cells.

  6. Data of evolutionary structure change: 1CF5B-1RTCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CF5B-1RTCA 1CF5 1RTC B A --------DVNFDLSTATAKTYTKFIEDFRATL-PFSHK...A 211 1RTC A 1RTCA...ain> 1RTC A 1RTCA SALYYYSTGGTQLPT...pdbChain> 1RTCA MRTRIRYNRRSA HHHHHH 1RTCA AYFFH-PDNQE

  7. The influence of alloying elements in aluminium on the grain refinement with ALTI5B1

    Directory of Open Access Journals (Sweden)

    Naglič I.

    2009-07-01

    Full Text Available This work deals with the influence of alloying elements in aluminium on the grain refinement with various additions of AlTi5B1. Grain-refinement tests were made at a cooling rate of 15 °C/s. The results revealed that in both aluminium and an Al-Fe alloy the grain size decreases with increasing additions of the AlTi5B1 grain refiner. We found that for the same boron content the grain size was smaller in the case of the Al-Fe alloy. The difference in the grain sizes for the same content of boron was approximately 15 μm; this is considerably smaller than the difference between the grain sizes in samples with the same difference of growth-restricting factor made at slower cooling rates.

  8. Modular Stellarator Fusion Reactor (MSR) concept

    International Nuclear Information System (INIS)

    Miller, R.L.; Krakowski, R.A.

    1981-01-01

    A preliminary conceptual study has been made of the Modulator Stellarator Reactor (MSR) as a stedy-state, ignited, DT-fueled, magnetic fusion reactor. The MSR concept combines the physics of classic stellarator confinement with an innovative, modular-coil design. Parametric tradeoff calculations are described, leading to the selection of an interim design point for a 4.8-GWt plant based on Alcator transport scaling and an average beta value of 0.04 in an l = 2 system with a plasma aspect ratio of 11. Neither an economic analysis nor a detailed conceptual engineering design is presented here, as the primary intent of this scoping study is the elucidation of key physics tradeoffs, constraints, and uncertainties for the ultimate power-reactor embodiment

  9. MSR Founders Narrative and Content Analysis of Scholarly Papers

    DEFF Research Database (Denmark)

    Tackney, Charles T.; Chappell, Stacie F.; Sato, Toyoko

    2017-01-01

    This is a founders’ narrative and research paper content analysis of the first 15 years of the Management Spirituality and Religion Interest Group (MSR) of the Academy of Management. Based on archival data and founder interviews, our inquiry recounts how the early collaborators established......: a corpus epitomizing MSR research and practice. The combined study is a benchmark of founding and institutionalization for current and potential MSR members. By tracing the research trends MSR has taken in light of the founding aspirations, we illuminate the distinctive values, tensions, and meanings...

  10. Radionuclides release possibility analysis of MSR at various accident conditions

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Choong Wie; Kim, Hee Reyoung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    There are some accidents which go beyond our expectation such as Fukushima Daiichi nuclear disaster and amounts of radionuclides release to environment, so more effort and research are conducted to prevent it. MSR (Molten Salt Reactor) is one of GEN-IV reactor types, and its coolant and fuel are mixtures of molten salt. MSR has a schematic like figure 1 and it has different features with the solid fuel reactor, but most important and interesting feature of MSR is its many safety systems. For example, MSR has a large negative void coefficient. Even though power increases, the reactor slows down soon. Radionuclides release possibility of MSR was analyzed at various accident conditions including Chernobyl and Fukushima ones. The MSR was understood to prevent the severe accident by the negative reactivity coefficient and the absence of explosive material such as water at the Chernobyl disaster condition. It was expected to contain fuel salts in the reactor building and not to release radionuclides into environment even if the primary system could be ruptured or broken and fuel salts would be leaked at the Fukushima Daiichi nuclear disaster condition of earthquake and tsunami. The MSR, which would not lead to the severe accident and therefore prevents the fuel release to the environment at many expected scenarios, was thought to have priority in the aspect of accidents. A quantitative analysis and a further research are needed to evaluate the possibility of radionuclide release to the environment at the various accident conditions based on the simple comparison of the safety feature between MSR and solid fuel reactor.

  11. Management, Spirituality, and Religion (MSR) Ways and Means

    DEFF Research Database (Denmark)

    Tackney, Charles Thomas; Chappell, Stacie F.; Harris, Dan

    2017-01-01

    Despite 15 years of functioning as an interest group, our domain of inquiry is relatively young and there are limited theoretical boundaries to support, shape, and assist our efforts. This metaphorical “blank canvas” is both empowering, in that so many inquiries are open for exploration, and yet...... also limiting. In this document we highlight three critical elements to emphasize their importance in MSR research: (a) delineating and operationalizing the key terms of religion, spirituality, and workplace spirituality; (b) acknowledging the work to date in the MSR corpus around definitions...

  12. Estadísticas culturales de Colombia: abril de 1967

    Directory of Open Access Journals (Sweden)

    Fernán Torres León

    1967-04-01

    Full Text Available El documento presenta un cuadro comparativo de las actividades culturales del pais, así como las exposiciones de artes plasticas y otras inauguradas, recitales poéticos, conciertos y recitales de música, libros de autores colombianos publicados y representaciones teatrales realizadas en el pais en el mes de abril de 1967

  13. El 9 de Abril y su contexto internacional

    Directory of Open Access Journals (Sweden)

    Pierre Gilhodes

    1986-01-01

    Full Text Available Los acontecimientos del 9 de abril de 1948 en Bogotá son vistos no tanto en sus aspectos internos, sino que se les muestra con las posibles conexiones e influencias de la situación social de agitación existente en otros países latinoamericanos y la guerra fría a nivel mundial.

  14. Preliminary Study for Radioactivity Evaluation of MSR compared with LWR

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Geun Hyeong; Kim, Hee Reyoung [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2014-05-15

    LWR uses fuel as {sup 235}U and fissile material as solid (enriched uranium). Those cannot control its component artificially and hard to change fuel frequently. Therefore this fuel remains as much as possible. That makes risk of high radiation leakage because of long neutron irradiation time. On the other hand, MSR (Molten Salt Reactor) uses fuel as thorium-uranium; fissile {sup 233}U when {sup 232}Th absorbs one neutron, and fissile material as liquid (molten salt). It has plenty of benefits respect to radioactive safety. It leads nuclear fuel dump when accident happens, diminishes basic fission substances' radiation and even the cost (Th exist 3∼4 times more on the earth compared with natural uranium). Source term is much lower than conventional LWR in order to processing time. Radiation exposure from volatile fission products in severe accidents is thought to be negligible due to the continuous removal mechanism. The generation of high level radioactive wastes from MSR is estimated to be much smaller than that of conventional LWR because of its less converting probability of thorium to minor actinides. It was thought the fundamental approach to MSR would make it possible to realize the safety of reactor when considering the severe accidents affecting on nuclear power plants due to natural disaster.

  15. Preliminary Study for Radioactivity Evaluation of MSR compared with LWR

    International Nuclear Information System (INIS)

    Lee, Geun Hyeong; Kim, Hee Reyoung

    2014-01-01

    LWR uses fuel as 235 U and fissile material as solid (enriched uranium). Those cannot control its component artificially and hard to change fuel frequently. Therefore this fuel remains as much as possible. That makes risk of high radiation leakage because of long neutron irradiation time. On the other hand, MSR (Molten Salt Reactor) uses fuel as thorium-uranium; fissile 233 U when 232 Th absorbs one neutron, and fissile material as liquid (molten salt). It has plenty of benefits respect to radioactive safety. It leads nuclear fuel dump when accident happens, diminishes basic fission substances' radiation and even the cost (Th exist 3∼4 times more on the earth compared with natural uranium). Source term is much lower than conventional LWR in order to processing time. Radiation exposure from volatile fission products in severe accidents is thought to be negligible due to the continuous removal mechanism. The generation of high level radioactive wastes from MSR is estimated to be much smaller than that of conventional LWR because of its less converting probability of thorium to minor actinides. It was thought the fundamental approach to MSR would make it possible to realize the safety of reactor when considering the severe accidents affecting on nuclear power plants due to natural disaster

  16. Emamectin benzoate induces ROS-mediated DNA damage and apoptosis in Trichoplusia Tn5B1-4 cells.

    Science.gov (United States)

    Luan, Shaorong; Yun, Xinming; Rao, Wenbing; Xiao, Ciying; Xu, Zhikang; Lang, Jialin; Huang, Qingchun

    2017-08-01

    Emamectin benzoate (EMB), a novel macrocyclic lactone insecticide, possesses high efficacy and beneficial selective toxicity in agriculture, but so far the EMB-induced cytotoxic action in arthropod insect remains unclear. The present studies were carried out to characterize the property of EMB on the induction of reactive oxygen species (ROS)-mediated DNA damage and apoptosis in Trichoplusia Tn5B1-4 cell model. Following the exposure to EMB at 2.5, 5, 10 or 15 μM, the cells changed to be round, suspended and aggregated, and the decline of cell proliferating ability and cell viability was positively related with the exposure time. Median inhibitory concentration (IC 50 ) of EMB on cell viability was 3.72 μM during 72 h exposure. Apoptosis was induced in 29.8% (24 h) and 39.5% (48 h) of the cells by EMB at 15 μM, showing chromatin condensation in nuclei. The content of ROS in the cells increased rapidly as the concentration of EMB increased, and the pre-incubation of the cells with vitamin E significantly reduced the ROS accumulation. In the treatment of 15 μM EMB, the migrated cell nucleus with DNA strand breaks appeared a teardrop, pear-shaped, or large fan-like tail, and 63.1% of γH2AX-positive cells contained more than four foci, accompanying with high expression level of caspase-3 in time-dependent manner, which consequently led to cell apoptotic death. These evidences in ROS-mediated DNA damage and cell apoptosis induced by EMB may be helpful for deep understanding the cytotoxic action of EMB based on cell model. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Parametric systems analysis of the Modular Stellarator Reactor (MSR)

    International Nuclear Information System (INIS)

    Miller, R.L.; Krakowski, R.A.; Bathke, C.G.

    1982-05-01

    The close coupling in the stellarator/torsatron/heliotron (S/T/H) between coil design (peak field, current density, forces), magnetics topology (transform, shear, well depth), and plasma performance (equilibrium, stability, transport, beta) complicates the reactor assessment more so than for most magnetic confinement systems. In order to provide an additional degree of resolution of this problem for the Modular Stellarator Reactor (MSR), a parametric systems model has been developed and applied. This model reduces key issues associted ith plasma performance, first-wall/blanket/shield (FW/B/S), and coil design to a simple relationship between beta, system geometry, and a number of indicators of overall plant performance. The results of this analysis can then be used to guide more detailed, multidimensional plasma, magnetics, and coil design efforts towards technically and economically viable operating regimes. In general, it is shown that beta values > 0.08 may be needed if the MSR approach is to be substantially competitive with other approaches to magnetic fusion in terms of system power density, mass utilization, and cost for total power output around 4.0 GWt; lower powers will require even higher betas

  18. Ecdysone Induction of MsrA Protects Against Oxidative Stress in Drosophila

    Energy Technology Data Exchange (ETDEWEB)

    Roesijadi, Guri; Rezvankhah, Saeid; Binninger, David M.; Weissbach, Herbert

    2007-03-09

    The methionine sulfoxide reductases MsrA and MsrB reduce Met(O) to Met in epimer-specific fashion. In Drosophila, the major ecdysone induced protein is MsrA, which is regulated by the EcR-USP complex. We tested Kc cells for induction of MsrA, MsrB, EcR. and CAT by ecdysone and found that MsrA and the EcR were induced by ecdysone, but MsrB and CAT were not. When we tested for resistance to 20 mM H2O2 toxicity, viability of Kc cells was reduced threefold. After pretreatment with 0.2 μM ecdysone for 48 h, then exposed to H2O2, viability of Kc cells increased to 77% of controls. The EcR-deficient L57-3-11 knockout line was not responsive to ecdysone, and H2O2 resistance of both control and ecdysone-treated L57-3-11 cells was similar to that of the ecdysone-untreated Kc cells. These results show that hormonal regulation of MsrA is implicated in conferring protection against oxidative stress in the Drosophila model.

  19. Mechanism study of freeze-valve for molten salt reactor (MSR)

    International Nuclear Information System (INIS)

    Qinhua, Zhang

    2014-01-01

    Molten salt reactor (MSR) is one of the fourth generation nuclear reactor, ordinary nuclear grade valve is unsuitable for MSR due to its special coolant and extraordinary working temperature. Freeze-valve is proposed as the most appropriate valve for MSR, but the technology issue about freeze-valve has not been report in recent decades. Its significance to test the comprehensive property of freeze-valve for the application in MSR. A high temperature molten salt test loop was built which the physics property of salt is similar to the coolant of MSR. The results indicate that freeze-valve has a good performance use in the molten salt circumstances of high temperature (max 700 deg. C) and strong corrosion (authors)

  20. Estudio Descriptivo del Programa “Hatos Libres de Brucelosis” de FEDEGAN Tunja periodo abril 2008 - abril 2009

    Directory of Open Access Journals (Sweden)

    Nadia Esperanza Divantoque, Julio Roberto Sánchez, Juber Oswaldo Bernal y Martin Orlando Pulido

    2011-11-01

    Full Text Available El establecimiento de fincas con ganaderías libres de  brucelosis  es  una  estrategia  diseñada  en  el ámbito mundial para avanzar en  la prevención, control  y  erradicación  de  la  brucelosis  y,  así mismo, cumplir con requisitos para el comercio internacional  de productos  y  subproductos  de origen bovino. Colombia se encuentra ante  la OIE, como uno de  los países con enfermedad clínica demostrada, por  tal razón se han creado campañaspara  la  erradicación  de  esta  enfermedad. FEDEGAN ha hecho esfuerzos conjuntos con sus planes  sanitarios  de  vacunación  y  creación  de organismos de  inspección en el control de esta enfermedad. En Boyacá se ha creado un proyecto piloto, en el cual se realiza un análisis sanitario de la  situación  de  la  brucelosis mediante pruebasdiagnósticas, como  son: Rosa de Bengala  (RB, ElisaIndirecta  (EI y Elisa Competitiva  (EC. En el periodocomprendido entre abril de 2008 y abril de 2009 se muestrearon  1910  animales  en  41  fincas ubicadas en las provincias de Centro, Tundama y Sugamuxi, en las cuales el 98.8% de los bovinos muestreados fueron hembras y el 1.2% machos, encontrándose en éstos una positividad  ante  la prueba RB del 2.9%, ante la prueba EI un 0.8% y ante  la prueba EC un 2.8% de positividad, conuna  prevalencia  de  0.73%  en  la  población analizada.Palabras clave: brucelosis, rosa de Bengala, Elisa indirecta, Elisa competitiva.

  1. A unified form of exact-MSR codes via product-matrix frameworks

    KAUST Repository

    Lin, Sian Jheng

    2015-02-01

    Regenerating codes represent a class of block codes applicable for distributed storage systems. The [n, k, d] regenerating code has data recovery capability while possessing arbitrary k out of n code fragments, and supports the capability for code fragment regeneration through the use of other arbitrary d fragments, for k ≤ d ≤ n - 1. Minimum storage regenerating (MSR) codes are a subset of regenerating codes containing the minimal size of each code fragment. The first explicit construction of MSR codes that can perform exact regeneration (named exact-MSR codes) for d ≥ 2k - 2 has been presented via a product-matrix framework. This paper addresses some of the practical issues on the construction of exact-MSR codes. The major contributions of this paper include as follows. A new product-matrix framework is proposed to directly include all feasible exact-MSR codes for d ≥ 2k - 2. The mechanism for a systematic version of exact-MSR code is proposed to minimize the computational complexities for the process of message-symbol remapping. Two practical forms of encoding matrices are presented to reduce the size of the finite field.

  2. A unified form of exact-MSR codes via product-matrix frameworks

    KAUST Repository

    Lin, Sian Jheng; Chung, Weiho; Han, Yunghsiangsam; Al-Naffouri, Tareq Y.

    2015-01-01

    Regenerating codes represent a class of block codes applicable for distributed storage systems. The [n, k, d] regenerating code has data recovery capability while possessing arbitrary k out of n code fragments, and supports the capability for code fragment regeneration through the use of other arbitrary d fragments, for k ≤ d ≤ n - 1. Minimum storage regenerating (MSR) codes are a subset of regenerating codes containing the minimal size of each code fragment. The first explicit construction of MSR codes that can perform exact regeneration (named exact-MSR codes) for d ≥ 2k - 2 has been presented via a product-matrix framework. This paper addresses some of the practical issues on the construction of exact-MSR codes. The major contributions of this paper include as follows. A new product-matrix framework is proposed to directly include all feasible exact-MSR codes for d ≥ 2k - 2. The mechanism for a systematic version of exact-MSR code is proposed to minimize the computational complexities for the process of message-symbol remapping. Two practical forms of encoding matrices are presented to reduce the size of the finite field.

  3. MSR (Pu converters) and MSBRs in commercial nuclear power stations

    International Nuclear Information System (INIS)

    Reichle, L.F.C.

    1977-01-01

    Molten Salt Reactors are likely to be the best way to achieve lowest-cost, safe, reliable and environmentally compatible commercial nuclear power in the early 1990's. This conclusion is based on work performed by the industrial members of the U.S. Molten Salt Group and by the Oak Ridge National Laboratory - both of whom are in general agreement on the status and prospects of Molten Salt Reactor technology. The MSBR Development Program is a 14-year program comprised of a 250 MWe MSTR (Molten Salt Test Reactor), a 1,000 MWe MSBR (Molten Salt Breeder Reactor) Demonstration Plant, and related development work. Plutonium from LWRs will fuel MSR (Pu Converters) which, in turn, will produce U-233 to fuel MSBRs. Because of the low inventory of fissile material in MSRs, a given amount of Pu will start-up many more MSRs than LMFBRs or GCFRs. MSRs can be expected to produce energy at a cost that will be competitive with LWRs before LMFBRs or GCFRs. They will use less uranium and require less enrichment. They will have a much lower development cost. They have the potential of producing high-temperature process heat. MSRs use a fluid fuel, and therefore eliminate the high cost of fuel fabrication. They have on-stream refueling and high thermal efficiency. They will have construction costs comparable to LWRs. MSRs have relative safety and environmental advantages, such as no possibility of a LOCA, low inventory of fissile material, continuous removal of fission products and on-site storage of spent fuel wastes

  4. Metasurface Reflector (MSR Loading for High Performance Small Microstrip Antenna Design.

    Directory of Open Access Journals (Sweden)

    Md Rezwanul Ahsan

    Full Text Available A meander stripline feed multiband microstrip antenna loaded with metasurface reflector (MSR structure has been designed, analyzed and constructed that offers the wireless communication services for UHF/microwave RFID and WLAN/WiMAX applications. The proposed MSR assimilated antenna comprises planar straight forward design of circular shaped radiator with horizontal slots on it and 2D metasurface formed by the periodic square metallic element that resembles the behavior of metamaterials. A custom made high dielectric bio-plastic substrate (εr = 15 is used for fabricating the prototype of the MSR embedded planar monopole antenna. The details of the design progress through numerical simulations and experimental results are presented and discussed accordingly. The measured impedance bandwidth, radiation patterns and gain of the proposed MSR integrated antenna are compared with the obtained results from numerical simulation, and a good compliance can be observed between them. The investigation shows that utilization of MSR structure has significantly broadened the -10 dB impedance bandwidth than the conventional patch antenna: from 540 to 632 MHz (17%, 467 to 606 MHz (29% and 758 MHz to 1062 MHz (40% for three distinct operating bands centered at 0.9, 3.5 and 5.5 GHz. Additionally, due to the assimilation of MSR, the overall realized gains have been upgraded to a higher value of 3.62 dBi, 6.09 dBi and 8.6 dBi for lower, middle and upper frequency band respectively. The measured radiation patterns, impedance bandwidths (S11<-10 dB and gains from the MSR loaded antenna prototype exhibit reasonable characteristics that can satisfy the requirements of UHF/microwave (5.8 GHz RFID, WiMAX (3.5/5.5 GHz and WLAN (5.2/5.8 GHz applications.

  5. Remelting of aluminium with the addition of AlTi5B1 and AlTi3C0,15 grain refiners

    Directory of Open Access Journals (Sweden)

    Dobešrek, M.

    2008-04-01

    Full Text Available It was found that concentration of boron in aluminium with the addition of AlTi5B1 grain refiner is decreasing during remelting as a consequence of TiB2 particles settling down due to gravity. TiB2 particles remained in aluminium after four remelts shows lower effect of grain refinement compared to non-remelted samples with the same TiB2 content. It was also found that TiC particles are still present in aluminium with the addition of AlTi3C0,15 grain refiner after four remelts and they probably participate in nucleation of α-Al grains.

  6. The influence of stirring on the fading of the AlTi5B1 grain refiner in an Al–Fe alloy

    Directory of Open Access Journals (Sweden)

    I. Naglič

    2011-01-01

    Full Text Available An Al–Fe alloy, melted in an induction furnace with a graphite crucible, was grain refined with the AlTi5B1 grain refiner. The melt was stirred after the addition of the grain refiner. The first sample was cast two minutes after the addition of the grain refiner and the second sample fifteen minutes after the addition of the grain refiner. The melt was stirred again before the third sample was cast. The grain size was found to increase with the holding time. However, the grain size of the third sample, after stirring, decreased to a similar size to that of the first sample. The results indicate that the stirring of a grain-refined melt can restore the grain-refinement effect.

  7. System design description of forced-convection molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4

    International Nuclear Information System (INIS)

    Huntley, W.R.; Silverman, M.D.

    1976-11-01

    Molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4 are high-temperature test facilities designed to evaluate corrosion and mass transfer of modified Hastelloy N alloys for future use in Molten-Salt Breeder Reactors. Salt is circulated by a centrifugal sump pump to evaluate material compatibility with LiF-BeF 2 -ThF 4 -UF 4 fuel salt at velocities up to 6 m/s (20 fps) and at salt temperatures from 566 to 705 0 C (1050 to 1300 0 F). The report presents the design description of the various components and systems that make up each corrosion facility, such as the salt pump, corrosion specimens, salt piping, main heaters, salt coolers, salt sampling equipment, and helium cover-gas system, etc. The electrical systems and instrumentation and controls are described, and operational procedures, system limitations, and maintenance philosophy are discussed

  8. Metasurface Reflector (MSR) Loading for High Performance Small Microstrip Antenna Design.

    Science.gov (United States)

    Ahsan, Md Rezwanul; Islam, Mohammad Tariqul; Ullah, Mohammad Habib; Singh, Mandeep Jit; Ali, Mohd Tarmizi

    2015-01-01

    A meander stripline feed multiband microstrip antenna loaded with metasurface reflector (MSR) structure has been designed, analyzed and constructed that offers the wireless communication services for UHF/microwave RFID and WLAN/WiMAX applications. The proposed MSR assimilated antenna comprises planar straight forward design of circular shaped radiator with horizontal slots on it and 2D metasurface formed by the periodic square metallic element that resembles the behavior of metamaterials. A custom made high dielectric bio-plastic substrate (εr = 15) is used for fabricating the prototype of the MSR embedded planar monopole antenna. The details of the design progress through numerical simulations and experimental results are presented and discussed accordingly. The measured impedance bandwidth, radiation patterns and gain of the proposed MSR integrated antenna are compared with the obtained results from numerical simulation, and a good compliance can be observed between them. The investigation shows that utilization of MSR structure has significantly broadened the -10 dB impedance bandwidth than the conventional patch antenna: from 540 to 632 MHz (17%), 467 to 606 MHz (29%) and 758 MHz to 1062 MHz (40%) for three distinct operating bands centered at 0.9, 3.5 and 5.5 GHz. Additionally, due to the assimilation of MSR, the overall realized gains have been upgraded to a higher value of 3.62 dBi, 6.09 dBi and 8.6 dBi for lower, middle and upper frequency band respectively. The measured radiation patterns, impedance bandwidths (S11WLAN (5.2/5.8 GHz) applications.

  9. El ritmo de intensidad en La rosa escrita de Xavier Abril

    Directory of Open Access Journals (Sweden)

    Óscar Coello

    2011-07-01

    Full Text Available Luego de las aventuras rítmicas practicadas por Abril en las más audaces posiciones de vanguardia, se produce una abjuración insólita –explicada luego metatextualmente– en la poiesis del artista, que lo regresa a los cauces de la elaboración versal tradicional. La rosa escrita es el poemario más emblemático de este retorno. La presente ponencia ejemplifica en un texto, a través del ritmo de intensidad, los pormenores de esta redención.Palabras claves: Xavier Abril, La rosa escrita, Vanguardia, ritmo.

  10. The molten salt reactors (MSR) pyro chemistry and fuel cycle for innovative nuclear systems

    International Nuclear Information System (INIS)

    Brossard, Ph.; Garzenne, C.; Mouney, H.

    2002-01-01

    In the frame of the studies on next generation nuclear systems, and especially for the molten salt reactors and for the integrated fuel cycle (as IFR), the fuel cycle constraints must be taken into account in the preliminary studies of the system to improve the cycle and reactor optimisation. Among the purposes for next generation nuclear systems, sustainability and waste (radio-toxicity and mass) management are important goals. These goals imply reprocessing and recycling strategies. The objectives of this workshop are to present and to share the different strategies and scenarios, the needs based on these scenarios, the experimental facilities available today or in the future and their capabilities, the needs for demonstration. It aims at: identifying the needs for fuel cycle based on solid fuel or liquid fuel, and especially, the on-line reprocessing or clean up for the molten salt reactors; assessing the state-of-the-art on the pyro-chemistry applied to solid fuel and to present the research activities; assessing the state-of-the-art on liquid fuels (or others), and to present the research activities; expressing the R and D programs for pyro-chemistry, molten salt, and also to propose innovative processes; and proposing some joint activities in the frame of GEDEON and PRACTIS programs. This document brings together the transparencies of 18 contributions dealing with: scenario studies with AMSTER concept (Scenarios, MSR, breeders (Th) and burners); fuel cycle for innovative systems; current reprocessing of spent nuclear fuel (SNF) in molten salts (review of pyro-chemistry processes (non nuclear and nuclear)); high temperature NMR spectroscopies in molten salts; reductive extraction of An from molten fluorides (salt - liquid metal extraction); electrochemistry characterisation; characterisation with physical methods - extraction coefficient and kinetics; electrolytic extraction; dissolution-precipitation of plutonium in the eutectic LiCl-KCl (dissolution and

  11. Aproximación a la gestión del talento. Abril 2012

    OpenAIRE

    Gallardo-Gallardo, Eva

    2012-01-01

    Este documento lo preparé para introducir el concepto de talento y de gestión de Talento en una sesión del Máster de Creación y Gestión de Empresas Innovadoras y de Base Tecnológicas de la Universidad de Barcelona, el pasado 24 de abril de 2012.

  12. Evaluation of the root cause for MSR high level trip in Maanshan

    International Nuclear Information System (INIS)

    Liao, L.-Y.; Ferng, Y.-M.; Jange, S.J.; Ko, C.M.

    2004-01-01

    Reactor trip due to Moisture Separator Reheater (MSR) high water level has been a long time issue for Maanshan nuclear power plant. The operating experience shows that there are five reactor trips due to MSR high water level. Four out of the five reactor trips are generated when Combined Intermediate valve (CIV) no. 1 is closed during CIV closure test. The fifth reactor trip occurs when the reactor power is increasing from 99% to 100%. An extensive root cause analysis has been performed by Taipower Company. It is concluded that the water accumulated in the cross under leg between the exhaust of high pressure turbine and the inlet of MSR was the water source contributing to the MSR high level trip. Although, Maanshan does not have similar trip after the root cause analysis, it is interested to evaluate the proposed root cause from thermal hydraulic point of view. It is also hoped that some useful guidelines can be established. This paper includes a description of the scenario of reactor trips, a summary of the root cause analysis done by Taipower Company, an examination of possible mechanisms, an identification of key parameters and a presentation of major findings. In addition, the applicability of RELAP5/MOD3 under this condition is discussed. (author)

  13. Data Analysis with the Morse-Smale Complex: The msr Package for R

    KAUST Repository

    Gerber, Samuel

    2012-01-01

    In many areas, scientists deal with increasingly high-dimensional data sets. An important aspect for these scientists is to gain a qualitative understanding of the process or system from which the data is gathered. Often, both input variables and an outcome are observed and the data can be characterized as a sample from a high-dimensional scalar function. This work presents the R package msr for exploratory data analysis of multivariate scalar functions based on the Morse-Smale complex. The Morse-Smale complex provides a topologically meaningful decomposition of the domain. The msr package implements a discrete approximation of the Morse-Smale complex for data sets. In previous work this approximation has been exploited for visualization and partition-based regression, which are both supported in the msr package. The visualization combines the Morse-Smale complex with dimension-reduction techniques for a visual summary representation that serves as a guide for interactive exploration of the high-dimensional function. In a similar fashion, the regression employs a combination of linear models based on the Morse-Smale decomposition of the domain. This regression approach yields topologically accurate estimates and facilitates interpretation of general trends and statistical comparisons between partitions. In this manner, the msr package supports high-dimensional data understanding and exploration through the Morse-Smale complex.

  14. [download] (941Data Analysis with the Morse-Smale Complex: The msr Package for R

    Directory of Open Access Journals (Sweden)

    Samuel Gerber

    2012-07-01

    Full Text Available In many areas, scientists deal with increasingly high-dimensional data sets. An important aspect for these scientists is to gain a qualitative understanding of the process or system from which the data is gathered. Often, both input variables and an outcome are observed and the data can be characterized as a sample from a high-dimensional scalar function. This work presents the R package msr for exploratory data analysis of multivariate scalar functions based on the Morse-Smale complex. The Morse-Smale complex provides a topologically meaningful decomposition of the domain. The msr package implements a discrete approximation of the Morse-Smale complex for data sets. In previous work this approximation has been exploited for visualization and partition-based regression, which are both supported in the msr package. The visualization combines the Morse-Smale complex with dimension-reduction techniques for a visual summary representation that serves as a guide for interactive exploration of the high-dimensional function. In a similar fashion, the regression employs a combination of linear models based on the Morse-Smale decomposition of the domain. This regression approach yields topologically accurate estimates and facilitates interpretation of general trends and statistical comparisons between partitions. In this manner, the msr package supports high-dimensional data understanding and exploration through the Morse-Smale complex.

  15. MSR Founding Narratives and Content Analysis of Best/Dexter Award Nominee Papers (2001-2015)

    DEFF Research Database (Denmark)

    Tackney, Charles T.; Chappell, Stacie; Sato, Toyoko

    data and founder interviews. The individuals interviewed were identified through preliminary inquiry and from archival data. As a complement of and extension to this inclusive founding narrative, we conducted a content and discourse analysis of the 15 years of MSR Best Papers and Carolyn Dexter Best...

  16. Reactor physical program in the frame of the MSR-SPHINX transmuter concept development

    International Nuclear Information System (INIS)

    Hron, M.; Mikisek, M.

    2008-01-01

    In the frame of the R and D program for the Molten Salt Reactor (MSR) - SPHINX (Spent Hot fuel Incinerator by Neutron flux) concept, which has been under development in the Czech Republic as an actinide burner in resonance neutron spectrum and a radionuclide transmuter in a well-thermalized neutron spectrum, and namely its reactor physical part, the relatively broad experimental activities have been involved in the program, recently, which will serve for a validation of computer codes and verification of design inputs for designing of a demonstration unit of the MSR-type. The experimental program, which has been focused, in its first stage, on a short-term irradiation of small size samples of molten-salt systems as well as structural materials proposed for the MSR blanket in the field of high neutron flux of research reactors, will be in the proposed next stage of the program focused on a large-scale experimental verification of design inputs by use of MSR-type inserted zones into the existing light water moderated experimental reactor LR-0, which may allow to modify it to experimental zero power salt reactor SR-0. There has been a preparatory stage of the project called EROS started in the year 2006 and new experiments with MSR-type zones irradiated by cyclotron based neutron source are planned at the end of 2007 and should go on in the year 2008. There will be a brief description of the so far prepared and performed experimental programs introduced in the paper. (authors)

  17. MsrA Overexpression Targeted to the Mitochondria, but Not Cytosol, Preserves Insulin Sensitivity in Diet-Induced Obese Mice.

    Directory of Open Access Journals (Sweden)

    JennaLynn Hunnicut

    Full Text Available There is growing evidence that oxidative stress plays an integral role in the processes by which obesity causes type 2 diabetes. We previously identified that mice lacking the protein oxidation repair enzyme methionine sulfoxide reductase A (MsrA are particularly prone to obesity-induced insulin resistance suggesting an unrecognized role for this protein in metabolic regulation. The goals of this study were to test whether increasing the expression of MsrA in mice can protect against obesity-induced metabolic dysfunction and to elucidate the potential underlying mechanisms. Mice with increased levels of MsrA in the mitochondria (TgMito MsrA or in the cytosol (TgCyto MsrA were fed a high fat/high sugar diet and parameters of glucose homeostasis were monitored. Mitochondrial content, markers of mitochondrial proteostasis and mitochondrial energy utilization were assessed. TgMito MsrA, but not TgCyto MsrA, mice remain insulin sensitive after high fat feeding, though these mice are not protected from obesity. This metabolically healthy obese phenotype of TgMito MsrA mice is not associated with changes in mitochondrial number or biogenesis or with a reduction of proteostatic stress in the mitochondria. However, our data suggest that increased mitochondrial MsrA can alter metabolic homeostasis under diet-induced obesity by activating AMPK signaling, thereby defining a potential mechanism by which this genetic alteration can prevent insulin resistance without affecting obesity. Our data suggest that identification of targets that maintain and regulate the integrity of the mitochondrial proteome, particular against oxidative damage, may play essential roles in the protection against metabolic disease.

  18. Study on domestic material purchasing in MSR manufacture of conventional island

    International Nuclear Information System (INIS)

    Xie Zhengmao

    2010-01-01

    Combining the real case of Dongfang Electric (Guangzhou) Heavy Machinery Co., Ltd. trying to purchase the domestic sealing gasket as needed in the MSR of the conventional island, this paper describes the trends and relevant experience about nuclear power equipment manufacturers purchasing materials in the domestic market, and provides a reference to broadening the procurement channels of the purchasing departments of nuclear equipment manufacturers. (author)

  19. Brote de enfermedad transmitida por alimentos en el distrito de Catache, provincia de Santa Cruz, departamento de Cajamarca. Abril 2007

    OpenAIRE

    Suarez, Victor

    2007-01-01

    De acuerdo con la información proporcionada por la Dirección de Epidemiología de la DIRESA Cajamarca, durante la primera semana de abril se ha producido un brote de una enfermedad transmitida por alimentos en el distrito de Catache, provincia de Santa Cruz, departamento de Cajamarca, con 49 casos. Los primeros casos se presentaron el 3 de abril y los últimos seis casos fueron atendidos en el C.S. Catache el día 9 de abril. El 100% de los casos presentaron nauseas, 85,7% vómitos y 75,5% cef...

  20. Peptide methionine sulfoxide reductase A (MsrA): direct electrochemical oxidation on carbon electrodes.

    Science.gov (United States)

    Enache, T A; Oliveira-Brett, A M

    2013-02-01

    The direct electrochemical behaviour of peptide methionine sulfoxide reductase A (MsrA) adsorbed on glassy carbon and boron doped diamond electrodes surface, was studied over a wide pH range by cyclic and differential pulse voltammetry. MsrA oxidation mechanism occurs in three consecutive, pH dependent steps, corresponding to the oxidation of tyrosine, tryptophan and histidine amino acid residues. At the glassy carbon electrode, the first step corresponds to the oxidation of tyrosine and tryptophan residues and occurs for the same potential. The advantage of boron doped diamond electrode was to enable the separation of tyrosine and tryptophan oxidation peaks. On the second step occurs the histidine oxidation, and on the third, at higher potentials, the second tryptophan oxidation. MsrA adsorbs on the hydrophobic carbon electrode surface preferentially through the three hydrophobic domains, C1, C2 and C3, which contain the tyrosine, tryptophan and histidine residues, and tryptophan exists only in these regions, and undergo electrochemical oxidation. Copyright © 2012 Elsevier B.V. All rights reserved.

  1. El golpe de abril: el Estado nacional venezolano ante la globalización neoliberal

    Directory of Open Access Journals (Sweden)

    Jose Honorio Martinez

    2012-06-01

    Full Text Available El golpe de abril fue una coyuntura en la que midieron fuerzas dos bloques políticos, la burguesía aliada a los intereses corporativos de los monopolios transnacionales y el bloque nacional popular representado por el gobierno y las organizaciones populares que le respaldaron. El transcurso y desenlace de los acontecimientos mostró que los antagonismos corrieron por diversos frentes, el militar, el de la movilización callejera, el mediático y el institucional. ¿Qué significó el golpe de abril en términos del desenvolvimiento de la lucha de clases en Venezuela? ¿En qué medida los antagonismos entre el bloque opositor y el bloque gubernamental reflejaron la contradicción entre el estado nacional y la globalización neoliberal? Estas preguntas serán el objeto de estudio de este artículo.  Palabras claves: golpe de abril, globalización neoliberal, estado nacional, lucha de clases   ________________________________  Abstract  The coup d’état in April was a moment in which two political forces measured their power. One force was represented the bourgeoisie allied with corporative interests from transnational monopolies, the other one was the national popular group represented by the Government and the popular organizations that support such a Government. The antagonisms were carried out by different fronts: the military front, the mass media front, the popular mobilization on the streets, and the institutional front. What did the coup d’état in April in terms of the classes struggle in Venezuela mean? How did the antagonisms between the opponent group and the Governmental one reflect the contradictions between National-States and neoliberal globalization? These questions will be answered in this study.   Keywords: Coup d’April, neoliberal globalization, National-State, classes struggle

  2. Characterization of the Metabolically Modified Heavy Metal-Resistant Cupriavidus metallidurans Strain MSR33 Generated for Mercury Bioremediation

    Science.gov (United States)

    Rojas, Luis A.; Yáñez, Carolina; González, Myriam; Lobos, Soledad; Smalla, Kornelia; Seeger, Michael

    2011-01-01

    Background Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. Methodology/Principal Findings To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other mer genes was introduced into the bacterium by biparental mating. The transconjugant Cupriavidus metallidurans strain MSR33 was genetically and biochemically characterized. Strain MSR33 maintained stably the plasmid pTP6 over 70 generations under non-selective conditions. The organomercurial lyase protein MerB and the mercuric reductase MerA of strain MSR33 were synthesized in presence of Hg2+. The minimum inhibitory concentrations (mM) for strain MSR33 were: Hg2+, 0.12 and CH3Hg+, 0.08. The addition of Hg2+ (0.04 mM) at exponential phase had not an effect on the growth rate of strain MSR33. In contrast, after Hg2+ addition at exponential phase the parental strain CH34 showed an immediate cessation of cell growth. During exposure to Hg2+ no effects in the morphology of MSR33 cells were observed, whereas CH34 cells exposed to Hg2+ showed a fuzzy outer membrane. Bioremediation with strain MSR33 of two mercury-contaminated aqueous solutions was evaluated. Hg2+ (0.10 and 0.15 mM) was completely volatilized by strain MSR33 from the polluted waters in presence of thioglycolate (5 mM) after 2 h. Conclusions/Significance A broad-spectrum mercury-resistant strain MSR33 was generated by incorporation of plasmid pTP6 that was directly isolated from the environment into C. metallidurans CH34. Strain MSR33 is capable to remove mercury from polluted waters. This is the first study to use an IncP-1β plasmid directly isolated from the environment, to generate a novel and stable bacterial strain

  3. Characterization of the metabolically modified heavy metal-resistant Cupriavidus metallidurans strain MSR33 generated for mercury bioremediation.

    Directory of Open Access Journals (Sweden)

    Luis A Rojas

    Full Text Available BACKGROUND: Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. METHODOLOGY/PRINCIPAL FINDINGS: To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other mer genes was introduced into the bacterium by biparental mating. The transconjugant Cupriavidus metallidurans strain MSR33 was genetically and biochemically characterized. Strain MSR33 maintained stably the plasmid pTP6 over 70 generations under non-selective conditions. The organomercurial lyase protein MerB and the mercuric reductase MerA of strain MSR33 were synthesized in presence of Hg(2+. The minimum inhibitory concentrations (mM for strain MSR33 were: Hg(2+, 0.12 and CH(3Hg(+, 0.08. The addition of Hg(2+ (0.04 mM at exponential phase had not an effect on the growth rate of strain MSR33. In contrast, after Hg(2+ addition at exponential phase the parental strain CH34 showed an immediate cessation of cell growth. During exposure to Hg(2+ no effects in the morphology of MSR33 cells were observed, whereas CH34 cells exposed to Hg(2+ showed a fuzzy outer membrane. Bioremediation with strain MSR33 of two mercury-contaminated aqueous solutions was evaluated. Hg(2+ (0.10 and 0.15 mM was completely volatilized by strain MSR33 from the polluted waters in presence of thioglycolate (5 mM after 2 h. CONCLUSIONS/SIGNIFICANCE: A broad-spectrum mercury-resistant strain MSR33 was generated by incorporation of plasmid pTP6 that was directly isolated from the environment into C. metallidurans CH34. Strain MSR33 is capable to remove mercury from polluted waters. This is the first study to use an IncP-1β plasmid directly isolated from the environment, to generate a novel

  4. ABrIL - Advanced Brain Imaging Lab : a cloud based computation environment for cooperative neuroimaging projects.

    Science.gov (United States)

    Neves Tafula, Sérgio M; Moreira da Silva, Nádia; Rozanski, Verena E; Silva Cunha, João Paulo

    2014-01-01

    Neuroscience is an increasingly multidisciplinary and highly cooperative field where neuroimaging plays an important role. Neuroimaging rapid evolution is demanding for a growing number of computing resources and skills that need to be put in place at every lab. Typically each group tries to setup their own servers and workstations to support their neuroimaging needs, having to learn from Operating System management to specific neuroscience software tools details before any results can be obtained from each setup. This setup and learning process is replicated in every lab, even if a strong collaboration among several groups is going on. In this paper we present a new cloud service model - Brain Imaging Application as a Service (BiAaaS) - and one of its implementation - Advanced Brain Imaging Lab (ABrIL) - in the form of an ubiquitous virtual desktop remote infrastructure that offers a set of neuroimaging computational services in an interactive neuroscientist-friendly graphical user interface (GUI). This remote desktop has been used for several multi-institution cooperative projects with different neuroscience objectives that already achieved important results, such as the contribution to a high impact paper published in the January issue of the Neuroimage journal. The ABrIL system has shown its applicability in several neuroscience projects with a relatively low-cost, promoting truly collaborative actions and speeding up project results and their clinical applicability.

  5. Three dimensional neutronic/thermal-hydraulic coupled simulation of MSR in transient state condition

    International Nuclear Information System (INIS)

    Zhou, Jianjun; Zhang, Daling; Qiu, Suizheng; Su, Guanghui; Tian, Wenxi; Wu, Yingwei

    2015-01-01

    Highlights: • Developed a three dimensional neutronic/thermal-hydraulic coupled transient analysis code for MSR. • Investigated the neutron distribution and thermal-hydraulic characters of the core under transient condition. • Analyzed three different transient conditions of inlet temperature drop, reactivity jump and pump coastdown. - Abstract: MSR (molten salt reactor) use liquid molten salt as coolant and fuel solvent, which was the only one liquid reactor of six Generation IV reactor types. As a liquid reactor the physical property of reactor was significantly influenced by fuel salt flow and the conventional analysis methods applied in solid fuel reactors are not applicable for this type of reactors. The present work developed a three dimensional neutronic/thermal-hydraulic coupled code investigated the neutronics and thermo-hydraulics characteristics of the core in transient condition based on neutron diffusion theory and numerical heat transfer. The code consists of two group neutron diffusion equations for fast and thermal neutron fluxes and six group balance equations for delayed neutron precursors. The code was separately validated by neutron benchmark and flow and heat transfer benchmark. Three different transient conditions was analyzed with inlet temperature drop, reactivity jump and pump coastdown. The results provide some valuable information in design and research this kind of reactor

  6. Three dimensional neutronic/thermal-hydraulic coupled simulation of MSR in transient state condition

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Jianjun [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xianning Road, 28, Xi’an 710049, Shaanxi (China); College of Mechanical and Power Engineering, China Three Gorges University, No 8, Daxue road, Yichang, Hubei 443002 (China); Zhang, Daling, E-mail: dlzhang@mail.xjtu.edu.cn [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xianning Road, 28, Xi’an 710049, Shaanxi (China); Qiu, Suizheng; Su, Guanghui; Tian, Wenxi; Wu, Yingwei [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xianning Road, 28, Xi’an 710049, Shaanxi (China)

    2015-02-15

    Highlights: • Developed a three dimensional neutronic/thermal-hydraulic coupled transient analysis code for MSR. • Investigated the neutron distribution and thermal-hydraulic characters of the core under transient condition. • Analyzed three different transient conditions of inlet temperature drop, reactivity jump and pump coastdown. - Abstract: MSR (molten salt reactor) use liquid molten salt as coolant and fuel solvent, which was the only one liquid reactor of six Generation IV reactor types. As a liquid reactor the physical property of reactor was significantly influenced by fuel salt flow and the conventional analysis methods applied in solid fuel reactors are not applicable for this type of reactors. The present work developed a three dimensional neutronic/thermal-hydraulic coupled code investigated the neutronics and thermo-hydraulics characteristics of the core in transient condition based on neutron diffusion theory and numerical heat transfer. The code consists of two group neutron diffusion equations for fast and thermal neutron fluxes and six group balance equations for delayed neutron precursors. The code was separately validated by neutron benchmark and flow and heat transfer benchmark. Three different transient conditions was analyzed with inlet temperature drop, reactivity jump and pump coastdown. The results provide some valuable information in design and research this kind of reactor.

  7. El impacto del 9 de abril en Cali y el Valle del Cauca

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Charry Joya

    2009-12-01

    Full Text Available DESDE UNA PERSPECTIVA PROCESUAL, ESTE ARTÍcULO EXPLORA y ANALIZA LAS formas de configuración social de poder regional durante los años previos al asesinato de Jorge Eliécer Gaitán y el impacto que el magnicidio tuvo en dicho proceso. El autor destaca el mejor posicionamiento logrado por los grupos sociales marginados como consecuencia de las transformaciones sociopoliticas ocurridas en la década de 1930 y 1940, señala las tensiones que esto generó entre los sectores establecidos y, tras el 9 de abril de 1948, nota un cambio considerable en los equilibrios de poder entre los sectores sociales que contraviene la tendencia antes mencionada.

  8. Luminescent properties of UV excitable blue emitting phosphors MSr4(BO3)3:Ce3+ (M = Li and Na)

    International Nuclear Information System (INIS)

    Guo Chongfeng; Ding Xu; Seo, Hyo Jin; Ren Zhaoyu; Bai Jintao

    2011-01-01

    Research highlights: → Novel blue emitting phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were prepared first. → Luminescent properties of phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were investigated extensively as candidates of blue emitting phosphor used for UV excited LED. → The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined as 0.05 for Li and x = 0.09 for Na excited by UV light respectively. - Abstract: A series of Ce 3+ doped novel borate phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) were successfully synthesized by traditional solid-state reaction. The crystal structures and the phase purities of samples were characterized by powder X-ray diffraction. The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined through the measurements of photoluminescence spectra of phosphors. Ce 3+ doped phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) show strong broad band absorption in UV spectral region and bright blue emission under the excitation of 345 nm light. In addition, the temperature dependences of emission spectra of M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors with optimal composition x = 0.05 for Li and x = 0.09 for Na excited under 355 nm pulse laser were also investigated. The experimental results indicate that the M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors are promising blue emitting phosphors pumped by UV light.

  9. 1998. Primarias en España. Se inicia la era posfelipista. Almunia versus Borrell. 24 de abril de 1998

    OpenAIRE

    Sanz Díaz, Benito

    2015-01-01

    Primarias en España. Se inicia la era posfelipista. Almunia versus borrell. 24 de abril de 1998. Felipe González: “…no seré candidato a la Secretaría General”. Las elecciones primarias socialistas en el País Vasco. Nicolás Redondo Terreros/Rosa Díez. 14 de marzo de 1998. Almunia opta por las primarias. Almunia versus Borrell. 24 de abril 1998. Borrell se lanza a la piscina. El proceso. Cómo se organizaron las primeras elecciones primarias. La campaña electoral Almunia/Borrell. Sondeos sobre i...

  10. Hoy hace: Sismo de Tilarán, 14 de abril de 1973

    Directory of Open Access Journals (Sweden)

    Esquivel Valverde, Lidier

    2005-08-01

    Full Text Available Como parte de un proyecto del Departamento de Prevención y Mitigación de la Comisión Nacional de Prevención de Riesgos y Atención de Emergencias, que busca mantener en la memoria de la población una serie de eventos históricos relacionados con emergencias, se presenta una reseña sobre el sismo de Tilarán el 14 de abril de 1973, donde se narran algunas de las situaciones que se dieron, entre ellos datos técnicos sobre el sismo y un recuento de los daños y pérdidas As part of one Project of the Prevention and Mitigation Department of the National Commission of Risk Prevention and Emergency Response that tries to maintain in the memory of the population a series of historical events related to emergencies, it is presented a summary of the Tilarán earthquake, April 14, 1973, which narrates some of the situations occurred, among them technical data about the earthquake and a summary of the damages and losses

  11. Effects of transgenic methionine sulfoxide reductase A (MsrA expression on lifespan and age-dependent changes in metabolic function in mice

    Directory of Open Access Journals (Sweden)

    Adam B. Salmon

    2016-12-01

    Full Text Available Mechanisms that preserve and maintain the cellular proteome are associated with long life and healthy aging. Oxidative damage is a significant contributor to perturbation of proteostasis and is dealt with by the cell through regulation of antioxidants, protein degradation, and repair of oxidized amino acids. Methionine sulfoxide reductase A (MsrA repairs oxidation of free- and protein-bound methionine residues through enzymatic reduction and is found in both the cytosol and the mitochondria. Previous studies in Drosophila have shown that increasing expression of MsrA can extend longevity. Here we test the effects of increasing MsrA on longevity and healthy aging in two transgenic mouse models. We show that elevated expression of MsrA targeted specifically to the cytosol reduces the rate of age-related death in female mice when assessed by Gompertz analysis. However, neither cytosolic nor mitochondrial MsrA overexpression extends lifespan when measured by log-rank analysis. In mice with MsrA overexpression targeted to the mitochondria, we see evidence for improved insulin sensitivity in aged female mice. With these and our previous data, we conclude that the increasing MsrA expression in mice has differential effects on aging and healthy aging that are dependent on the target of its subcellular localization.

  12. Determination and analysis of the dispersive optical constants of the 5,5',6,6'-tetraphenyl-2,2'-bi([1,3]dithiolo[4,5-b][1,4]dithiinylidene)-DDQ complex thin film

    International Nuclear Information System (INIS)

    Atalay, Y.; Basoglu, A.; Avci, D.; Arslan, M.; Ozturk, T.; Ertas, E.

    2008-01-01

    The synthesis and optical properties of the 5,5',6,6'-tetraphenyl-2,2'-bi([1,3]dithiolo [4,5-b] [1,4]dithiinylidene)-2,3-dichloro-5,6-dicyano-p-benzoquinone (DDQ) complex thin film were investigated by the optical characterization. The optical constants such as refractive index, extinction coefficient and absorption coefficient were determined using the transmittance T(λ) and reflectance R(λ) spectra and the refractive index dispersion was analyzed using single oscillator of Wemple-Didomenico model. The single oscillator energy E 0 and the dispersion energy E d were calculated. The effect of temperature on refractive dispersion and optical band gap E g is also discussed. As a result, the annealing temperatures have an important effect on refractive index of thin film

  13. Mining Tasks from the Web Anchor Text Graph: MSR Notebook Paper for the TREC 2015 Tasks Track

    Science.gov (United States)

    2015-11-20

    Mining Tasks from the Web Anchor Text Graph: MSR Notebook Paper for the TREC 2015 Tasks Track Paul N. Bennett Microsoft Research Redmond, USA pauben...anchor text graph has proven useful in the general realm of query reformulation [2], we sought to quantify the value of extracting key phrases from...anchor text in the broader setting of the task understanding track. Given a query, our approach considers a simple method for identifying a relevant

  14. Assessment of rigid multi-modality image registration consistency using the multiple sub-volume registration (MSR) method

    International Nuclear Information System (INIS)

    Ceylan, C; Heide, U A van der; Bol, G H; Lagendijk, J J W; Kotte, A N T J

    2005-01-01

    Registration of different imaging modalities such as CT, MRI, functional MRI (fMRI), positron (PET) and single photon (SPECT) emission tomography is used in many clinical applications. Determining the quality of any automatic registration procedure has been a challenging part because no gold standard is available to evaluate the registration. In this note we present a method, called the 'multiple sub-volume registration' (MSR) method, for assessing the consistency of a rigid registration. This is done by registering sub-images of one data set on the other data set, performing a crude non-rigid registration. By analysing the deviations (local deformations) of the sub-volume registrations from the full registration we get a measure of the consistency of the rigid registration. Registration of 15 data sets which include CT, MR and PET images for brain, head and neck, cervix, prostate and lung was performed utilizing a rigid body registration with normalized mutual information as the similarity measure. The resulting registrations were classified as good or bad by visual inspection. The resulting registrations were also classified using our MSR method. The results of our MSR method agree with the classification obtained from visual inspection for all cases (p < 0.02 based on ANOVA of the good and bad groups). The proposed method is independent of the registration algorithm and similarity measure. It can be used for multi-modality image data sets and different anatomic sites of the patient. (note)

  15. MSR redesign and reconstruction at Indiana Michigan Power Company's Donald C. Cook Nuclear Power Plant, Unit 1

    International Nuclear Information System (INIS)

    Yarden, A.L.; Tam, C.W.; Benes, J.D.; Arnold, W.E.

    1993-01-01

    When Indiana Michigan Power Company's (I and M) 1089- MWe, PWR, Donald C. Cook Nuclear Plant, Unit 1, (Cook 1) in Bridgeman, Michigan went into commercial operation in late 1975, its turbine generator included two Moisture Separator Reheater (MSR) vessels. Each of these original MSRs contained, in addition to the moisture separation section, a single stage 2-pass reheater consisting of 5/8 inch O.D., finned CuNi tubes with main heating steam as an energy source. The enormous size of the tube bank, with a vertical orientation of its tubes' U-bends, led the designer to choose two separate headers for the inlet side and outlet side of the tube bank. Over the years, these 2-pass reheaters had deteriorated mechanically such that maintenance costs had increased considerably. Also, the MSR performance in terms of MWe gain, had fallen off as a result of a gradual reduction of both superheat and moisture separation efficiency. In 1990, these MSRs were totally reconstructed with inherently different 4-pass reheaters and upgraded moisture separation systems. The performance and other direct parameters of these newly retrofitted and improved MSRs have exceeded original design specifications, and their operational stability has improved markedly. This MSR reconstruction at Cook 1 is the first of its kind to include a 4-pass reheater in association with a nuclear turbine generator of this design. This paper highlights the problems and solutions associated respectively with the original reheaters in the Cook 1 MSRs and their recent redesign, reconstruction, and performance

  16. Application of spectrometer cropscan MSR 16R and Landsat imagery for identification the spectral characteristics of land cover

    Science.gov (United States)

    Tampubolon, Togi; Abdullah, Khiruddin bin; San, Lim Hwee

    2013-09-01

    The spectral characteristics of land cover are basic references in classifying satellite image for geophysics analysis. It can be obtained from the measurements using spectrometer and satellite image processing. The aims of this study to investigate the spectral characteristics of land cover based on the results of measurement using Spectrometer Cropscan MSR 16R and Landsat satellite imagery. The area of study in this research is in Medan, (Deli Serdang, North Sumatera) Indonesia. The scope of this study is the basic survey from the measurements of spectral land cover which is covered several type of land such as a cultivated and managed terrestrial areas, natural and semi-natural, cultivated aquatic or regularly flooded areas, natural and semi-natural aquatic, artificial surfaces and associated areas, bare areas, artificial waterbodies and natural waterbodies. The measurement and verification were conducted using a spectrometer provided their spectral characteristics and Landsat imagery, respectively. The results of the spectral characteristics of land cover shows that each type of land cover have a unique characteristic. The correlation of spectral land cover based on spectrometer Cropscan MSR 16R and Landsat satellite image are above 90 %. However, the land cover of artificial waterbodiese have a correlation under 40 %. That is because the measurement of spectrometer Cropscan MSR 16R and acquisition of Landsat satellite imagery has a time different.

  17. Transgenic Brassica juncea plants expressing MsrA1, a synthetic cationic antimicrobial peptide, exhibit resistance to fungal phytopathogens.

    Science.gov (United States)

    Rustagi, Anjana; Kumar, Deepak; Shekhar, Shashi; Yusuf, Mohd Aslam; Misra, Santosh; Sarin, Neera Bhalla

    2014-06-01

    Cationic antimicrobial peptides (CAPs) have shown potential against broad spectrum of phytopathogens. Synthetic versions with desirable properties have been modeled on these natural peptides. MsrA1 is a synthetic chimera of cecropin A and melittin CAPs with antimicrobial properties. We generated transgenic Brassica juncea plants expressing the msrA1 gene aimed at conferring fungal resistance. Five independent transgenic lines were evaluated for resistance to Alternaria brassicae and Sclerotinia sclerotiorum, two of the most devastating pathogens of B. juncea crops. In vitro assays showed inhibition by MsrA1 of Alternaria hyphae growth by 44-62 %. As assessed by the number and size of lesions and time taken for complete leaf necrosis, the Alternaria infection was delayed and restricted in the transgenic plants with the protection varying from 69 to 85 % in different transgenic lines. In case of S. sclerotiorum infection, the lesions were more severe and spread profusely in untransformed control compared with transgenic plants. The sclerotia formed in the stem of untransformed control plants were significantly more in number and larger in size than those present in the transgenic plants where disease protection of 56-71.5 % was obtained. We discuss the potential of engineering broad spectrum biotic stress tolerance by transgenic expression of CAPs in crop plants.

  18. Preserving Samples and Their Scientific Integrity — Insights into MSR from the Astromaterials Acquisition and Curation Office at NASA Johnson Space Center

    Science.gov (United States)

    Calaway, M. J.; Regberg, A. B.; Mitchell, J. L.; Fries, M. D.; Zeigler, R. A.; McCubbin, F. M.; Harrington, A. D.

    2018-04-01

    Rigorous collection of samples for contamination knowledge, the information gained from the characterization of reference materials and witness plates in concurrence with sample return, is essential for MSR mission success.

  19. Salida de campo por Aguilar de Campoo (Palencia) entre el 3 y el 10 de abril de 1954

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Salida de campo por Aguilar de Campoo, en Palencia, entre el 3 y el 10 de abril de 1954, de la que se anotaron observaciones sobre las siguientes aves: "Buitre grande" (probablemente, Aegypius monachus, el Buitre negro), Ciconia sp. (Cigüeña), Neophron percnopterus (Alimoche común, también conocido como Buitre blanco) y Saxicola torquata (Tarabilla común). Field trip through Aguilar de Campoo, at Palencia, between the 3rd and the 10th of April of 1954, of which there were noted observatio...

  20. Positron annihilation study of La2-xMxCuO4 (M=Sr, Ba) system

    International Nuclear Information System (INIS)

    Lu Qingfeng; Du Baoli; Li Xigui

    2004-01-01

    The positron lifetime spectra of La 2-x M x CuO 4 (LMCO, M=Sr, Ba, x=0.05, 0.10, 0.125, 0.15, 0.2) were measured at room temperature for studying the long-standing mystery of '1/8 abnormal' in doped lanthanum cuprate. Electron density n e and void concentration (number density) C V were calculated as a function of substitution content x. The appearance of peak (n e ) and valley (C V ) at x=0.125 and the correlation with superconductivity were discussed. (authors)

  1. A general overview of generation IV molten salt reactor (MSR) and the use of thorium as fuel

    Energy Technology Data Exchange (ETDEWEB)

    Yamaguchi, Carlos H.; Stefani, Giovanni L.; Santos, Thiago A., E-mail: carlos.yamaguchi@usp.br, E-mail: giovanni.stefani@ipen.br, E-mail: thiago.santos@ufabc.edu.br [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Universidade Federal do ABC (CECS/UFABC), Santo Andre, SP (Brazil). Centro de Engenharia, Modelagem e Ciencias Sociais Aplicadas

    2017-07-01

    The molten salt reactors (MSRs) make use of fluoride salt as primary cooler, at low pressure. Although considered a generation IV reactor, your concept isn't new, since in the 1960 years the Oak Ridge National Laboratory created a little prototype of 8MWt. Over the 20{sup th} century, other countries, like UK, Japan, Russia, China and France also did research in the area, especially with the use of thorium as fuel. This goes with the fact that Brazil possess the biggest reserve of thorium in the world. In the center of nuclear engineering at IPEN is being created a study group connected to thorium reactors, which purpose is to investigate reactors using thorium to produce {sup 233}U and tailing burn, thus making the MSR using thorium as fuel, an object of study. This present work searches to do a general summary about the researches of MSR's, having as focus the utilization of thorium with the goal being to show it's efficiency and utilization is doable. (author)

  2. High-resolution wave number spectrum using multi-point measurements in space – the Multi-point Signal Resonator (MSR technique

    Directory of Open Access Journals (Sweden)

    Y. Narita

    2011-02-01

    Full Text Available A new analysis method is presented that provides a high-resolution power spectrum in a broad wave number domain based on multi-point measurements. The analysis technique is referred to as the Multi-point Signal Resonator (MSR and it benefits from Capon's minimum variance method for obtaining the proper power spectral density of the signal as well as the MUSIC algorithm (Multiple Signal Classification for considerably reducing the noise part in the spectrum. The mathematical foundation of the analysis method is presented and it is applied to synthetic data as well as Cluster observations of the interplanetary magnetic field. Using the MSR technique for Cluster data we find a wave in the solar wind propagating parallel to the mean magnetic field with relatively small amplitude, which is not identified by the Capon spectrum. The Cluster data analysis shows the potential of the MSR technique for studying waves and turbulence using multi-point measurements.

  3. MSR - SPHINX concept program Eros (Experimental zero power Salt reactor SR-0) - The proposed experimental program as a basis for validation of reactor physics methods

    Energy Technology Data Exchange (ETDEWEB)

    Hron, M.; Juricek, V.; Kyncl, J.; Mikisek, M.; Rypar, V. [Nuclear Research Institute Rez plc, Rez (Czech Republic)

    2007-07-01

    The Molten Salt Reactor (MSR) - SPHINX (SPent Hot fuel Incinerator by Neutron fluX) concept solves this principal problem of spent fuel treatment by means of so-called nuclear incineration. It means the burning of fissionable part of its inventory and transmutation of other problematic radionuclides by use of nuclear reactions with neutrons in a MSR-SPHINX system. This reactor system is an actinide burner (most in resonance neutron spectrum) and a radionuclide transmuter in a well-thermalized neutron spectrum. In the frame of the physical part, there are computational analyses and experimental activities. The experimental program has been focused, in its first stage, on a short-term irradiation of small size samples of molten-salt systems as well as structural materials proposed for the MSR blanket in the field of high neutron flux of research reactors. The proposed next stage of the program will focus on a large-scale experimental verification of design inputs by use of MSR-type inserting zones into the existing light water moderated experimental reactor LR-0, which may allow us to modify it into the experimental zero power salt reactor SR-0. There will be a detail description of the proposed program given in the paper together with the so far performed experiments and their first results. These realized experiments help us also to verify computational codes used, and to recognize some anomalies related to molten fluorides utilization. (authors)

  4. The Anti-Oxidant Defense System of the Marine Polar Ciliate Euplotes nobilii: Characterization of the MsrB Gene Family

    Directory of Open Access Journals (Sweden)

    Francesca Ricci

    2017-01-01

    Full Text Available Organisms living in polar waters must cope with an extremely stressful environment dominated by freezing temperatures, high oxygen concentrations and UV radiation. To shed light on the genetic mechanisms on which the polar marine ciliate, Euplotes nobilii, relies to effectively cope with the oxidative stress, attention was focused on methionine sulfoxide reductases which repair proteins with oxidized methionines. A family of four structurally distinct MsrB genes, encoding enzymes specific for the reduction of the methionine-sulfoxide R-forms, were identified from a draft of the E. nobilii transcriptionally active (macronuclear genome. The En-MsrB genes are constitutively expressed to synthesize proteins markedly different in amino acid sequence, number of CXXC motifs for zinc-ion binding, and presence/absence of a cysteine residue specific for the mechanism of enzyme regeneration. The En-MsrB proteins take different localizations in the nucleus, mitochondria, cytosol and endoplasmic reticulum, ensuring a pervasive protection of all the major subcellular compartments from the oxidative damage. These observations have suggested to regard the En-MsrB gene activity as playing a central role in the genetic mechanism that enables E. nobilii and ciliates in general to live in the polar environment.

  5. Genetic modification of potato against microbial diseases: in vitro and in planta activity of a dermaseptin B1 derivative, MsrA2.

    Science.gov (United States)

    Osusky, Milan; Osuska, Lubica; Kay, William; Misra, Santosh

    2005-08-01

    Dermaseptin B1 is a potent cationic antimicrobial peptide found in skin secretions of the arboreal frog Phyllomedusa bicolor. A synthetic derivative of dermaseptin B1, MsrA2 (N-Met-dermaseptin B1), elicited strong antimicrobial activities against various phytopathogenic fungi and bacteria in vitro. To assess its potential for plant protection, MsrA2 was expressed at low levels (1-5 microg/g of fresh tissue) in the transgenic potato (Solanum tuberosum L.) cv. Desiree. Stringent challenges of these transgenic potato plants with a variety of highly virulent fungal phytopathogens--Alternaria, Cercospora, Fusarium, Phytophthora, Pythium, Rhizoctonia and Verticillium species--and with the bacterial pathogen Erwinia carotovora demonstrated that the plants had an unusually broad-spectrum and powerful resistance to infection. MsrA2 profoundly protected both plants and tubers from diseases such as late blight, dry rot and pink rot and markedly extended the storage life of tubers. Due to these properties in planta, MsrA2 is proposed as an ideal antimicrobial peptide candidate to significantly increase resistance to phytopathogens and improve quality in a variety of crops worldwide with the potential to obviate fungicides and facilitate storage under difficult conditions.

  6. Transcriptional attenuation controls macrolide inducible efflux and resistance in Streptococcus pneumoniae and in other Gram-positive bacteria containing mef/mel(msr(D)) elements.

    Science.gov (United States)

    Chancey, Scott T; Bai, Xianhe; Kumar, Nikhil; Drabek, Elliott F; Daugherty, Sean C; Colon, Thomas; Ott, Sandra; Sengamalay, Naomi; Sadzewicz, Lisa; Tallon, Luke J; Fraser, Claire M; Tettelin, Hervé; Stephens, David S

    2015-01-01

    Macrolide resistance, emerging in Streptococcus pneumoniae and other Gram-positive bacteria, is increasingly due to efflux pumps encoded by mef/mel(msr) operons found on discrete mobile genetic elements. The regulation of mef/mel(msr) in these elements is not well understood. We identified the mef(E)/mel transcriptional start, localized the mef(E)/mel promoter, and demonstrated attenuation of transcription as a mechanism of regulation of macrolide-inducible mef-mediated macrolide resistance in S. pneumoniae. The mef(E)/mel transcriptional start site was a guanine 327 bp upstream of mef(E). Consensus pneumococcal promoter -10 (5'-TATACT-3') and -35 (5'-TTGAAC-3') boxes separated by 17 bp were identified 7 bp upstream of the start site. Analysis of the predicted secondary structure of the 327 5' region identified four pairs of inverted repeats R1-R8 predicted to fold into stem-loops, a small leader peptide [MTASMRLR, (Mef(E)L)] required for macrolide induction and a Rho-independent transcription terminator. RNA-seq analyses provided confirmation of transcriptional attenuation. In addition, expression of mef(E)L was also influenced by mef(E)L-dependent mRNA stability. The regulatory region 5' of mef(E) was highly conserved in other mef/mel(msr)-containing elements including Tn1207.1 and the 5612IQ complex in pneumococci and Tn1207.3 in Group A streptococci, indicating a regulatory mechanism common to a wide variety of Gram-positive bacteria containing mef/mel(msr) elements.

  7. MONITORAMENTO DAS ÁGUAS DO RIO MOSSORÓ/RN, NO PERÍODO DE ABRIL/2005 A JULHO/2006

    Directory of Open Access Journals (Sweden)

    Valdiery Silva de Araújo

    2007-12-01

    Full Text Available O trabalho tem por objetivo realizar uma comparação da qualidade físico-química e microbiológica entre três pontos de monitoramento do Rio Mossoró: Barragem do Genésio (utmx-681464; utmy-9422890, Barragem Central (utmx-683867; utmy-9425546 e Barragem Passagem de Pedra (utmx-690119; utmy-9429968 no município Mossoró/RN. Os pontos encontram-se sob diferentes influências antrópicas e foram monitorados no período de abril/2005 a julho/2006, sendo analisadas as seguintes variáveis: coliformes totais, coliformes termotolerantes, oxigênio dissolvido (OD, demanda química de oxigênio (DQO, nitrato, zinco, cobre, chumbo, cromo, mercúrio, cádmio, pH, temperatura, cor e turbidez. Além dessas análises, ainda houve outras variáveis como nitrogênio total, sólidos totais, fósforo total, demanda bioquímica de oxigênio (DBO que somadas as citadas serviram de base de cálculo para o Índice de Qualidade de Águas – IQA da primeira coleta de 2007 (10 de jan.. Embora à sazonalidade climática altere as concentrações dos contaminantes por intermédio da variação do volume do rio, a Barragem do Genésio, situada a montante da cidade, apresenta-se como o ponto de menor concentração das variáveis analisadas. A Barragem Central, localizada no centro da cidade, responde pelas maiores concentrações analisadas durante o período, resultado do lançamento de esgotos domésticos e industriais sem o devido tratamento. Outra característica observada nesse ponto é a proliferação anormal de macrófitas e algas, indicando o processo da eutrofização. Em termos de Índice de Qualidade das Águas, conclui-se que há diminuição da qualidade no sentido montante-jusante, embora o IQA da Barragem Central e Passagem de Pedra sejam semelhantes. PALAVRAS-CHAVE: Rio Mossoró. Monitoramento. Índice de Qualidade das Águas. Eutrofização. Autodepuração.

  8. Informe sobre la alimentación de Tyto alba (Lechuza común) en Villacastín (Segovia) el 12 de abril de 1956

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Informe cuantitativo sobre la alimentación de Tyto alba (Lechuza común) en Villacastín (Segovia) el 12 de abril de 1956, a partir de diverso material encontrado en el desván de la iglesia del pueblo. Se observaron restos de insectos (fundamentalmente coleópteros y ortópteros), ranas, los siguientes mamíferos: Apodemus sp. (Ratón), Arvicola sapidus (Rata de agua, también llamado Ratón aguadero), Crocidura sp. (Musaraña) y "Pytimis" (llamado así por el autor, siendo posiblemente el actual géne...

  9. D-MSR: A Distributed Network Management Scheme for Real-Time Monitoring and Process Control Applications in Wireless Industrial Automation

    Science.gov (United States)

    Zand, Pouria; Dilo, Arta; Havinga, Paul

    2013-01-01

    Current wireless technologies for industrial applications, such as WirelessHART and ISA100.11a, use a centralized management approach where a central network manager handles the requirements of the static network. However, such a centralized approach has several drawbacks. For example, it cannot cope with dynamicity/disturbance in large-scale networks in a real-time manner and it incurs a high communication overhead and latency for exchanging management traffic. In this paper, we therefore propose a distributed network management scheme, D-MSR. It enables the network devices to join the network, schedule their communications, establish end-to-end connections by reserving the communication resources for addressing real-time requirements, and cope with network dynamicity (e.g., node/edge failures) in a distributed manner. According to our knowledge, this is the first distributed management scheme based on IEEE 802.15.4e standard, which guides the nodes in different phases from joining until publishing their sensor data in the network. We demonstrate via simulation that D-MSR can address real-time and reliable communication as well as the high throughput requirements of industrial automation wireless networks, while also achieving higher efficiency in network management than WirelessHART, in terms of delay and overhead. PMID:23807687

  10. D-MSR: a distributed network management scheme for real-time monitoring and process control applications in wireless industrial automation.

    Science.gov (United States)

    Zand, Pouria; Dilo, Arta; Havinga, Paul

    2013-06-27

    Current wireless technologies for industrial applications, such as WirelessHART and ISA100.11a, use a centralized management approach where a central network manager handles the requirements of the static network. However, such a centralized approach has several drawbacks. For example, it cannot cope with dynamicity/disturbance in large-scale networks in a real-time manner and it incurs a high communication overhead and latency for exchanging management traffic. In this paper, we therefore propose a distributed network management scheme, D-MSR. It enables the network devices to join the network, schedule their communications, establish end-to-end connections by reserving the communication resources for addressing real-time requirements, and cope with network dynamicity (e.g., node/edge failures) in a distributed manner. According to our knowledge, this is the first distributed management scheme based on IEEE 802.15.4e standard, which guides the nodes in different phases from joining until publishing their sensor data in the network. We demonstrate via simulation that D-MSR can address real-time and reliable communication as well as the high throughput requirements of industrial automation wireless networks, while also achieving higher efficiency in network management than WirelessHART, in terms of delay and overhead.

  11. New Data on the Life of the Peruvian-Bolivian Composer Pedro Ximénez-Abrill Tirado (1784-1856

    Directory of Open Access Journals (Sweden)

    José Manuel Izquierdo König

    2017-07-01

    Full Text Available Since the mid-nineteenth century the name of Pedro Ximénez Abrill Tirado has been known in musicological and historiographical studies. However, his role and relevance as composer has been acknowledged only recently in the study of historical repertoires of South America, with the discovery of scores containing his music in a private collection in Bolivia, which was later acquired by various archives and individuals. In spite of this, biographical accounts on him have kept using the same information for decades, and mythical constructions have increased rapidly during the last decade. This paper presents a new biographical picture of Pedro Ximénez, with a broader understanding of the context surrounding his life and works along with the transition of his life between Peru and Bolivia, on the basis of important new sources gathered by both authors through research in various archives.

  12. The molten salt reactors (MSR) pyro chemistry and fuel cycle for innovative nuclear systems; Congres sur les reacteurs a sels fondus (RSF) pyrochimie et cycles des combustibles nucleaires du futur

    Energy Technology Data Exchange (ETDEWEB)

    Brossard, Ph. [GEDEON, Groupement de Recherche CEA CNRS EDF FRAMATOME (France); Garzenne, C.; Mouney, H. [and others

    2002-07-01

    In the frame of the studies on next generation nuclear systems, and especially for the molten salt reactors and for the integrated fuel cycle (as IFR), the fuel cycle constraints must be taken into account in the preliminary studies of the system to improve the cycle and reactor optimisation. Among the purposes for next generation nuclear systems, sustainability and waste (radio-toxicity and mass) management are important goals. These goals imply reprocessing and recycling strategies. The objectives of this workshop are to present and to share the different strategies and scenarios, the needs based on these scenarios, the experimental facilities available today or in the future and their capabilities, the needs for demonstration. It aims at: identifying the needs for fuel cycle based on solid fuel or liquid fuel, and especially, the on-line reprocessing or clean up for the molten salt reactors; assessing the state-of-the-art on the pyro-chemistry applied to solid fuel and to present the research activities; assessing the state-of-the-art on liquid fuels (or others), and to present the research activities; expressing the R and D programs for pyro-chemistry, molten salt, and also to propose innovative processes; and proposing some joint activities in the frame of GEDEON and PRACTIS programs. This document brings together the transparencies of 18 contributions dealing with: scenario studies with AMSTER concept (Scenarios, MSR, breeders (Th) and burners); fuel cycle for innovative systems; current reprocessing of spent nuclear fuel (SNF) in molten salts (review of pyro-chemistry processes (non nuclear and nuclear)); high temperature NMR spectroscopies in molten salts; reductive extraction of An from molten fluorides (salt - liquid metal extraction); electrochemistry characterisation; characterisation with physical methods - extraction coefficient and kinetics; electrolytic extraction; dissolution-precipitation of plutonium in the eutectic LiCl-KCl (dissolution and

  13. Lei nº 2.880, de 4 de abril de 1963 | Decreto 4.846, de 25 de setembro de 1967

    Directory of Open Access Journals (Sweden)

    Marta Maria Araujo

    2018-04-01

    Full Text Available Nos governos de Aluizio Alves (1961-1966 e de Monsenhor Walfredo Gurgel (1966-1971, respectivamente, no Estado do Rio Grande do Norte, foram criados o Instituto “Padre Miguelinho” (1963 e o Colégio Estadual “Winston Churchill” (1967 na capital Natal. O Instituto “Padre Miguelinho abrangia quatro unidades educacionais: Jardim de Infância “Professor Anfilóquio Câmara”; Grupo Escolar “Professor Luís Soares”; Colégio Estadual do Alecrim e o Ginásio Industrial. O Colégio Estadual “Winston Churchill” compreendia o Ensino Médio com o 1° e 2° ciclos (ginasial e colegial. Nesta Seção de Documento da Revista Educação em Questão, o Conselho Editorial publica a Lei n° 2.880, de 4 de abril de 1963, que criou o Instituto “Padre Miguelinho e o Decreto n° 4.846, de 25 de setembro de 1967, que criou o Colégio Estadual “Winston Churchill”, para fins de estudo e pesquisa de Historiadores da Educação.

  14. Estrategias para el desarrollo turístico del cantón Bolívar post terremoto del 16 de abril (Ecuador

    Directory of Open Access Journals (Sweden)

    Nelson García Reinoso

    2016-12-01

    Full Text Available La presente investigación tiene como objetivo general determinar estrategias que contribuyan al desarrollo turístico del cantón Bolívar, provincia de Manabí, Ecuador afectado por el terremoto del pasado 16 de abril.  Se analizó comparativamente varias metodologías de diferentes autores, que tributan a la identificación de estrategias. Las diferentes   técnicas   y herramientas   utilizadas   (observación, encuesta, entrevista, FODA, permitieron identificar las estrategias a implementar para promover el desarrollo turístico. La metodología propuesta se conforma por tres fases: el diagnostico turístico situacional del territorio; análisis de la gestión turística y su planificación estratégica que posibilitaron la identificación de siete estrategias centradas en el fortalecimiento de la actividad turística sostenible de cantón,  establecimiento de un sistema adecuado de gobernanza turística, desarrollo de productos y servicios locales, fortalecer la promoción, comercialización, capacitación y establecimiento de mecanismos financieros, que permitan la ejecución de los ocho programas definidos. Palabras clave: Desarrollo turístico, estrategias de intervención.

  15. O discurso político da agroecologia no MST: O caso do Assentamento 17 de Abril em Eldorado dos Carajás, Pará

    Directory of Open Access Journals (Sweden)

    Caetano De’ Carli

    2013-10-01

    Full Text Available O presente artigo visa debater a agroecologia enquanto discurso político. Parte‑se das pesquisas de Altieri, Nichols, Gliessman, Gúzman, Cristoffoli, entre outros autores, para evidenciar as trajetórias da agroecologia enquanto ciência e as tentativas da sua materialização em áreas da reforma agrária. Após essas perspectivas, aborda‑se a agroecologia na prática política do Movimento dos Trabalhadores Rurais Sem‑Terra, tanto no que se refere às suas experiências‑modelos como ao discurso político que assume, em contraposição com o modelo hegemônico da Revolução Verde. Por fim, debruça‑se sobre o caso do Assentamento 17 de Abril em Eldorado dos Carajás, ressaltando como esse discurso político representa uma importante estratégia do MST em relação a uma mudança de paradigma na mentalidade dos assentados e das lideranças locais do movimento, destacando ser esse um importante passo para a materialização de produções agropecuárias alternativas nas áreas de reforma agrária no Brasil.

  16. Objetivo 2.000: un mundo sin poliomielitis, día mundial de la salud: 7 de abril de 1995

    Directory of Open Access Journals (Sweden)

    Gómez S. Consuelo

    1995-06-01

    Full Text Available

    Con ocasión de la celebración del día mundial de la salud, la Organización Mundial de la Salud lanzó como meta para inicio del próximo milenio la erradicación total de la poliomielitis. En la celebración efectuada por el Ministerio de Salud se dio un testimonio en lo concerniente a Colombia, durante 1994 se declaró erradicada la poliomielitis del territorio nacional. El 7 de abril se efectuó una jornada de análisis de la experiencia; se efectuó una presentación del proceso a lo largo de las dos últimas décadas, rindieron testimonio diferentes  actores de la empresa liberadora del polio a la niñez colombiana: los gestores de la política nacional, los creadores de los programas y campañas de vacunación, los agentes de los medios de comunicación, los ejecutores de los procesos, funciones y tareas. Colombia ha cumplido la meta antes de finalizar el plazo fijado. Ahora en rumba sus esfuerzos a la erradicación del sarampión y del tétanos neonatal.

  17. Pharmacological characterization of [trans-5'-(4-amino-7,7-dimethyl-2-trifluoromethyl-7H-pyrimido[4,5-b][1,4]oxazin-6-yl)-2',3'-dihydrospiro(cyclohexane-1,1'-inden)-4-yl]acetic acid monobenzenesulfonate (JTT-553), a novel acyl CoA:diacylglycerol transferase (DGAT) 1 inhibitor.

    Science.gov (United States)

    Tomimoto, Daisuke; Okuma, Chihiro; Ishii, Yukihito; Akiyama, Yoshiyuki; Ohta, Takeshi; Kakutani, Makoto; Ohkuma, Yoshiaki; Ogawa, Nobuya

    2015-01-01

    Acyl CoA:diacylglycerol acyltransferase (DGAT) 1 is an enzyme that catalyzes the final step in triglyceride (TG) synthesis. This enzyme is considered to be a potential therapeutic target for obesity and diabetes. Here, results of an investigation of the pharmacological effects of JTT-553 [trans-5'-(4-amino-7,7-dimethyl-2-trifluoromethyl-7H-pyrimido[4,5-b][1,4]oxazin-6-yl)-2',3'-dihydrospiro(cyclohexane-1,1'-inden)-4-yl]acetic acid monobenzenesulfonate, a novel DGAT1 inhibitor, are reported. To measure the inhibitory activity of JTT-553 against DGAT1, TG synthesis using [(14)C]-labeled oleoyl-CoA was evaluated. Similarly, the inhibitory activity of JTT-553 against DGAT2, an isozyme of DGAT1, and acyl-CoA cholesterol acyltransferase (ACAT) 1, which is highly homologous to DGAT1, were evaluated. JTT-553 selectively inhibited human DGAT1 and showed comparable inhibitory effects on the activity of human, rat, and mouse DGAT. In vivo, JTT-553 suppressed plasma TG and chylomicron TG levels after olive oil loading in Sprague-Dawley (SD) rats. JTT-553 also inhibited TG synthesis in epididymal fat after [(14)C] oleic acid injection in C57BL/6J mice. Food intake was evaluated in SD rats fed 3.1%, 13%, or 35% (w/w) fat diets. In rats fed the 35% fat diet, JTT-553 reduced food intake. This reduction of food intake was observed 2 h after feeding, lasted for 24 h, and correlated with dietary fat content. Furthermore, JTT-553 reduced daily food intake and body weight gain in diet-induced obese rats after 4-week repeated administration. JTT-553 exerted multiple effects on intestinal fat absorption, adipose fat synthesis, and food intake, and consequently induced body weight reduction. Therefore, JTT-553 is expected to be an effective novel therapeutic agent for the treatment of obesity.

  18. Comportamiento clínico epidemiológico de las lesiones bucales en pacientes VIH/SIDA. Artemisa. Enero-Abril 2015

    Directory of Open Access Journals (Sweden)

    Arahí Gómez Casañas

    2016-02-01

    Full Text Available Objetivo: Caracterizar el comportamiento clínico epidemiológico de las lesiones bucales en los pacientes con diagnóstico serológico confirmado de VIH/SIDA, para determinar la prevalencia de lesiones bucales en la población estudiada. Caracterizar la población de estudio según sexo, edad, tiempo de diagnóstico, presencia y tipo de lesiones bucales. Método: Se realizó un estudio observacional, descriptivo, de corte transversal, con los pacientes diagnosticados con VIH/SIDA que acudieron a su consulta de seguimiento del policlínico Tomás Romay, Artemisa en el período de Enero -Abril de 2015, el universo fue de 69 pacientes con diagnóstico confirmado de VIH/SIDA, se tomó una muestra de 25 pacientes que cumplían los criterios de inclusión. Se les realizó un exhaustivo interrogatorio y examen clínico bucal, previo consentimiento informado de los pacientes. Resultados: Del total de pacientes estudiados, el 64% presentó alguna lesión bucal; el 72% de la muestra perteneció al sexo masculino y al grupo de edad de 26 a 35 años; las lesiones bucales predominantes fueron la candidiasis bucal (24.0% seguido del eritema gingival lineal (12.0% ubicándose el mayor número de pacientes con estas lesiones (16%, en el grupo de más de 5 años de diagnóstico. Conclusiones: Se encontró una elevada prevalencia de lesiones bucales en la población objeto de estudio, con predominio del sexo masculino, en el grupo de edad de 26 a 35 años, siendo la candidiasis bucal y el eritema gingival lineal, las dos lesiones más frecuentemente encontradas en la muestra.

  19. Unravelling Local Atomic Order of the Anionic Sublattice in M(Al1-x Gax )4 with M=Sr and Ba by Using NMR Spectroscopy and Quantum Mechanical Modelling.

    Science.gov (United States)

    Pecher, Oliver; Mausolf, Bernhard; Peters, Volker; Lamberts, Kevin; Korthaus, Alexander; Haarmann, Frank

    2016-12-05

    The quasibinary section of the intermetallic phases MAl 4 and MGa 4 with M=Sr and Ba have been characterised by means of X-ray diffraction (XRD) studies and differential thermal analysis. The binary phases show complete miscibility and form solid solutions M(Al 1-x Ga x ) 4 with M=Sr and Ba. These structures crystallise in the BaAl 4 structure type with four- and five-bonded Al and/or Ga atoms (denoted as Al(4b), Al(5b), Ga(4b), and Ga(5b), respectively) that form a polyanionic Al/Ga sublattice. Solid state 27 Al NMR spectroscopic analysis and quantum mechanical (QM) calculations were applied to study the bonding of the Al centres and the influence of Al/Ga substitution, especially in the regimes with low degrees of substitution. M(Al 1-x Ga x ) 4 with M=Sr and Ba and 0.925≤x≤0.975 can be described as a matrix of the binary majority compound in which a low amount of the Ga atoms has been substituted by Al atoms. In good agreement with the QM calculations, 27 Al NMR investigations and single crystal XRD studies prove a preferred occupancy of Al(4b) for these substitution regimes. Furthermore, two different local Al environments were found, namely isolated Al(4b1) atoms and Al(4b2), due to the formation of Al(4b)-Al(4b) pairs besides isolated Al(4b) atoms within the polyanionic sublattice. QM calculations of the electric field gradient (EFG) using superlattice structures under periodic boundary conditions are in good agreement with the NMR spectroscopic results. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Entre rios e ruas: água, açude e tragédia em uma cidade do agreste potiguar (Santa Cruz, 1º de abril de 1981)

    OpenAIRE

    Bezerra, Islândia Marisa Santos

    2014-01-01

    Na noite do dia primeiro de abril de 1981, a cidade de Santa Cruz foi tomada por uma inundação que destruiu o sangradouro do açude Santa Cruz e de boa parte da cidade, fazendo com que a população das áreas mais baixas abandonasse suas casas. Residências e ruas mais próximas ao açude, ao rio Trairi e ao riacho do Pecado foram totalmente afetadas, sendo muitas das casas e prédios públicos completamente destruídos. Localizada no interior do estado do Rio Grande do Norte, a cida...

  1. CASOS DE INFECCIÓN POR GRIPE PANDÉMICA A (H1N1) 2009 HOSPITALIZADOS EN UCI EN ESPAÑA: FACTORES ASOCIADOS A RIESGO DE MUERTE, ABRIL 2009-ENERO 2010

    OpenAIRE

    Patricia Santa-Olalla Peralta; Marta Cortes García; Aurora Limia Sánchez; Josefa Andrés Prado; Isabel Pachón del Amo; Mª José Sierra Moros

    2010-01-01

    Fundamento: El análisis de los casos graves de gripe pandémica es necesario para identificar grupos de población vulnerables y adecuar las políticas de prevención y control. Se analizan las características clínicas y epidemiológicas así como los factores asociados a riesgo de muerte en los casos de infección por virus pandémico (H1N1) 2009 hospitalizados en unidades de cuidados intensivos (UCI) en España y notificados entre el 24 de abril de 2009 y el 31 de enero de 2010. Métodos: En el marco...

  2. Queratocono: Caracterización clínico epidemiológica y topográfica. Consulta de Córnea. Sancti Spíritus, Abril - Octubre 2013.

    Directory of Open Access Journals (Sweden)

    Bárbara de la Luz Hernández Rodríguez

    2015-12-01

    Full Text Available El queratocono constituye una de las distrofias corneales de etiología no precisada, caracterizada por una ectasia no inflamatoria y vascular de la córnea, se manifiesta en la adolescencia y adultos jóvenes dando lugar a un adelgazamiento corneal y disminución de la agudeza visual a causa del desarrollo de un astigmatismo miópico irregular, con el objetivo de describir las características clínicas, epidemiológicas y topográficas de pacientes con queratocono atendidos en la consulta de Córnea del Hospital General “Camilo Cienfuegos” de Sancti-Spíritus, en el periodo comprendido entre Abril y Octubre del 2013. Se realizó un estudio descriptivo transversal. La muestra quedó conformada por 29 pacientes (58 ojos con criterios de inclusión. Predominó el sexo femenino entre 20 y 29 años. La visión borrosa fue el síntoma principal. El mayor número de pacientes presentó un queratocono avanzado con signos corneales y paquimetría por debajo de 400 µm. Se encontró una estrecha relación entre el grado de severidad del queratocono, los signos clínicos predominantes, los valores de la paquimetría y el patrón topográfico central asimétrico.

  3. Intoxicación alimentaria por consumo de carne de caimán negro (Melanosuchus niger en el internado indígena de Nazareth, Amazonas, abril de 1997

    Directory of Open Access Journals (Sweden)

    Martha C. Suárez

    2000-03-01

    Full Text Available Las intoxicaciones alimentarias son ocasionadas por consumo de alimentos en malas condiciones de preparación o de conservación o que han sufrido contaminación con agentes quimicos, fisicos o biológicos. La reciente incorporación de la vigilancia de este evento en el sistema de vigilancia intensificado de la Secretaria de Salud del Amazonas, ha permitido identificar la presencia de brotes de intoxicación alimentaria en el departamento. En abril de 1997, se informó a la Oficina de Epidemiologia de la Secretaria de Salud del Amazonas, la llegada de 30 pacientes al Hospital Empresa Social del Estado San Rafael de Leticia, con un cuadro clinico de dolor abdominal, vómito y cefalea. Las pacientes eran estudiantes adolescentes del internado indígena femenino de Nazareth, que presentaban como antecedente común la ingestión de pescado recalentado el día anterior a su consulta. En la investigación del presente brote de intoxicación alimentaria se comprobó por laboratorio que el alimento implicado era la carne de caimán negro, Melanosuchusniger, contaminada con Bacillus cereus. Esta carne iba a ser vendida como 'pescado seco' en Bogotá, por la gran demanda que tiene este alimento en la época de Semana Santa.

  4. El mundo del libro : abril de 1968

    Directory of Open Access Journals (Sweden)

    Agustín Rodríguez Garavito

    1968-04-01

    Full Text Available Se presentan reseñas de los siguiente autores y textos: -Echeverri Mejía, Óscar. Diccionario abreviado de la lengua española -Vergara, Hernán. El complejo de layo -León Rey, José Antonio. Díalogos extraordinario -Administración y desarrollo -Cortés ahumada, Ernesto. Los Amantes -Nannetti Concha, Guillermo. Código de ética administrativa -Uslar Pietri, Arturo. Barrabás y otros cuentos

  5. El mundo del libro: Abril de 1966

    Directory of Open Access Journals (Sweden)

    Agustín Rodríguez Garavito

    1966-04-01

    Full Text Available El documento presenta las reseñas de los siguientes títulos: EL BUEN SALVAJE-Por Eduardo Caballero Calderón. Premio NADAL 1965-Ediciones Ancora y Delfín. GUAYACAN-Novela-Premio Esso 1964. LOS SILENCIOS-Por David Mejía Velilla-Bogotá, 1966. SOCAVÓN-Por Helcías Martán G6ngora. ¿QUE SABEMOS DE LA PLANIFICACIÓN?-Por Albert Waterston-Ediciones Tercer Mundo. DE LA ENTRAÑA A LA PIEL-Mario H. Perico Ramírez- Imprenta Departamental de Boyacá-Colombia.

  6. Seasonal distribution and evolving forms of multiple sclerosis patients diagnosed from April 2004 to November 2007 Distribución estacional y formas evolutivas de esclerosis múltiple en pacientes diagnosticados entre Abril del 2004 y Noviembre del 2007

    Directory of Open Access Journals (Sweden)

    Hermes Fundora-Hernández

    2009-09-01

    Full Text Available BACKGROUND: Multiple sclerosis (MS was first reported in Cuba in 1965. The most frequent appearance is observed in the first six months of the year. OBJECTIVE: To determine the seasonal distribution and evolving forms of MS patients diagnosed with the disease between April 2004 and November 2007. METHOD: Twenty-one patients with suspected MS and 42 outbreaks were studied. Patients were classified according to Lublin and Revingold's criteria for clinical forms and according to McDonald. RESULTS: Most patients were classified in outbreak and remission and only two patients classified as primary-progressive multiple sclerosis. The higher number of outbreaks occurred in the first two quarters of the year. CONCLUSION: It is recommended to study further weather variables that may be related to the emergence of these outbreaks in our environment.INTRODUCCIÓN: La esclerosis múltiple (EM fue reportada en Cuba por primera vez en 1965. Se ha venido observando la aparición más frecuente en los primeros seis meses del año. OBJETIVO: Determinar la distribución estacional y formas evolutivas de EM en pacientes con diagnóstico de esta enfermedad entre abril 2004 y noviembre 2007. MÉTODO: Se estudiaron 21 pacientes con sospecha de EM y un total de 42 brotes. Los pacientes fueron clasificados según los criterios de Lublin y Revingold para las formas evolutivas y según los criterios de McDonald. RESULTADOS: Solo dos pacientes clasificaron en la forma evolutiva progresiva primaria; los primeros dos trimestres del año fueron los de mayor número de brotes. CONCLUSIÓN: Se recomienda profundizar en las variables climatológicas que pudieran tener vínculo con la aparición de estos brotes en nuestro medio.

  7. Wykorzystanie informacji prospektywnychw sprawozdawczości finansowej zorientowanejna wartość na przykładzie MSR 36„Utrata wartości aktywów”

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2009-12-01

    Full Text Available Autorzy artykułu wskazują na istotę i rosnące znaczenie informacji prospektywnych we współczesnych systemach sprawozdawczości finansowej opartej na MSSF. Ewolucja dokonująca się w sprawozdawczości finansowej, pod wpływem harmonizacji zasad rachunkowości wskutek ciągle zmieniających się MSSF, została przedstawiona na tle zmian dokonujących się w otoczeniu, w celach i w systemach zarządzania (orientacja strategiczna, wartość przedsiębiorstwa, jak również w systemach strategicznej rachunkowości zarządczej. Na podstawie szerokiego kontekstu analizy autorzy stawiają wniosek, że koncepcja wartości (przedsiębiorstwa stanowi istotny element systemu pomiaru i wyceny w systemie sprawozdawczości finansowej. Tworzy ona także spójną podstawę dla integracji rachunkowości zarządczej i rachunkowości finansowej w jeden system zapewniający użyteczne informacje zarówno dla użytkowników zewnętrznych, jak i wewnętrznych, których łączy wspólny cel – maksymalizacja wartości. Uwarunkowania tworzenia systemu sprawozdawczości opartego na informacjach prospektywnych, zorientowanego na wartość, jak również stopień dostosowania przedsiębiorstw do jego wdrożenia pokazano na przykładzie praktycznej realizacji postanowień MSR 36.

  8. CASOS DE INFECCIÓN POR GRIPE PANDÉMICA A (H1N1 2009 HOSPITALIZADOS EN UCI EN ESPAÑA: FACTORES ASOCIADOS A RIESGO DE MUERTE, ABRIL 2009-ENERO 2010

    Directory of Open Access Journals (Sweden)

    Patricia Santa-Olalla Peralta

    2010-01-01

    Full Text Available Fundamento: El análisis de los casos graves de gripe pandémica es necesario para identificar grupos de población vulnerables y adecuar las políticas de prevención y control. Se analizan las características clínicas y epidemiológicas así como los factores asociados a riesgo de muerte en los casos de infección por virus pandémico (H1N1 2009 hospitalizados en unidades de cuidados intensivos (UCI en España y notificados entre el 24 de abril de 2009 y el 31 de enero de 2010. Métodos: En el marco de la estrategia nacional de vigilancia de casos hospitalizados por gripe pandémica se recogió, a nivel nacional, información clínica y epidemiológica individualizada de todos los casos hospitalizados en UCI por infección por virus pandémico (H1N1 2009. Resultados: De los 1.231 casos ingresados en una UCI 271 fallecieron (letalidad: 22%. La mediana de edad fue 40 años (rango: 0-90. Un total de 838 (76,3% pacientes presentaban alguna patología subyacente, siendo la respiratoria la más frecuente (34,1%, seguida en adultos de la obesidad mórbida (18,8%. Un 93,1% recibió tratamiento antiviral y un 25,6% (n=231 lo recibió en 48 horas desde el inicio de síntomas. En el análisis multivariante el cáncer (OR 2,71; IC95% 1,44-5,1, las inmunodeficiencias (OR 2,25; IC95% 1,29-3,92 y la obesidad mórbida (OR 1,79; IC95% 1,13- 2,85 estaban asociados significativamente a muerte en los adultos. Conclusiones: Las conclusiones deben estar relacionadas con los resultados: La mortalidad de los pacientes adultos ingresados en la UCI por gripe (H1N1 2009 estuvo asociada a la coexistencia de cáncer, inmunodeficiencia y obesidad mórbida. En el caso de los niños estaban significativamente asociados al riesgo de fallecimiento la presencia de cáncer, las inmunodeficiencias y los trastornos convulsivos.

  9. Review of ORNL's MSR technology and status

    International Nuclear Information System (INIS)

    Toth, L.M.; Gat, U.; Del Cul, G.D.; Dai, S.; Williams, D.F.

    1996-01-01

    The current status of molten salt reactor development is discussed with reference to the experience from the Oak Ridge Molten Salt Reactor Experiment. Assessment of the future for this reactor system is reviewed with consideration of both advantages and disadvantages. Application of this concept to ADTT (accelerator driven transmutation technology) needs appears to be feasible by drawing on the MSRE experience. Key chemical considerations remain as: solubility, redox behavior, and chemical activity and their importance to ADTT planning is briefly explained. Priorities in the future development of molten salts for these applications are listed, with the foremost being the acceptance of the 2LiF-BeF 2 solvent system. 8 refs, 2 figs

  10. Descripción de un brote de leptospirosis en la ciudad de Santa Fe, Argentina, marzo-abril de 1998 Description of a leptospirosis outbreak in the city of Santa Fe, Argentina, March-April 1998

    Directory of Open Access Journals (Sweden)

    Norma B. Vanasco

    2000-01-01

    Full Text Available En marzo-abril de 1998 se identificó en un barrio de la ciudad de Santa Fe (Argentina un brote de una enfermedad aguda caracterizada por fiebre, cefaleas y mialgias intensas. Se presentan los estudios realizados en relación con este brote y los intentos de identificación de la fuente y del modo de transmisión. Los hallazgos epidemiológicos, serológicos y clínicos indicaron que el agente causal fue Leptospira interrogans. Como prueba de tamizaje se aplicó la técnica de aglutinación macroscópica con antígeno termorresistente, seguida de la prueba de ELISA y, como prueba de confirmación, la aglutinación microscópica frente a 10 serovariedades de L. interrogans. Se estudiaron 32 individuos, 8 perros y 8 muestras de agua. Se registraron 12 casos confirmados, 2 probables y 18 negativos. En seis perros se demostró la existencia de infección y en las muestras de agua se detectó la presencia de espiroquetas móviles. Los sueros humanos reaccionaron con las serovariedades ballum, canicola, icterohaemorrhagiae y pyrogenes, y los caninos con ballum, canicola y pomona. La coaglutinación observada en todos los casos confirmados indica que se trató de casos agudos de leptospirosis, pero no permite identificar la serovariedad causal. Salvo en el caso índice, no se reconoció clínicamente la enfermedad. Varios hechos sugieren que la causa del brote fue la inundación pluvial de la zona estudiada. Los resultados de este estudio resaltan la necesidad de una vigilancia activa de la leptospirosis ante desastres naturales como las inundaciones.In March-April 1998 in a neighborhood in the city of Santa Fe, Argentina, there was an outbreak of an acute disease characterized by fever, headaches, and intense myalgias. This article presents the studies surrounding this outbreak and the attempts to identify the source and the mode of transmission. The epidemiological, serological, and clinical findings indicated that the causative agent was Leptospira

  11. Avaliação epidemiológica dos traumas faciais em pacientes idosos atendidos na Área de Cirurgia Buco-maxilo-facial da FOP-UNICAMP no período de abril de 1999 à dezembro de 2012

    OpenAIRE

    Castelo Pedro Vemba Cidade

    2013-01-01

    Resumo: Estudos atuais demonstram um aumento da população idosa mundial. No Brasil os idosos representam cerca de 9% da população, sendo aproximadamente 21 milhões de pessoas com mais de 60 anos. Este trabalho analisou características epidemiológicas de pacientes idosos vítimas de trauma de face atendido pela Área de Cirurgia Buco-Maxilo-Facial da Faculdade de Odontologia de Piracicaba (FOP) - Unicamp, na cidade de Piracicaba e região, no período de abril de 1999 a dezembro de 2012. A análise...

  12. Evaluación del tratamiento "C.R.A." en pacientes que asisten al área de adicciones del Centro de Rehabilitación de Alcohólicos de Cuenca, período abril-septiembre de 2002

    OpenAIRE

    Cabrera Orellana, Patricio Eduardo; Pintado Sacaquirin, César Manuel

    2003-01-01

    Se evaluó la eficacia del "Modelo CRA" de tratamiento para adictos al alcohol que asistieron al Área de Adicciones del Centro de Reposo y Adicciones [Antiguo Centro de Rehabilitación del Alcohólicos]. De Cuenca, en el período Abril-Septiembre de 2002 y comparar con otros resultados que han utilizado similar metodología. La eficacia se midió en función de la capacidad del modelo para cambiar algunas actitudes, pensamientos y sentimientos, medidos al ingreso y después de un mes de intervención,...

  13. “Resúmenes de la 5a Reunión de Egresados del Instituto de Investigaciones Médicas y la 1a del Área de Ciencias de la Salud de la Universidad de Guanajuato” Abril 13 – 15, 2005. León, Gto.

    Directory of Open Access Journals (Sweden)

    Leticia Soto Franco

    2012-02-01

    Full Text Available Del 13 al 15 de Abril de 2005 se efectuó la 5ª Reunión de egresados del Instituto de Investigaciones Médicas, que en una nueva tradición es además la 1ª Reunión de Ciencias de la Salud de la Universidad de Guanajuato. Esta iniciativa busca un intercambio de experiencias académicas. Examinando el contenido temático, encontramos áreas de interés común para grupos diferentes. Es deseable que cada unidad, conservando la independencia de sus líneas y proyectos alcancen nuevos niveles de intercambio para mayor eficiencia de sus programas.

  14. [Various report forms and letters regarding Abril 1-1

    Energy Technology Data Exchange (ETDEWEB)

    Various

    2007-08-16

    The documents described here and the following may be found at the Website of the State of California Department of Conservation, Division of Oil, Gas & Geothermal Resources, http://www.consrv.ca.gov/DOG/geothermal/unit_15/Unit15.htm. GEO Operator Corporation (formerly Thermogenics, Inc. and Geothermal Resources International Operator Corporation) drilled steam production and injection wells in the northwestern portion of The Geysers geothermal field from 1967 to 1985. These wells produced steam that was sold to PG&E's power plant 15. In 1989, the plant stopped operating so the wells stopped producing and GEO Operator Corporation went bankrupt. In 1997-1998, the U.S. Environmental Protection Agency and the Division of Oil, Gas, and Geothermal Resources, with funding from the California Energy Commission, plugged and abandoned most of these idle wells because of severe wellhead corrosion. Technical data and well cuttings were salvaged from an abandoned warehouse on the GEO Operator Corporation lease. These data have recently been scanned and added to the Division's existing scanned well records. The data are unique because GEO Operator Corporation performed an unusually high number of studies, well tests, and analyses. A total of over 10,300 pages and over 340 logs are included in the scans. The reservoir engineering section alone contains over 3,300 pages of reservoir characterization, well testing, and related studies. These data will be useful to the operators at The Geysers Geothermal field, as well as the public and researchers worldwide.

  15. No. 43 - Abril/Junio 1992 / PUBLICACIONES ICESI

    OpenAIRE

    Sicard Ramírez, Jaime; Vargas Quiñones, Martha Elena; Aldana de Vega, Luzángela; Urrea Cortavarria, Amalia; Pérez Uribe, Rafael Ignacio; Ochoa Díaz, Francisco Héctor; Coate, L. Edwin; González Zamora, José Hipólito

    2010-01-01

    Esta revista provee acceso libre inmediato a su contenido bajo el principio de que hacer disponible gratuitamente la investigación al publico, lo cual fomenta un mayor intercambio de conocimiento global. Libertad, ciencia y eficiencia : objetivos de la gerencia universitaria, Sicard Ramírez, Jaime -- Calidad total en la Universidad de la Sabana : un modelo a desarrollar, Vargas Quiñones, Martha Elena ; Aldana de Vega, Luzángela -- Concepto de calidad en EAFIT, Urrea Co...

  16. [Various report forms and letters regarding Abril 1-2

    Energy Technology Data Exchange (ETDEWEB)

    Various

    2007-08-16

    The documents described here and the following may be found at the Website of the State of California Department of Conservation, Division of Oil, Gas & Geothermal Resources, http://www.consrv.ca.gov/DOG/geothermal/unit_15/Unit15.htm. GEO Operator Corporation (formerly Thermogenics, Inc. and Geothermal Resources International Operator Corporation) drilled steam production and injection wells in the northwestern portion of The Geysers geothermal field from 1967 to 1985. These wells produced steam that was sold to PG&E's power plant 15. In 1989, the plant stopped operating so the wells stopped producing and GEO Operator Corporation went bankrupt. In 1997-1998, the U.S. Environmental Protection Agency and the Division of Oil, Gas, and Geothermal Resources, with funding from the California Energy Commission, plugged and abandoned most of these idle wells because of severe wellhead corrosion. Technical data and well cuttings were salvaged from an abandoned warehouse on the GEO Operator Corporation lease. These data have recently been scanned and added to the Division's existing scanned well records. The data are unique because GEO Operator Corporation performed an unusually high number of studies, well tests, and analyses. A total of over 10,300 pages and over 340 logs are included in the scans. The reservoir engineering section alone contains over 3,300 pages of reservoir characterization, well testing, and related studies. These data will be useful to the operators at The Geysers Geothermal field, as well as the public and researchers worldwide.

  17. Libros colombianos raros y curiosos: abril de 1963

    Directory of Open Access Journals (Sweden)

    Ignacio Rodríguez Guerrero

    1963-04-01

    Full Text Available El documento presenta la reseña del titulo: POMBO RAFAEL (1833-1912 - "Sonetos satírico-políticos olvidades". En Pérez y Soto Juan Bautista (1854-1926: Caro y su desprecio. Cit. supra. Cap. XXV.

  18. Cruz y raya en los libros: Abril de 1966

    Directory of Open Access Journals (Sweden)

    Ernesto Cortés Ahumada

    1966-04-01

    Full Text Available PERICO RAMIREZ, MARIO. De la entraña a la piel. Introducción de Eduardo Mendoza Varela. Tunja. Fondo Rotatorio de Publicaciones de la Contraloría Departamental. 1966, 246 p. He aquí un libro en extremo individual porque todo cuanto dice es algo personal, en el sentido de que si bien en ninguna parte nos cuenta hechos de la propia vida del autor, con vehemente intensidad, en cambio, nos describe, nos deja ver puro desnudo su yo temperamental. Mejor aún: nos lo avienta apostrofador e increpante.

  19. Episode of Low Level Jets in the north and northeast coast of state of Para: a case study of 2002 april 21st to 22nd Episódio de jatos de baixos níveis no litoral norte e nordeste do estado do Pará: um estudo de caso de 21-22 de abril de 2002

    Directory of Open Access Journals (Sweden)

    Adriano Marlisom Leão Sousa

    2008-09-01

    Full Text Available In this study the characteristics of the vertical structure of an episode of Low Level Jets (LLJ occurring in the coast of Para is described. Radiosonde data of Ajuruteua city in Bragança collected during the DESMATA Experiment (Impact of the Deforestation the Atlantic Coast of the Amazonian, taking place in 2002, from April 08th to 22th, are used. Among the detected cases during the rainy period, one specific case with 12 hours duration, average velocity of 15m/s and directed from NE to E in the point of maximum velocity was selected. The observational results have indicated that this LLJ located in the coast of Para was due to the combined action of two factors: (1 inertial oscillation and (2 superficial baroclinicity. These two combined factors sustained this LLJ with velocities between 10 and 13m/s during the day and between 14 and 16m/s during the night, at an average altitude of 800m above surface.Neste estudo descreve-se as características da estrutura vertical de um episódio de Jatos de Baixos Níveis (JBN ocorrido no litoral do Pará, utilizando-se para tal, dados das radiossondagens de Ajuruteua, Município de Bragança coletados durante o experimento DESMATA (Impacto do Desmatamento Junto ao Litoral Atlântico da Amazônia realizado no período de 08 a 22 de abril de 2002. Dentre os casos detectados no período chuvoso, selecionou-se um que se manteve por 12 horas com velocidade média de 15m/s e que estava direcionado de Nordeste para Leste, no ponto de máxima velocidade. Os resultados observacionais indicaram que, este JBN localizado no litoral Paraense foi resultado da ação combinada de dois fatores: (1 oscilação inercial e (2 baroclinia superficial. Estes dois fatores combinados sustentaram este JBN com intensidades entre 10 e 13m/s durante o dia e entre 14 e 16m/s durante a noite, localizado a uma altitude média de 800m acima da superfície.

  20. MSR Fetch Rover Capability Development at the Canadian Space Agency

    Science.gov (United States)

    Picard, M.; Hipkin, V.; Gingras, D.; Allard, P.; Lamarche, T.; Rocheleau, S. G.; Gemme, S.

    2018-04-01

    Describes Fetch Rover technology testing during CSA's 2016 Mars Sample Return Analogue Deployment which demonstrated autonomous navigation to 'cache depots' of M-2020-like sample tubes, acquisition of six such tubes, and transfer to a MAV mock up.

  1. 2-Methylsulfanyl-5,6-dihydro-2H-1,3-dithiolo[4,5-b][1,4]dioxin-2-ium tetrafluoroborate

    Directory of Open Access Journals (Sweden)

    Guoquan Zhou

    2012-04-01

    Full Text Available The title compound, C6H7O2S3+·BF4−, consists of a planar 2-thioxo-1,3-dithiol-4,5-yl unit [maximum deviation from the ring plane = 0.020 (3 Å], with an ethylenedioxy group fused at the 4,5-positions; the ethylenedioxy C atoms are disordered over two positions with site-occupancy factors of 0.5. The 1,4-dioxine ring has a twist-chair conformation. Weak cation–anion S...F interactions [3.022 (4–3.095 (4 Å] and an S...O [3.247 (4 Å] interaction are present.

  2. Otimização de propriedades mecânicas de misturas ternárias de polipropileno (PP/borracha de etileno-propileno-dieno (EPDM/pó de pneus (SRT sob tração e impacto usando a metodologia da superfície de resposta (MSR Optimization of mechanical properties of polypropylene (PP/ethylene-propylene-diene monomer rubber (EPDM/scrap rubber tire (SRT ternary mixtures under tensile and impact using the response surface methodology (RSM

    Directory of Open Access Journals (Sweden)

    Helson M. da Costa

    2012-01-01

    Full Text Available A metodologia da superfície de resposta (MSR é uma coleção de técnicas estatísticas e matemáticas para desenvolver, melhorar e otimizar processos. Neste estudo, a técnica MSR foi aplicada na investigação do comportamento mecânico de diferentes misturas ternárias de PP/EPDM/SRT. Após a mistura apropriada em uma extrusora de dupla rosca co-rotante e a moldagem por injeção, as propriedades mecânicas (resistência à tração e a resistência ao impacto foram determinadas e usadas como variáveis de resposta. A microscopia eletrônica de varredura (MEV foi usada para investigar a morfologia das diferentes misturas e interpretar os resultados. Com ferramentas estatísticas específicas, um número mínimo de experimentos permitiu o desenvolvimento de um modelo de superfície de resposta e a otimização das concentrações dos componentes de acordo com o desempenho mecânico. Valores elevados de resistência ao impacto são alcançados (>80 J.m-1 quando, de acordo com as condições experimentais estudadas, a mistura física de PP/EPDM/SRT mantém as proporções de EPDM e SRT em torno de 25%.The response surface methodology (RSM is a collection of statistical and mathematical techniques for developing, improving and optimizing processes. In this study, RSM technique was applied to the investigation of the mechanical behavior of different PP/EPDM/SRT ternary mixtures. After appropriate processing in a co-rotating twin extruder and injection molding, the mechanical properties, such as tensile strength and impact strength, were determined and used as response variables. Scanning electron microscopy (SEM was used for investigating the morphology of the different blends and to interpret the results. With specific statistical tools, a minimum number of experiments allowed the response surface model to be developed and the concentrations of the components to be optimized according to the mechanical performance. High values of impact

  3. Bibliografía jurídica colombiana : abril de 1969

    Directory of Open Access Journals (Sweden)

    Jorge Ortega Torres

    1969-04-01

    Full Text Available Estudios sobre la pena de muerte: El Código Penal del 27 de junio de 1837 en sus artículos 33 a 40, fuera de algunos otros, reglamenta la pena de muerte. La ley del 11 de junio de 1844, sobre reformas judiciales, en su artículo 24, dispone cuándo debe conmutarse. La ley del 26 de mayo de 1849 suprimió la pena de muerte y otras, en delitos políticos y la de vergüenza pública en los comunes. El proyecto fue presentado por los conservadores Manuel J. Quijano y Juan Nepomuceno Neira. La Constitución Nacional expedida en 1886 en sus artículos 29 y 30 habla de ella; dichas disposiciones fueron reglamentadas por los artículos 47 a 54 del Código Penal de 1890 (ley 19. El acto legislativo 3 de 1910 (artículo 39 la suprimió (artículo 29 de la compilación actual.

  4. Académico Correspondiente. CARLOS ROBERTO SILVA MOJICA (Abril 22, 1919 - Enero 12, 2015

    Directory of Open Access Journals (Sweden)

    Fernando Sánchez Torres

    2015-03-01

    Full Text Available Natural de Tasco, Boyacá, Carlos Roberto Silva Mojica recibió el grado de médico en la Universidad Nacional en 1946. Su tesis de grado, “Sufrimiento fetal” hacía presagiar que su especialidad sería la misma de su tío Carlos Julio Mojica, profesor de Clínica Obstétrica en el Instituto Materno Infantil. En efecto, Silva Mojica inició allí su periplo como especialista y como docente de la Facultad de Medicina de la Nacional. En 1945, un grupo conformado por profesores de las universidades Nacional y Javeriana dio inicio al estudio formal de los procedimientos psicosomáticos de analgesia obstétrica preconizados desde 1933 en Inglaterra por Grantly Dick Read a través de su libro Nacimiento sin temor. Principios y práctica del parto sin dolor. De ese grupo sobresalió el doctor Silva Mojica, pues de todos fue el más denodado defensor y divulgador del llamado “parto psicoprofíláctico”. En 1955, durante el Primer Seminario de Educación Médica y por iniciativa suya, entre las recomendaciones relacionadas con la cátedra de Obstetricia se acogió la siguiente: “Recalcar al estudiante y al personal docente la necesidad de la preparación psicológica, o mejor psicoprofiláctica, en su doble aspecto educativo y afectivo, para lograr la colaboración activa y apacible de la parturienta en losprocesos de su parto”. Liderado por Silva Mojica, en 1956 se creó, con fines de investigación, el “Equipo Médico de Estudios Psicofisicos de Analgesia Obstétrica (Emesfao”, que mantuvo vigente el interés por el enfoque psicoanalítico de la obstetricia. Desde un comienzo, Emesfao fijó una posición ecléctica ante la diversidad de criterios respecto a estos sistemas, y puso en práctica un método psicoprofiláctico integrado con elementos de las principales escuelas, cuya diferencia estribaba en la interpretación neurofisiológica y psicológica de la indolorización del parto. Dado que la psicoprofilaxis obstétrica había despertado gran interés en el ámbito obstétrico, se crearon sociedades y equipos de trabajo tanto en Bogotá como en otras ciudades del país. Bajo la dirección de Silva Mojica, Emesfao publicó en 1959 el libro Educación para el parto y en 1963 La preparación psicoprofiláctica de las embarazadas. Los compromisos adquiridos con esta actividad y el entusiasmo que a ella entregó, llevaron al doctor Silva a retirarse de la cátedra en 1964. Durante su larga vida profesional, Carlos Roberto Silva Mojica se distinguió por sus dotes de caballero y su lealtad con los principios éticos de la profesión. En julio de 2003 fue recibido como Miembro Correspondiente de la Academia. Lamentablemente, quebrantos de salud no le permitieron asistir a la corporación con la asiduidad que hubiera querido. Apenas iniciado el 2015 falleció en Bogotá a la edad de 95 años.

  5. Decree number 801 of April 20, 1992; Decreto no. 801 de 20 de abril de 1992

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-04-20

    Concerns on the entailing of entities which take part of the indirect Federal Public Administration to the Republic Presidency organs e to its Ministries Dispoe sobre a vinculacao das entidades integrantes da Administracao Publica Federal indireta aos orgaos da Presidencia da Republica e aos Ministerios.

  6. El 20 de abril: presente y pasado de un proyecto militar corporativo

    Directory of Open Access Journals (Sweden)

    García Gallegos, Bertha

    2005-09-01

    Full Text Available En el Ecuador, las dictaduras de los años 60 y 70 vincularon a los militares con el desarrollo social y económico. Si bien en los 80 retornaron a los cuarteles, y a su bien acariciada política de autogestión empresarial, durante los 25 años de democracia formal se quedaron con esa visión idílica del poder basado en la fuerza y en el reemplazo de la política por la tecnocracia. Siguieron acariciando su vocación planificadora sobre lo social y lo político, hasta el punto que, ya en el siglo XXI, no dudaron en hacer suya la aventura gutierrista, apoyando tras bastidores a uno más de los populismos ecuatorianos. Criticando a la clase política, el gutierrismo saltó a la política por la vía electoral. Quiso revivir el proyecto militar. Pero ahora -como entonces- esta aventura no era más que una versión ideológica de una sociedad pensada en los cuarteles.

  7. Data Analysis with the Morse-Smale Complex: The msr Package for R

    KAUST Repository

    Gerber, Samuel; Potter, Kristin

    2012-01-01

    In many areas, scientists deal with increasingly high-dimensional data sets. An important aspect for these scientists is to gain a qualitative understanding of the process or system from which the data is gathered. Often, both input variables

  8. Molten Salt Demonstration Transmuter (comparison of new technical problems with old US MSR plans)

    International Nuclear Information System (INIS)

    Lelek, V.

    2001-01-01

    A Molten Salt Demonstration Transmuter (MSDT) is required to show the operation and design performance for closing the nuclear spent fuel (NSF) cycle for PWR or WWER reactors operated in the once-through cycle (OTC) mode. The remnant waste (fission products only) would be either permanently stored or held for secondary use. The purpose of this proposal is to establish the design basis for the MSDT and compare contemporary knowledge and demands with that from US plans for MS reactors from 1974, because both technologies are very near (Authors)

  9. The design and optimization of disk structures for MAMMOS/MSR magneto-optic recording

    International Nuclear Information System (INIS)

    Hendren, W R; Atkinson, R; Pollard, R J; Salter, I W; Wright, C D; Clegg, W W; Jenkins, D F L

    2005-01-01

    Existing quadrilayer and trilayer techniques for optimizing the magneto-optical effects from magnetic materials have been applied to new generation recording media to investigate the possibility of maximizing the signal-to-noise readout performance. Various methods are reviewed and the designs they produce are compared with each other and with the working media found in the literature. In order to address a number of inadequacies, a new numerical approach to the optimization of a quadrilayer structure is used to find further solutions that are considered more suitable for the practical recording media. The effects on design and performance of medium of incidence, type of storage layer and wavelength are all considered

  10. Th and U fuel photofission study by NTD for AD-MSR subcritical assembly

    Energy Technology Data Exchange (ETDEWEB)

    Sajo-Bohus, Laszlo; Greaves, Eduardo D.; Barros, Haydn; Pino, Felix; Barrera, Maria T.; Farina, Fulvio [Universidad Simón Bolívar, Nuclear Physics Laboratory, Apdo 89000, Caracas 1080A (Venezuela, Bolivarian Republic of); Davila, Jesus [Física Médica C. A. and Universidad Central de Venezuela, Caracas (Venezuela, Bolivarian Republic of)

    2015-07-23

    During the last decade a considerable effort has been devoted for developing energy generating systems based on advanced nuclear technology within the design concepts of GEN-IV. Thorium base fuel systems such as accelerator driven nuclear reactors are one of the often mentioned attractive and affordable options. Several radiotherapy linear accelerators are on the market and due to their reliability, they could be employed as drivers for subcritical liquid fuel assemblies. Bremsstrahlung photons with energies above 5.5MeV, induce (γ,n) and (e,e’n) reactions in the W-target. Resulting gamma radiation and photo or fission neutrons may be absorbed in target materials such as thorium and uranium isotopes to induce sustained fission or nuclear transmutation in waste radioactive materials. Relevant photo driven and photo-fission reaction cross sections are important for actinides {sup 232}Th, {sup 238}U and {sup 237}Np in the radiotherapy machines energy range of 10-20 MV. In this study we employ passive nuclear track detectors (NTD) to determine fission rates and neutron production rates with the aim to establish the feasibility for gamma and photo-neutron driven subcritical assemblies. To cope with these objectives a 20 MV radiotherapy machine has been employed with a mixed fuel target. Results will support further development for a subcritical assembly employing a thorium containing liquid fuel. It is expected that acquired technological knowledge will contribute to the Venezuelan nuclear energy program.

  11. Th and U fuel photofission study by NTD for AD-MSR subcritical assembly

    Science.gov (United States)

    Sajo-Bohus, Laszlo; Greaves, Eduardo D.; Davila, Jesus; Barros, Haydn; Pino, Felix; Barrera, Maria T.; Farina, Fulvio

    2015-07-01

    During the last decade a considerable effort has been devoted for developing energy generating systems based on advanced nuclear technology within the design concepts of GEN-IV. Thorium base fuel systems such as accelerator driven nuclear reactors are one of the often mentioned attractive and affordable options. Several radiotherapy linear accelerators are on the market and due to their reliability, they could be employed as drivers for subcritical liquid fuel assemblies. Bremsstrahlung photons with energies above 5.5MeV, induce (γ,n) and (e,e'n) reactions in the W-target. Resulting gamma radiation and photo or fission neutrons may be absorbed in target materials such as thorium and uranium isotopes to induce sustained fission or nuclear transmutation in waste radioactive materials. Relevant photo driven and photo-fission reaction cross sections are important for actinides 232Th, 238U and 237Np in the radiotherapy machines energy range of 10-20 MV. In this study we employ passive nuclear track detectors (NTD) to determine fission rates and neutron production rates with the aim to establish the feasibility for gamma and photo-neutron driven subcritical assemblies. To cope with these objectives a 20 MV radiotherapy machine has been employed with a mixed fuel target. Results will support further development for a subcritical assembly employing a thorium containing liquid fuel. It is expected that acquired technological knowledge will contribute to the Venezuelan nuclear energy program.

  12. Optimized Application of MSR and Steam Turbine Retrofits in Nuclear Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    Crossland, Robert; McCoach, John [ALSTOM Power, Willans Works, Newbold Road, Rugby, Warwickshire CV21 2NH (United Kingdom); Gagelin, Jean-Philippe [ALSTOM Power Heat Exchange, 19-21 avenue Morane-Saulnier, BP 65, 78143 Velizy Cedex (France)

    2004-07-01

    The benefit to a nuclear power plant from a steam turbine retrofit has often been clearly demonstrated in recent years but, for light water nuclear plants, the Moisture Separator Reheaters (MSRs) are also of prime importance. This paper describes how refurbishment of these crucial components can only provide full potential performance benefit when made in conjunction with a steam turbine retrofit (although in practice these activities are frequently separated). Examples are given to show how combined application is best handled within a single organization to ensure optimized integration into the thermal cycle. (authors)

  13. Optimized Application of MSR and Steam Turbine Retrofits in Nuclear Power Plants

    International Nuclear Information System (INIS)

    Crossland, Robert; McCoach, John; Gagelin, Jean-Philippe

    2004-01-01

    The benefit to a nuclear power plant from a steam turbine retrofit has often been clearly demonstrated in recent years but, for light water nuclear plants, the Moisture Separator Reheaters (MSRs) are also of prime importance. This paper describes how refurbishment of these crucial components can only provide full potential performance benefit when made in conjunction with a steam turbine retrofit (although in practice these activities are frequently separated). Examples are given to show how combined application is best handled within a single organization to ensure optimized integration into the thermal cycle. (authors)

  14. The design and optimization of disk structures for MAMMOS/MSR magneto-optic recording

    Energy Technology Data Exchange (ETDEWEB)

    Hendren, W R [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Atkinson, R [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Pollard, R J [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Salter, I W [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Wright, C D [School of Engineering and Computer Science, University of Exeter, Exeter EX4 4QF (United Kingdom); Clegg, W W [Centre for Research in Information Storage Technology, University of Plymouth, Plymouth PL4 8AA (United Kingdom); Jenkins, D F L [Centre for Research in Information Storage Technology, University of Plymouth, Plymouth PL4 8AA (United Kingdom)

    2005-07-21

    Existing quadrilayer and trilayer techniques for optimizing the magneto-optical effects from magnetic materials have been applied to new generation recording media to investigate the possibility of maximizing the signal-to-noise readout performance. Various methods are reviewed and the designs they produce are compared with each other and with the working media found in the literature. In order to address a number of inadequacies, a new numerical approach to the optimization of a quadrilayer structure is used to find further solutions that are considered more suitable for the practical recording media. The effects on design and performance of medium of incidence, type of storage layer and wavelength are all considered.

  15. Ferrol y Coishco, Chimbote, Perú. Evaluación am- biental en abril y julio 2002.

    OpenAIRE

    Sanchéz, Guadalupe; Enriquéz, Edgardo; García, Víctor

    2008-01-01

    Este trabajo fue parte de la Red del Monitoreo Ambiental, del Plan Operativo Institucional 2002 del IMARPE. Se evaluó la calidad del ambiente marino y la contaminación de origen terrestre. En la bahía El Ferrol las aguas servidas son vertidas por cuatro cámaras de bombeo en la zona norte, y al sur desemboca el río Lacramarca. La bahía Coishco recibe aguas de escorrentía agrícola y doméstica que, con las del río Santa, forman aguas de mezcla con salinidad propia. La temperatura correspondió...

  16. Streptococo del grupo B en mujeres embarazadas atendidas en el Centro de Salud Primero de Mayo. Abril-Agosto 2007

    OpenAIRE

    Dubón Méndez, Nancy; Altamirano González, Marjorie del Socorro; Alemán Rivera, Teresa de Jesús

    2008-01-01

    Streptococos del grupo B (SGB) es una de las principales causas de muertes neonatales en todo el mundo y esta directamente relacionada con la colonización materna al momento del parto. Se realizó un estudio descriptivo de corte transversal que incluyó un total de 120 mujeres embarazadas atendidas en el Centro de Salud 1ro. de mayo-León, con el objetivo de identificar la frecuencia de streptococo del grupo B, debido a que la identificación de esta bacteria influye positivamente en la prevenció...

  17. APXS Data from Mars and MSR Samples: How Can They Be Combined and Benefit from Each Other?

    Science.gov (United States)

    Gellert, R.

    2018-04-01

    The APXS has returned the chemical composition of more than 1000 samples on four rover missions along the combined traverse of >70km. Combining Mars data with terrestrial lab results of martian samples will be important, but it has to be done right.

  18. Effects of Dissolved Oxygen Concentration and Iron Addition on Immediate-early Gene Expression of Magnetospirillum gryphiswaldense MSR-1

    DEFF Research Database (Denmark)

    Zhuang, Shiwen; Anyaogu, Diana Chinyere; Kasama, Takeshi

    2017-01-01

    in cultures at 0.5% O2 compared to those at higher oxygen tensions. Moreover, expression of katG (catalase-peroxidase gene) and feoB2 (ferrous transport protein B2 gene) was reduced markedly by iron addition, regardless of oxygen conditions. The data provides a greater understanding of molecular response...

  19. Personas y comunidades: Actas del Segundo Congreso Internacional de Buenas Prácticas en Patrimonio Mundial: (29 -30 de abril, 1 y 2 de mayo de 2015)

    OpenAIRE

    Castillo Mena, Alicia R. (ed.)

    2015-01-01

    Este volumen está compuesto por una introducción y los textos de las comunicaciones y pósteres del congreso internacional, con una participación de 30 países y casi 100 centros de investigación. Recoge un documento de Buenas Prácticas sobre el tema.

  20. Conclusiones adoptadas por la primera convención venerológica reunida en Medellín en abril de 1935

    Directory of Open Access Journals (Sweden)

    Gustavo Uribe Escobar

    1935-05-01

    Full Text Available Unificación de los sistemas en los centros de tratamiento, con el fin de darles a todos la misma organización científica. Enfermeras sociales. Fomento de la creación de centros venerológicos en las poblaciones. Problema de la prostitución. Estudiar las medidas más convenientes al respecto. ¿prohibición? ¿abolición? ¿reglamentación de los lenocinios? campaña educativa popular. Comprende la educación del niño, del adolescente y del adulto en materia sexual, moral y antivenérea. Legislación venérea. Campaña educativa popular. Delito de contaminación. Tratamiento obligatorio. Certificado previo para colocarse en empresas particulares u oficiales.

  1. Medición y propuesta de mejoramiento del clima laboral en una empresa pública, durante el periodo de abril 2016 a febrero 2017.

    OpenAIRE

    Orbe Calvachi, Gabriela de los Ángeles

    2017-01-01

    In the last decade organizations have had a significant development characterized by the improvement of their processes, inclusion of technology and the hiring of people with greater competencies, so that the study of organizational climate acquires a growing interest in organizations. From the organizational model based on human resources management, proposed by authors like Fayol and Taylor, it evolved to a human talent management that gives importance to people not only as resources but as...

  2. Importancia que ha dado la prensa escrita nacional El Comercio y El Universo en el mes de abril a los espacios de ciencia y tecnología.

    OpenAIRE

    Baldeón Robalino, Katherine del Rocío

    2003-01-01

    El inicio del Periodismo Científico se puede situar en la reforma hecha a la declaración de los Derechos Humanos del Hombre durante la Segunda Guerra Mundial. Aquí se proclama el derecho de todos los seres humanos a la cultura y la información. El siglo XX se caracteriza por un desarrollo acelerado del conocimiento científico y de las innovaciones tecnológicas.

  3. DO SONHO À DEVASTAÇÃO, ONDE TUDO SE RECONSTRÓI: Caldeirão e Assrntamento 10 de Abril

    Directory of Open Access Journals (Sweden)

    Judson Jorge da Silva

    2010-01-01

    are their professional interests and where they want to live in the future was also explored. The results of this research show that over the years there is a readjustment of the peasant¿s aspirations in the settlement, an outcome of the different expectations between different generations. The young has shown a tendency to break the values of the older settlers, especially related to the practice of cooperative work, expressing also a desire to be employed outside the settlement.

  4. Inteligencia emocional: Su relación con el rendimiento académico en preadolescentes de la Escuela 4 de Abril, de Io ciclo, Angola

    OpenAIRE

    María Domingas Cassinda Vissupe; António Chingombe Jacob; Lisandra Angulo Gallo; Vivian M. Guerra Morales

    2017-01-01

    La investigación fue realizada con el objetivo de caracterizar la expresión de la inteligencia emocional (en lo sucesivo IE) en preadolescentes con bajo rendimiento académico, de la escuela “4 de Abril”, de la provincia de Huambo, Angola. Se asumió un paradigma mixto, predominantemente cuantitativo, con un diseño no experimental, transversal y un tipo de estudio exploratorio. Se efectuó un muestreo no probabilístico, se seleccionó una muestra de 60 preadolescentes, 30 con bajo rendimiento (en...

  5. Inteligencia emocional: Su relación con el rendimiento académico en preadolescentes de la Escuela 4 de Abril, de Io ciclo, Angola

    Directory of Open Access Journals (Sweden)

    María Domingas Cassinda Vissupe

    2017-01-01

    Full Text Available La investigación fue realizada con el objetivo de caracterizar la expresión de la inteligencia emocional (en lo sucesivo IE en preadolescentes con bajo rendimiento académico, de la escuela “4 de Abril”, de la provincia de Huambo, Angola. Se asumió un paradigma mixto, predominantemente cuantitativo, con un diseño no experimental, transversal y un tipo de estudio exploratorio. Se efectuó un muestreo no probabilístico, se seleccionó una muestra de 60 preadolescentes, 30 con bajo rendimiento (en lo sucesivo GE y 30 con rendimiento medio (en lo sucesivo GC. Para la recogida de los datos se aplicó el Trait Meta-Mood Scale, Informe escolar, conflicto de diálogo y composición. La Inteligencia Emocional mostró resultados diferentes en ambos grupos de preadolescentes, en términos de percepción, comprensión y facilitación, siendo mejores en el grupo de desempeño académico medio. Se reveló que las mayores dificultades fueron apreciadas en la regulación emocional.

  6. Biocrónica: recorriendo el trapecio Amazónico una experiencia inolvidable, del 27 de abril al 6 de mayo del 2009.

    Directory of Open Access Journals (Sweden)

    Angie Andrea Delgadillo

    2009-07-01

    Full Text Available Esta bio- crónica muestra la práctica de Campo realizada por estudiantes de de sexto semestre en Licenciatura en Biología en el marco del Componente Interacción, donde a través de esta experiencia se retoma el Concepto “Interacción” de manera Multidisciplinar y responde de manera parcial a preguntas orientadoras como ¿Cuál es la noción de territorio de los  diferentes actores sociales de la región? Así mismo se trabajan aspectos de área de la biología como el concepto de Interacción Biología y productividad en ecosistemas.

  7. Académico RICARDO RUEDA GONZÁLEZ (Panamá, abril 1, 1929 - Bogotá, noviembre 14, 2011

    Directory of Open Access Journals (Sweden)

    Efraim Otero Ruiz

    2011-10-01

    Full Text Available

    Anonadados por lo impetuoso de su separa-ción definitivanos reunimos aquí hoy bajo el cielo invernal de una Bogotá doliente para despedir los restos mortales de un paradigma de académicos, de señores y amigos como fue Ricardo Rueda González. Quizás así lo hubiera querido él, epítome de la elegancia y el ingenio bogotanos, para irse de esta tierra ajustando su corbata Tremlet, su chaqueta de Tweed y su bufanda de Cachemira como para salir airoso de este club del mundo moderno, que lo tenía ya aburrido por lo abigarrado, por lo vulgar y por lo anónimo; y llegar a donde el Padre Eterno sin presumir, confrmando que “la elegancia es el arte de pasar desapercibido”, como lo hubiera dicho Oscar Wilde, uno de sus autores preferidos.

    Porque tal es, señores académicos, queridos familiares y amigos, la imagen superficial que nos deja Ricardo. Digo superfical, porque en el fondo se agitaba el más profundo de los humanistas y el más compasivo y atento de los médicos, preocupado a toda hora por ayudar a sus abnegadas pacientes a concebir y a dar a luz lo mejor de sus entrañas, así como él mismo se preocupaba siempre por dar a luz lo mejor y más vivaz de su gracia y de su intelecto.

  8. El caso de las plantas de celulosa sobre el río Uruguay: Sentencia de la Corte Internacional de Justicia de 20 de abril 2010

    Directory of Open Access Journals (Sweden)

    José Juste Ruiz

    2011-01-01

    Full Text Available The Judgement on the merits in the case concerning the Pulp Mills on the River Uruguay focuses on the dilemma of sustainable development, opposing the requirements of the economic development of a State versus the rights of protection of human and environmental health of another State facing the risks of transboundary harm resulting from industrial activities that, in addition, affect a shared natural resource like an international water course used for aims other than navigation. Although it is true that this Judgement contains statements of great environmental importance, at the same time it generates preoccupation due to the proactive attitude adopted by the International Court of Justice related to the industrial projects that give rise to potential environmental risks, settling all the disputed points in the most favourable way to the State promoting its execution

  9. ClpP-Independent Function of ClpX Interferes with Telithromycin Resistance Conferred by Msr(A) in Staphylococcus aureus

    Czech Academy of Sciences Publication Activity Database

    Vimberg, Vladimír; Lenart, Jakub; Janata, Jiří; Balíková Novotná, Gabriela

    2015-01-01

    Roč. 59, č. 6 (2015), s. 3611-3614 ISSN 0066-4804 R&D Projects: GA MŠk(CZ) EE2.3.20.0055; GA ČR GPP302/12/P632; GA MŠk(CZ) EE2.3.30.0003; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : COAGULASE-NEGATIVE STAPHYLOCOCCI * ZINC-BINDING DOMAIN * STRESS TOLERANCE Subject RIV: EE - Microbiology, Virology Impact factor: 4.415, year: 2015

  10. Classification of agricultural assets on the international accounting standard 41 Agriculture Klasyfikacja aktywów pochodzenia rolniczego według MSR 41 Rolnictwo

    Directory of Open Access Journals (Sweden)

    Dorota Czerwińska-Kayzer

    2011-12-01

    Full Text Available Agricultural activity is characterised by dissimilarity and complexity of economic events. Therefore, the assets related to agricultural activity, should be properly classified, as it affects the method of valuation and the company assessment. In the article the classification of agricultural assets has been presented in respect of IAS/IFRS 41 Agriculture.

  11. D-MSR: A Distributed Network Management Scheme for Real-Time Monitoring and Process Control Applications in Wireless Industrial Automation

    NARCIS (Netherlands)

    Zand, P.; Dilo, Arta; Havinga, Paul J.M.

    2013-01-01

    Current wireless technologies for industrial applications, such as WirelessHART and ISA100.11a, use a centralized management approach where a central network manager handles the requirements of the static network. However, such a centralized approach has several drawbacks. For example, it cannot

  12. Regulation of Expression of Oxacillin-Inducible Methionine Sulfoxide Reductases in Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Kyle R. Baum

    2015-01-01

    Full Text Available Cell wall-active antibiotics cause induction of a locus that leads to elevated synthesis of two methionine sulfoxide reductases (MsrA1 and MsrB in Staphylococcus aureus. To understand the regulation of this locus, reporter strains were constructed by integrating a DNA fragment consisting of the msrA1/msrB promoter in front of a promoterless lacZ gene in the chromosome of wild-type and MsrA1-, MsrB-, MsrA1/MsrB-, and SigB-deficient methicillin-sensitive S. aureus strain SH1000 and methicillin-resistant S. aureus strain COL. These reporter strains were cultured in TSB and the cellular levels of β-galactosidase activity in these cultures were assayed during different growth phases. β-galactosidase activity assays demonstrated that the lack of MsrA1, MsrB, and SigB upregulated the msrA1/msrB promoter in S. aureus strain SH1000. In S. aureus strain COL, the highest level of β-galactosidase activity was observed under the conditions when both MsrA1 and MsrB proteins were absent. The data suggest that the msrA1/msrB locus, in part, is negatively regulated by MsrA1, MsrB, and SigB in S. aureus.

  13. Detección de las complicaciones en los pacientes diabéticos que asisten a la unidad básica la libertad, durante los meses de abril y mayo del año 2006

    Directory of Open Access Journals (Sweden)

    Elisa Katie Vergel-Arevalo

    2006-12-01

    Full Text Available La diabetes continua siendo uno de los mayores problemas de salud pública en el mundo, coma consecuencia de complicaciones tales como neuropatías, oftalmopatias, nefropatías, Hipertensión Arterial (HTA, alteraciones micro y macrovasculares. La presente revisión pretende exponer las complicaciones encontradas en una muestra de 14 pacientes diabéticos de la Unidad Básica la Libertad de la ciudad de Cúcuta (Colombia, con el objetivo de detectar tempranamente las complicaciones propias de la Diabetes. El principal respaldo de esta investigación se basa en los grandes estudios epidemiológicos que han demostrado que el control adecuado de la glicemia previene o retarda las complicaciones. Al valorar los pacientes diabéticos se tomaron variables sociodemográficas como sexo, edad, estrato, ocupación y nivel educativo; alteraciones en los niveles de glicemia casual en sangre, en el estado neurológico, oftalmológico, factores que puedan propiciar pie diabético, antecedentes de complicaciones agudas, valores de presión arterial y prácticas como dieta balanceada y ejercicios

  14. "La escuela en tiempos de guerra. Una mirada a la educación desde la crisis y la violencia", CEAPAZ, TAREA Y IPEDEHP. Lima, abril 1992, 285 p.

    OpenAIRE

    Flores Flores, Elizabeth

    2013-01-01

    Este libro, fruto de una investigación conjunta, plantea derroteros de trabajo coordinado en la tarea de construir la paz desde la educación en nuestro país. Es asimismo una llamada de alerta para aquellos que aun piensan que militarizando la educación se puede detener el avance del terrorismo.Parte de la convicción que la educación debe ser entendida como el espacio propicio para ir construyendo un proyecto de vida en paz. Por ello constituye una lectura obligada para quienes estamos abocado...

  15. "La escuela en tiempos de guerra. Una mirada a la educación desde la crisis y la violencia", CEAPAZ, TAREA Y IPEDEHP. Lima, abril 1992, 285 p.

    Directory of Open Access Journals (Sweden)

    Elizabeth Flores Flores

    1992-11-01

    Full Text Available Este libro, fruto de una investigación conjunta, plantea derroteros de trabajo coordinado en la tarea de construir la paz desde la educación en nuestro país. Es asimismo una llamada de alerta para aquellos que aun piensan que militarizando la educación se puede detener el avance del terrorismo.Parte de la convicción que la educación debe ser entendida como el espacio propicio para ir construyendo un proyecto de vida en paz. Por ello constituye una lectura obligada para quienes estamos abocados aesta tarea.

  16. Propuesta de gestión para reducción de costos de no calidad, causados por la ocurrencia de sucesos adversos en ASSBASALUD ESE (Manizales) Colombia, período Abril a Septiembre de 2014

    OpenAIRE

    Villa Gallón, Jazmín Eliana

    2014-01-01

    Tesis (Especialista en Gerencia de la Calidad). Universidad Católica de Manizales, Facultad de Humanidades, Ciencias Sociales y Humanidades, 2014 El presente trabajo tiene por objeto aportar elementos estratégicos, tácticos y operativos para impactar en la disminución de los costos de no calidad ocasionados por la ocurrencia de los sucesos adversos en la institución de salud objeto de estudio. Es de resaltar que la Seguridad del Paciente como política ha tomado gran relevancia a nivel n...

  17. “Monitoreo de editoriales y artículos de opinión y la imagen que proyectan del Presidente Rafael Correa. Estudio de caso: diario el comercio abril 2009”

    OpenAIRE

    Rivadeneira Moreno, Katerine Elisa

    2013-01-01

    The objective of this work is to show that the conflict between political power and media power have always existed, since the earliest ways of journalism in Greece and Rome, during the Middle Age, with the invention of printing press, during the French Revolution, with the Industrial Revolution until our times. Conflicts between political power and media power have place all over the world in Europe, Asia, Africa and North America where even neoliberal governments like Barack Obama have p...

  18. Descripción clinico-radiológica y patológica de las lesiones palpables de mama, Clínica León XIII, Seguro Social, Medellín, enero 2001-abril 2002

    Directory of Open Access Journals (Sweden)

    Gloria Marín

    2001-04-01

    Full Text Available

    El médico, frente a un paciente con enfermedad mamaria, debe realizar una historia clínica completa en donde se tengan en cuenta los factores de riesgo, los antecedentes personales y familiares de lesión mamaria (menarca precoz, y menopausia tardía, entre otros; el examen físico debe hacerse detenidamente, teniendo en cuenta la inspección, localización, signos y síntomas. No se puede restar importancia
    al estudio de las lesiones de mama, ya que con él se puede
    descartar y prevenir una posible lesión maligna.
    Para el estudio se tendrá en cuenta la «tríada diagnóstica» de las
    lesiones mamarias: clínica, mamografía o ecografía y biopsia en las
    lesiones palpables. Se desea observar la relación que existe entre la
    clínica y las ayudas diagnósticas para el establecimiento de una determinada enfermedad (1.

     

  19. Programa de intervención psicológica grupal para fortalecer la autoestima de la comunidad homosexual de la fundación ecuatoriana equidad en el período abril – junio de 2017.

    OpenAIRE

    López Bahamonde, María Fernanda; Noboa Obaco, Alba Estefanía

    2017-01-01

    The present document contains the systematization of the experience on the formation of a psychological group intervention program for the self – esteem strengthening of the homosexual community of the Equatorial Equity Foundation in the period April - June, 2017. For the realization of this project, the procedure that was followed consisted of a diagnosis, the project approach, the application of the project and finally the development of the present work that reflects each step during th...

  20. CHAND LC 4445 CAPITOL. EL TERCER VIAJE DE LE CORBUSIER A CHANDIGARH, MARZO-ABRIL 1952 / Chand LC 4445 Capitol. Third trip of Le Corbusier to Chandigarh, March-April 1952

    Directory of Open Access Journals (Sweden)

    Pere Fuertes Pérez

    2010-11-01

    Full Text Available RESUMEN El tercer viaje de Le Corbusier a Chandigarh, un año después de su primer contacto con la India, está íntimamente ligado a la definición del Capitolio en tanto que plataforma activa, capaz de poner en tensión los palacios institucionales de la que forman parte, y en tanto que realidad aislada de la ciudad y únicamente vinculada a la experiencia de las vastas dimensiones del país, al llano que la sustenta, a su techo de cielo y a las montañas que ponen fin al terreno horizontal. Durante los veinticinco días que permanece en el lugar, Le Corbusier define el Capitolio como recinto y determina sus límites, introduce la física de los reflejos combinados, intensifica la topografía como tema arquitectónico que anima la plataforma del Capitolio y dibuja los jardines que preceden al palacio del Gobernador, como síntesis de todos los temas expuestos. Los resultados darán lugar, a su vuelta, al plano con número de atelier chand lc 4445 capitol. Más adelante, a medida que se definen los palacios, el Capitolio irá modificándose para alcanzar una nueva situación de equilibrio respecto a ellos, pero siempre en relación a aquello que sucedió durante esos días de 1952. SUMMARY. The third trip of Le Corbusier to Chandigarh, a year after his first contact with India, is closely bound to the definition of the Capitol as an active platform, capable of pulling together the institutional palaces of which it forms a part and as a reality isolated from the city and uniquely linked to the experience of the vast dimensions of the country, to the plain that supports it, to its ceiling of sky and to the mountains that end the horizontal land. During the twenty-five days he stayed there, Le Corbusier defined the Capitol as an area and determined its limits. He introduced the physics of the combined reflections, intensified the topography as an architectural theme that animates the platform of the Capitol and drew the gardens that lead to the Governor's palace, as a synthesis of all the presented themes. The results would give rise, on his return, to the plan with the studio number of chand lc 4445 capitol. Later, as the palaces came to be defined, the Capitol would be modified to achieve a new position of balance with respect to them, but always in relation to what happened during those days of 1952.

  1. Report on the Fourth Reactor Refueling. Laguna Verde Nuclear Central. Unit 1. April-May 1995; Informe de la Cuarta Recarga de Combustible. Central Laguna Verde. Unidad 1. Abril-Mayo 1995

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza L, A; Flores C, E; Lopez G, C P.F.

    1996-12-31

    The fourth refueling of the Unit 1 of Laguna Verde Nuclear Central was executed in the period of April 17 to May 31 of 1995 with the participation of a task group of 358 persons, included technicians and radiation protection officials and auxiliaries.The radiation monitoring and radiological surveillance to the workers was present length ways the refueling process and always attached to the ALARA criteria. The check points for radiation levels were set at: primary container or dry well, reloading floor, decontamination room (level 10.5), turbine building and radioactive waste building. To take advantage of the refueling process, rooms 203 and 213 of the turbine buildings were subject to inspection and maintenance work in valves, heaters and drains of heaters. Management aspects as personnel selection and training, costs, and countable are also presented in this report. Owing to the high cost of man-hour of the members of the ININ staff, its participation in the refueling process was in smaller number than years before. (Author).

  2. Methionine sulfoxide reductase A deficiency exacerbates acute liver injury induced by acetaminophen

    International Nuclear Information System (INIS)

    Singh, Mahendra Pratap; Kim, Ki Young; Kim, Hwa-Young

    2017-01-01

    Acetaminophen (APAP) overdose induces acute liver injury via enhanced oxidative stress and glutathione (GSH) depletion. Methionine sulfoxide reductase A (MsrA) acts as a reactive oxygen species scavenger by catalyzing the cyclic reduction of methionine-S-sulfoxide. Herein, we investigated the protective role of MsrA against APAP-induced liver damage using MsrA gene-deleted mice (MsrA −/− ). We found that MsrA −/− mice were more susceptible to APAP-induced acute liver injury than wild-type mice (MsrA +/+ ). The central lobule area of the MsrA −/− liver was more impaired with necrotic lesions. Serum alanine transaminase, aspartate transaminase, and lactate dehydrogenase levels were significantly higher in MsrA −/− than in MsrA +/+ mice after APAP challenge. Deletion of MsrA enhanced APAP-induced hepatic GSH depletion and oxidative stress, leading to increased susceptibility to APAP-induced liver injury in MsrA-deficient mice. APAP challenge increased Nrf2 activation more profoundly in MsrA −/− than in MsrA +/+ livers. Expression and nuclear accumulation of Nrf2 and its target gene expression were significantly elevated in MsrA −/− than in MsrA +/+ livers after APAP challenge. Taken together, our results demonstrate that MsrA protects the liver from APAP-induced toxicity. The data provided herein constitute the first in vivo evidence of the involvement of MsrA in hepatic function under APAP challenge. - Highlights: • MsrA deficiency increases APAP-induced liver damage. • MsrA deletion enhances APAP-induced hepatic GSH depletion and oxidative stress. • MsrA deficiency induces more profound activation of Nrf2 in response to APAP. • MsrA protects the liver from APAP-induced toxicity.

  3. Deficiency of methionine sulfoxide reductase A causes cellular dysfunction and mitochondrial damage in cardiac myocytes under physical and oxidative stresses

    International Nuclear Information System (INIS)

    Nan, Changlong; Li, Yuejin; Jean-Charles, Pierre-Yves; Chen, Guozhen; Kreymerman, Alexander; Prentice, Howard; Weissbach, Herbert; Huang, Xupei

    2010-01-01

    Research highlights: → Deficiency of MsrA in the heart renders myocardial cells more sensitive to oxidative stress. → Mitochondrial damage happens in the heart lacking MsrA. → More protein oxidation in myocardial cells lacking MsrA. → MsrA protects the heart against oxidative stress. -- Abstract: Methionine sulfoxide reductase A (MsrA) is an enzyme that reverses oxidation of methionine in proteins. Using a MsrA gene knockout (MsrA -/- ) mouse model, we have investigated the role of MsrA in the heart. Our data indicate that cellular contractility and cardiac function are not significantly changed in MsrA -/- mice if the hearts are not stressed. However, the cellular contractility, when stressed using a higher stimulation frequency (2 Hz), is significantly reduced in MsrA -/- cardiac myocytes. MsrA -/- cardiac myocytes also show a significant decrease in contractility after oxidative stress using H 2 O 2 . Corresponding changes in Ca 2+ transients are observed in MsrA -/- cardiomyocytes treated with 2 Hz stimulation or with H 2 O 2 . Electron microscope analyses reveal a dramatic morphological change of mitochondria in MsrA -/- mouse hearts. Further biochemical measurements indicate that protein oxidation levels in MsrA -/- mouse hearts are significantly higher than those in wild type controls. Our study demonstrates that the lack of MsrA in cardiac myocytes reduces myocardial cell's capability against stress stimulations resulting in a cellular dysfunction in the heart.

  4. OHB's Exploration Capabilities Overview Relevant to Mars Sample Return Mission

    Science.gov (United States)

    Jaime, A.; Gerth, I.; Rohrbeck, M.; Scheper, M.

    2018-04-01

    The presentation will give an overview to all the OHB past and current projects that are relevant to the Mars Sample Return (MSR) mission, including some valuable lessons learned applicable to the upcoming MSR mission.

  5. Drets individuals i col·lectius. Deures dels empleats públics en la Llei 7/2007, de 12 d’abril, de l’Estatut bàsic de l’empleat públic - Individual and Collective Rights: the Duties of Public Employees under Act 7, Enacted on April 12, 2007, Establishing the Basic Statute for Public Employees - Derechos individuales y colectivos. Deberes de los empleados públicos en la Ley 7/2007, de 12 de abril, del Estatuto Básico del Empleado Público

    Directory of Open Access Journals (Sweden)

    Ignacio Garcia Ninet

    2012-12-01

    Full Text Available L’Estatut bàsic de l’empleat públic (EBEP estableix els principis aplicables al conjunt de les relacions d’ocupació pública, per tal com la finalitat primordial de qualsevol reforma en aquesta matèria ha de ser la de millorar la qualitat dels serveis que el ciutadà rep de l’Administració. Cal advertir que en aquests temps, l’àmbit públic està rebent una sèrie d’envestides del camp privat, el qual tracta de cobrir amb ànim de lucre l’espai dels serveis públics, argumentant que l’empresa privada pot prestar el mateix servei i amb un cost menor per als ciutadans; però la realitat ens demostra que, a la llarga, la privatització desl serveis acaba sent de pitjor qualitat, ja que només es mou per l’afany de lucre.Un servei públic exigeix claredat i precisió dels objectius, una organització adequada dels seus recursos materials i humans, una direcció adequada, una adequada selecció del personal d’entrada i de promoció i participació en els objectius públics.The Basic Statute for Public Employees establishes the general principles applicable to the entire set of relations in public employment, since the fundamental goal of any reform in this area has to be that of improving the quality of services that the citizenry receive from the government. It must be pointed out that the public sector is under onslaught from the private sector, which is attempting to cover the public service space with a profit motive. The argument put forth is that the private sector can provide the same service at a lower price for the citizenry. The reality, however, is that privatized services turn out to be of lesser quality, since the only motivating factor is that of monetary gain.A quality public service sector demands clear objectives, a proper organization of material and human resources, proper management, proper selection of recruited personnel. In addition, public sector employees must be familiarized with the objectives and participate in attaining them.El Estatuto Básico del Empleado Público  establece los principios aplicables al conjunto de las relaciones de empleo público, por cuanto que la finalidad primordial de cualquier reforma en  esta materia debe ser mejorar la calidad de los servicios que el ciudadano recibe de la Administración.  Hay que advertir que en estos tiempos  lo público está recibiendo una serie de embestidas por parte de lo privado, tratando de cubrir con ánimo de lucro el espacio de los servicios públicos, argumentando que la empresa privada puede prestar el mismo servicio y con menor costo para los ciudadanos, siendo así que la realidad demuestra, que la privatización de los servicios, más pronto que tarde, acaba siendo de peor calidad, pues solo se mueve por el afán de lucro.Un Servicio Público exige claridad y precisión de sus objetivos, adecuada organización de recursos materiales y humanos, buena dirección, adecuada selección del personal de entrada y de promoción y participación en los objetivos públicos.

  6. Decreased immunostaining for macrophage scavenger receptor is associated with poor prognosis of prostate cancer.

    Science.gov (United States)

    Takayama, Hitoshi; Nonomura, Norio; Nishimura, Kazuo; Oka, Daizo; Shiba, Masahiro; Nakai, Yasutomo; Nakayama, Masashi; Tsujimura, Akira; Aozasa, Katsuyuki; Okuyama, Akihiko

    2009-02-01

    The aim of this study is to evaluate the expression of the macrophage scavenger receptor (MSR) in prostate needle biopsy specimens as a possible prognostic factor for prostate cancer. As MSR reportedly has a role in recognizing foreign pathogenic substances, MSR-positive inflammatory cells are often detected in solid tumours, and there is a correlation between the relative risk of prostate cancer and polymorphism of the MSR gene. MSR was evaluated by immunostaining in needle biopsies of the prostate from 135 patients who were confirmed to have prostate cancer. Among these men, 70 were treated by radical prostatectomy or by radiotherapy as definitive therapy; the other 65 were treated by hormonal therapy because of advanced disease or age. Needle-biopsy specimens were sectioned at 5 microm and immunostained with a monoclonal antibody against MSR. Six microscopic (x400) fields around the cancer foci were selected in each case for analysis. The median number of MSR-positive cells (MSR count) in each case was 24. There was an inverse correlation between the MSR count and Gleason score and clinical stage. The MSR count was lower in patients with biochemical (prostate-specific antigen, PSA) failure than that in those with no PSA failure (P or =24) than that in those with low MSR count (<24, P < 0.001). Moreover, for patients treated by definitive or hormonal therapy, the RFS rates in those with a higher MSR count were higher than in those with a lower MSR count (P < 0.001 and 0.014, respectively). Cox multivariate analysis showed that the MSR count was a prognostic factor for prostate cancer in addition to extraprostatic extension and Gleason score (P = 0.002, 0.038 and 0.011, respectively). The results of immunostaining of MSR in needle-biopsy specimens is a prognostic factor for prostate cancer.

  7. Interpersonal Problems and Their Relationship to Depression, Self-Esteem, and Malignant Self-Regard.

    Science.gov (United States)

    Huprich, Steven K; Lengu, Ketrin; Evich, Carly

    2016-12-01

    DSM-5 Section III recommends that level of personality functioning be assessed. This requires an assessment of self and other representations. Malignant self-regard (MSR) is a way of assessing the level of functioning of those with a masochistic, self-defeating, depressive, or vulnerably narcissistic personality. In Study 1, 840 undergraduates were assessed for MSR, depressive symptoms, self-esteem, anaclitic and introjective depression, and interpersonal problems. MSR, self-esteem, depressive symptoms, and anaclitic and introjective depression were correlated with multiple dimensions of interpersonal problems, and MSR predicted the most variance in interpersonal scales measuring social inhibition, nonassertion, over-accommodation, and excessive self-sacrifice. MSR, anaclitic, and introjective depression predicted unique variance in six of the eight domains of interpersonal problems assessed. In Study 2, 68 undergraduates were provided positive or negative feedback. Consistent with theory, MSR predicted unique variance in state anxiety but not state anger. Results support the validity of the MSR construct.

  8. Variabilidad de la presión arterial pre y post-quirúrgica en pacientes sometidos a cirugía oral que asistieron a la clínica odontológica de la Universidad del Magdalena en los meses de abril y mayo periodo 2008

    Directory of Open Access Journals (Sweden)

    Luis Castillo Castilla

    2013-10-01

    Full Text Available Resumen La incidencia de enfermedades cardiovasculares se ha asociado como una de las principales causas de mortalidad no violenta en Colombia. La hipertensión arterial (HTA es la patología cardiovascular de mayor prevalencia en nuestra nación, con un rango que oscila entre 13% y 23%, por la alta frecuencia en la población adulta. Los últimos avances en el estudio de la HTA revelan que el componente genético determina el 50% de los niveles altos de presión arterial (PA y el 50% restante es determinado por la presencia de una serie de factores de riesgos exógenos1. Los valores de PA en el ejercicio de la practica odontológica pueden alterarse, lo que es importante tener en cuenta al momento de ejecutar procedimientos quirúrgicos ya que puede estar sujeta a diversos factores de riesgo tales como estrés, alcoholismo, tabaquismo, consumo de medicamentos y sedentarismo, entre otros, agentes que pueden causar su aumento o disminución, constituyendo en su conjunto un serio riesgo para la vida del paciente sino existe su adecuada atención ante cualquier práctica quirúrgico1,2. Con el objeto de determinar la variabilidad de la presión arterial generada en los procedimientos pre y post-quirúrgicos, se tomó una muestra de 33 pacientes en la Clínica Odontológica de la Universidad del Magdalena a los cuales se les realizó una toma de presión arterial en cada una de las fases del evento correspondiente. Los datos se tabularon y analizaron mediante estadísticas descriptivas; obteniéndose que el 64% de los pacientes presentó aumento de la presión arterial tras el procedimiento quirúrgico, el 18% mantuvo la presión normal y el restante manifestó descenso de la misma. (DUAZARY 2011, 48 - 57 AbstractThe incidence of cardiovascular disease has been associated as the main cause of death does not violent in Colombia. Hypertension (HT is the highest prevalence of cardiovascular disease in our nation, with a range of between 13% and 23 %,(1 for the high frequency in the adult population. Recent advances in the study of the ETS show that the genetic component, determines 50% of high blood pressure (BP and the remaining 50% is determined by the presence of a number of exogenous risk factors. The values of PA in the exercise of dental practice can be changed, so it is important to take into account when implementing surgical procedures, as they may be subject to various risk factors such as stress, alcoholism, smoking, consumption of drugs, sedentary lifestyle, among others, its agents that can cause an increase or decrease, as a whole constitutes a serious risk to the patient 33, life if there is no proper care before any surgery practices. In order to determine the variability of blood pressure generated in the procedures pre and post-surgical samples were taken from 33 patients in the dental clinic at the University of Magdalena to which were conducted taking a blood pressure at each stage of the event in question. The data are tabulated and analyzed using descriptive statistics, which produces 64% of patients had increased blood pressure following the surgical procedure, 18% maintained the pressure was normal and the remaining drop of it.Keyword: Blood pressure; surgical procedures; risk factors; anesthetics; descriptive statistics; oral surgery.

  9. Physical Measurements of Water Properties Across the Mouth of the Gulf of California during April 2013 (PESCAR24 Cruise) (Mediciones Fisicas de las Propiedades del Agua a Traves de la Boca del Golfo de California Durante Abril de 2013 (Crucero PESCAR24)

    Science.gov (United States)

    2013-11-26

    Ciencias Marinas en Kiel, Alemania. El intervalo de profundidad entre súper-ensambles conjuntos se estableció en 8 m. Los perfiles de CTD...variation of the temperature and salinity at the entrance to the Gulf of California, Mexico. Ciencias Marinas 26(4): 561-583. Castro, R., R

  10. Ingeniería Energética, 2016:XXXVII(1:45-54, Enero/Abril, ISSN 1815-5901 45 Análisis energético de un sistema fo tovoltaico integrad o a una cubierta plana horizontal; Energetic analysis of a photovoltaic system integrated to a horizontal flatrooftop

    Directory of Open Access Journals (Sweden)

    Liomnis – Osorio Laurencio

    2016-02-01

    Full Text Available En el presente trabajo se analiza el desempeño energético de un sistema fotovoltaico a base de silicio amorfo, integrado a la cubierta plana horizontal del Edificio Docente # 2 del Instituto Superior Minero Metalúrgico de Moa. Con el software PV syst se determinó la producción anual de ene rgía eléctrica del sistema de 3 kWp conectado a la red, así como las pérdidas por sombras, cableado, electrón ica de potencia, modificación del ángulo de inclinación y por efecto de la irradiancia y temperatura. Tambi én se calcularon los parámetros característicos de la instalación, útiles para establecer perfiles mensuales para la planificación del consumo eléctrico. Los resultados demostraron que la energía anual generada, es equivalente al co nsumo eléctrico del Instituto durante dos días y además, constituye una alternativa para la generación de energí a, a partir del aprovechamiento de espacios disponibles en azoteas de las áreas docentes y administrativas. In this research the energy performance of a photovolta ic system based on amorphous silicon is analyzed. It is integrated to the flat horizontal rooftop of Teaching Building # 2 of the Metallurgical Mining Institute of Moa. With the PVsyst software annual electricity production of 3 kWp system connected to grid, as well as losses shadows, wiring, power electronics, also, tilt angle and the effect of irradiance and temperature were determined. The characteristic parameters of the installation, useful were calculated to establish monthly planning profiles for electrical consumption. The results showed that the annual energy generated is equivalent to the electricity consumption of the Institute for two days and also an alternative for generation energy from the use of space available on rooftops of teaching and administrative areas.

  11. La familia y su influencia educativa en las actividades de formación curricular, de los estudiantes de educación básica media de la escuela 23 De Abril del cantón Pasaje de la provincia de El Oro, año lectivo 2013-2014.

    OpenAIRE

    Olaya Ramírez, Narcisa Lorena

    2014-01-01

    This research is related to the family and its educational influence on the activities of curricular education of students of primary and secondary education , urgent that teachers include curriculum strategy school support aimed at improving the collaboration of parents of family in the process of schooling at home. The scientific problem Improving family collaboration in training curricular activities at home tutoring students in elementary and high school education April 23 Canton Passage ...

  12. Diseño e implementación de un modelo de gestión administrativo para la cooperativa de ahorro y crédito educadores de Chimborazo Ltda., y su incidencia en los indicadores de gestión. Periodo marzo 2013-abril 2014.

    OpenAIRE

    Castillo Fiallos, Mariela Paulina

    2015-01-01

    El presente trabajo de investigación se realizó en la Cooperativa de Ahorro y Crédito Educadores de Chimborazo Ltda., de la Ciudad de Riobamba, Provincia de Chimborazo, ubicada en las calles Veloz 22-11 y Espejo (esquina), con el propósito de dotar a la Institución de una herramienta idónea, capaz de analizar la gestión administrativa de manera cuantitativa y cualitativa. La gestión administrativa, es una herramienta que brindara parámetros para facilitar la toma de decisiones mejorando...

  13. Memorias del segundo simposio internacional sobre políticas, planificación y economía de los programas de protección contra incendios forestales: una visión global; 2004 Abril 19–22; Córdoba, España

    Science.gov (United States)

    Armando González-Cabán

    2008-01-01

    Estas memorias resumen el resultado de un simposio diseñado para discutir los problemas actuales que confrontan las agencias con responsabilidad para la protección contra incendios forestales a nivel federal y estadual en los EE.UU., al igual que agencias en la comunidad internacional. Los temas discutidos en el simposio incluyen economía del fuego, teoría y modelos...

  14. Análisis de la inteligencia emocional en cargos altos y medios y su influencia en la resolución de conflictos en el Hospital José Carrasco Arteaga de la ciudad de Cuenca en el período abril-septiembre del año 2008

    OpenAIRE

    Calle Moscoso, María Paulina; Sánchez Albarracín, Rosa Isabel

    2008-01-01

    Durante mucho tiempo uno de los dogmas ha sido el concepto de inteligencia, entendida ésta como el coeficiente intelectual. En contraposición a este concepto de inteligencia sale hoy en día a la luz el concepto de inteligencia emocional que comprende tanto las aptitudes como las habilidades sociales. Siendo así, la inteligencia el coeficiente, que no mide únicamente el éxito profesional, social o sentimental sino también mide otros factores como la motivación, el optimismo, la empatía o el au...

  15. A mulher e o cancro do pulmão** Textos referentes à mesa-redonda com o mesmo título organizada pela Comissão de Trabalho de «Pneumologia Oncológica». Coimbra, 13 de Abril de 2002

    Directory of Open Access Journals (Sweden)

    E. Teixeira

    2003-05-01

    Full Text Available RESUMO: A epidemiologia do cancro do pulmão mudou em vários países nos últimos anos.No século XIX o cancro do pulmão era raro, mas a sua incidência aumentou drasticamente durante o século XX e é previsível que continue a aumentar no início do século XXI.Actualmente, as taxas de incidência e mortalidade do cancro do pulmão são maiores nos países desenvolvidos, especialmente EUA e Europa, tendo-se verificado aumento de incidência na mulher. Estas diferenças geográficas e entre os sexos estão largamente relacionadas com os hábitos tabágicos.As mulheres começam a fumar mais precocemente e têm mais dificuldade na desabituação tabágica, por problemas relacionados com o controlo de peso; apresentam uma susceptibilidade maior aos carcinogéneos, tendo um risco de cancro do pulmão 1,5 vezes superior ao homem com os mesmos hábitos tabágicos. O adenocarcinoma é o tipo histológico mais frequente nos jovens, nas mulheres em todas as idades e nos não fumadores.Vários factores desde tabaco, poluição doméstica e profissional, nutricional doenças associadas, até factores genéticos e hormonais, têm sido investigados no sentido de definir a sua influência no desenvolvimento de cancro do pulmão na mulher.Quem trata este tipo de patologia vê-se ainda confrontado com inúmeras questões que se relacionam com a sua especificidade do sexo feminino. A literatura sobre este tema é no entanto vaga.REV PORT PNEUMOL 2003; IX (3: 225-247 ABSTRACT: The epidemiology of lung cancer has changed in the last years in several countries all over the world. In the 19th century, the lung cancer was rare but it incidence increase drastically during the 20th century, and the tendency is to continue in the 20th century. Actually the lung cancer’s incidence and mortality are higher in the developed countries, especially in Europe and Unites States of America, with a increasing in the women incidence. These geographic differences and gender differences are related with smoking habits.Women begin to smoke earlier and have more difficulty to stop, because of problems related with obesity; they have more sensibility to the carcinogens and the risk of lung cancer is 1,5 times higher than the men with the same habits.Adenocarcinoma is the more frequent histological type in young people, in the total of the women and in non-smokers.Many factors since tobacco, home and professional pollution, nutritional, associated diseases even genetic and hormonal factors have been investigated to define its influence in development in women lung cancer.It specificity in women with lung cancer is the comum problem for the medical people to treat this disease (pathology.The literature about this problem is not clear, and is necessary to advance with many studies in this arca with the objective to clarify this important question.REV PORT PNEUMOL 2003; IX (3: 225-247 Palavras-chave: Cancro do pulmão, mulher, epidemiologia, tratamento, Key-words: Lung Cancer, women, epidemiology, treatment

  16. Estudio del impacto económico del uso de cocinas a iducción implementando en la ciudad de Tulcán, en la población ingresos medios y bajos, período de estudio abril 2011 - marzo 2014

    OpenAIRE

    Jácome Rengifo, Wendy Anabel; Rojas Vásquez, Andrea Cecibel

    2015-01-01

    This project is focused on the analysis of change of the productive matrix of the country, emphasizing the proper use and management of water resources that it allows us to improve the economy of Ecuadorians. The most important change promoted by the government is the transformation in strategic sectors, this is achieved with the construction of eight hydroelectric plants that are intended to leave the dependence on the oil economy. The transformation of the energy matrix is one of the ...

  17. Motivación para la “inclusión”, características y necesidades de los estudiantes y docentes en la universidad. (Aplicativo con análisis de Recibido: Abril 02 de 2015 Aceptado: Junio 10 de 2015 gráficos estadísticos

    Directory of Open Access Journals (Sweden)

    Ruth Mery González-Sepúlveda

    2015-01-01

    Full Text Available The Government requires educational institutions and among them those of Higher Education, taking on new challenges and therefore “ the inclusion of persons with disabilities “ is one of them ; participate in building more inclusive, just and egalitarian societies through the development of , sensitive to the enormous diversity with multiple learning needs quality education models . Therefore, the concern to meet these needs and specific interest groups , perceptions arises characteristics that determine statistical supports them, interactions intervening factors that explain types of innovation required for these disabled people and responds to their needs Nortesantandereana being members of society. Hence the purpose of engaging in a “Inclusion” with educational proposals to guide the development of skills in college students with some kind of disability. The research design corresponds to a perspective on the quantitative paradigm supported by qualitative methodology; a multi-method approach as a viable development to solve problems, requirements or needs of a social group operating model. The Information search phases will result in descriptive analyzes looking at the reality of the subject matter from different points of view. For the analysis and interpretation of information tools Excel, SPSS was used. This research is expected to participate in the beginning to “Inclusion” scheme working as a mediator between the educational reality and knowledge.

  18. Proceso de intervención psicológica para fortalecer la relación madre-hijo desde la perspectiva de apego seguro en madres adolescentes de 15 a 17 años del centro de ADOLE-ISIS fundación patronato municipal San José en el período abril-julio de 2015

    OpenAIRE

    Bayas Velastegui, Katherine Alexandra

    2016-01-01

    This report systematizes the intervention from secure attachment perspective, which was carried out with adolescent mothers of ADOLE-ISIS Center and her children, and that included two axes: work in individual psychotherapy sessions and strengthening the link through early stimulation sessions. It also describes the initial situation of attachment and the changes that occurred, all of which were recorded by adapting the experiment "strange situation" proposed by Mary A...

  19. Elaboración y ejecución de talleres de motivación, empoderamiento, comunicación asertiva y adaptabilidad al cambio, dirigido al personal de la EMETET en el período abril - julio de 2010

    OpenAIRE

    Jara Crespo, Edwin Fabián; Neira Ruilova, Víctor Hugo

    2010-01-01

    Nuestra propuesta consiste en el diseño, elaboración y ejecución de talleres vivenciales, participativos, totalmente prácticos, referentes a temas de motivación, empoderamiento, comunicación asertiva y adaptabilidad al cambio, dirigidos al personal de la EMTET Cuenca, previo al desarrollo de los procesos de evaluación de desempeño. La metodología que utilizaremos cuenta con un sustento teórico basado en el modelo de Aprendizaje de Kolb, Programación Neurolingüística e Inteligencia Emociona...

  20. The Organization of Behavior Over Time: Insights from Mid-Session Reversal

    OpenAIRE

    Rayburn-Reeves, Rebecca M.; Cook, Robert G.

    2016-01-01

    What are the mechanisms by which behavior is organized sequentially over time? The recently developed mid-session reversal (MSR) task offers new insights into this fundamental question. The typical MSR task is arranged to have a single reversed discrimination occurring in a consistent location within each session and across sessions. In this task, we examine the relevance of time, reinforcement, and other factors as the switching cue in the sequential modulation of control in MSR. New analyse...

  1. New exploration on TMSR: modelling and simulation

    Energy Technology Data Exchange (ETDEWEB)

    Si, S.; Chen, Q.; Bei, H.; Zhao, J., E-mail: ssy@snerdi.com.cn [Shanghai Nuclear Engineering Research & Design Inst., Shanghai (China)

    2015-07-01

    A tightly coupled multi-physics model for MSR (Molten Salt Reactor) system involving the reactor core and the rest of the primary loop has been developed and employed in an in-house developed computer code TANG-MSR. In this paper, the computer code is used to simulate the behavior of steady state operation and transient for our redesigned TMSR. The presented simulation results demonstrate that the models employed in TANG-MSR can capture major physics phenomena in MSR and the redesigned TMSR has excellent performance of safety and sustainability. (author)

  2. Mechanical structure and problem of thorium molten salt reactor

    International Nuclear Information System (INIS)

    Kamei, Takashi

    2011-01-01

    After Fukushima Daiichi accident, there became great interest in Thorium Molten Salt Reactor (MSR) for the safety as station blackout leading to auto drainage of molten salts with freeze valve. This article described mechanical structure of MSR and problems of materials and pipes. Material corrosion problem by molten salts would be solved using modified Hastelloy N with Ti and Nb added, which should be confirmed by operation of an experimental reactor. Trends in international activities of MSR were also referred including China declaring MSR development in January 2011 to solve thorium contamination issues at rare earth production and India rich in thorium resources. (T. Tanaka)

  3. ORF Alignment: NC_004116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available de methionine ... sulfoxide reductase msrB ... Length = 140 ... Query: 2 ... KETQEELRQRIGHTAYQVTQNS...ATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 61 ... KETQEELRQRIGHTAYQVTQNSATEHAF...TGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG Sbjct: 1 ... KETQEELRQRIGHTAYQVTQNSATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 60

  4. ORF Alignment: NC_004368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available de methionine ... sulfoxide reductase msrB ... Length = 140 ... Query: 2 ... KETQEELRQRIGHTAYQVTQNS...ATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 61 ... KETQEELRQRIGHTAYQVTQNSATEHAF...TGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG Sbjct: 1 ... KETQEELRQRIGHTAYQVTQNSATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 60

  5. Molten salt reactor related research in Switzerland

    International Nuclear Information System (INIS)

    Krepel, Jiri; Hombourger, Boris; Fiorina, Carlo

    2015-01-01

    Switzerland represented by the Paul Scherrer Institute (PSI) is a member of the Generation IV International Forum (GIF). In the past, the research at PSI focused mainly on HTR, SFR, and GFR. Currently, a research program was established also for Molten Salt Reactors (MSR). Safety is the key point and main interest of the MSR research at the Nuclear Energy and Safety (NES) department of PSI. However, it cannot be evaluated without knowing the system design, fuel chemistry, salt thermal-hydraulics features, safety and fuel cycle approach, and the relevant material and chemical limits. Accordingly, sufficient knowledge should be acquired in the other individual fields before the safety can be evaluated. The MSR research at NES may be divided into four working packages (WP): WP1: MSR core design and fuel cycle, WP2: MSR fuel behavior at nominal and accidental conditions, WP3: MSR thermal-hydraulics and decay heat removal system, WP4: MSR safety, fuel stream, and relevant limits. The WPs are proposed so that there are research topics which can be independently studied within each of them. The work plan of the four WPs is based on several ongoing or past national and international projects relevant to MSR, where NES/PSI participates. At the current stage, the program focuses on several specific and design independent studies. The safety is the key point and main long-term interest of the MSR research at NES. (author)

  6. Condensation front modelling in a moisture separator reheater by application of SICLE numerical model

    International Nuclear Information System (INIS)

    Grange, J.L.; Caremoli, C.; Eddi, M.

    1988-01-01

    This paper presents improvements performed on SICLE numerical model in order to analyse the condensation front that occurs in the moisture separator reheaters (MSR) of nuclear power plants. Modifications of SICLE numerical model architecture and a fine modelling of reheater have allowed to correctly simulate the MSR thermohydraulic behaviour during a severe transient (plant islanding) [fr

  7. High Flux Microchannel Receiver Development with Adap-tive Flow Control

    Energy Technology Data Exchange (ETDEWEB)

    Drost, Kevin [Oregon State Univ., Corvallis, OR (United States)

    2015-08-15

    This project is focused on the demonstration of a microchannel-based solar receiver (MSR). The MSR concept consists of using a modular arrangement of arrayed microchannels to heat a working fluid in a concentrating solar receiver, allowing a much higher solar flux on the receiver and consequently a significant reduction in thermal losses, size, and cost.

  8. Macrophage specific overexpression of the human macrophage scavenger receptor in transgenic mice, using a 180-kb yeast artificial chromosome, leads to enhanced foam cell formation of isolated peritoneal macrophages

    NARCIS (Netherlands)

    de Winther, M. P.; van Dijk, K. W.; van Vlijmen, B. J.; Gijbels, M. J.; Heus, J. J.; Wijers, E. R.; van den Bos, A. C.; Breuer, M.; Frants, R. R.; Havekes, L. M.; Hofker, M. H.

    1999-01-01

    Macrophage scavenger receptors class A (MSR) are thought to play an important role in atherogenesis by mediating the unrestricted uptake of modified lipoproteins by macrophages in the vessel wall leading to foam cell formation. To investigate the in vivo role of the MSR in this process, a transgenic

  9. Thorium and Molten Salt Reactors: "Essential Questions for Classroom Discussions"

    Science.gov (United States)

    DiLisi, Gregory A.; Hirsch, Allison; Murray, Meredith; Rarick, Richard

    2018-01-01

    A little-known type of nuclear reactor called the "molten salt reactor" (MSR), in which nuclear fuel is dissolved in a liquid carrier salt, was proposed in the 1940s and developed at the Oak Ridge National Laboratory in the 1960s. Recently, the MSR has generated renewed interest as a remedy for the drawbacks associated with conventional…

  10. The Organization of Behavior Over Time: Insights from Mid-Session Reversal.

    Science.gov (United States)

    Rayburn-Reeves, Rebecca M; Cook, Robert G

    2016-01-01

    What are the mechanisms by which behavior is organized sequentially over time? The recently developed mid-session reversal (MSR) task offers new insights into this fundamental question. The typical MSR task is arranged to have a single reversed discrimination occurring in a consistent location within each session and across sessions. In this task, we examine the relevance of time, reinforcement, and other factors as the switching cue in the sequential modulation of control in MSR. New analyses also highlight some of the potential mechanisms underlying this serially organized behavior. MSR provides new evidence and we offer some ideas about how cues interact to compete for the control of behavior within and across sessions. We suggest that MSR is an excellent preparation for studying the competition among psychological states and their resolution toward action.

  11. Role of Helicobacter pylori methionine sulfoxide reductase in urease maturation

    Science.gov (United States)

    Kuhns, Lisa G.; Mahawar, Manish; Sharp, Joshua S.; Benoit, Stéphane; Maier, Robert J.

    2014-01-01

    The persistence of the gastric pathogen Helicobacter pylori is due in part to urease and Msr (methionine sulfoxide reductase). Upon exposure to relatively mild (21% partial pressure of O2) oxidative stress, a Δmsr mutant showed both decreased urease specific activity in cell-free extracts and decreased nickel associated with the partially purified urease fraction as compared with the parent strain, yet urease apoprotein levels were the same for the Δmsr and wild-type extracts. Urease activity of the Δmsr mutant was not significantly different from the wild-type upon non-stress microaerobic incubation of strains. Urease maturation occurs through nickel mobilization via a suite of known accessory proteins, one being the GTPase UreG. Treatment of UreG with H2O2 resulted in oxidation of MS-identified methionine residues and loss of up to 70% of its GTPase activity. Incubation of pure H2O2-treated UreG with Msr led to reductive repair of nine methionine residues and recovery of up to full enzyme activity. Binding of Msr to both oxidized and non-oxidized UreG was observed by cross-linking. Therefore we conclude Msr aids the survival of H. pylori in part by ensuring continual UreG-mediated urease maturation under stress conditions. PMID:23181726

  12. Current and potential sustainable corn stover feedstock for biofuel production in the United States

    Science.gov (United States)

    Tan, Zhengxi; Liu, Shu-Guang; Tieszen, Larry L.; Bliss, Norman

    2012-01-01

    Increased demand for corn (Zea mays L.) stover as a feedstock for cellulosic ethanol raises concerns about agricultural sustainability. Excessive corn stover harvesting could have long-term impacts on soil quality. We estimated current and future stover production and evaluated the potential harvestable stover amount (HSA) that could be used for biofuel feedstock in the United States by defining the minimum stover requirement (MSR) associated with the current soil organic carbon (SOC) content, tillage practices, and crop rotation systems. Here we show that the magnitude of the current HSA is limited (31 Tg y−1, dry matter) due to the high MSR for maintaining the current SOC content levels of soils that have a high carbon content. An alternative definition of MSR for soils with a moderate level of SOC content could significantly elevate the annual HSA to 68.7 Tg, or even to 132.2 Tg if the amount of currently applied manure is counted to partially offset the MSR. In the future, a greater potential for stover feedstock could come from an increase in stover yield, areal harvest index, and/or the total planted area. These results suggest that further field experiments on MSR should be designed to identify differences in MSR magnitude between maintaining SOC content and preventing soil erosion, and to understand the role of current SOC content level in determining MSR from soils with a wide range of carbon contents and climatic conditions.

  13. Leishmania major methionine sulfoxide reductase A is required for resistance to oxidative stress and efficient replication in macrophages.

    Directory of Open Access Journals (Sweden)

    Fiona M Sansom

    Full Text Available Leishmania are protozoan parasites that proliferate within the phagolysome of mammalian macrophages. While a number of anti-oxidant systems in these parasites have been shown to protect against endogenous as well as host-generated reactive oxygen species, the potential role of enzymes involved in the repair of oxidatively damaged proteins remains uncharacterized. The Leishmania spp genomes encode a single putative methionine sulfoxide reductase (MsrA that could have a role in reducing oxidized free and proteinogenic methionine residues. A GFP-fusion of L. major MsrA was shown to have a cytoplasmic localization by immunofluorescence microscopy and subcellular fractionation. An L. major msrA null mutant, generated by targeted replacement of both chromosomal allelles, was viable in rich medium but was unable to reduce exogenous methionine sulfoxide when cultivated in the presence of this amino acid, indicating that msrA encodes a functional MsrA. The ΔmsrA mutant exhibited increased sensitivity to H(2O(2 compared to wild type parasites and was unable to proliferate normally in macrophages. Wild type sensitivity to H(2O(2 and infectivity in macrophages was restored by complementation of the mutant with a plasmid encoding MsrA. Unexpectedly, the ΔmsrA mutant was able to induce normal lesions in susceptible BALB/c indicating that this protein is not essential for pathogenesis in vivo. Our results suggest that Leishmania MsrA contributes to the anti-oxidative defences of these parasites, but that complementary oxidative defence mechansims are up-regulated in lesion amastigotes.

  14. Simulation of Molten Salt Reactor dynamics

    International Nuclear Information System (INIS)

    Krepel, J.; Rohde, U.; Grundmann, U.

    2005-01-01

    Dynamics of the Molten Salt Reactor - one of the 'Generation IV' concepts - was studied in this paper. The graphite-moderated channel type MSR was selected for the numerical simulation of the reactor with liquid fuel. The MSR dynamics is very specific because of two physical peculiarities of the liquid fueled reactor: the delayed neutrons precursors are drifted by the fuel flow and the fission energy is immediately released directly into the coolant. Presently, there are not many accessible numerical codes appropriate for the MSR simulation, therefore the DYN3D-MSR code was developed based on the FZR in-house code DYN3D. It allows calculating of full 3D transient neutronics in combination with parallel channel type thermal-hydraulics. By means of DYN3D-MSR, several transients typical for the liquid fuel system were analyzed. Those transients were initiated by reactivity insertion, by overcooling of fuel at the core inlet, by the fuel pump start-up or coast-down, or by the blockage of selected fuel channels. In these considered transients, the response of the MSR is characterized by the immediate change of the fuel temperature with changing power and fast negative temperature feedback to the power. The response through the graphite temperature is slower. Furthermore, for big MSR cores fueled with U233 the graphite feedback coefficient can be positive. In this case the addition of erbium to the graphite can ensure the inherent safety features. The DYN3D-MSR code has been shown to be an effective tool for MSR dynamics studies. (author)

  15. Proposed Guidance for Preparing and Reviewing Molten Salt Nonpower Reactor Licence Applications (NUREG-1537)

    Energy Technology Data Exchange (ETDEWEB)

    Belles, Randy [ORNL; Flanagan, George F. [ORNL; Voth, Marcus [Boston Government Services, LLC

    2018-05-01

    Development of non-power molten salt reactor (MSR) test facilities is under consideration to support the analyses needed for development of a full-scale MSR. These non-power MSR test facilities will require review by the US Nuclear Regulatory Commission (NRC) staff. This report proposes chapter adaptations for NUREG-1537 in the form of interim staff guidance to address preparation and review of molten salt non-power reactor license applications. The proposed adaptations are based on a previous regulatory gap analysis of select chapters from NUREG-1537 for their applicability to non-power MSRs operating with a homogeneous fuel salt mixture.

  16. Monte Carlo computed machine-specific correction factors for reference dosimetry of TomoTherapy static beam for several ion chambers

    International Nuclear Information System (INIS)

    Sterpin, E.; Mackie, T. R.; Vynckier, S.

    2012-01-01

    Purpose: To determine k Q msr ,Q o f msr ,f o correction factors for machine-specific reference (msr) conditions by Monte Carlo (MC) simulations for reference dosimetry of TomoTherapy static beams for ion chambers Exradin A1SL, A12; PTW 30006, 31010 Semiflex, 31014 PinPoint, 31018 microLion; NE 2571. Methods: For the calibration of TomoTherapy units, reference conditions specified in current codes of practice like IAEA/TRS-398 and AAPM/TG-51 cannot be realized. To cope with this issue, Alfonso et al. [Med. Phys. 35, 5179–5186 (2008)] described a new formalism introducing msr factors k Q msr ,Q o f msr ,f o for reference dosimetry, applicable to static TomoTherapy beams. In this study, those factors were computed directly using MC simulations for Q 0 corresponding to a simplified 60 Co beam in TRS-398 reference conditions (at 10 cm depth). The msr conditions were a 10 × 5 cm 2 TomoTherapy beam, source-surface distance of 85 cm and 10 cm depth. The chambers were modeled according to technical drawings using the egs++ package and the MC simulations were run with the egs c hamber user code. Phase-space files used as the source input were produced using PENELOPE after simulation of a simplified 60 Co beam and the TomoTherapy treatment head modeled according to technical drawings. Correlated sampling, intermediate phase-space storage, and photon cross-section enhancement variance reduction techniques were used. The simulations were stopped when the combined standard uncertainty was below 0.2%. Results: Computed k Q msr ,Q o f msr ,f o values were all close to one, in a range from 0.991 for the PinPoint chamber to 1.000 for the Exradin A12 with a statistical uncertainty below 0.2%. Considering a beam quality Q defined as the TPR 20,10 for a 6 MV Elekta photon beam (0.661), the additional correction k Q msr, Q f msr, f ref to k Q,Q o defined in Alfonso et al. [Med. Phys. 35, 5179–5186 (2008)] formalism was in a range from 0.997 to 1.004.Conclusion: The MC computed

  17. Proposition of a Solution for the Setting of the Abrasive Waterjet Cutting Technology

    Czech Academy of Sciences Publication Activity Database

    Valíček, Jan; Harničárová, M.; Kušnerová, M.; Grznárik, R.; Zavadil, J.

    2013-01-01

    Roč. 13, č. 5 (2013), s. 279-285 ISSN 1335-8871 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : abrasive waterjet cutting of materials * surface topography function * correlation relations * surface roughness * optimization of technology Subject RIV: JQ - Machines ; Tools Impact factor: 1.162, year: 2013 http://www.degruyter.com/view/j/msr.2013.13.issue-5/msr-2013-0041/msr-2013-0041. xml

  18. Tendances Carbone no. 99. EU ETS and competitiveness: the tricky equation of free allocation through to 2030

    International Nuclear Information System (INIS)

    Jalard, Matthieu; Alberola, Emilie

    2015-02-01

    Among the publications of CDC Climat Research, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS - MSR debate: on 21 January, the ITRE committee of the European Parliament voted and rejected amendments to the MSR reform, and therefore will not provide any opinion concerning the mechanism to the ENVI committee. - EU ETS - MSR timetable: the ENVI committee voted on 23 and 24 February 2015 about possible amendments to the MSR. - New Entrants Reserve (NER): 18.6 million allowances were allocated in 2013 and 2014, 51 million will be earmarked for the period 2015-2020

  19. Ignition Systems for Long-Term Storage and Multi-Start Capability, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — A Mars Sample Return (MSR) campaign has been identified as the critical next step in Mars science. Of the tasks needing to be accomplished, the Mars Ascent Vehicle...

  20. Description of European Space Agency (ESA) Double Walled Isolator (DWI) Breadboard Currently Under Development for Demonstration of Critical Technology Foreseen to be Used in the Mars Sample Receiving Facility (MSRF)

    Science.gov (United States)

    Vrublevskis, J.; Berthoud, L.; McCulloch, Y.; Bowman, P.; Holt, J.; Bridges, J.; Bennett, A.; Gaubert, F.; Duvet, L.

    2018-04-01

    The need for biocontainment from Planetary Protection Policy and the need for cleanliness for scientific investigation requires that the samples returned from Mars by the Mars Sample Return (MSR) mission must be handled in a Double Walled Isolator (DWI).

  1. Tendances Carbone no. 103. EU ETS auctions revenues: few guidelines to improve use for the low-carbon transition financing

    International Nuclear Information System (INIS)

    Vaidyula, Manasvini; Alberola, Emilie

    2015-05-01

    Among the publications of CDC Climat Research, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS - MSR negotiations: On May 26, the Environment Committee of the EU Parliament approved the consolidated text for the implementation of the MSR as from 2019, and a placement of back-loaded as well as unused allowances straight into the reserve. A vote in plenary session is scheduled on 7 July. - EU ETS reform: A vote in EU Parliament is scheduled on 7 July to endorse the MSR. The European Commission should propose measures to tackle carbon leakages issues in the six months following the adoption of the MSR. - EU ETS emissions: Emissions under the EU ETS decreased by 4,5 % in 2014, and reached 1,812 Mt CO 2 e

  2. Space Storable Hybrid Rockets for Orbit Insertion or In Situ Resource Utilization Applications

    Data.gov (United States)

    National Aeronautics and Space Administration — This research effort will pave the way towards a Mars Sample Return (MSR) campaign and potentially, future human exploration of Mars. Hybrid rockets utilize a solid...

  3. Production bananière durable et recours aux pesticides au Costa Rica

    International Development Research Centre (IDRC) Digital Library (Canada)

    ISA) : final technical report (April 2009 - April 2013); executive summary. Téléchargez le PDF. Rapports. Programa infantes y salud ambiental con un enfoque ecosistémico (ISA) : informe técnico final (abril 2009 - abril 2013); resumen ejecutivo.

  4. Analysis of a molten salt reactor benchmark

    International Nuclear Information System (INIS)

    Ghosh, Biplab; Bajpai, Anil; Degweker, S.B.

    2013-01-01

    This paper discusses results of our studies of an IAEA molten salt reactor (MSR) benchmark. The benchmark, proposed by Japan, involves burnup calculations of a single lattice cell of a MSR for burning plutonium and other minor actinides. We have analyzed this cell with in-house developed burnup codes BURNTRAN and McBURN. This paper also presents a comparison of the results of our codes and those obtained by the proposers of the benchmark. (author)

  5. Reactor of the XXI century

    International Nuclear Information System (INIS)

    Zhotabaev, Zh.R.; Solov'ev, Yu.A.

    2001-01-01

    The advantages of both molten salt reactors (MSR) and homogenous molten salt reactors (HMSR) are illuminated. It is noted that the MSR possess accident probability A=10 -6 1/reactor.years and the HMSR with integral configuration has A=10 -7 1/reactor.years. The methods for these reactors technological problems solution - tritium removal, salt melt circulation and capacity pick up - are discussed

  6. Transient thermal characteristics of a core channel in a molten salt reactor

    International Nuclear Information System (INIS)

    Sakashita, H.; Ishiguro, R.; Sugiyama, K.

    1987-01-01

    The present paper deals with the thermal characteristics of Molten Salt Reactor (MSR). Analyses of the fundamental behavior of internal heat generating fluid and graphite contiguous to the fluid are performed. As a result, it is known that the transient thermal characteristics of MSR differ fundamentally from those of a solid-fuel reactor, and the simplified method of thermal analysis which is commonly used for solid-fuel reactors gives optimistic predictions than the actual phenomena. (author)

  7. The Thioredoxin Domain of Neisseria Gonorrhoeae PilB can use Electrons from DsbD to Reduce Downstream Methionine Sulfoxide Reductases

    Energy Technology Data Exchange (ETDEWEB)

    Brot,N.; Collet, J.; Johnson, L.; Jonsson, T.; Weissbach, H.; Lowther, W.

    2006-01-01

    The PilB protein from Neisseria gonorrhoeae is located in the periplasm and made up of three domains. The N-terminal, thioredoxin-like domain (NT domain) is fused to tandem methionine sulfoxide reductase A and B domains (MsrA/B). We show that the {alpha} domain of Escherichia coli DsbD is able to reduce the oxidized NT domain, which suggests that DsbD in Neisseria can transfer electrons from the cytoplasmic thioredoxin to the periplasm for the reduction of the MsrA/B domains. An analysis of the available complete genomes provides further evidence for this proposition in other bacteria where DsbD/CcdA, Trx, MsrA, and MsrB gene homologs are all located in a gene cluster with a common transcriptional direction. An examination of wild-type PilB and a panel of Cys to Ser mutants of the full-length protein and the individually expressed domains have also shown that the NT domain more efficiently reduces the MsrA/B domains when in the polyprotein context. Within this framework there does not appear to be a preference for the NT domain to reduce the proximal MsrA domain over MsrB domain. Finally, we report the 1.6 {angstrom} crystal structure of the NT domain. This structure confirms the presence of a surface loop that makes it different from other membrane-tethered, Trx-like molecules including TlpA, CcmG and ResA. Subtle differences are observed in this loop when compared to the N. meningitidis NT domain structure. The data taken together supports the formation of specific NT domain interactions with the MsrA/B domains and its in vivo recycling partner, DsbD.

  8. Methionine sulphoxide reductases revisited: free methionine as a primary target of H2O2 stress in auxotrophic fission yeast

    OpenAIRE

    García Santamarina, Sarela, 1978-; Boronat i Llop, Susanna, 1965-; Ayté del Olmo, José; Hidalgo Hernando, Elena

    2013-01-01

    Amino acid methionine can suffer reversible oxidation to sulphoxide and further irreversible over-oxidation to methionine sulphone. As part of the cellular antioxidant scavenging activities are the methionine sulphoxide reductases (Msrs), with a reported role in methionine sulphoxide reduction, both free and in proteins. Three families of Msrs have been described, but the fission yeast genome only includes one representative for two of these families: MsrA/Mxr1 and MsrB/Mxr2. We have investig...

  9. Self-recognition, theory-of-mind, and self-awareness: what side are you on?

    Science.gov (United States)

    Morin, Alain

    2011-05-01

    A fashionable view in comparative psychology states that primates possess self-awareness because they exhibit mirror self-recognition (MSR), which in turn makes it possible to infer mental states in others ("theory-of-mind"; ToM). In cognitive neuroscience, an increasingly popular position holds that the right hemisphere represents the centre of self-awareness because MSR and ToM tasks presumably increase activity in that hemisphere. These two claims are critically assessed here as follows: (1) MSR should not be equated with full-blown self-awareness, as it most probably only requires kinaesthetic self-knowledge and does not involve access to one's mental events; (2) ToM and self-awareness are fairly independent and should also not be taken as equivalent notions; (3) MSR and ToM tasks engage medial and left brain areas; (4) other self-awareness tasks besides MSR and ToM tasks (e.g., self-description, autobiography) mostly recruit medial and left brain areas; (5) and recent neuropsychological evidence implies that inner speech (produced by the left hemisphere) plays a significant role in self-referential activity. The main conclusions reached based on this analysis are that (a) organisms that display MSR most probably do not possess introspective self-awareness, and (b) self-related processes most likely engage a distributed network of brain regions situated in both hemispheres.

  10. Spontaneous expression of mirror self-recognition in monkeys after learning precise visual-proprioceptive association for mirror images.

    Science.gov (United States)

    Chang, Liangtang; Zhang, Shikun; Poo, Mu-Ming; Gong, Neng

    2017-03-21

    Mirror self-recognition (MSR) is generally considered to be an intrinsic cognitive ability found only in humans and a few species of great apes. Rhesus monkeys do not spontaneously show MSR, but they have the ability to use a mirror as an instrument to find hidden objects. The mechanism underlying the transition from simple mirror use to MSR remains unclear. Here we show that rhesus monkeys could show MSR after learning precise visual-proprioceptive association for mirror images. We trained head-fixed monkeys on a chair in front of a mirror to touch with spatiotemporal precision a laser pointer light spot on an adjacent board that could only be seen in the mirror. After several weeks of training, when the same laser pointer light was projected to the monkey's face, a location not used in training, all three trained monkeys successfully touched the face area marked by the light spot in front of a mirror. All trained monkeys passed the standard face mark test for MSR both on the monkey chair and in their home cage. Importantly, distinct from untrained control monkeys, the trained monkeys showed typical mirror-induced self-directed behaviors in their home cage, such as using the mirror to explore normally unseen body parts. Thus, bodily self-consciousness may be a cognitive ability present in many more species than previously thought, and acquisition of precise visual-proprioceptive association for the images in the mirror is critical for revealing the MSR ability of the animal.

  11. Limiar anaeróbico: comparação entre os métodos directos e indirectos em nadadores de alta competição Portugueses(+(+ Trabalho apresentado sob forma de comunicação oral no II Congresso Hispano-Luso de Pneumologia. Sevilha, 21 de Abril de 1993 econcorrente ao Prémio Thomé Villar 1993 (Secção B. da SPPR.

    Directory of Open Access Journals (Sweden)

    Cecília Longo

    1995-01-01

    Full Text Available RESUMO: Com o objectivo de avaliar o limiar anaeróbico (AT compara-se o ponto de rotura ventilatória ou “limiar ventilatório” (ATV com a lactatémia de 4 mmol/1 (ATL. Realizou-se uma prova de esforço progressiva máxima (EOS Sprint Jaeger, em cicloergómetro, com carga inicial de 1 Watt/ Kg de peso e incrementos todos os dois minutos. Os lactatos foram determinados pelo método enzimático. A determinação do ATV foi efectuada por 2 observadores independentes. Estudámos para o efeito 23 nadadores de alta competição portugueses, submetidos a uma média de treino semanal de 15 h (mínimo 14 e máximo de 22 h. Destes, 16 eram do sexo masculino e 7 do feminino; tinham idades médias de 15.8 anos±2.5 (mínima 13 e máxima de 24 anos. A altura média era de 169 cm± 7.8 e o peso médio foi de 62Kg±10.09.Da análise das médias dos parâmetros cardiorespiratórios e carga aonível do ATL e do ATV encontrámos diferenças com significado estatístico em relação com: a carga em watt/ Kg: ATL 2.98±0.59 e ATV 3.45±0.64 (P =0.01; os watt totais: ATL 184.35±36.9 e ATV 214.8±46.3 (P =0.01; a ventilação minuto (V: ATL 53.85±10.7 e ATV 62.17±16 (P<0.05; a eliminação de CO2 1/ min (VCO2: ATL 2.22±.5 e ATV 2.61±.77 (P<0.05; os valores percentuais entre o consumo de O2 (VO2 ao nível do ATL e do ATV (1/ m e o VO2 máximo (P<0.05; a FC: ATL 147.2±12.3 e ATV 160.3±20 (P=0.01; o cociente respiratório (QR: ATL 0.94±0.06 e ATV 0.99±0.06 (P<0.05. Em relação aos parâmetros médios seguintes não se encontrou differenças estatísticamente significativas: VO2, VO2/FC/Kg, VO2/FC, equivalentes respiratórios para O2 e CO2 (ERO2 e ERCO2. Como a determinação do AT permite precisar a intensidade do exercício a partir do qual o metabolismo anaeróbico lactico é predominante, os resultados do nosso trabalho levam-nos a concluir que, ou o valor do ATL é superior ao convencionado classicamente em indivíduos treinados, ou então não há sobreposição entre o ATL e o ATV. ABSTRACT: We compare the ventililtory threshold (ATV with a 4 mmol/1 of the lactatemie (ATL during a progressive maximal shedule. Lactates were determined by the enzymatic method. ATV determination was done by two independent observers.We studied 23 portuguese elite swimmers, with an average training of 15 hours/week; 16 were male and 7 female. Mean age was 15.8 ±2.5 years old. When we compared cardiorespiratory parameters and load at the level of ATL and ATV, we found statistical significance in the following parameters:• p<0.01: the total load, the load/ kg of weight, heart frequency and• p<0.05: the minute ventilation, the VCO2, the relation of VO2 at AT and VO2 maximum in pourcentage, the respiratory ratio (QR.We conclude that in trained swimmers there are no superposition between ATL and ATV. Key-words: lactates, anaerobic threshold, ventilatory threshold, swimmers, Palavras-chave: lactatos, limiar anaeróbico, limiar ventilatório, nadadores

  12. TH-AB-201-09 [Medical Physics, Jun 2016, v. 43(6)

    Energy Technology Data Exchange (ETDEWEB)

    Mirzakhanian, L [McGill University, Medical Physics Unit, Montreal, Quebec (Canada); Benmakhlouf, H [Department of Medical Physics, Karolinska University Hospital, Stockholm (Sweden); Seuntjens, J [McGill University, Montreal, Quebec (Canada)

    2016-06-15

    Purpose: To determine the k-(Q-msr,Q)^(f-msr,f-ref ) factor, introduced in the small field formalism for five common type chambers used in the calibration of Leksell Gamma-Knife Perfexion model over a range of different phantom electron densities. Methods: Five chamber types including Exradin-A16, A14SL, A14, A1SL and IBA-CC04 are modeled in EGSnrc and PENELOPE Monte Carlo codes using the blueprints provided by the manufacturers. The chambers are placed in a previously proposed water-filled phantom and four 16-cm diameter spherical phantoms made of liquid water, Solid Water, ABS and polystyrene. Dose to the cavity of the chambers and a small water volume are calculated using EGSnrc/PENELOPE codes. The calculations are performed over a range of phantom electron densities for two chamber orientations. Using the calculated dose-ratio in reference and machine specific reference field, the k-(Q-msr,Q)^(f-msr,f-ref ) factor can be determined. Results: When chambers are placed along the symmetry axis of the collimator block (z-axis), the CC04 requires the smallest correction followed by A1SL and A16. However, when detectors are placed perpendicular to z-axis, A14SL needs the smallest and A16 the largest correction. Moreover, an increase in the phantom electron density results in a linear increase in the k-(Q-msr,Q)^(f-msr,f-ref ). Depending on the chambers, the agreement between this study and a previous study performed varies between 0.05–0.70% for liquid water, 0.07–0.85% for Solid Water and 0.00–0.60% for ABS phantoms. After applying the EGSnrc-calculated k-(Q-msr,Q)^(f-msr,f-ref ) factors for A16 to the previously measured dose-rates in liquid water, Solid Water and ABS normalized to the dose-rate measured with TG-21 protocol and ABS phantom, the dose-rate ratios are found to be 1.004±0.002, 0.996±0.002 and 0.998±0.002 (3σ) respectively. Conclusion: Knowing the electron density of the phantoms, the calculated k-(Q-msr,Q)^(f-msr,f-ref ) values in this work

  13. Design of the Natural Circulation Loop and Implementation of DOWTHERM A Properties into MARS-LMR Code

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Yukyung; Park, Seong Dae; Kang, Sarah; Bang, In Cheol [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2015-05-15

    Molten Salt Reactor (MSR), which is one of the generation IV reactors, has an advantage in these requirements. MSR uses a molten salt mixture as the primary coolant, or the fuel itself and it operates on high temperature, so it doesn't need pressurizing. Also, liquid state fuel has an advantage for pyro-processing with easy separation of fission products. These fission products also have relatively short half-lives compared to those of the existing reactors. With these characteristics, MSR can have inherent safety in both direct and indirect sides. Also, MSR can operate at high temperature range, so that it can have the high efficiency to produce electricity. Therefore, research of MSR is meaningful for developing advanced nuclear reactors. FLiBe which is a mixture of lithium fluoride (LiF) and beryllium fluoride (BeF{sub 2}) is used as a primary coolant in MSR and LMR (Liquid Metal cooled Reactor). It has superiority over conventional liquid metal coolant like sodium, because it doesn't react with air or water. thermos-physical properties of DOWTHERM A for MARS-LMR code were made by modifying stg file of existing one. It was based on the process of Moore using 6 output parameters such as specific volume, internal energy, thermal expansion coefficient, isothermal compressibility, specific heat and entropy. With generated stg file (stgdowa.f90) and input file, tpf file (tpfdowa) which includes fluid property tables for MARS-LMR simulation was obtained. For the verification, this tpf file with execution file will be applied to the input deck of our natural circulation design. This work will contribute to researching and developing of MSR and LMR.

  14. Development of fuel cycle technology for molten-salt reactor systems

    International Nuclear Information System (INIS)

    Uhlir, J.

    2006-01-01

    Full text: Full text: The Molten-Salt Reactor (MSR) represents one of promising advanced reactor type assigned to the GEN IV reactor systems. It can be operated either as thorium breeder within the Th -133U fuel cycle or as actinide transmuter incinerating transuranium fuel. Essentially the main advantage of MSR comes out from the prerequisite, that this reactor type should be directly connected with the 'on-line' reprocessing of circulating liquid (molten-salt) fuel. This principle should allow very effective extraction of freshly constituted fissile material (233U). Besides, the on-line fuel salt clean up is necessary within a long run to keep the reactor in operation. As a matter of principle, it permits to clear away typical reactor poisons like xenon, krypton, lanthanides etc. and possibly also other products of burned plutonium and transmuted minor actinides. The fuel salt clean up technology should be linked with the fresh MSR fuel processing to continuously refill the new fuel (thorium or transuranics) into the reactor system. On the other hand, the technologies of fresh transuranium molten-salt fuel processing from the current LWR spent fuel and of the on-line reprocessing of MSR fuel represent two killing points of the whole MSR technology, which have to be successfully solved before MSR deployment in the future. There are three main pyrochemical partitioning techniques proposed for processing and/or reprocessing of MSR fuel: Fluoride volatilization processes, Molten salt / liquid metal extraction processes and Electrochemical separation processes. Two of them - Fluoride Volatility Method and Electrochemical separation process from fluoride media are under development in the Nuclear Research Institute Rez pic. R and D in the field of Fluoride Volatility Method is concentrated to the development and verification of experimental semi-pilot technology for LWR spent fuel reprocessing, which may result in a product the form and composition of which might be

  15. APPLICATION OF MEMBRANE SORPTION REACTOR TECHNOLOGY FOR LRW MANAGEMENT

    International Nuclear Information System (INIS)

    Glagolenko, Yuri; Dzekun, Evgeny; Myasoedovg, Boris; Gelis, Vladimir; Kozlitin, Evgeny; Milyutin, Vitaly; Trusov, Lev; Rengel, Mike; Mackay, Stewart M.; Johnson, Michael E.

    2003-01-01

    A new membrane-sorption technology has been recently developed and industrially implemented in Russia for the treatment of the Liquid (Low-Level) Radioactive Waste (LRW). The first step of the technology is a precipitation of the radionuclides and/or their adsorption onto sorbents of small particle size. The second step is filtration of the precipitate/sorbent through the metal-ceramic membrane, Trumem.. The unique feature of the technology is a Membrane-Sorption Reactor (MSR), in which the precipitation / sorption and the filtration of the radionuclides occur simultaneously, in one stage. This results in high efficiency, high productivity and compactness of the equipment, which are the obvious advantages of the developed technology. Two types of MSR based on Flat Membranes device and Centrifugal Membrane device were developed. The advantages and disadvantages of application of each type of the reactors are discussed. The MSR technology has been extensively tested and efficiently implemented at ''Mayak '' nuclear facility near Chelyabinsk, Russia as well as at other Russian sites. The results of this and other applications of the MSR technology at the different Russian nuclear facilities are discussed. The results of the first industrial applications of the MSR technology for radioactive waste treatment in Russia and analysis of the available information about LRW accumulated in other countries imply that this technology can be successfully used for the Low Level Radioactive Waste treatment in the USA and in other nuclear countries

  16. Matrix-based system reliability method and applications to bridge networks

    International Nuclear Information System (INIS)

    Kang, W.-H.; Song Junho; Gardoni, Paolo

    2008-01-01

    Using a matrix-based system reliability (MSR) method, one can estimate the probabilities of complex system events by simple matrix calculations. Unlike existing system reliability methods whose complexity depends highly on that of the system event, the MSR method describes any general system event in a simple matrix form and therefore provides a more convenient way of handling the system event and estimating its probability. Even in the case where one has incomplete information on the component probabilities and/or the statistical dependence thereof, the matrix-based framework enables us to estimate the narrowest bounds on the system failure probability by linear programming. This paper presents the MSR method and applies it to a transportation network consisting of bridge structures. The seismic failure probabilities of bridges are estimated by use of the predictive fragility curves developed by a Bayesian methodology based on experimental data and existing deterministic models of the seismic capacity and demand. Using the MSR method, the probability of disconnection between each city/county and a critical facility is estimated. The probability mass function of the number of failed bridges is computed as well. In order to quantify the relative importance of bridges, the MSR method is used to compute the conditional probabilities of bridge failures given that there is at least one city disconnected from the critical facility. The bounds on the probability of disconnection are also obtained for cases with incomplete information

  17. Quantitative MRI comparison of pulmonary hemodynamics in mustard/senning-repaired patients suffering from transposition of the great arteries and healthy volunteers at rest

    International Nuclear Information System (INIS)

    Laffon, Eric; Latrabe, Valerie; Jimenez, Maria; Ducassou, Dominique; Laurent, Francois; Marthan, Roger

    2006-01-01

    In Mustard/Senning-repaired (MSR) patients, the right and left ventricles (RV, LV) act as the systemic and pulmonary ventricle, respectively. The purpose of the study was to compare non-invasively, at rest, pulmonary ventricle systolic function and hemodynamics in MSR patients with those of healthy volunteers. Velocity-encoded MR imaging was performed at the level of the main pulmonary artery (MPA) in ten male patients late after a Mustard/Senning correction performed early in infancy and in ten male volunteers. Both blood flow and MPA cross-sectional area variations were recorded over a complete cardiac cycle. MPA distensibility, body surface area (BSA)-normalized pulmonary ventricle systolic power and work were significantly lower in the MSR patients compared to volunteers. In particular, BSA-normalized LV systolic power and work in MSR patients were equal to 82 and 77% on average of those of the RV in volunteers (0.32 vs. 0.39 W/m 2 and 0.10 vs. 0.13 J/m 2 ), respectively. We conclude that in MSR patients at rest two unrelated findings were observed: (1) a reduced MPA distensibility and (2) a significantly lower systolic mechanical performance of the pulmonary LV compared to that of the RV in healthy volunteers. The latter quantification indirectly confirms the lowest systemic RV systolic mechanical performance previously published. (orig.)

  18. Precocious development of self-awareness in dolphins.

    Directory of Open Access Journals (Sweden)

    Rachel Morrison

    Full Text Available Mirror-self recognition (MSR is a behavioral indicator of self-awareness in young children and only a few other species, including the great apes, dolphins, elephants and magpies. The emergence of self-awareness in children typically occurs during the second year and has been correlated with sensorimotor development and growing social and self-awareness. Comparative studies of MSR in chimpanzees report that the onset of this ability occurs between 2 years 4 months and 3 years 9 months of age. Studies of wild and captive bottlenose dolphins (Tursiops truncatus have reported precocious sensorimotor and social awareness during the first weeks of life, but no comparative MSR research has been conducted with this species. We exposed two young bottlenose dolphins to an underwater mirror and analyzed video recordings of their behavioral responses over a 3-year period. Here we report that both dolphins exhibited MSR, indicated by self-directed behavior at the mirror, at ages earlier than generally reported for children and at ages much earlier than reported for chimpanzees. The early onset of MSR in young dolphins occurs in parallel with their advanced sensorimotor development, complex and reciprocal social interactions, and growing social awareness. Both dolphins passed subsequent mark tests at ages comparable with children. Thus, our findings indicate that dolphins exhibit self-awareness at a mirror at a younger age than previously reported for children or other species tested.

  19. Corynebacterium diphtheriae methionine sulfoxide reductase a exploits a unique mycothiol redox relay mechanism.

    Science.gov (United States)

    Tossounian, Maria-Armineh; Pedre, Brandán; Wahni, Khadija; Erdogan, Huriye; Vertommen, Didier; Van Molle, Inge; Messens, Joris

    2015-05-01

    Methionine sulfoxide reductases are conserved enzymes that reduce oxidized methionines in proteins and play a pivotal role in cellular redox signaling. We have unraveled the redox relay mechanisms of methionine sulfoxide reductase A of the pathogen Corynebacterium diphtheriae (Cd-MsrA) and shown that this enzyme is coupled to two independent redox relay pathways. Steady-state kinetics combined with mass spectrometry of Cd-MsrA mutants give a view of the essential cysteine residues for catalysis. Cd-MsrA combines a nucleophilic cysteine sulfenylation reaction with an intramolecular disulfide bond cascade linked to the thioredoxin pathway. Within this cascade, the oxidative equivalents are transferred to the surface of the protein while releasing the reduced substrate. Alternatively, MsrA catalyzes methionine sulfoxide reduction linked to the mycothiol/mycoredoxin-1 pathway. After the nucleophilic cysteine sulfenylation reaction, MsrA forms a mixed disulfide with mycothiol, which is transferred via a thiol disulfide relay mechanism to a second cysteine for reduction by mycoredoxin-1. With x-ray crystallography, we visualize two essential intermediates of the thioredoxin relay mechanism and a cacodylate molecule mimicking the substrate interactions in the active site. The interplay of both redox pathways in redox signaling regulation forms the basis for further research into the oxidative stress response of this pathogen. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  20. An optimized symbiotic fusion and molten-salt fission reactor system

    International Nuclear Information System (INIS)

    Blinkin, V.L.; Novikov, V.M.

    A symbiotic fusion-fission reactor system which breeds nuclear fuel is discussed. In the blanket of the controlled thermonuclear reactor (CTR) uranium-233 is generated from thorium, which circulates in the form of ThF 4 mixed with molten sodium and beryllium fluorides. The molten-salt fission reactor (MSR) burns up the uranium-233 and generates tritium for the fusion reactor from lithium, which circulates in the form of LiF mixed with BeF 2 and 233 UF 4 through the MSR core. With a CTR-MSR thermal power ratio of 1:11 the system can produce electrical energy and breed fuel with a doubling time of 4-5 years. The system has the following special features: (1) Fuel reprocessing is much simpler and cheaper than for contemporary fission reactors; reprocessing consists simply in continuous removal of 233 U from the salt circulating in the CTR blanket by the fluorination method and removal of xenon from the MSR fuel salt by gas scavenging; the MSR fuel salt is periodically exchanged for fresh salt and the 233 U is then removed from it; (2) Tritium is produced in the fission reactor, which is a much simpler system than the fusion reactor; (3) The CTR blanket is almost ''clean''; no tritium is produced in it and fission fragment activity does not exceed the activity induced in the structural materials; (4) Almost all the thorium introduced into the CTR blanket can be used for producing 233 U

  1. The enzymatic activities of brain catechol-O-methyltransferase (COMT) and methionine sulphoxide reductase are correlated in a COMT Val/Met allele-dependent fashion.

    Science.gov (United States)

    Moskovitz, Jackob; Walss-Bass, Consuelo; Cruz, Dianne A; Thompson, Peter M; Hairston, Jenaqua; Bortolato, Marco

    2015-12-01

    The enzyme catechol-O-methyltransferase (COMT) plays a primary role in the metabolism of catecholamine neurotransmitters and is implicated in the modulation of cognitive and emotional responses. The best characterized single nucleotide polymorphism (SNP) of the COMT gene consists of a valine (Val)-to-methionine (Met) substitution at codon 108/158. The Met-containing variant confers a marked reduction in COMT catalytic activity. We recently showed that the activity of recombinant COMT is positively regulated by the enzyme Met sulphoxide reductase (MSR), which counters the oxidation of Met residues of proteins. The current study was designed to assess whether brain COMT activity may be correlated to MSR in an allele-dependent fashion. COMT and MSR activities were measured from post-mortem samples of prefrontal cortices, striata and cerebella of 32 subjects by using catechol and dabsyl-Met sulphoxide as substrates, respectively. Allelic discrimination of COMT Val(108/185) Met SNP was performed using the Taqman 5'nuclease assay. Our studies revealed that, in homozygous carriers of Met, but not Val alleles, the activity of COMT and MSR was significantly correlated throughout all tested brain regions. These results suggest that the reduced enzymatic activity of Met-containing COMT may be secondary to Met sulphoxidation and point to MSR as a key molecular determinant for the modulation of COMT activity. © 2015 British Neuropathological Society.

  2. Alometría y dimorfismo sexual del fémur de Homo sapiens y Homo neanderthalensis en un contexto evolutivo

    OpenAIRE

    Anaya García, Noelia; Rosas, Antonio; Bastir, Markus; Estalrrich, Almudena; García-Tabernero, Antonio; Huguet, Rosa; Rasilla, Marco de la; Pastor, Francisco

    2015-01-01

    Comunicación presentada en el XIII Encuentro en Jóvenes Investigadores en Paleontología (XIII EJIP) - XIII Meeting of Early-Stage Researchers in Paleontology (XIII EJIP): Cercedilla, 15 - 18 de Abril de 2015

  3. Estudio comparativo sobre la variacion morfologica y fisiologica de Gelidium crinale y Gelidium spathulatum colectados en el Mediterraneo catalan

    OpenAIRE

    Echegaray Taborga, Juan; Seoane Camba, Juan Antonio

    1982-01-01

    Se estudia fenológicamente dos especies de Gelidium durante el período comprendido entre abril 1980 y marzo 1981, con especial referencia a variaciones morfológicas, crecimiento, estadios reproductivos y de pigmentos.

  4. La costumbre no es fuente del Derecho Procesal

    OpenAIRE

    Gascón Inchausti, Fernando

    1999-01-01

    Comentario a la Sentencia del Tribunal Supremo de 28 de abril de 1998. Se analiza el valor jurídico que cabe atribuir a ciertos usos forenses, dado que la costumbre no es fuente del Derecho Procesal.

  5. A new window to an old world: reconstructing the Middle Eocene of Messel for Hessisches Landesmuseum Darmstadt

    OpenAIRE

    Sanisidro, Óscar; Micklich, Norbert; Sandrock, Oliver

    2015-01-01

    Comunicación presentada en el XIII Encuentro en Jóvenes Investigadores en Paleontología (XIII EJIP) - XIII Meeting of Early-Stage Researchers in Paleontology (XIII EJIP): Cercedilla, 15 - 18 de Abril de 2015

  6. Overview of the Mars Sample Return Earth Entry Vehicle

    Science.gov (United States)

    Dillman, Robert; Corliss, James

    2008-01-01

    NASA's Mars Sample Return (MSR) project will bring Mars surface and atmosphere samples back to Earth for detailed examination. Langley Research Center's MSR Earth Entry Vehicle (EEV) is a core part of the mission, protecting the sample container during atmospheric entry, descent, and landing. Planetary protection requirements demand a higher reliability from the EEV than for any previous planetary entry vehicle. An overview of the EEV design and preliminary analysis is presented, with a follow-on discussion of recommended future design trade studies to be performed over the next several years in support of an MSR launch in 2018 or 2020. Planned topics include vehicle size for impact protection of a range of sample container sizes, outer mold line changes to achieve surface sterilization during re-entry, micrometeoroid protection, aerodynamic stability, thermal protection, and structural materials selection.

  7. Preliminary Study for Inventories of Minor Actinides in Thorium Molten Salt Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Choong Wie; Kim, Hee Reyoung [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2015-05-15

    It has different characteristic with the conventional reactors which use a solid fuel. It can continually supply the fuel by online refueling and reprocessing of minor actinides so that those can be separated and eliminated from the reactor. The MSR maintains steady state except initial stage and the reactor becomes stable. In this research, considering online refueling, bubbling and reprocessing, the basic concept for evaluation of the inventory of minor actinide in the molten salt reactor is driven using the Bateman equation. The simulation results, where REM and MCNP code from CNRS (Centre National de la Recherche Scientifique) applied to the concept equation are analyzed. The analysis of the basic concept was carried out for evaluation of the inventory of the minor actinides in MSR. It was thought that the inventories of the minor actinides should be evaluated by solving the modified Bateman equation due to the MSR characteristic of online refueling, chemical reprocessing and bubbling.

  8. Simulation tool of the on-line reprocessing unit of a molten salt reactor

    International Nuclear Information System (INIS)

    Simon, Nicole; Conocar, Olivier; Boussier, Hubert; Gastaldi, Olivier; Penit, Thomas; Walle, Eric; Huguet, Anne

    2006-01-01

    Molten salt reactor (MSR) is an interesting technology selected in the frame of the Generation IV forum. In the MSR, actinides are diluted in a molten salt which is both the fuel and the coolant. The ability of such a reactor is the reducing of the long-lived wastes due to high burn-up and the on-site simplified reprocessing directly connected with the core which preserve the salt properties necessary for its correct operation. Here is defined a flexible computer reprocessing code which can use data from neutronic calculations and can be coupled to a neutronic code. The code allow the description the whole behaviour of MSR, including, a coupled manner, both the design of the core and the optimised reprocessing scheme effects. (authors)

  9. Open problems in reprocessing of a molten salt reactor fuel

    International Nuclear Information System (INIS)

    Lelek, Vladimir; Vocka, Radim

    2000-01-01

    The study of fuel cycle in a molten salt reactor (MSR) needs deeper understanding of chemical methods used for reprocessing of spent nuclear fuel and preparation of MSR fuel, as well as of the methods employed for reprocessing of MSR fuel itself. Assuming that all the reprocessing is done on the basis of electrorefining, we formulate some open questions that should be answered before a flow sheet diagram of the reactor is designed. Most of the questions concern phenomena taking place in the vicinity of an electrode, which influence the efficiency of the reprocessing and sensibility of element separation. Answer to these questions would be an important step forward in reactor set out. (Authors)

  10. Definition of breeding gain for molten salt reactors - 147

    International Nuclear Information System (INIS)

    Nagy, K.; Kloosterman, J.L.; Lathouwers, D.; Van der Hagen, T.H.J.J.

    2010-01-01

    The graphite-moderated Molten Salt Reactor (MSR) is a potential breeder reactor using the thorium fuel cycle. The MSR has unique properties due to the possibility of making changes to the salt composition during operation. Most important is the extraction of protactinium, which separates the fissile uranium production into two volumes: the reactor core and the external stockpile. The paper focuses on the definition of breeding gain in such a system. The prospects of using breeding gain expressions defined for solid fuel reactors are investigated and new definitions are given which incorporate the processes occurring in the reactor core and the external stockpile. The difference of the growth rate of the mass of fissile material and breeding gain is pointed out. The new definitions are applied to an optimization study of the graphite-salt lattice of a breeder MSR. (authors)

  11. Molten salt treatment to minimize and optimize waste

    International Nuclear Information System (INIS)

    Gat, U.; Crosley, S.M.; Gay, R.L.

    1993-01-01

    A combination molten salt oxidizer (MSO) and molten salt reactor (MSR) is described for treatment of waste. The MSO is proposed for contained oxidization of organic hazardous waste, for reduction of mass and volume of dilute waste by evaporation of the water. The NTSO residue is to be treated to optimize the waste in terms of its composition, chemical form, mixture, concentration, encapsulation, shape, size, and configuration. Accumulations and storage are minimized, shipments are sized for low risk. Actinides, fissile material, and long-lived isotopes are separated and completely burned or transmuted in an MSR. The MSR requires no fuel element fabrication, accepts the materials as salts in arbitrarily small quantities enhancing safety, security, and overall acceptability

  12. Replacement of low pressure reheater and performance evaluation on domestic NPP moisture separator reheater

    International Nuclear Information System (INIS)

    Choi, Y. S.; Jeong, W. T.; Shon, S. Y.; Kim, M. H.

    2003-01-01

    Moisture Separator Reheater is one of the most important equipment for the integrity of low pressure turbine and the total efficiency of the nuclear power plant, It supplies the dry steam to low pressure turbine after separation of moisture and reheating the wet steam out of high pressure turbine. This equipment is always operated under severe conditions, therefore it should be carefully maintained for safe operation and operating confidence. After replacement low pressure reheater of moister separator reheater on domestic nuclear power plant, there was MSR performance degradation and vibration of condensate drain line. So I found out root cause and commented a solution, site people modified the equipment. Finally I concluded the performanc of MSR was good condition, after I inspected the equipment and evaluated the performance of MSR

  13. Tendances Carbone no. 98. From the rehearsal dinner in Lima to the wedding of interests in Paris: finding the recipe to keep everyone seated at the negotiations table

    International Nuclear Information System (INIS)

    Deheza, Mariana; Morel, Romain; Cochran, Ian

    2015-01-01

    Among the publications of CDC Climat Research, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS - MSR debate: ENVI Committee met on 3 December to discuss issues concerning the implementation of the MSR. MPs remain divided. - EU ETS - MSR timetable: the ITRE Committee will hold an opinion vote on 22 January 2015, while the ENVI Committee will vote on 23 and 24 February 2015. - EU ETS Directive: On 19 December, the European Commission launched a public consultation on the revision of the EU ETS directive post 2020

  14. Tendances Carbone no. 106. Free allocation in the EU ETS by 2030: paving the way for decarbonization of industry

    International Nuclear Information System (INIS)

    Jalard, Matthieu; Alberola, Emilie; Dahan, Lara

    2015-10-01

    Among the publications of I4CE, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS - MSR: On September 18, EU Environment Ministers adopted the Market Stability Reserve (MSR) for a start date in 2018. - EU ETS - MSR: On September, the timeline for the revision of the Directive for Phase IV of the EU ETS was detailed. A vote in plenary is expected in November 2016. - Energy Union: On September 28, a European Council meeting on Energy published draft conclusions on the governance system of the Energy Union, based on National Energy and Climate Plans to be drawn up in 2018

  15. Molten salt reactor as asymptotic safety nuclear system

    International Nuclear Information System (INIS)

    Novikov, V.M.; Ignatyev, V.V.

    1989-01-01

    Safety is becoming the main and priority problem of the nuclear power development. An increase of the active safety measures could hardly be considered as the proper way to achieve the asymptotically high level of nuclear safety. It seem that the more realistic way to achieve such a goal is to minimize risk factors and to maximize the use of inherent and passive safety properties. The passive inherent safety features of the liquid fuel molten salt reactor (MSR) technology are making it attractive for future energy generation. The achievement of the asymptotic safety in MSR is being connected with the minimization of such risk factors as a reactivity excess, radioactivity stored, decay heat, non nuclear energy stored in core. In this paper safety peculiarities of the different MSR concepts are discussed

  16. Modular Stellarator Fusion Reactor concept

    International Nuclear Information System (INIS)

    Miller, R.L.; Krakowski, R.A.

    1981-08-01

    A preliminary conceptual study is made of the Modular Stellarator Reactor (MSR). A steady-state ignited, DT-fueled, magnetic fusion reactor is proposed for use as a central electric-power station. The MSR concept combines the physics of the classic stellarator confinement topology with an innovative, modular-coil design. Parametric tradeoff calculations are described, leading to the selection of an interim design point for a 4-GWt plant based on Alcator transport scaling and an average beta value of 0.04 in an l = 2 system with a plasma aspect ratio of 11. The physics basis of the design point is described together with supporting magnetics, coil-force, and stress computations. The approach and results presented herein will be modified in the course of ongoing work to form a firmer basis for a detailed conceptual design of the MSR

  17. Tendances Carbone no. 102. Effort sharing, enhanced flexibility and low-carbon transformation: a new proposal for non-ETS sectors in the post-2020 period

    International Nuclear Information System (INIS)

    Sarto, Oliver; Cochran, Ian

    2015-05-01

    Among the publications of CDC Climat Research, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS - MSR timetable: The second Trilogue meeting between EU institutions took place on 5 May. An agreement was reached for the implementation of the MSR as from 2019, and a placement of back-loaded as well as unused allowances straight into the reserve. - EU ETS - Carbon leakages: The European Commission should propose measures to tackle carbon leakages issues in the six months following the adoption of the MSR. - EU ETS emissions: Emissions under the EU ETS decreased by 4,4 % in 2014, and are yet below the 2020 cap of 1,816 Mt CO 2 e

  18. Multiple system responses program: Identification of concerns related to a number of specific regulatory issues

    International Nuclear Information System (INIS)

    Murphy, G.A.; Casada, M.L.; Palko, L.E.; Roberts, M.W.

    1989-10-01

    This document describes the activities and results of the Multiple System Responses (MSR) program conducted by the Nuclear Operations Analysis Center (NOAC) at Oak Ridge National Laboratory (ORNL). The objective of the MSR program was to gather and review documentation for several unresolved safety issues and related programs of interest, and from that documentation, describe any additional potential safety concerns. The MSR program provides information that will aid the NRC staff in making an assessment of the relative safety significance of the concerns through the established prioritization process. Judgments were not made regarding the validity of the concerns expressed by others. Rather, the concerns were documented and potential safety issues were developed and defined as specifically as possible. Twenty-one potential safety issues were developed from the documented concerns. Additional information was gathered to support the NRC efforts in reviewing these issues for prioritization. 73 refs., 2 tabs

  19. Preliminary Study for Inventories of Minor Actinides in Thorium Molten Salt Reactor

    International Nuclear Information System (INIS)

    Lee, Choong Wie; Kim, Hee Reyoung

    2015-01-01

    It has different characteristic with the conventional reactors which use a solid fuel. It can continually supply the fuel by online refueling and reprocessing of minor actinides so that those can be separated and eliminated from the reactor. The MSR maintains steady state except initial stage and the reactor becomes stable. In this research, considering online refueling, bubbling and reprocessing, the basic concept for evaluation of the inventory of minor actinide in the molten salt reactor is driven using the Bateman equation. The simulation results, where REM and MCNP code from CNRS (Centre National de la Recherche Scientifique) applied to the concept equation are analyzed. The analysis of the basic concept was carried out for evaluation of the inventory of the minor actinides in MSR. It was thought that the inventories of the minor actinides should be evaluated by solving the modified Bateman equation due to the MSR characteristic of online refueling, chemical reprocessing and bubbling

  20. Entre dos exilios: Cesare Civita, un editor italiano en Buenos Aires, desde la guerra mundial hasta la dictadura militar (1941- 1976

    Directory of Open Access Journals (Sweden)

    Scarzanella, Eugenia

    2009-04-01

    Full Text Available This paper deals with the history of an Argentinian publishing house called Editorial Abril, which was founded in 1941 by Cesare Civita, a Jewish immigrant who left Italy after the «race laws» approval. Abril published cartoons (Donald Duck, photo novels (Idilio, women’s magazines (Claudia and news magazines (Panorama. Abril was a family business which knew how to use a wide relation network in Argentina, Italy and the United States. The history of this publishing house ends with Cesare Civita’s new exile in 1976. The material used includes file sources, testimonies, journals and books.

    El artículo trata de la historia de una editorial argentina, la Editorial Abril creada en 1941 por Cesare Civita, un inmigrante judío que abandonó Italia después de la aprobación de las «leyes raciales». Abril publicaba historietas (El Pato Donald, fotonovelas (Idilio, revistas Femeninas (Claudia y de actualidad (Panorama. Abril era una empresa familiar que supo utilizar una vasta red de relaciones en la Argentina, Italia y los Estados Unidos. La historia de la Editorial termina con un nuevo exilio de Cesare Civita en 1976. Se utilizan: fuentes de archivo, testimonios, revistas y libros.

  1. Efficiency of an LBE spallation target in an accelerator-driven molten salt subcritical reactor

    Energy Technology Data Exchange (ETDEWEB)

    Bak, Sang-In [Sungkyunkwan University, Suwon (Korea, Republic of); Hong, Seung-Woo [Sungkyunkwan University, Suwon (Korea, Republic of); Kadi, Yacine [CERN, Geneva (Switzerland)

    2016-10-15

    An Accelerator-Driven System (ADS) combined with a subcritical Molten Salt Reactor (MSR) is a type of hybrid reactor originally designed to breed uranium from thorium or to incinerate long-lived minor actinides in nuclear wastes. In an MSR, the salt material is used not only as a nuclear fuel but also as a primary coolant. In addition, this material is used as a target for inducing spallation neutrons in most AD-MSR concepts. A high energy proton beam impinges on a heavy metal target to induce spallation reactions and produces neutrons. Accordingly, a reliable proton accelerator is needed to feed the source neutrons. As ADSs have been criticized for requiring high power accelerators, minimization of beam power is an important aspect of ADS design. A primary concern associated with ADS development is stable high-power accelerators. We therefore studied the neutron source efficiencies of an AD-MSR involving chloride fuels by including a Pb-Bi eutectic (LBE) spallation target. The proton source efficiency and the accelerator beam power required have been studied for an AD-MSR. Adoption of an LBE spallation target induces an increase in proton source efficiencies in comparison to the case without a spallation target. Thus the presence of an efficient spallation target is useful in the reduction of the beam power of an accelerator. Almost 33 % of the beam power can be reduced in comparison to the case without the target for NaCl-Th/{sup 233}U fuel, and about 16 % for NaCl-U/TRU fuel. The beam power amplifications increase by 1.5 times for NaCl-Th/{sup 233}U and 1.2 times for NaCl-U/TRU in comparison with the no target AD-MSR.

  2. Sensory-Challenge Balance Exercises Improve Multisensory Reweighting in Fall-Prone Older Adults.

    Science.gov (United States)

    Allison, Leslie K; Kiemel, Tim; Jeka, John J

    2018-04-01

    Multisensory reweighting (MSR) deficits in older adults contribute to fall risk. Sensory-challenge balance exercises may have value for addressing the MSR deficits in fall-prone older adults. The purpose of this study was to examine the effect of sensory-challenge balance exercises on MSR and clinical balance measures in fall-prone older adults. We used a quasi-experimental, repeated-measures, within-subjects design. Older adults with a history of falls underwent an 8-week baseline (control) period. This was followed by an 8-week intervention period that included 16 sensory-challenge balance exercise sessions performed with computerized balance training equipment. Measurements, taken twice before and once after intervention, included laboratory measures of MSR (center of mass gain and phase, position, and velocity variability) and clinical tests (Activities-specific Balance Confidence Scale, Berg Balance Scale, Sensory Organization Test, Limits of Stability test, and lower extremity strength and range of motion). Twenty adults 70 years of age and older with a history of falls completed all 16 sessions. Significant improvements were observed in laboratory-based MSR measures of touch gain (P = 0.006) and phase (P = 0.05), Berg Balance Scale (P = 0.002), Sensory Organization Test (P = 0.002), Limits of Stability Test (P = 0.001), and lower extremity strength scores (P = 0.005). Mean values of vision gain increased more than those for touch gain, but did not reach significance. A balance exercise program specifically targeting multisensory integration mechanisms improved MSR, balance, and lower extremity strength in this mechanistic study. These valuable findings provide the scientific rationale for sensory-challenge balance exercise to improve perception of body position and motion in space and potential reduction in fall risk.

  3. Sulfur isotopic and proteomic profiles of sulfate reducers grown under differential steady-states

    Science.gov (United States)

    Leavitt, W.; Venceslau, S.; Waldbauer, J.; Smith, D. A.; Boidi, F. J.; Bradley, A. S.

    2016-12-01

    Microbial sulfate reducers (MSR) drive the Earth's biogeochemical sulfur cycle. At the heart of this energy metabolism is a cascade of redox transformations coupling organic carbon and/or hydrogen oxidation to the dissimilatory reduction of sulfate to sulfide. The product sulfide is depleted in the heavier isotopes of sulfur, relative to the reactant sulfate, consistent with a normal kinetic isotope effect. However, the magnitude of the net fractionation during MSR can range over a range of 70 permil, consistent with a multi-step set of reactions. This range in MSR fractionation has been shown to mainly depend on: i) the cell-specific sulfate reduction rate (csSRR), and ii) the ambient sulfate concentration. However, the fractionation under identical conditions differs among strains (Bradley et al. 2016. Geobio), and so must also be mediated by strain-specific processes, such as the nature and quantity of individual proteins involved in sulfate reduction, electron transport, and growth. In recent work we have examined the influence of electron donor, electron acceptor, and co-limitation under controlled steady-state culture conditions in order better inform models of MSR isotope fractionation, and the physiological and isotopic response to differential environmental forcings (e.g. Leavitt et al. (2013) PNAS). Recent models of the fractionation response to MSR rate (c.f. Bradley 2016; Wing & Halevy, 2016) make specific predictions for the responses of the cellular metabolome and proteome. Here we compare the steady-state S-isotopic fractionation and proteome of `fast' versus `slow' grown D. vulgaris, using replicate chemostats under electron donor limitation. We observe clear and statistically robust changes in some key central MSR and C-metabolism enzymes, though a host of the critical energy-transfer enzymes show no statistically discernable change. We discuss these results in light of recent theoretical advances and their relevance to modern and ancient

  4. Solution of heat removal from nuclear reactors by natural convection

    Directory of Open Access Journals (Sweden)

    Zitek Pavel

    2014-03-01

    Full Text Available This paper summarizes the basis for the solution of heat removal by natural convection from both conventional nuclear reactors and reactors with fuel flowing coolant (such as reactors with molten fluoride salts MSR.The possibility of intensification of heat removal through gas lift is focused on. It might be used in an MSR (Molten Salt Reactor for cleaning the salt mixture of degassed fission products and therefore eliminating problems with iodine pitting. Heat removal by natural convection and its intensification increases significantly the safety of nuclear reactors. Simultaneously the heat removal also solves problems with lifetime of pumps in the primary circuit of high-temperature reactors.

  5. The introduction of the safety of molten salt reactor

    International Nuclear Information System (INIS)

    Zuo Jiaxu; Zhang Chunming

    2011-01-01

    This paper introduces the generation TV Nuclear Energy Systems and molten salt reactor which is the only fluid fuel reactor in the Gen-TV. Safety features and attributes of MSR are described. The supply of fuel and the minimum of waste are described. The clean molten salt in the secondary heat transport system transfers the heat from the primary heat exchanger to a high-temperature Brayton cycle that converts the heat to electricity. With the Brayton cycle, the thermal efficiency of the system will be improved. Base on the MSR, the thorium-uranium fuel cycle is also introduced. (authors)

  6. Thorium Molten Salt Nuclear Energy Synergetic System (THORIMS-NES)

    International Nuclear Information System (INIS)

    Yoshioka, Ritsuo; Mitachi, Koshi

    2013-01-01

    The authors have been promoting nuclear energy technology based on thorium molten salt as Thorium Molten Salt Nuclear Energy Synergetic System (THORIMS-NES). This system is a combination of fission power reactor of Molten Salt Reactor (MSR), and Accelerator Molten Salt Breeder (AMSB) for production of fissile 233 U with connecting chemical processing facility. In this paper, concept of THORIMS-NES, advantages of thorium and molten salt recent MSR design results such as FUJI-U3 using 233 U fuel, FUJI-Pu, large sized super-FUJI, pilot plant miniFUJI, AMSB, and chemical processing facility are described. (author)

  7. On-line reprocessing of a molten salt reactor: a simulation tool

    International Nuclear Information System (INIS)

    Simon, Nicole; Gastaldi, Olivier; Penit, Thomas; Cohin, Olivier; Campion, Pierre-Yves

    2008-01-01

    The molten salt reactor (MSR) is one of the concepts studied in the frame of GEN IV road-map. Due to the specific features of its liquid fuel, the reprocessing unit may be directly connected to the reactor. A modelling of this unit is presented. The final objective is to create a flexible computer reprocessing code which can use data from neutron calculations and can be coupled to a neutron code. Such a code allows the description of the whole behaviour of MSR, including, in a coupled manner, both the design of the core and the optimised reprocessing scheme effects. (authors)

  8. Monte Carlo and experimental determination of correction factors for gamma knife perfexion small field dosimetry measurements

    Science.gov (United States)

    Zoros, E.; Moutsatsos, A.; Pappas, E. P.; Georgiou, E.; Kollias, G.; Karaiskos, P.; Pantelis, E.

    2017-09-01

    Detector-, field size- and machine-specific correction factors are required for precise dosimetry measurements in small and non-standard photon fields. In this work, Monte Carlo (MC) simulation techniques were used to calculate the k{{Qmsr},{{Q}0}}{{fmsr},{{f}ref}} and k{{Qclin},{{Q}msr}}{{fclin},{{f}msr}} correction factors for a series of ionization chambers, a synthetic microDiamond and diode dosimeters, used for reference and/or output factor (OF) measurements in the Gamma Knife Perfexion photon fields. Calculations were performed for the solid water (SW) and ABS plastic phantoms, as well as for a water phantom of the same geometry. MC calculations for the k{{Qclin},{{Q}msr}}{{fclin},{{f}msr}} correction factors in SW were compared against corresponding experimental results for a subset of ionization chambers and diode detectors. Reference experimental OF data were obtained through the weighted average of corresponding measurements using TLDs, EBT-2 films and alanine pellets. k{{Qmsr},{{Q}0}}{{fmsr},{{f}ref}} values close to unity (within 1%) were calculated for most of ionization chambers in water. Greater corrections of up to 6.0% were observed for chambers with relatively large air-cavity dimensions and steel central electrode. A phantom correction of 1.006 and 1.024 (breaking down to 1.014 from the ABS sphere and 1.010 from the accompanying ABS phantom adapter) were calculated for the SW and ABS phantoms, respectively, adding up to k{{Qmsr},{{Q}0}}{{fmsr},{{f}ref}} corrections in water. Both measurements and MC calculations for the diode and microDiamond detectors resulted in lower than unit k{{Qclin},{{Q}msr}}{{fclin},{{f}msr}} correction factors, due to their denser sensitive volume and encapsulation materials. In comparison, higher than unit k{{Qclin},{{Q}msr}}{{fclin},{{f}msr}} results for the ionization chambers suggested field size depended dose underestimations (being significant for the 4 mm field), with magnitude depending on the combination of

  9. Moisture separators and reheaters for wet steam turbines

    International Nuclear Information System (INIS)

    Gibbins, J.

    1979-01-01

    Moisture separator reheater (M.S.R.) units are now a well established feature of the wet steam cycle as associated with the various types of water cooled reactor. This paper describes the development of M.S.Rs. as supplied by GEC for turbine generators of up to 1200 MW ratings covering the design procedures used and the features required to ensure efficient and reliable operation. In addition to details of the M.S.R. design, the desirable features of the steam supply, venting and drain control systems are also discussed. The recent developments, as provided on current projects, are described. (author)

  10. Safe actinide disposition in molten salt reactors

    International Nuclear Information System (INIS)

    Gat, U.

    1997-01-01

    Safe molten salt reactors (MSR) can readily accommodate the burning of all fissile actinides. Only minor compromises associated with plutonium are required. The MSRs can dispose safely of actinides and long lived isotopes to result in safer and simpler waste. Disposing of actinides in MSRs does increase the source term of a safety optimized MSR. It is concluded that the burning and transmutation of actinides in MSRs can be done in a safe manner. Development is needed for the processing to handle and separate the actinides. Calculations are needed to establish the neutron economy and the fuel management. 9 refs

  11. Early Detection of Bone Lesions by Photoscanning with Radioactive Strontium-87m

    Energy Technology Data Exchange (ETDEWEB)

    Kostamis, P.; Constantinides, C.; Papavasiliou, C.; Binopoulos, D.; Sfontouris, J.; Malamos, B. [University of Athens Medical School, ' Alexandra' Hospital, Athens (Greece)

    1969-05-15

    Patients with proven and suspected bone lesions were scanned from 30 min to 3 h after an intravenous injection of 400 {mu}Ci to 1 mCi of {sup 87m}Sr. Many different types of bone tumours were detected, such as osteogenic sarcoma and metastatic cancer of breast, thyroid, lung and other organs. {sup 87m}Sr photoscanning easily demonstrates obvious tumours of the bone which have been visualized on the roentgenogram, but the most important purpose of the present study is the visualization of lesions which were not demonstrated on the conventional roentgenogram. The analysis of the examined cases is discussed. (author)

  12. The Development of Mirror Self-Recognition in Different Sociocultural Contexts

    Science.gov (United States)

    Kartner, Joscha; Keller, Heidi; Chaudhary, Nandita; Yovsi, Relindis D.

    2012-01-01

    The overarching goal of the present study was to trace the development of mirror self-recognition (MSR), as an index of toddlers' sense of themselves and others as autonomous intentional agents, in different sociocultural environments. A total of 276 toddlers participated in the present study. Toddlers were either 16, 17, 18, 19, 20, or 21 months…

  13. Using Association Rules to Study the Co-evolution of Production & Test Code

    NARCIS (Netherlands)

    Lubsen, Z.; Zaidman, A.; Pinzger, M.

    2009-01-01

    Paper accepted for publication in the proceedings of the 6th International Working Conference on Mining Software Repositories (MSR 2009). Unit tests are generally acknowledged as an important aid to produce high quality code, as they provide quick feedback to developers on the correctness of their

  14. Studying Co-evolution of Production and Test Code Using Association Rule Mining

    NARCIS (Netherlands)

    Lubsen, Z.; Zaidman, A.; Pinzger, M.

    2009-01-01

    Long version of the short paper accepted for publication in the proceedings of the 6th International Working Conference on Mining Software Repositories (MSR 2009). Unit tests are generally acknowledged as an important aid to produce high quality code, as they provide quick feedback to developers on

  15. Pengaruh Dexketoprofen Dengan Ketorolac Terhadap Kadar Kortisol Plasma Pada Tikus Wistar Yang Mengalami Insisi

    OpenAIRE

    Pranowo, Devina Adiyani; Witjaksono, Witjaksono

    2014-01-01

    Latar belakang: Luka pasca pembedahan seperti insisi dapat menimbulkan nyeri yang akan merangsang timbulnya respon stress metabolik (MSR) berupa peningkatan kadar kortisol. Meningkatnya kadar kortisol menyebabkan penekanan respon imun dan melambatnya penyembuhan luka. Pemberian Dexketoprofen dan Ketorolac akan mengurangi rasa nyeri yang berefek pada penurunan kadar kortisol dan mempercepat penyembuhan luka.Tujuan: Membuktikan adanya perbedaan pengaruh Dexketoprofen intramuskular dengan Ketoro...

  16. A study on the mechanical stress relieving and safety assessment without post-weld heat treatment

    International Nuclear Information System (INIS)

    Xu Jijin; Chen Ligong; Ni Chunzhen

    2007-01-01

    For full welded body valve, the temperature of grommet cannot exceed 150 deg. C in order to prevent it from damaging and assure the tightness and the service life of valve. Therefore, post-weld heat treatment (PWHT) cannot be used to relieve the residual stresses. In this study, the effect of the mechanical stress relieving (MSR) treatment on the residual stresses was studied by the finite element method and experimental work. A pressure and time diagram of MSR treatment was established. A two-dimensional axisymmetric finite element model was used to simulate the residual stresses field. Before and after MSR treatment, the residual stresses on the outer surface were measured by the blind hole drilling method. Finally, the fracture toughness behaviors of weld zone (WZ) and heat affected zone (HAZ) were investigated in terms of crack tip opening displacement (CTOD) according to BS7448 and DNV-OS-C401 fracture toughness tests standards. The safety of the valve in active service was assessed without PWHT. Through comparison and analysis, the axial residual stresses and the hoop residual stresses on the outer surface of valve are mainly tensile. The peak value of tensile stress occurs nearer to the outer surface of the valve. MSR treatment can decrease the peak value of axial residual stresses and hoop residual stresses on the outer surface obviously and make the residual stresses distribution more uniform. The safety of the valve in active service is reliable without PWHT

  17. Increase in Nutrients, Mercury, and Methylmercury as a Consequence of Elevated Sulfate Reduction to Sulfide in Experimental Wetland Mesocosms

    Science.gov (United States)

    Myrbo, A.; Swain, E. B.; Johnson, N. W.; Engstrom, D. R.; Pastor, J.; Dewey, B.; Monson, P.; Brenner, J.; Dykhuizen Shore, M.; Peters, E. B.

    2017-11-01

    Microbial sulfate reduction (MSR) in both freshwater and marine ecosystems is a pathway for the decomposition of sedimentary organic matter (OM) after oxygen has been consumed. In experimental freshwater wetland mesocosms, sulfate additions allowed MSR to mineralize OM that would not otherwise have been decomposed. The mineralization of OM by MSR increased surface water concentrations of ecologically important constituents of OM: dissolved inorganic carbon, dissolved organic carbon, phosphorus, nitrogen, total mercury, and methylmercury. Increases in surface water concentrations, except for methylmercury, were in proportion to cumulative sulfate reduction, which was estimated by sulfate loss from the surface water into the sediments. Stoichiometric analysis shows that the increases were less than would be predicted from ratios with carbon in sediment, indicating that there are processes that limit P, N, and Hg mobilization to, or retention in, surface water. The highest sulfate treatment produced high levels of sulfide that retarded the methylation of mercury but simultaneously mobilized sedimentary inorganic mercury into surface water. As a result, the proportion of mercury in the surface water as methylmercury peaked at intermediate pore water sulfide concentrations. The mesocosms have a relatively high ratio of wall and sediment surfaces to the volume of overlying water, perhaps enhancing the removal of nutrients and mercury to periphyton. The presence of wild rice decreased sediment sulfide concentrations by 30%, which was most likely a result of oxygen release from the wild rice roots. An additional consequence of the enhanced MSR was that sulfate additions produced phytotoxic levels of sulfide in sediment pore water.

  18. Thermodynamic characterization of salt components for Molten Salt Reactor fuel

    NARCIS (Netherlands)

    Capelli, E.

    2016-01-01

    The Molten Salt Reactor (MSR) is a promising future nuclear fission reactor technology with excellent performance in terms of safety and reliability, sustainability, proliferation resistance and economics. For the design and safety assessment of this concept, it is extremely important to have a

  19. R and D of On-line Reprocessing Technology for Molten-Salt Reactor Systems

    International Nuclear Information System (INIS)

    Uhlir, Jan; Tulackova, Radka; Chuchvalcova Bimova, Karolina

    2006-01-01

    The Molten Salt Reactor (MSR) represents one of promising future nuclear reactor concept included in the Generation IV reactors family. The reactor can be operated as the thorium breeder or as the actinide transmuter. However, the future deployment of Molten-Salt Reactors will be significantly dependent on the successful mastering of advanced reprocessing technologies dedicated to their fuel cycle. Here the on-line reprocessing technology connected with the fuel circuit of MSR is of special importance because the reactor cannot be operated for a long run without the fuel salt clean-up. Generally, main MSR reprocessing technologies are pyrochemical, majority of them are fluoride technologies. The proposed flow-sheets of MSR on-line reprocessing are based on a combination of molten-salt / liquid metal extraction and electro-separation processes, which can be added to the gas extraction process already verified during the MSRE project in ORNL. The crucial separation method proposed for partitioning of actinides from fission products is based on successive Anodic dissolution and Cathodic deposition processes in molten fluoride media. (authors)

  20. Thermodynamics of soluble fission products cesium and iodine in the Molten Salt Reactor

    NARCIS (Netherlands)

    Capelli, E.; Beneš, O.; Konings, R.J.M.

    2018-01-01

    The present study describes the full thermodynamic assessment of the Li,Cs,Th//F,I system. The existing database for the relevant fluoride salts considered as fuel for the Molten Salt Reactor (MSR) has been extended with two key fission products, cesium and iodine. A complete evaluation of all

  1. Molten Salt Breeder Reactor Analysis Based on Unit Cell Model

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Yongjin; Choi, Sooyoung; Lee, Deokjung [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2014-05-15

    Contemporary computer codes like the MCNP6 or SCALE are only good for solving a fixed solid fuel reactor. However, due to the molten-salt fuel, MSR analysis needs some functions such as online reprocessing and refueling, and circulating fuel. J. J. Power of Oak Ridge National Laboratory (ORNL) suggested in 2013 a method for simulating the Molten Salt Breeder Reactor (MSBR) with SCALE, which does not support continuous material processing. In order to simulate MSR characteristics, the method proposes dividing a depletion time into short time intervals and batchwise reprocessing and refueling at each step. We are applying this method by using the MCNP6 and PYTHON and NEWT-TRITON-PYTHON and PYTHON code systems to MSBR. This paper contains various parameters to analyze the MSBR unit cell model such as the multiplication factor, breeding ratio, change of amount of fuel, amount of fuel feeding, and neutron flux distribution. The result of MCNP6 and NEWT module in SCALE show some difference in depletion analysis, but it still seems that they can be used to analyze MSBR. Using these two computer code system, it is possible to analyze various parameters for the MSBR unit cells such as the multiplication factor, breeding ratio, amount of material, total feeding, and neutron flux distribution. Furthermore, the two code systems will be able to be used for analyzing other MSR model or whole core models of MSR.

  2. Review on the current status of molten chloride reactor and its future prospect

    Energy Technology Data Exchange (ETDEWEB)

    Seo, Seok Bin; Shin, Yukyung; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

    2016-10-15

    This paper has summarized and reviewed the current status of MCR as an online pyroprocessing reactor, and introduced the related works in UNIST. As the developments of the next generation nuclear energy systems require the fuel sustainability, passive operation safety, nuclear proliferation, and reduction of highly radioactive waste, only several types of nuclear reactor systems survive to the last. Among these, molten salt reactor (MSR) is one of the most promising concepts of next generation nuclear reactor system that deliver on these requirements. MSR have great advantages in the fuel cycle and reduction of nuclear waste, since MSR can serve the online reprocessing system for the reprocessing of spent fuel. Especially, MSR utilizing chloride-based fuel, called molten chloride reactor (MCR) has been recently highlighted in USA under the DOE’s Gateway for Accelerated Innovation in Nuclear (GAIN) program. Recently, the interests in the molten chloride salt have arisen. The use of chloride-based salt gives great advantages to the reactor operating in a fast spectrum. Then MCR can serve waste management functions or fuel cycle sustainability functions, which can solve the current issues in nuclear field. Thus, research plan was established in UNIST which includes the investigation of thermal-hydraulic characteristics of chloride salt and optimization of heat transport system of MCR, using both numerical method and experimental method.

  3. Quantitative MRI comparison of systemic hemodynamics in Mustard/Senning repaired patients and healthy volunteers at rest

    International Nuclear Information System (INIS)

    Laffon, Eric; Jimenez, Maria; Choussat, Alain; Latrabe, Valerie; Ducassou, Dominique; Marthan, Roger; Laurent, Francois

    2004-01-01

    The purpose of the present study was to non-invasively compare ascending aortic blood flow and cross-sectional area (CSA) variations vs time in Mustard or Senning repaired (MSR) patients against those of healthy volunteers at rest. Velocity-encoded MR imaging was performed in 10 male patients (age range 18-24 years, median age 20.5 years) late after a Mustard or Senning correction, and in 10 male healthy volunteers (age range 21-25 years, median age 22.5 years), at the upper part of the ascending aorta. Both aortic cross-sectional area (CSA) and blood-flow variations were recorded over a complete cardiac cycle, with a 30-ms time of resolution. The body-surface area (BSA), the mean CSA over the systolic phase, and the BSA-normalized systemic ventricle power and work were significantly lower in the patient series compared with those of the volunteer series. The BSA-normalized right ventricle (RV) power and work of MSR patients were equal to 87 and 83% on average of those of the left ventricle (LV) of healthy volunteers. We conclude that, at rest, the mechanical performance of the systemic RV in MSR patients is significantly lower than that of the LV in healthy volunteers. Furthermore, the significantly lower aortic CSA found in MSR patients than in healthy volunteers may reveal an increase in the vasomotor tone. (orig.)

  4. Study of electrochemical processes for separation of the actinides and lanthanides in molten fluoride media

    International Nuclear Information System (INIS)

    Zvejskova, R.; Chuchvalcova Bimova, K.; Lisy, F.; Soucek, P.

    2005-01-01

    The technology of the Molten Salt Reactors (MSR) is developed for two possible applications: For one thing as the Molten Salt Transmutation Reactor (MSTR) incinerating plutonium and minor actinides within reprocessing of spent fuel from PWR or FBR and for another thing as electricity generating MSR working under thorium uranium fuel cycle. Electrochemical separation processes are one of promising pyrochemical techniques that should enable the on-line reprocessing of circulating fuel salt in MSR (fuel cycle back-end). The former application represents the Czech P and T concept, in which framework the electrolytic separation can be applied both in the front-end and back-end of the MSTR fuel cycle. Within the front-end electro separation should follow the Fluoride Volatility Method (FVM), which should separate 95 % of uranium from the spent fuel in the form of volatile uranium hexafluoride. The residual uranium and fission products (FP) are supposed to be separated among others also by electrochemical methods. The presented work comprises the results reached within development of electrochemical separation of the actinides and fission products from each other by electrolytic deposition method on solid cathode in molten fluoride media, that represent he carrier salts of MSR technology. The knowledge of electrochemical properties (red-ox potentials, mainly of deposition potentials) is necessary for determination of separation possibilities of individual components by electrolysis. (authors)

  5. Joint effect of unlinked genotypes: application to type 2 diabetes in the EPIC-Potsdam case-cohort study.

    Science.gov (United States)

    Knüppel, Sven; Meidtner, Karina; Arregui, Maria; Holzhütter, Hermann-Georg; Boeing, Heiner

    2015-07-01

    Analyzing multiple single nucleotide polymorphisms (SNPs) is a promising approach to finding genetic effects beyond single-locus associations. We proposed the use of multilocus stepwise regression (MSR) to screen for allele combinations as a method to model joint effects, and compared the results with the often used genetic risk score (GRS), conventional stepwise selection, and the shrinkage method LASSO. In contrast to MSR, the GRS, conventional stepwise selection, and LASSO model each genotype by the risk allele doses. We reanalyzed 20 unlinked SNPs related to type 2 diabetes (T2D) in the EPIC-Potsdam case-cohort study (760 cases, 2193 noncases). No SNP-SNP interactions and no nonlinear effects were found. Two SNP combinations selected by MSR (Nagelkerke's R² = 0.050 and 0.048) included eight SNPs with mean allele combination frequency of 2%. GRS and stepwise selection selected nearly the same SNP combinations consisting of 12 and 13 SNPs (Nagelkerke's R² ranged from 0.020 to 0.029). LASSO showed similar results. The MSR method showed the best model fit measured by Nagelkerke's R² suggesting that further improvement may render this method a useful tool in genetic research. However, our comparison suggests that the GRS is a simple way to model genetic effects since it does not consider linkage, SNP-SNP interactions, and no non-linear effects. © 2015 John Wiley & Sons Ltd/University College London.

  6. 1H, 15N and 13C NMR Assignments of Mouse Methionine Sulfoxide Reductase B2

    Science.gov (United States)

    Breivik, Åshild S.; Aachmann, Finn L.; Sal, Lena S.; Kim, Hwa-Young; Del Conte, Rebecca; Gladyshev, Vadim N.; Dikiy, Alexander

    2011-01-01

    A recombinant mouse methionine-r-sulfoxide reductase 2 (MsrB2ΔS) isotopically labeled with 15N and 15N/13C was generated. We report here the 1H, 15N and 13C NMR assignments of the reduced form of this protein. PMID:19636904

  7. mu SR in Organic and Free Radical Chemistry

    CERN Multimedia

    2002-01-01

    Experiment SC82 was begun as a simple attempt to substitute positive muons into polymer molecules, and thereby to use the @mSR technique to study the mechanical relaxation of the different molecular groups. \\\\ \\\\ The experiment has since developed in several directions and has produced a wealth of information on the properties of muonic molecules, and adequately demonstrated the potential of @mSR as applied to molecular physics and chemistry. Physics aspects are now covered by a new experiment code SC95.\\\\ \\\\ The present experiment includes studies where the position occupied by the muon in the molecule (or crystal lattice) is readily established and the @mSR signal is exploited to reveal the intrinsic properties of the material. In this respect the @mSR techniques may be regarded simply as an experimental tool to probe the molecular behaviour of a chemical system. \\\\ \\\\ Two main classes of application include the measurement of isotope effects, where differences between muonic and corresponding photonic radi...

  8. Methane-induced Activation Mechanism of Fused Ferric Oxide-Alumina Catalysts during Methane Decomposition

    KAUST Repository

    Reddy Enakonda, Linga; Zhou, Lu; Saih, Youssef; Ould-Chikh, Samy; Lopatin, Sergei; Gary, Daniel; Del-Gallo, Pascal; Basset, Jean-Marie

    2016-01-01

    Activation of Fe2O3-Al2O3 with CH4 (instead of H2) is a meaningful method to achieve catalytic methane decomposition (CMD). This reaction of CMD is more economic and simple against commercial methane steam reforming (MSR) as it produces COx-free H2

  9. INTRAVASAL INJECTION OF FORMED-IN-PLACE MEDICAL GRADE SILICONE-RUBBER FOR VAS OCCLUSION

    NARCIS (Netherlands)

    SOEBADI, DM; GARDJITO, W; MENSINK, HJA

    This paper describes two consecutive studies: a volume study and an efficacy study. The volume study determined the appropriate volume of Medical Grade Silicone Rubber (MSR) needed to achieve complete occlusion of the vas deferens. This was done by in-vitro testing of 130 human vas specimens

  10. Become One In A Million: Partnership Updates. Million Solar Roofs and Interstate Renewable Energy Council Annual Meeting, Washington, D.C., October 2005

    Energy Technology Data Exchange (ETDEWEB)

    Tombari, C.

    2005-09-01

    The U.S. Department of Energy's Million Solar Roofs Initiative (MSR) is a unique public-private partnership aimed at overcoming market barriers for photovoltaics (PV), solar water heating, transpired solar collectors, solar space heating and cooling, and pool heating. This report contains annual progress reports from 866 partners across the United States.

  11. Characterisation of the zebrafish serotonin transporter functionally links TM10 to the ligand binding site

    DEFF Research Database (Denmark)

    Severinsen, Kasper; Müller, Heidi Kaastrup; Wiborg, Ove

    2008-01-01

    and [(3)H]-escitalopram binding in transiently transfected human embryonic kidney cells; HEK-293-MSR. Residues responsible for altered affinities inhibitors were pinpointed by generating cross-species chimeras and subsequent point mutations by site directed mutagenesis. drSERT has a higher affinity...

  12. Replacement of the level control of draining tanks MSRS and powered water heaters with the OVATION system in Asco NPP

    International Nuclear Information System (INIS)

    Serrano Jimenez, J.

    2012-01-01

    The current MSR drains and heaters tanks level control is local control individual, pneumatic and without action from Control room. The system has level switches for the generation of alarms, isolations and shots of bombs. Single control room operators have level alarms, final race of valves of control and indication of temperature and pressure of some tanks.

  13. Locally Minimum Storage Regenerating Codes in Distributed Cloud Storage Systems

    Institute of Scientific and Technical Information of China (English)

    Jing Wang; Wei Luo; Wei Liang; Xiangyang Liu; Xiaodai Dong

    2017-01-01

    In distributed cloud storage sys-tems, inevitably there exist multiple node fail-ures at the same time. The existing methods of regenerating codes, including minimum storage regenerating (MSR) codes and mini-mum bandwidth regenerating (MBR) codes, are mainly to repair one single or several failed nodes, unable to meet the repair need of distributed cloud storage systems. In this paper, we present locally minimum storage re-generating (LMSR) codes to recover multiple failed nodes at the same time. Specifically, the nodes in distributed cloud storage systems are divided into multiple local groups, and in each local group (4, 2) or (5, 3) MSR codes are constructed. Moreover, the grouping method of storage nodes and the repairing process of failed nodes in local groups are studied. The-oretical analysis shows that LMSR codes can achieve the same storage overhead as MSR codes. Furthermore, we verify by means of simulation that, compared with MSR codes, LMSR codes can reduce the repair bandwidth and disk I/O overhead effectively.

  14. New reactor concepts. An analysis of the actual research status; Neue Reaktorkonzepte. Eine Analyse des aktuellen Forschungsstands

    Energy Technology Data Exchange (ETDEWEB)

    Pistner, Christoph; Englert, Matthias

    2017-04-15

    The report on new reactor concepts covers the following issues: characterization and survey of new reactor concepts; evaluation criteria: safety, resources for fuel supply, waste problems, economy and proliferation; comprehensive relevant aspects: thorium as alternative resource, partitioning and transmutation; actual developments and preliminary experiences for fast breeding reactor (FBR), high-temperature reactor (HTR), molten salt reactor (MSR), small modular reactor (SMR).

  15. Low Cost Mars Sample Return Utilizing Dragon Lander Project

    Science.gov (United States)

    Stoker, Carol R.

    2014-01-01

    We studied a Mars sample return (MSR) mission that lands a SpaceX Dragon Capsule on Mars carrying sample collection hardware (an arm, drill, or small rover) and a spacecraft stack consisting of a Mars Ascent Vehicle (MAV) and Earth Return Vehicle (ERV) that collectively carry the sample container from Mars back to Earth orbit.

  16. A comparative parametric study of a catalytic plate methane reformer coated with segmented and continuous layers of combustion catalyst for hydrogen production

    Science.gov (United States)

    Mundhwa, Mayur; Parmar, Rajesh D.; Thurgood, Christopher P.

    2017-03-01

    A parametric comparison study is carried out between segmented and conventional continuous layer configurations of the coated combustion-catalyst to investigate their influence on the performance of methane steam reforming (MSR) for hydrogen production in a catalytic plate reactor (CPR). MSR is simulated on one side of a thin plate over a continuous layer of nickel-alumina catalyst by implementing an experimentally validated surface microkinetic model. Required thermal energy for the MSR reaction is supplied by simulating catalytic methane combustion (CMC) on the opposite side of the plate over segmented and continuous layer of a platinum-alumina catalyst by implementing power law rate model. The simulation results of both coating configurations of the combustion-catalyst are compared using the following parameters: (1) co-flow and counter-flow modes between CMC and MSR, (2) gas hourly space velocity and (3) reforming-catalyst thickness. The study explains why CPR designed with the segmented combustion-catalyst and co-flow mode shows superior performance not only in terms of high hydrogen production but also in terms of minimizing the maximum reactor plate temperature and thermal hot-spots. The study shows that the segmented coating requires 7% to 8% less combustion-side feed flow and 70% less combustion-catalyst to produce the required flow of hydrogen (29.80 mol/h) on the reforming-side to feed a 1 kW fuel-cell compared to the conventional continuous coating of the combustion-catalyst.

  17. On direct internal methane steam reforming kinetics in operating solid oxide fuel cells with nickel-ceria anodes

    Science.gov (United States)

    Thallam Thattai, A.; van Biert, L.; Aravind, P. V.

    2017-12-01

    Major operating challenges remain to safely operate methane fuelled solid oxide fuel cells due to undesirable temperature gradients across the porous anode and carbon deposition. This article presents an experimental study on methane steam reforming (MSR) global kinetics for single operating SOFCs with Ni-GDC (gadolinium doped ceria) anodes for low steam to carbon (S/C) ratios and moderate current densities. The study points out the hitherto insufficient research on MSR global and intrinsic kinetics for operating SOFCs with complete Ni-ceria anodes. Further, it emphasizes the need to develop readily applicable global kinetic models as a subsequent step from previously reported state-of-art and complex intrinsic models. Two rate expressions of the Power law (PL) and Langmuir-Hinshelwood (LH) type have been compared and based on the analysis, limitations of using previously proposed rate expressions for Ni catalytic beds to study MSR kinetics for complete cermet anodes have been identified. Firstly, it has been shown that methane reforming on metallic (Ni) current collectors may not be always negligible, contrary to literature reports. Both PL and LH kinetic models predict significantly different local MSR reaction rate and species partial pressure distributions along the normalized reactor length, indicating a strong need for further experimental verifications.

  18. 78 FR 56980 - Muscle Shoals Reservation Redevelopment, Colbert County, Alabama

    Science.gov (United States)

    2013-09-16

    ... provided in accordance with the Council on Environmental Quality's regulations (40 CFR 1500 to 1508) and... management. Under Alternative C, TVA would declare the MSR study area surplus and sell it with the... alternative could include mall, theaters, government buildings, gas stations, department stores, restaurants...

  19. A dense Pd/Ag membrane reactor for methanol steam reforming: Experimental study

    NARCIS (Netherlands)

    Basile, A.; Gallucci, F.; Paturzo, L.

    2005-01-01

    This paper focuses on an experimental study of the methanol steam reforming (MSR) reaction. A dense Pd/Ag membrane reactor (MR) has been used, and its behaviour has been compared to the performance of a traditional reactor (TR) packed with the same catalyst type and amount. The parameters

  20. A longitudinal study of the emerging self from 9 months to the age of 4 years

    Directory of Open Access Journals (Sweden)

    Susanne eKristen-Antonow

    2015-06-01

    Full Text Available The aim of this study was to investigate if children’s early responsiveness towards social partners is developmentally related to their growing concept of self, as reflected in their mirror self recognition (MSR and delayed self recognition (DSR. Thus, a longitudinal study assessed infants' responsiveness (e.g., smiling, gaze towards social partners during the still-face task and a social imitation game and related it to their emerging MSR and DSR. Thereby, children were tested at regular time points from 9 months to 4 years of age. Results revealed significant predictive relations between children’s responsiveness towards a social partner in the still-face task at 9 months and their MSR at 24 months. Further, interindividual differences in children’s awareness of and responsiveness towards being imitated in a social imitation game at 12 months proved to be the strongest predictor of children’s DSR at 4 years, while some additional variance was explained by MSR at 24 months and verbal intelligence. Overall, findings suggest a developmental link between children’s early awareness of and responsiveness towards the social world and their later ability to form a concept of self.

  1. Constraining neutrinoless double beta decay

    International Nuclear Information System (INIS)

    Dorame, L.; Meloni, D.; Morisi, S.; Peinado, E.; Valle, J.W.F.

    2012-01-01

    A class of discrete flavor-symmetry-based models predicts constrained neutrino mass matrix schemes that lead to specific neutrino mass sum-rules (MSR). We show how these theories may constrain the absolute scale of neutrino mass, leading in most of the cases to a lower bound on the neutrinoless double beta decay effective amplitude.

  2. Replacement of the level control of draining tanks MSRS and powered water heaters with the OVATION system in Asco NPP; Sustitucion del control del nivel de tanques de drenaje MSRS y calentadores de agua de alimentacion con el sistema ovation en CN Asco

    Energy Technology Data Exchange (ETDEWEB)

    Serrano Jimenez, J.

    2012-07-01

    The current MSR drains and heaters tanks level control is local control individual, pneumatic and without action from Control room. The system has level switches for the generation of alarms, isolations and shots of bombs. Single control room operators have level alarms, final race of valves of control and indication of temperature and pressure of some tanks.

  3. System reliability analysis using dominant failure modes identified by selective searching technique

    International Nuclear Information System (INIS)

    Kim, Dong-Seok; Ok, Seung-Yong; Song, Junho; Koh, Hyun-Moo

    2013-01-01

    The failure of a redundant structural system is often described by innumerable system failure modes such as combinations or sequences of local failures. An efficient approach is proposed to identify dominant failure modes in the space of random variables, and then perform system reliability analysis to compute the system failure probability. To identify dominant failure modes in the decreasing order of their contributions to the system failure probability, a new simulation-based selective searching technique is developed using a genetic algorithm. The system failure probability is computed by a multi-scale matrix-based system reliability (MSR) method. Lower-scale MSR analyses evaluate the probabilities of the identified failure modes and their statistical dependence. A higher-scale MSR analysis evaluates the system failure probability based on the results of the lower-scale analyses. Three illustrative examples demonstrate the efficiency and accuracy of the approach through comparison with existing methods and Monte Carlo simulations. The results show that the proposed method skillfully identifies the dominant failure modes, including those neglected by existing approaches. The multi-scale MSR method accurately evaluates the system failure probability with statistical dependence fully considered. The decoupling between the failure mode identification and the system reliability evaluation allows for effective applications to larger structural systems

  4. Optimization of temperature coefficient and breeding ratio for a graphite-moderated molten salt reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zou, C.Y.; Cai, X.Z.; Jiang, D.Z.; Yu, C.G.; Li, X.X.; Ma, Y.W.; Han, J.L. [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); CAS Center for Excellence in TMSR Energy System, Chinese Academy of Sciences, Shanghai 201800 (China); Key Laboratory of Nuclear Radiation and Nuclear Energy Technology, Chinese Academy of Sciences, Shanghai 201800 (China); Chen, J.G., E-mail: chenjg@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); CAS Center for Excellence in TMSR Energy System, Chinese Academy of Sciences, Shanghai 201800 (China); Key Laboratory of Nuclear Radiation and Nuclear Energy Technology, Chinese Academy of Sciences, Shanghai 201800 (China)

    2015-01-15

    Highlights: • The temperature feedback coefficient with different moderation ratios for TMSR in thermal neutron region is optimized. • The breeding ratio and doubling time of a thermal TMSR with three different reprocessing schemes are analyzed. • The smaller hexagon size and larger salt fraction with more negative feedback coefficient can better satisfy the safety demands. • A shorter reprocessing time can achieve a better breeding ratio in a thermal TMSR. • The graphite moderator lifespan is compared with other MSRs and discussed. - Abstract: Molten salt reactor (MSR) has fascinating features: inherent safety, no fuel fabrication, online fuel reprocessing, etc. However, the graphite moderated MSR may present positive feedback coefficient which has severe implications for the transient behavior during operation. In this paper, the feedback coefficient and the breeding ratio are optimized based on the fuel-to-graphite ratio variation for a thorium based MSR (TMSR). A certain thermal core with negative feedback coefficient and relative high initial breeding ratio is chosen for the reprocessing scheme analysis. The breeding performances for the TMSR under different online fuel reprocessing efficiencies and frequencies are evaluated and compared with other MSR concepts. The results indicate that the thermal TMSR can get a breeding ratio greater than 1.0 with appropriate reprocessing scheme. The low fissile inventory in thermal TMSR leads to a short doubling time and low transuranic (TRU) inventory. The lifetime of graphite used for the TMSR is also discussed.

  5. Parametric analyses of single-zone thorium-fueled molten salt reactor fuel cycle options

    International Nuclear Information System (INIS)

    Powers, J.J.; Worrall, A.; Gehin, J.C.; Harrison, T.J.; Sunny, E.E.

    2013-01-01

    Analyses of fuel cycle options based on thorium-fueled Molten Salt Reactors (MSRs) have been performed in support of fuel cycle screening and evaluation activities for the United States Department of Energy. The MSR options considered are based on thermal spectrum MSRs with 3 different separations levels: full recycling, limited recycling, and 'once-through' operation without active separations. A single-fluid, single-zone 2250 MWth (1000 MWe) MSR concept consisting of a fuel-bearing molten salt with graphite moderator and reflectors was used as the basis for this study. Radiation transport and isotopic depletion calculations were performed using SCALE 6.1 with ENDF/B-VII nuclear data. New methodology developed at Oak Ridge National Laboratory (ORNL) enables MSR analysis using SCALE, modeling material feed and removal by taking user-specified parameters and performing multiple SCALE/TRITON simulations to determine the resulting equilibrium operating conditions. Parametric analyses examined the sensitivity of the performance of a thorium MSR to variations in the separations efficiency for protactinium and fission products. Results indicate that self-sustained operation is possible with full or limited recycling but once-through operation would require an external neutron source. (authors)

  6. Molten Salt Breeder Reactor Analysis Based on Unit Cell Model

    International Nuclear Information System (INIS)

    Jeong, Yongjin; Choi, Sooyoung; Lee, Deokjung

    2014-01-01

    Contemporary computer codes like the MCNP6 or SCALE are only good for solving a fixed solid fuel reactor. However, due to the molten-salt fuel, MSR analysis needs some functions such as online reprocessing and refueling, and circulating fuel. J. J. Power of Oak Ridge National Laboratory (ORNL) suggested in 2013 a method for simulating the Molten Salt Breeder Reactor (MSBR) with SCALE, which does not support continuous material processing. In order to simulate MSR characteristics, the method proposes dividing a depletion time into short time intervals and batchwise reprocessing and refueling at each step. We are applying this method by using the MCNP6 and PYTHON and NEWT-TRITON-PYTHON and PYTHON code systems to MSBR. This paper contains various parameters to analyze the MSBR unit cell model such as the multiplication factor, breeding ratio, change of amount of fuel, amount of fuel feeding, and neutron flux distribution. The result of MCNP6 and NEWT module in SCALE show some difference in depletion analysis, but it still seems that they can be used to analyze MSBR. Using these two computer code system, it is possible to analyze various parameters for the MSBR unit cells such as the multiplication factor, breeding ratio, amount of material, total feeding, and neutron flux distribution. Furthermore, the two code systems will be able to be used for analyzing other MSR model or whole core models of MSR

  7. Methicillin-resistant Staphylococcus aureus isolates from Iranian ...

    African Journals Online (AJOL)

    Methicillin-resistant Staphylococcus aureus isolates from Iranian restaurant food samples: Panton-Valentine Leukocidin, SCCmec phenotypes and antimicrobial resistance. ... TetK (80.72 %), linA (67.46 %), aadA1 (62.65 %), and msrA (55.42 %) were the most frequently identified resistance genes. SCCmec V (57.83%) ...

  8. Assessment of Genetic Diversity in Quality Protein Maize (QPM ...

    African Journals Online (AJOL)

    sriram

    maize (QPM) lines using simple sequence repeat (SSR) markers. MSR Krishna1, S. Sokka Reddy2 and V. Chinna Babu Naik3. 1Department of Biotechnology, KL University, Vijayawada, AP, India. 2Institute of Biotechnology, College of Agriculture, Rajendranagar, Hyderabad, AP, India. 3Central Institute of Cotton Research ...

  9. Review on the current status of molten chloride reactor and its future prospect

    International Nuclear Information System (INIS)

    Seo, Seok Bin; Shin, Yukyung; Bang, In Cheol

    2016-01-01

    This paper has summarized and reviewed the current status of MCR as an online pyroprocessing reactor, and introduced the related works in UNIST. As the developments of the next generation nuclear energy systems require the fuel sustainability, passive operation safety, nuclear proliferation, and reduction of highly radioactive waste, only several types of nuclear reactor systems survive to the last. Among these, molten salt reactor (MSR) is one of the most promising concepts of next generation nuclear reactor system that deliver on these requirements. MSR have great advantages in the fuel cycle and reduction of nuclear waste, since MSR can serve the online reprocessing system for the reprocessing of spent fuel. Especially, MSR utilizing chloride-based fuel, called molten chloride reactor (MCR) has been recently highlighted in USA under the DOE’s Gateway for Accelerated Innovation in Nuclear (GAIN) program. Recently, the interests in the molten chloride salt have arisen. The use of chloride-based salt gives great advantages to the reactor operating in a fast spectrum. Then MCR can serve waste management functions or fuel cycle sustainability functions, which can solve the current issues in nuclear field. Thus, research plan was established in UNIST which includes the investigation of thermal-hydraulic characteristics of chloride salt and optimization of heat transport system of MCR, using both numerical method and experimental method

  10. Spatial regression analysis on 32 years of total column ozone data

    NARCIS (Netherlands)

    Knibbe, J.S.; van der A, J.R.; de Laat, A.T.J.

    2014-01-01

    Multiple-regression analyses have been performed on 32 years of total ozone column data that was spatially gridded with a 1 × 1.5° resolution. The total ozone data consist of the MSR (Multi Sensor Reanalysis; 1979-2008) and 2 years of assimilated SCIAMACHY (SCanning Imaging Absorption spectroMeter

  11. Mining Software Repositories with CVSgrab

    NARCIS (Netherlands)

    Voinea, Lucian; Telea, Alexandru

    2006-01-01

    In this paper we address the process and team analysis categories of the MSR Mining Challenge 2006. We use our CVSgrab tool to acquire the data and interactively visualize the evolution of ArgoUML and PostgreSQL, in order to answer three relevant questions. We conclude summarizing the strong and

  12. Mining software repositories with CVSgrab

    NARCIS (Netherlands)

    Telea, A.C.; Voinea, S.L.

    2006-01-01

    In this paper we address the process and team analysis categories of the MSR Mining Challenge 2006. We use our CVSgrab tool to acquire the data and interactively visualize the evolution of ArgoUML and PostgreSQL, in order to answer three relevant questions. We conclude summarizing the strong and

  13. Dose and diagnostic performance comparison between phase-contrast mammography with synchrotron radiation and digital mammography: a clinical study report.

    Science.gov (United States)

    Fedon, Christian; Rigon, Luigi; Arfelli, Fulvia; Dreossi, Diego; Quai, Elisa; Tonutti, Maura; Tromba, Giuliana; Cova, Maria Assunta; Longo, Renata

    2018-01-01

    Two dosimetric quantities [mean glandular dose (MGD) and entrance surface air kerma (ESAK)] and the diagnostic performance of phase-contrast mammography with synchrotron radiation (MSR) are compared to conventional digital mammography (DM). Seventy-one patients (age range, 41 to 82 years) underwent MSR after a DM examination if questionable or suspicious breast abnormalities were not clarified by ultrasonography. The MGD and the ESAK delivered in both examinations were evaluated and compared. Two on-site radiologists rated the images in consensus according to the Breast Imaging Reporting and Data System assessment categories, which were then correlated with the final diagnoses by means of statistical generalized linear models (GLMs). Receiver operating characteristic curves were also used to assess the diagnostic performance by comparing the area under the curve (AUC). An important MGD and ESAK reduction was observed in MSR due to the monoenergetic beam. In particular, an average 43% reduction was observed for the MGD and a reduction of more than 50% for the ESAK. GLM showed higher diagnostic accuracy, especially in terms of specificity, for MSR, confirmed by AUC analysis ([Formula: see text]). The study design implied that the population was characterized by a high prevalence of disease and that the radiologists, who read the DM images before referring the patient to MSR, could have been influenced in their assessments. Within these limitations, the use of synchrotron radiation with the phase-contrast technique applied to mammography showed an important dose reduction and a higher diagnostic accuracy compared with DM. These results could further encourage research on the translation of x-ray phase-contrast imaging into the clinics.

  14. Synergistic Roles of Helicobacter pylori Methionine Sulfoxide Reductase and GroEL in Repairing Oxidant-damaged Catalase*

    Science.gov (United States)

    Mahawar, Manish; Tran, ViLinh; Sharp, Joshua S.; Maier, Robert J.

    2011-01-01

    Hypochlorous acid (HOCl) produced via the enzyme myeloperoxidase is a major antibacterial oxidant produced by neutrophils, and Met residues are considered primary amino acid targets of HOCl damage via conversion to Met sulfoxide. Met sulfoxide can be repaired back to Met by methionine sulfoxide reductase (Msr). Catalase is an important antioxidant enzyme; we show it constitutes 4–5% of the total Helicobacter pylori protein levels. msr and katA strains were about 14- and 4-fold, respectively, more susceptible than the parent to killing by the neutrophil cell line HL-60 cells. Catalase activity of an msr strain was much more reduced by HOCl exposure than for the parental strain. Treatment of pure catalase with HOCl caused oxidation of specific MS-identified Met residues, as well as structural changes and activity loss depending on the oxidant dose. Treatment of catalase with HOCl at a level to limit structural perturbation (at a catalase/HOCl molar ratio of 1:60) resulted in oxidation of six identified Met residues. Msr repaired these residues in an in vitro reconstituted system, but no enzyme activity could be recovered. However, addition of GroEL to the Msr repair mixture significantly enhanced catalase activity recovery. Neutrophils produce large amounts of HOCl at inflammation sites, and bacterial catalase may be a prime target of the host inflammatory response; at high concentrations of HOCl (1:100), we observed loss of catalase secondary structure, oligomerization, and carbonylation. The same HOCl-sensitive Met residue oxidation targets in catalase were detected using chloramine-T as a milder oxidant. PMID:21460217

  15. Literaturas centroamericanas hoy. En el foco de dos congresos internacionales celebrados en Alemania

    Directory of Open Access Journals (Sweden)

    Werner Mackenbach

    2014-06-01

    Full Text Available Seguramente, las literaturas centroamericanas nunca habían tenido una atención tan grande entre los estudiosos alemanes como en el mes de abril de 2002. Dos congresos, dedicados exclusivamente a ellas, reunieron durante casi dos semanas a un grupo significativo de autoras y autores de la región, así como a críticos de América Latina, Estados Unidos, Europa e incluso Australia: el simposio internacional “Literaturas Centroamericanas Hoy” celebrado en la Universidad Católica de Eichstätt en Baviera, del 17 al 20 de abril, y el “Décimo Congreso Internacional de Literatura Centroamericana” (CILCA celebrado en el Instituto Ibero-Americano de Berlín, del 22 al 24 de abril.

  16. Aniversarios astronómicos en Cananea, Sonora

    Directory of Open Access Journals (Sweden)

    Raúl Pérez – Enríquez

    2013-06-01

    Full Text Available El 21 de marzo de 1913, en la ciudad de México, nació Guillermo Haro Barraza y el 27 de abril de 1988, se inauguró el Observatorio Astrofísico Guillermo Haro, en Cananea, Sonora. Estos dos muy importantes aniversarios astronómicos se conmemoraron el pasado 27 de abril. Aquí se da cuenta de la relevancia de ambos festejos, de la fructuosa vida del homenajeado y de las actividades desarrolladas ese día allá donde está instalada “Una mina de estrellas”.

  17. Estructura de la comunidad de peces en el sistema Candelaria-Panlau, Campeche, México

    OpenAIRE

    Luis Amado Ayala-Pérez; Obed Agustín Avilés-Alatriste; José Luis Rojas-Galaviz

    1998-01-01

    Se describe el comportamiento de los parámetros de temperatura, salinidad, transparencia del agua y temperatura ambiente, y de la abundancia y diversidad de la comunidad del peces del sistema Candelaria-Panlau en escalas temporal y espacial. Los trabajos de campo se realizaron de manera mensual en cinco estaciones entre abril de 1993 y abril de 1994. La comunidad de peces quedó representada por 50 especies con 7 926 organismos y 144.7 kg de peso. Los valores de abundancia y diversidad de la c...

  18. Condiciones sanitarias de los comedores comunitarios del conurbano de Buenos Aires, Argentina

    OpenAIRE

    Arango Julia; Agostini Adela; Silvestre Alejandro; Yaafar Marcela; López Clara; Fishmann Hilda

    1997-01-01

    Debido a la importancia que la inocuidad de los alimentos entraña para la salud pública, se procuró determinar la calidad microbiológica de los alimentos que consumen los usuarios de los comedores comunitarios del conurbano de Buenos Aires, Argentina. Se trata de un estudio descriptivo, cuyo universo lo conformaron tres municipios con índices medianos y altos de pobreza, de los que se extrajo al azar una muestra de 52 comedores. La información se recolectó desde abril de 1994 hasta abril de 1...

  19. Acrilamida em alimentos : ocorrencia, metodos analiticos e estimativas de ingestão.

    OpenAIRE

    Adriana Pavesi Arisseto

    2007-01-01

    Resumo: Uma importante descoberta de pesquisadores suecos em abril de 2002 mostrou que acrilamida, uma substância provavelmente carcinogênica a seres humanos, pode ser formada em determinados alimentos que são submetidos a tratamento térmico em altas temperaturas. No presente estudo, 111 amostras de diferentes categorias de alimentos foram coletadas em supermercados, lojas de "fast-foods" e restaurantes da cidade de Campinas-SP, entre os meses de setembro de 2004 e abril de 2006, e analisadas...

  20. Principales propuestas del próximo gobierno: Ni mercantilista, ni populista

    OpenAIRE

    Romero Cerna, José Salvador

    2016-01-01

    En abril próximo se llevarán a cabo las eleccionespresidenciales, y si bien, se esperaría que pasen a lasegunda vuelta las propuestas electorales que defiendenel actual modelo de crecimiento seguido por los3 últimos gobiernos (sobre las bases de las reformasimpuestas después del autogolpe y disolución delCongreso del 05 de abril de 1992), existe todavía laposibilidad que una propuesta electoral alternativahaga frente al status quo en la segunda vuelta, por loque es necesario que los candidato...

  1. Evaluación de la varazón y contaminación en la Bahía Paracas – Pisco

    OpenAIRE

    Jacinto, María Elena; Martínez, Carlos; Sánchez, Sonia; Flores, Georgina; Pizarro, Luis

    1996-01-01

    Presenta los resultados de las prospecciones realizadas el 29 de abril y el 4-7 de mayo de 1995 como consecuencia de la varazón de lizas acaecido el 25 de abril en las playas de Santo Domingo, Pisco-Perú. Durante el operativo se realizó una evaluación, física, química y biológica del ecosistema marino costero el cual incluyó la cuantificación de hidrocarburos de petróleo. Los resultados demostraron condiciones críticas en el ambiente acuático (anoxia, sulfuros elevados, grandes cantidades de ...

  2. CARACTERIZACIÓN DE LOS FACTORES DE RIESGO VASCULAR EN PACIENTES ADULTOS / Characterization of vascular risk factors in adult patients

    OpenAIRE

    Estrella M. Hernández Hurtado; Yannelis Rodríguez Valido; Valentina Carpio García; Isis Yera Alós; Liset Valdés Manresa; Nercy O. Díaz Águila; Orestes Díaz Castro; Orestes Díaz Águila

    2013-01-01

    Resumen: Introducción: La elevada prevalencia de factores de riesgo vascular en la población y su relación con el desarrollo de la cardiopatía isquémica representan un problema de salud pública. Objetivo: Caracterizar estos factores en adultos. Método: Se realizó un estudio observacional, descriptivo, transversal en pacientes que asistieron a la consulta de riesgo vascular del municipio de Ranchuelo, en Villa Clara, entre abril de 2010 y abril de 2011. La información se procesó con el program...

  3. The risk-rewards structure of using spent nuclear fuel in molten salt reactor - 5513

    International Nuclear Information System (INIS)

    He, X.; Du, Z.; Macian-Juan, R.; Seidl, M.

    2015-01-01

    The molten salt reactor concept naturally lends itself to a re-use of fuel either by online reprocessing or by using spent nuclear fuel as part of the driver fuel. Moreover some well-known safety advantages over traditional LWR designs are promised: the primary loop can be operated at atmospheric pressure, refueling can be done online, only a minimum amount of excess reactivity needs to be stored inside the core and the continuous circulation and inter-mixing of the fuel results in a more homogenous redistribution of fission products. In this paper the feasibility of running a molten salt reactor on spent LWR fuel is discussed in a number of scenarios in order to make the various trade-offs transparent: using SNF in a classic graphite moderated MSR and doing the same for a lead-cooled dual-fluid MSR. From a commercial company's point of view the MSR concept faces already substantial risks even without the use of SNF: licensing concerns due to an enrichment of fissile nuclides typically above 5% of heavy metal mass, limited practical experience with the reliability of proposed MSR materials and almost no experience with online reprocessing. For one thing one could therefore aim for the most conservative design which would rely on the design of ORNL's graphite moderated MSR operated in the sixties. While appearing realistic from a technical perspective, the potential for SNF re-use in the sense of actinide destruction appears limited. On the other hand one can maximize the risk and the potential payoff by concentrating on the most speculative design, i.e. a dual fluid reactor with an ultra-hard neutron spectrum in order to most efficiently burn higher actinides. In this paper the neutronic design calculations for the above described MSR concepts are presented in order to maximize SNF's contribution for the reactors' energy generation and their potential for actinide destruction. Among the optimization parameters are the lattice constants, the type

  4. Hidrogel como substituto da irrigação complementar em viveiro telado de mudas de cafeeiro Hydrogel as a substitute for irrigation in screened seed nursery coffee

    Directory of Open Access Journals (Sweden)

    Patricia Angélica Alves Marques

    2013-01-01

    Full Text Available O cafeeiro, em sua fase inicial de mudas, requer um adequado suprimento de água, pois o estresse hídrico pode causar reduções no crescimento e subsequentemente na produção em campo. A hipótese deste trabalho foi que o uso do hidrogel como substituto da irrigação de mudas de café cv. 'Iapar 59' proporciona mudas de qualidade igual ou superior àquelas irrigadas. O experimento foi conduzido em viveiro telado (50% sombrite em Presidente Prudente - SP - de fevereiro a outubro de 2008. Utilizou-se o delineamento inteiramente casualizado, com cinco tratamentos (sem polímero e irrigado diariamente; 0,0; 1,0; 2,0 e 3,0g por saco de polietileno sem irrigação e 20 repetições. Realizaram-se seis avaliações periódicas: número de folhas (NF, matéria seca da parte aérea (MSPA e raízes (MSR; comprimento da parte aérea (CPA e raízes (CR e MSPA/MSR. Para as condições do ensaio, o uso do hidrogel na dose de 2g por saco de polietileno proporcionou mudas de mesma qualidade que aquelas irrigadas. A relação MSPA/MSR foi superior para o tratamento irrigado.The coffee seedlings require an adequate water supply because the water stress can cause reductions in growth and subsequently in the production field. The hypothesis of this research was that the hydrogel used as a substitute for the irrigation of seedlings of 'Iapar 59' coffee provides quality equal or higher seedling irrigated. The experiment was conducted in a screened seed nursery (50 shading in Presidente Prudente city, São Paulo State, Brazil, since February to October 2008. The statistical design was completely randomized, with 5 treatments (without polymer and without irrigation; 0.0; 1.0; 2.0 and 3.0g of hydrogel per polythene bag without irrigation and 20 repetitions. We conducted six periodic evaluations: number of leaves (NF, dry matter of aerial part (MSPA and roots (MSR; length of aerial part (CPA and roots (CR and the MSPA/MSR. Under test conditions, the use of hydrogel

  5. Preliminary study on weapon grade uranium utilization in molten salt reactor miniFUJI

    International Nuclear Information System (INIS)

    Aji, Indarta Kuncoro; Waris, A.

    2014-01-01

    Preliminary study on weapon grade uranium utilization in 25MWth and 50MWth of miniFUJI MSR (molten salt reactor) has been carried out. In this study, a very high enriched uranium that we called weapon grade uranium has been employed in UF 4 composition. The 235 U enrichment is 90 - 95 %. The results show that the 25MWth miniFUJI MSR can get its criticality condition for 1.56 %, 1.76%, and 1.96% of UF 4 with 235 U enrichment of at least 93%, 90%, and 90%, respectively. In contrast, the 50 MWth miniFUJI reactor can be critical for 1.96% of UF 4 with 235 U enrichment of at smallest amount 95%. The neutron spectra are almost similar for each power output

  6. Preliminary study on weapon grade uranium utilization in molten salt reactor miniFUJI

    Energy Technology Data Exchange (ETDEWEB)

    Aji, Indarta Kuncoro [Department of Physics, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung (Indonesia); Waris, A., E-mail: awaris@fi.itb.ac.id [Nuclear Physics and Biophysics Research Division, Department of Physics, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesa No. 10 Bandung 40132 (Indonesia)

    2014-09-30

    Preliminary study on weapon grade uranium utilization in 25MWth and 50MWth of miniFUJI MSR (molten salt reactor) has been carried out. In this study, a very high enriched uranium that we called weapon grade uranium has been employed in UF{sub 4} composition. The {sup 235}U enrichment is 90 - 95 %. The results show that the 25MWth miniFUJI MSR can get its criticality condition for 1.56 %, 1.76%, and 1.96% of UF{sub 4} with {sup 235}U enrichment of at least 93%, 90%, and 90%, respectively. In contrast, the 50 MWth miniFUJI reactor can be critical for 1.96% of UF{sub 4} with {sup 235}U enrichment of at smallest amount 95%. The neutron spectra are almost similar for each power output.

  7. Driven Factors Analysis of China’s Irrigation Water Use Efficiency by Stepwise Regression and Principal Component Analysis

    Directory of Open Access Journals (Sweden)

    Renfu Jia

    2016-01-01

    Full Text Available This paper introduces an integrated approach to find out the major factors influencing efficiency of irrigation water use in China. It combines multiple stepwise regression (MSR and principal component analysis (PCA to obtain more realistic results. In real world case studies, classical linear regression model often involves too many explanatory variables and the linear correlation issue among variables cannot be eliminated. Linearly correlated variables will cause the invalidity of the factor analysis results. To overcome this issue and reduce the number of the variables, PCA technique has been used combining with MSR. As such, the irrigation water use status in China was analyzed to find out the five major factors that have significant impacts on irrigation water use efficiency. To illustrate the performance of the proposed approach, the calculation based on real data was conducted and the results were shown in this paper.

  8. Optimal risky bidding strategy for a generating company by self-organising hierarchical particle swarm optimisation

    International Nuclear Information System (INIS)

    Boonchuay, Chanwit; Ongsakul, Weerakorn

    2011-01-01

    In this paper, an optimal risky bidding strategy for a generating company (GenCo) by self-organising hierarchical particle swarm optimisation with time-varying acceleration coefficients (SPSO-TVAC) is proposed. A significant risk index based on mean-standard deviation ratio (MSR) is maximised to provide the optimal bid prices and quantities. The Monte Carlo (MC) method is employed to simulate rivals' behaviour in competitive environment. Non-convex operating cost functions of thermal generating units and minimum up/down time constraints are taken into account. The proposed bidding strategy is implemented in a multi-hourly trading in a uniform price spot market and compared to other particle swarm optimisation (PSO). Test results indicate that the proposed SPSO-TVAC approach can provide a higher MSR than the other PSO methods. It is potentially applicable to risk management of profit variation of GenCo in spot market.

  9. Methods of Scientific Research: Teaching Scientific Creativity at Scale

    Science.gov (United States)

    Robbins, Dennis; Ford, K. E. Saavik

    2016-01-01

    We present a scaling-up plan for AstroComNYC's Methods of Scientific Research (MSR), a course designed to improve undergraduate students' understanding of science practices. The course format and goals, notably the open-ended, hands-on, investigative nature of the curriculum are reviewed. We discuss how the course's interactive pedagogical techniques empower students to learn creativity within the context of experimental design and control of variables thinking. To date the course has been offered to a limited numbers of students in specific programs. The goals of broadly implementing MSR is to reach more students and early in their education—with the specific purpose of supporting and improving retention of students pursuing STEM careers. However, we also discuss challenges in preserving the effectiveness of the teaching and learning experience at scale.

  10. Spacecraft Actuator Diagnosis with Principal Component Analysis: Application to the Rendez-Vous Phase of the Mars Sample Return Mission

    Directory of Open Access Journals (Sweden)

    Othman Nasri

    2015-01-01

    Full Text Available This paper presents a fault detection and isolation (FDI approach in order to detect and isolate actuators (thrusters and reaction wheels faults of an autonomous spacecraft involved in the rendez-vous phase of the Mars Sample Return (MSR mission. The principal component analysis (PCA has been adopted to estimate the relationships between the various variables of the process. To ensure the feasibility of the proposed FDI approach, a set of data provided by the industrial “high-fidelity” simulator of the MSR and representing the opening (resp., the rotation rates of the spacecraft thrusters (resp., reaction wheels has been considered. The test results demonstrate that the fault detection and isolation are successfully accomplished.

  11. Tendances Carbone no. 97. Emissions Trading Schemes in China: the transition from experimental pilots to a national ETS

    International Nuclear Information System (INIS)

    Afriat, Marion

    2014-12-01

    Among the publications of CDC Climat Research, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS-MSR debate: The ENVI Committee has published a provisional report supporting the implementation of the mechanism and arguing for increased flexibility. The parliament's ITRE Commission suggested adjustments to the mechanism in order to protect industrial competitiveness on 17 November. - EU ETS-MSR timetable: the ITRE Committee will hold an opinion vote on 21 January 2015, while the ENVI Committee will vote on 23 and 24 February 2015. - 2030 Climate and Energy Package: the European Energy and Climate Commissioner supports increasing the energy-efficiency target to 30%

  12. Volatile earliest Triassic sulfur cycle

    DEFF Research Database (Denmark)

    Schobben, Martin; Stebbins, Alan; Algeo, Thomas J.

    2017-01-01

    model experiment. Exposure of evaporite deposits having a high δ 34S may account for the source change, with a possible role for the Siberian Traps volcanism by magmatic remobilization of Cambrian rock salt. A high sulfur cycle turnover rate would have left the ocean system vulnerable to development......Marine biodiversity decreases and ecosystem destruction during the end-Permian mass extinction (EPME) have been linked to widespread marine euxinic conditions. Changes in the biogeochemical sulfur cycle, microbial sulfate reduction (MSR), and marine dissolved sulfate concentrations during...... fractionation and point to a more universal control, i.e., contemporaneous seawater sulfate concentration.The MSR-trend transfer function yielded estimates of seawater sulfate of 0.6-2.8mM for the latest Permian to earliest Triassic, suggesting a balanced oceanic S-cycle with equal S inputs and outputs...

  13. Tendances Carbone no. 101. Will anybody dare resuscitating the EU ETS?

    International Nuclear Information System (INIS)

    Schleicher, Stefan

    2015-04-01

    Among the publications of CDC Climat Research, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS - MSR timetable: The first Trilogue meeting between EU institutions took place on 30 March. The second is scheduled on 5 May. The Committee of Permanent Representatives of the Member States approved an implementation of the MSR in 2021. - EU's INDC: On 6 March, the EU Environment Council approved the EU's intended nationally determined contribution to achieve at least 40% domestic reduction in GHG emissions by 2030 compared to 1990 levels. - Consultations: On 26 March, the EU Commission launched two parallel consultations running until 18 June on the development of 2030 climate and energy policies in the sectors not covered by the EU ETS

  14. Revised numerical model for F{sub 2} bubble breakdown in molten flibe and its economics in the fuel cycle

    Energy Technology Data Exchange (ETDEWEB)

    Seto, K., E-mail: kelvin.seto@uoit.ca [University of Ontario Institute of Technology, Oshawa, ON (Canada)

    2015-07-01

    A one-dimensional numerical model of the breakdown for a fluorine bubble due to break-up and chemical reactions with dissolved UF{sub 4} and PuF{sub 4} in the molten salt reactor (MSR) volatilization process was revised. The updated model utilized a more realistic, 1.0 cm F{sub 2} bubble to study the breakdown process in the idealized MSR fuel purification vessel. Although more accurate reaction interface and F{sub 2} reactivity values were used, chemical reactions were still found to be the primary cause of bubble breakdown. The importance of efficiency in F{sub 2} usage in the purification process on the economic and safety point of view was discussed. (author)

  15. Study on Utilization of Super Grade Plutonium in Molten Salt Reactor FUJI-U3 using CITATION Code

    Science.gov (United States)

    Wulandari, Cici; Waris, Abdul; Pramuditya, Syeilendra; Asril, Pramutadi AM; Novitrian

    2017-07-01

    FUJI-U3 type of Molten Salt Reactor (MSR) has a unique design since it consists of three core regions in order to avoid the replacement of graphite as moderator. MSR uses floride as a nuclear fuel salt with the most popular chemical composition is LiF-BeF2-ThF4-233UF4. ThF4 and 233UF4 are the fertile and fissile materials, respectively. On the other hand, LiF and BeF2 working as both fuel and heat transfer medium. In this study, the super grade plutonium will be utilized as substitution of 233U since plutonium is easier to be obtained compared to 233U as main fuel. Neutronics calculation was performed by using PIJ and CITATION modules of SRAC 2002 code with JENDL 3.2 as nuclear data library.

  16. Behavior study on Na heat pipe in passive heat removal system of new concept molten salt reactor

    International Nuclear Information System (INIS)

    Wang Chenglong; Tian Wenxi; Su Guanghui; Zhang Dalin; Wu Yingwei; Qiu Suizheng

    2013-01-01

    The high temperature Na heat pipe is an effective device for transporting heat, which is characterized by remarkable advantages in conductivity, isothermally and passively working. The application of Na heat pipe on passive heat removal system of new concept molten salt reactor (MSR) is significant. The transient performance of high temperature Na heat pipe was simulated by numerical method under the MSR accident. The model of the Na heat pipe was composed of three conjugate heat transfer zones, i.e. the vapor, wick and wall. Based on finite element method, the governing equations were solved by making use of FORTRAN to acquire the profiles of the temperature, velocity and pressure for the heat pipe transient operation. The results show that the high temperature Na heat pipe has a good performance on operating characteristics and high heat transfer efficiency from the frozen state. (authors)

  17. Minimizing magnetic fields for precision experiments

    Energy Technology Data Exchange (ETDEWEB)

    Altarev, I.; Fierlinger, P.; Lins, T.; Marino, M. G.; Nießen, B.; Petzoldt, G.; Reisner, M.; Stuiber, S., E-mail: stefan.stuiber@ph.tum.de; Sturm, M.; Taggart Singh, J.; Taubenheim, B. [Physikdepartment, Technische Universität München, D-85748 Garching (Germany); Rohrer, H. K. [Rohrer GmbH, D-80667 München (Germany); Schläpfer, U. [IMEDCO AG, CH-4614 Hägendorf (Switzerland)

    2015-06-21

    An increasing number of measurements in fundamental and applied physics rely on magnetically shielded environments with sub nano-Tesla residual magnetic fields. State of the art magnetically shielded rooms (MSRs) consist of up to seven layers of high permeability materials in combination with highly conductive shields. Proper magnetic equilibration is crucial to obtain such low magnetic fields with small gradients in any MSR. Here, we report on a scheme to magnetically equilibrate MSRs with a 10 times reduced duration of the magnetic equilibration sequence and a significantly lower magnetic field with improved homogeneity. For the search of the neutron's electric dipole moment, our finding corresponds to a 40% improvement of the statistical reach of the measurement. However, this versatile procedure can improve the performance of any MSR for any application.

  18. Minimizing magnetic fields for precision experiments

    International Nuclear Information System (INIS)

    Altarev, I.; Fierlinger, P.; Lins, T.; Marino, M. G.; Nießen, B.; Petzoldt, G.; Reisner, M.; Stuiber, S.; Sturm, M.; Taggart Singh, J.; Taubenheim, B.; Rohrer, H. K.; Schläpfer, U.

    2015-01-01

    An increasing number of measurements in fundamental and applied physics rely on magnetically shielded environments with sub nano-Tesla residual magnetic fields. State of the art magnetically shielded rooms (MSRs) consist of up to seven layers of high permeability materials in combination with highly conductive shields. Proper magnetic equilibration is crucial to obtain such low magnetic fields with small gradients in any MSR. Here, we report on a scheme to magnetically equilibrate MSRs with a 10 times reduced duration of the magnetic equilibration sequence and a significantly lower magnetic field with improved homogeneity. For the search of the neutron's electric dipole moment, our finding corresponds to a 40% improvement of the statistical reach of the measurement. However, this versatile procedure can improve the performance of any MSR for any application

  19. Development of flexible support for molten salt reactor

    International Nuclear Information System (INIS)

    Xie, Mingqiang

    2014-01-01

    Supporting member design for equipment and pipes is the requisite factor to realize the concept. It's a challenge to design a reliable supporting structure in molten salt reactor (MSR) due to the extraordinary working temperature (max 750 deg. C). High temperature may cause large expansion and reduce the mechanical strength of material, The support is required both enough strength and flexibility. In this paper, an all-dimensional support was designed, the validation work was carried out on a high temperature test loop. The results indicate that the support has a good performance, it reduce the thermal stress effectively and support the equipment and pipes stably for one year. The support design has a significance referential meaning for MSR construction (authors)

  20. The membrane stress response buffers lethal effects of lipid disequilibrium by reprogramming the protein homeostasis network.

    Science.gov (United States)

    Thibault, Guillaume; Shui, Guanghou; Kim, Woong; McAlister, Graeme C; Ismail, Nurzian; Gygi, Steven P; Wenk, Markus R; Ng, Davis T W

    2012-10-12

    Lipid composition can differ widely among organelles and even between leaflets of a membrane. Lipid homeostasis is critical because disequilibrium can have disease outcomes. Despite their importance, mechanisms maintaining lipid homeostasis remain poorly understood. Here, we establish a model system to study the global effects of lipid imbalance. Quantitative lipid profiling was integral to monitor changes to lipid composition and for system validation. Applying global transcriptional and proteomic analyses, a dramatically altered biochemical landscape was revealed from adaptive cells. The resulting composite regulation we term the "membrane stress response" (MSR) confers compensation, not through restoration of lipid composition, but by remodeling the protein homeostasis network. To validate its physiological significance, we analyzed the unfolded protein response (UPR), one facet of the MSR and a key regulator of protein homeostasis. We demonstrate that the UPR maintains protein biogenesis, quality control, and membrane integrity-functions otherwise lethally compromised in lipid dysregulated cells. Copyright © 2012 Elsevier Inc. All rights reserved.

  1. Acylated Ghrelin and Circulatory Oxidative Stress Markers Responses to Acute Resistance and Aerobic Exercise in Postmenopausal Women.

    Science.gov (United States)

    Carteri, Randhall B; Lopes, André Luis; Schöler, Cinthia M; Correa, Cleiton Silva; Macedo, Rodrigo C; Gross, Júlia Silveira; Kruger, Renata Lopes; Homem de Bittencourt, Paulo I; Reischak-Oliveira, Álvaro

    2016-06-01

    Since exercise increases the production of reactive oxygen species in different tissues, the objective of this study is to evaluate, compare and correlate the acute effects of aerobic and resistance exercise in circulatory markers of oxidative stress and acylated ghrelin (AG) in postmenopausal women. Ten postmenopausal women completed different protocols: a control session (CON), an aerobic exercise session (AERO); and a single-set (SSR) or 3-set (MSR) resistance exercise protocol. After exercise, both MSR (P = .06) and AERO (P = .02) sessions showed significant increased lipid peroxidation compared with baseline levels. CON and SSR sessions showed no differences after exercise. No differences were found between sessions at any time for total glutathione, glutathione dissulfide or AG concentrations. Exercise significantly increased lipid peroxidation compared with baseline values. As pro oxidant stimuli is necessary to promote chronic adaptations to the antioxidant defenses induced by exercise, our findings are important to consider when evaluating exercise programs prescription variables aiming quality of life in this population.

  2. Modeling of circulating nuclear fuels with Comsol Multiphysics

    International Nuclear Information System (INIS)

    Cammi, A.; Di Marcello, V.; Luzzi, L.

    2007-01-01

    This paper presents multi-physics modelling of circulating nuclear fuel in a simple geometry by means of COMSOL 3.3. Among the Circulating Fuel Reactors (CFR), the most promising is the Molten Salt Reactor (MSR). Physics of such circulating nuclear fuel requires five coupled equations of conservation laws: the momentum balance, the energy balance, the neutron balance and the precursors balance. In this complex field, represented by the coupling of thermal-hydrodynamics with neutronics, the highly non linear regime and the wide disparity of time scales, COMSOL was used to investigate the region of reactor that comprises only the flowing fluid, and a parametric study was performed by varying the size of the analyzed region and the inlet velocity of fluid. This study is sufficient to achieve a preliminary evaluation of the thermo-physical behaviour of the system and paves the way for further progress concerning a more complex and realistic MSR geometry. (authors)

  3. Directory of Open Access Journals (Sweden)

    Rolando Carrasco M.

    2007-01-01

    El presente artículo se inscribe en el proyecto FONDECYT N º 1060142. La Ilustración hispanoamericana. El siglo XVIII en Chile y el área andina. Una primera versión de éste fue leído en el Congreso de Peruanistas. Santiago de Chile, 25 al 27 de abril del 2007.

  4. Poesía del padre Briceño Jáuregui

    Directory of Open Access Journals (Sweden)

    Antonio J. Pérez H.

    1963-03-01

    Full Text Available En la Revista Javeriana (abril de 1962 apareció un haz de sonetos cincelados al pie mismo de los mármoles vetustos de Atica. Un poeta autóctono, virtuoso del clasicismo heleno, casi anónimo en meido de esta desazón literaria en que vivimos.

  5. Transformación digital en las instituciones de educación superior

    OpenAIRE

    Llorens Largo, Faraón

    2018-01-01

    Presentación utilizada en la charla "Transformación digital en las instituciones de educación superior" en el Dia Virtual de la Conferencia TICAL2018 y II Encuentro de eCiencia, el 12 de abril de 2018. https://eventos.redclara.net/indico/event/863/overview

  6. Violencia simbólica en televisión: representaciones de mujer en la información y ficción televisiva

    OpenAIRE

    Moreno Pachón, Susana; Macías Gómez, Alberto

    2016-01-01

    Mesa de debate en: I Jornadas "Violencia contra las mujeres en los medios de comunicación": Situación actual y propuestas de actuación, Burgos, 20, 27 y 28 de abril de 2016, con el apoyo del Instituto de la Mujer y para la Igualdad de Oportunidades

  7. Criptografía de Clave secreta: Cifrado en flujo

    OpenAIRE

    Fúster Sabater, Amparo

    2010-01-01

    Clase impartida en el curso "Introducción a la Criptología" dentro de la serie "Seguridad de la Información", celebrado en abril de 2009 en la Escuela de Técnicas de Mando, Control y Telecomunicaciones (EMACOT).

  8. Editorial: invitación al segundo congreso sudamericano de neurología

    OpenAIRE

    Revista, Facultad de Medicina

    2011-01-01

    Estimado colega: tenemos el agrado de invitarlo al Segundo Congreso Latino Americano de Neurocirugía que se celebrará en Santiago de Chile, en abril de 1947.Los temas oficiales han sido distribuidos a los diferentes servicios de Neurocirugía de Argentina, Brasil, Chile, Perú y Uruguay.

  9. Zona Incerta: o ARG como meio de construção colaborativa de conteúdo

    Directory of Open Access Journals (Sweden)

    Gabriel Costa Correia

    2011-05-01

    Full Text Available O presente artigo discorrerá sobre um estudo de caso realizado sobre o Alternate Reality Game (ARG Zona Incerta, realizado por membros da equipe da revista Superinteressante, publicação da Editora Abril, como estratégia de marketing alternativa para o produto Guaraná Antarctica, da empresa de bebidas AMBEV.

  10. 164 antitrypanosomal activity of senna villosa in infected balb/c mice ...

    African Journals Online (AJOL)

    AJTCAM

    Matilde Jimenez-Coelloa, Eugenia Guzman-Marina, SaludPerez-Gutierrez b, .... and administered orally (adjusted to 50 µL per animal) every 24 hours during 15 ..... Peruana de Medicina Experimental y Salud Pública [on line], 22 (abril-junio) ...

  11. Evaluación de la calidad de los sedimentos en la cuenca del río Santa

    OpenAIRE

    Autoridad Nacional del Agua. Dirección de Gestión de Calidad de los Recursos Hídricos; Salbatier Portugal, Melissa Guliana; Ocola Salazar, Juan José

    2014-01-01

    Evalúa el estado de la calidad de los cuerpos naturales de agua superficial en el ámbito de la cuenca del río Santa, en base a los análisis de muestras de agua, sedimentos y las mediciones realizadas en campo en noviembre del 2013 y abril del 2014 respectivamente.

  12. Seguridad en Sistemas de Información

    OpenAIRE

    Valverde Álvarez, Evangelino

    2012-01-01

    Material de apoyo de la charla "Seguridad en Sistemas de Información (un recorrido a vista de pájaro)" para los alumnos de primer curso de la Escuela Superior de Informática de Ciudad Real (Abril de 2012).

  13. Métricas alternativas e periódicos científicos

    OpenAIRE

    Nascimento, Andrea

    2016-01-01

    Palestra "Métricas alternativas e periódicos científicos" apresentada no I SIMPÓSIO INTERNACIONAL UNIVERSITÁRIO DE EDITORAÇÃO CIENTÍFICA DA UNIRIO - (I SINUEC) realizado de 29 a 30 de abril de 2015, no Rio de Janeiro/RJ

  14. Discourses of Inclusion and Exclusion in the Commemoration of the 40th Anniversary of the Portuguese Revolution

    Science.gov (United States)

    de Oliveira, Sandi Michele

    2014-01-01

    This article takes a discourse analytical approach to elements of the 40th commemoration of the Portuguese Revolution, focusing specifically on the absence of themes and participants by groups who were most directly involved in the Revolution, either as actors (the "Captains of Abril"), the "retornados" (Portuguese nationals…

  15. Shakespeare no Brasil

    Directory of Open Access Journals (Sweden)

    Enrico Schaeffer

    1964-09-01

    Full Text Available No dia 23 de abril de 1964 completaram-se quatrocentos anos que William Shakespeare, o maior gênio da Literatura Inglêsa — e um dos maiores de todos os tempos e de tôdas as nações — nasceu.

  16. Montaje de un amplificador de audio en las prácticas de electrónica analógica

    OpenAIRE

    Jiménez Fernández, Carlos Jesús; López Ojeda, Antonio; Valencia-Barrero, M.

    2010-01-01

    Comunicación presentada al IX Congreso de Tecnologías Apicadas a la Enseñanza de la Electrónica (TAEE-2010) celebrado del 13 al 15 de Abril del 2010 en Madrid (España), organizado por la UNED: http://e-spacio.uned.es:8080/fedora/get/taee:congreso-2010/demo:Collection/view

  17. La interpretación de la imagen visual de la "feminidad" en la prensa española de principios de s.XX

    OpenAIRE

    Luengo López, Jordi

    2003-01-01

    Actas del Décimo Coloquio Internacional de la Asociación Española de Investigación de Historia de las Mujeres (AEIHM) celebrado del 17 al 19 de abril de 2002 en la Universidad Carlos III de Madrid Publicado

  18. Respuesta de plántulas leñosas mediterráneas a la disponibilidad de luz y agua en condiciones experimentales

    OpenAIRE

    Sánchez Gómez, David

    2007-01-01

    Resumen de la Tesis Doctoral. Departamento de Ecología de la Universidad Complutense de Madrid. Realizada en el Centro de Ciencias Medioambientales, CSIC. Abril 2006. Dirección: Fernando Valladares Ros y Miguel Ángel de Zavala Gironés.

  19. Bio-historia

    OpenAIRE

    Réaumur, René-Antoine Ferchault de; Aguiló, F. de S.

    2012-01-01

    Memorias sobre las ranas (1) (el apareamiento de las ranas) (2) 1736 (Inédito) (3) / memorias sobre los sapos. Sapos de agua (9) (10 de abril de 1740) (Inédito). Versión y notas del Prof. F. de S. Aguiló

  20. Nuevas contribuciones en la fisioterapia del linfedema de miembro superior secundario al tratamiento del cáncer de mama

    OpenAIRE

    Canet Pérez, Cristina; Santandreu Mañó, Trinidad; Nácher Nebot, Rosa

    2011-01-01

    Resumen del póster presentado en las II Jornadas de Fisioterapia en Lesiones del Sistema Músculo-esquelético: miembro superior. Escuela Universitaria de Fisioterapia Universitat de València 28 y 29 abril de 2011 Introducción. El linfedema supone un importante problema en mujeres tratadas de cáncer de mama. Distintas revisiones han puesto...

  1. Revista de revistas

    Directory of Open Access Journals (Sweden)

    Facultad de Medicina Revista

    1946-10-01

    Full Text Available The Lanced Londres, abril 6 de 1946. Necrosis aguda del hígado. Tratada con hidrolizados de proteinas. Osteomielitis que semeja radiográficamente un sarvoma. BCG en Escandinavia / The Lnaces Londres, mayo 9 de 1946. Miopía tirotóxica aguda. Posible papel de la prehipófesis en la diabetes humana

  2. PSA de radio Mes de Concientización sobre las ETS PSA de radio (30 seg) (STD Awareness Month PSA (:30))

    Centers for Disease Control (CDC) Podcasts

    Abril es el Mes Nacional de Concientización sobre las Enfermedades de Transmisión Sexual (ETS). Las ETS pueden afectar a cualquier persona. Muchas ETS no tienen síntomas, por lo que es importante hacerse pruebas de detección.

  3. Bit keskus. (Uuendusliku Tehnoloogia Keskus) Inca, Mallorca, Hispaania / Alberto Campo Baeza

    Index Scriptorium Estoniae

    Campo Baeza, Alberto

    1998-01-01

    High-tech büroo kolmnurksel krundil industriaalpargis. Krundi sisemuses suletud alal "salaaed" apelsinipuudega. Seintel ronivad aromaatse lõhnaga taimed: jasmiinid, vistaaria, viinapuud. Konkurss 1995, ehitus 1997-1998. Arhitekt Alberto Campo Baeza (koos: L. Ignacio Aguirre Lopez, Anton Garcia Abril, Antonio Perez Villegas)

  4. BRAIN JOURNAL- Resumos de artigos em Português

    OpenAIRE

    Bogdan Pătruţ

    2010-01-01

    BRAIN. Broad Research in Artificial Intelligence and Neuroscience CÉREBRO. Ampla pesquisa em Inteligência Artificial e Neurociências ISSN 2067-3957 Volume 1, Número 2 Abril de 2010, "Feliz Primavera 2010!" www.brain.edusoft.ro Editor - chefe: Bogdan Pătruţ

  5. CDC Signos Vitales: El zika y el embarazo Lo que debe saber(Zika and Pregnancy: What You Should Know)

    Centers for Disease Control (CDC) Podcasts

    Este podcast se basa en el informe de Signos Vitales de los CDC de abril del 2016. Una mujer embarazada infectada por el virus del Zika puede pasar el virus a su feto. El virus se ha vinculado a la microcefalia, un defecto congénito grave. Este podcast trata sobre cómo protegerse del virus del Zika.

  6. Bio-historia

    Directory of Open Access Journals (Sweden)

    René-Antoine Ferchault de Réaumur

    1951-08-01

    Full Text Available Memorias sobre las ranas (1 (el apareamiento de las ranas (2 1736 (Inédito (3 / memorias sobre los sapos. Sapos de agua (9 (10 de abril de 1740 (Inédito. Versión y notas del Prof. F. de S. Aguiló

  7. La robótica de servicios: ¿cómo hacer que un robot nos vea?

    OpenAIRE

    Andrade-Cetto, Juan

    2014-01-01

    Trabajo presentado a la 6ª Jornada de Mecatrònica sobre Robòtica mòbil organitzada pel Grup de recerca Mecatrònica i Modelització Aplicada a la Tecnologia de Materials de la UVic-UCC, celebrada en Ripoll-Vic el 8 de abril de 2014.

  8. Las Matemáticas en Educación Infantil: sentidos y creatividad

    OpenAIRE

    GdI Educación Personalizada en la Era Digital, EPEDIG

    2016-01-01

    El Seminario de Educación Personalizada (SIEP) -actividad organizada por el Grupo de Investigación EDUC-04 EPEDIG de UNIRResearch-, tuvo el honor de recibir el pasado 18 de Abril a los Doctores Blanca Arteaga y Jesús Macías. Ambos son expertos en enseñar matemáticas de una forma diferente.

  9. Terapia asistida con perros

    OpenAIRE

    Martínez Artime, Aida.

    2010-01-01

    Descripció del recurs: 28 abril 2011. Treball presentat a la Facultat de Veterinària de la Universitat Autònoma de Barcelona. Treball presentat a l'assignatura de Deontologia i Veterinària Legal (21223)

  10. Seminarios de Derecho Constitucional 2014-2015: Programa

    OpenAIRE

    Matia Portilla, Francisco Javier

    2015-01-01

    Programa de los Seminarios de Derecho Constitucional 2014-2015, impartidos por grupos de estudiantes de Derecho Constitucional II el 30 de abril de 2015. Departamento de Derecho Constitucional, Procesal y Eclesiástico del Estado Área de Derecho Constitucional (campus de Segovia)

  11. Memoria 2013

    OpenAIRE

    Comisión de Investigaciones Científicas de la Provincia de Buenos Aires (CICBA)

    2014-01-01

    -Autoridades. -Plan general de acciones. -Junta de calificaciones. -Comisiones asesoras honorarias. -Estructura. -Formación de Recursos Humanos. -Ingreso a Carrera de Investigador. -1º Congreso Internacional Científico y Tecnológico de la provincia de Buenos Aires. -Consecuencias de la inundación del 2 de abril. -Centros de investigación. -Convenios. D...

  12. Análisis del microclima de la Península Byers, isla Livingston, Antártida en el marco del proyecto LIMNOPOLAR

    OpenAIRE

    Bañón García, Manuel; Justel, Ana; Quesada, Antonio

    2006-01-01

    Ponencia presentada en: XXIX Jornadas Científicas de la AME y el VII Encuentro Hispano Luso de Meteorología celebrado en Pamplona, del 24 al 26 de abril de 2006. Este estudio es parte del proyecto REN2000-0435 ANT de la CICYT.

  13. Giant pandas failed to show mirror self-recognition.

    Science.gov (United States)

    Ma, Xiaozan; Jin, Yuan; Luo, Bo; Zhang, Guiquan; Wei, Rongping; Liu, Dingzhen

    2015-05-01

    Mirror self-recognition (MSR), i.e., the ability to recognize oneself in a mirror, is considered a potential index of self-recognition and the foundation of individual development. A wealth of literature on MSR is available for social animals, such as chimpanzees, Asian elephants and dolphins, yet little is known about MSR in solitary mammalian species. We aimed to evaluate whether the giant panda can recognize itself in the mirror, and whether this capacity varies with age. Thirty-four captive giant pandas (F:M = 18:16; juveniles, sub-adults and adults) were subjected to four mirror tests: covered mirror tests, open mirror tests, water mark control tests, and mark tests. The results showed that, though adult, sub-adult and juvenile pandas exposed to mirrors spent similar amounts of time in social mirror-directed behaviors (χ(2) = 0.719, P = 0.698), none of them used the mirror to touch the mark on their head, a self-directed behavior suggesting MSR. Individuals of all age groups initially displayed attacking, threatening, foot scraping and backwards walking behaviors when exposed to their self-images in the mirror. Our data indicate that, regardless of age, the giant pandas did not recognize their self-image in the mirror, but instead considered the image to be a conspecific. Our results add to the available information on mirror self-recognition in large mammals, provide new information on a solitary species, and will be useful for enclosure design and captive animal management.

  14. Analysis of a multi-frequency electromagnetic imaging functional for thin, crack-like electromagnetic inclusions

    OpenAIRE

    Park, Won-Kwang

    2012-01-01

    Recently, a non-iterative multi-frequency subspace migration imaging algorithm was developed based on an asymptotic expansion formula for thin, curve-like electromagnetic inclusions and the structure of singular vectors in the Multi-Static Response (MSR) matrix. The present study examines the structure of subspace migration imaging functional and proposes an improved imaging functional weighted by the frequency. We identify the relationship between the imaging functional and Bessel functions ...

  15. Sealing nuclear graphite with pyrolytic carbon

    International Nuclear Information System (INIS)

    Feng, Shanglei; Xu, Li; Li, Li; Bai, Shuo; Yang, Xinmei; Zhou, Xingtai

    2013-01-01

    Pyrolytic carbon (PyC) coatings were deposited on IG-110 nuclear graphite by thermal decomposition of methane at ∼1830 °C. The PyC coatings are anisotropic and airtight enough to protect IG-110 nuclear graphite against the permeation of molten fluoride salts and the diffusion of gases. The investigations indicate that the sealing nuclear graphite with PyC coating is a promising method for its application in Molten Salt Reactor (MSR)

  16. Improving Night Time Driving Safety Using Vision-Based Classification Techniques.

    Science.gov (United States)

    Chien, Jong-Chih; Chen, Yong-Sheng; Lee, Jiann-Der

    2017-09-24

    The risks involved in nighttime driving include drowsy drivers and dangerous vehicles. Prominent among the more dangerous vehicles around at night are the larger vehicles which are usually moving faster at night on a highway. In addition, the risk level of driving around larger vehicles rises significantly when the driver's attention becomes distracted, even for a short period of time. For the purpose of alerting the driver and elevating his or her safety, in this paper we propose two components for any modern vision-based Advanced Drivers Assistance System (ADAS). These two components work separately for the single purpose of alerting the driver in dangerous situations. The purpose of the first component is to ascertain that the driver would be in a sufficiently wakeful state to receive and process warnings; this is the driver drowsiness detection component. The driver drowsiness detection component uses infrared images of the driver to analyze his eyes' movements using a MSR plus a simple heuristic. This component issues alerts to the driver when the driver's eyes show distraction and are closed for a longer than usual duration. Experimental results show that this component can detect closed eyes with an accuracy of 94.26% on average, which is comparable to previous results using more sophisticated methods. The purpose of the second component is to alert the driver when the driver's vehicle is moving around larger vehicles at dusk or night time. The large vehicle detection component accepts images from a regular video driving recorder as input. A bi-level system of classifiers, which included a novel MSR-enhanced KAZE-base Bag-of-Features classifier, is proposed to avoid false negatives. In both components, we propose an improved version of the Multi-Scale Retinex (MSR) algorithm to augment the contrast of the input. Several experiments were performed to test the effects of the MSR and each classifier, and the results are presented in experimental results section

  17. Coupled neutronics/thermal-hydraulics for analysis of molten salt reactor

    International Nuclear Information System (INIS)

    Guo, Zhangpeng; Zhou, Jianjun; Zhang, Dalin; Chaudri, Khurrum Saleem; Tian, Wenxi; Su, Guanghui; Qiu, Suizheng

    2013-01-01

    Highlights: ► A multiple-channel analysis code (MAC) is developed to be coupled with MCNP. ► 1/8 of core is simulated in MCNP and thermal-hydraulic code. ► The coupling calculation can achieve stable state after a few iterations. ► The coupling calculation results are in reasonable agreement with the analytic solutions of the ORNL. ► Parametric studies of MSR are performed to provide valuable information for future design MSR. -- Abstract: The Generation IV International Forum (GIF) selected molten salt reactor (MSR) among six advanced reactor types. It is characterized by a liquid circulating fuel that also serves as coolant. In this study, a multiple-channel analysis code (MAC) is developed and it is coupled with MCNP4c to analyze the neutronics/thermal-hydraulics behavior of molten salt reactor experiment (MSRE). The MAC calculates thermal-hydraulic parameters, such as temperature distribution, flow distribution and pressure drop. MCNP4c performs the analysis of effective multiplication factor, neutron flux and power distribution. A linkage code is developed to exchange data between MAC and MCNP to implement coupling iteration process until the power convergence is achieved. The coupling calculation can achieve converged solution after a few iterations. The results are in reasonable agreement with the analytic solutions from the ORNL. For further design analysis, parametric studies are performed to provide valuable information for new design of MSR. The effect of inlet temperature, graphite to molten salt volume ratio (G/Ms) from varying channel diameter and different power levels on the effective multiplication factor, neutron flux, graphite lifetime and temperature distribution are discussed in detail

  18. Development of the Flameless Ration Heater for the Meal, Ready-to-Eat

    Science.gov (United States)

    1993-04-01

    DRHD FB FED FTA FDTE FED-STD FPU FSC FY GRAS HDPE HHAR JSR JWG IDPE MANFRDTT MIL-H-44398 MILrR-44398 MORE MRE MRHD MSDS MSR...Bragg, NO Again, the CRH consisted of the ZT Energy Pad and an instruction card , with the MRE meal bag being used as the heating container...pack and assemble MRE menus with the following new items: FRH, pork chow mein, smokey links, sugar free beverage base, potato sticks, chew mein

  19. A Novel Molten Salt Reactor Concept to Implement the Multi-Step Time-Scheduled Transmutation Strategy

    International Nuclear Information System (INIS)

    Csom, Gyula; Feher, Sandor; Szieberthj, Mate

    2002-01-01

    Nowadays the molten salt reactor (MSR) concept seems to revive as one of the most promising systems for the realization of transmutation. In the molten salt reactors and subcritical systems the fuel and material to be transmuted circulate dissolved in some molten salt. The main advantage of this reactor type is the possibility of the continuous feed and reprocessing of the fuel. In the present paper a novel molten salt reactor concept is introduced and its transmutation capabilities are studied. The goal is the development of a transmutation technique along with a device implementing it, which yield higher transmutation efficiencies than that of the known procedures and thus results in radioactive waste whose load on the environment is reduced both in magnitude and time length. The procedure is the multi-step time-scheduled transmutation, in which transformation is done in several consecutive steps of different neutron flux and spectrum. In the new MSR concept, named 'multi-region' MSR (MRMSR), the primary circuit is made up of a few separate loops, in which salt-fuel mixtures of different compositions are circulated. The loop sections constituting the core region are only neutronically and thermally coupled. This new concept makes possible the utilization of the spatial dependence of spectrum as well as the advantageous features of liquid fuel such as the possibility of continuous chemical processing etc. In order to compare a 'conventional' MSR and a proposed MRMSR in terms of efficiency, preliminary calculational results are shown. Further calculations in order to find the optimal implementation of this new concept and to emphasize its other advantageous features are going on. (authors)

  20. Analysis of Dynamic Characteristics of the 21st Century Maritime Silk Road

    Science.gov (United States)

    Zhang, Xudong; Zhang, Jie; Fan, Chenqing; Meng, Junmin; Wang, Jing; Wan, Yong

    2018-06-01

    The 21st century Maritime Silk Road (MSR) proposed by China strongly promotes the maritime industry. In this paper, we use wind and ocean wave datasets from 1979 to 2014 to analyze the spatial and temporal distributions of the wind speed, significant wave height (SWH), mean wave direction (MWD), and mean wave period (MWP) in the MSR. The analysis results indicate that the Luzon Strait and Gulf of Aden have the most obvious seasonal variations and that the central Indian Ocean is relatively stable. We analyzed the distributions of the maximum wind speed and SWH in the MSR over this 36-year period. The results show that the distribution of the monthly average frequency for SWH exceeds 4 m (huge waves) and that of the corresponding wind speed exceeds 13.9 m s-1 (high wind speed). The occurrence frequencies of huge waves and high winds in regions east of the Gulf of Aden are as high as 56% and 80%, respectively. We also assessed the wave and wind energies in different seasons. Based on our analyses, we propose a risk factor (RF) for determining navigation safety levels, based on the wind speed and SWH. We determine the spatial and temporal RF distributions for different seasons and analyze the corresponding impact on four major sea routes. Finally, we determine the spatial distribution of tropical cyclones from 2000 to 2015 and analyze the corresponding impact on the four sea routes. The analysis of the dynamic characteristics of the MSR provides references for ship navigation as well as ocean engineering.

  1. Mesh-Sequenced Realizations for Evaluation of Subgrid-Scale Models for Turbulent Combustion (Short Term Innovative Research Program)

    Science.gov (United States)

    2018-02-15

    conservation equations. The closure problem hinges on the evaluation of the filtered chemical production rates. In MRA/MSR, simultaneous large-eddy... simultaneous , constrained large-eddy simulations at three different mesh levels as a means of connecting reactive scalar information at different...functions of a locally normalized subgrid Damköhler number (a measure of the distribution of inverse chemical time scales in the neighborhood of a

  2. Fast Spectrum Molten Salt Reactor Options

    Energy Technology Data Exchange (ETDEWEB)

    Gehin, Jess C [ORNL; Holcomb, David Eugene [ORNL; Flanagan, George F [ORNL; Patton, Bruce W [ORNL; Howard, Rob L [ORNL; Harrison, Thomas J [ORNL

    2011-07-01

    During 2010, fast-spectrum molten-salt reactors (FS-MSRs) were selected as a transformational reactor concept for light-water reactor (LWR)-derived heavy actinide disposition by the Department of Energy-Nuclear Energy Advanced Reactor Concepts (ARC) program and were the subject of a preliminary scoping investigation. Much of the reactor description information presented in this report derives from the preliminary studies performed for the ARC project. This report, however, has a somewhat broader scope-providing a conceptual overview of the characteristics and design options for FS-MSRs. It does not present in-depth evaluation of any FS-MSR particular characteristic, but instead provides an overview of all of the major reactor system technologies and characteristics, including the technology developments since the end of major molten salt reactor (MSR) development efforts in the 1970s. This report first presents a historical overview of the FS-MSR technology and describes the innovative characteristics of an FS-MSR. Next, it provides an overview of possible reactor configurations. The following design features/options and performance considerations are described including: (1) reactor salt options-both chloride and fluoride salts; (2) the impact of changing the carrier salt and actinide concentration on conversion ratio; (3) the conversion ratio; (4) an overview of the fuel salt chemical processing; (5) potential power cycles and hydrogen production options; and (6) overview of the performance characteristics of FS-MSRs, including general comparative metrics with LWRs. The conceptual-level evaluation includes resource sustainability, proliferation resistance, economics, and safety. The report concludes with a description of the work necessary to begin more detailed evaluation of FS-MSRs as a realistic reactor and fuel cycle option.

  3. Development of plasmid vector and electroporation condition for gene transfer in sporogenic lactic acid bacterium, Bacillus coagulans.

    Science.gov (United States)

    Rhee, Mun Su; Kim, Jin-Woo; Qian, Yilei; Ingram, L O; Shanmugam, K T

    2007-07-01

    Bacillus coagulans is a sporogenic lactic acid bacterium that ferments glucose and xylose, major components of plant biomass, a potential feedstock for cellulosic ethanol. The temperature and pH for optimum rate of growth of B. coagulans (50 to 55 degrees C, pH 5.0) are very similar to that of commercially developed fungal cellulases (50 degrees C; pH 4.8). Due to this match, simultaneous saccharification and fermentation (SSF) of cellulose to products by B. coagulans is expected to require less cellulase than needed if the SSF is conducted at a sub-optimal temperature, such as 30 degrees C, the optimum for yeast, the main biocatalyst used by the ethanol industry. To fully exploit B. coagulans as a platform organism, we have developed an electroporation method to transfer plasmid DNA into this genetically recalcitrant bacterium. We also constructed a B. coagulans/E. coli shuttle vector, plasmid pMSR10 that contains the rep region from a native plasmid (pMSR0) present in B. coagulans strain P4-102B. The native plasmid, pMSR0 (6823bp), has 9 ORFs, and replicates by rolling-circle mode of replication. Plasmid pNW33N, developed for Geobacillus stearothermophilus, was also transformed into this host and stably maintained while several other Bacillus/Escherichia coli shuttle vector plasmids were not transformed into B. coagulans. The transformation efficiency of B. coagulans strain P4-102B using the plasmids pNW33N or pMSR10 was about 1.5x10(16) per mole of DNA. The availability of shuttle vectors and an electroporation method is expected to aid in genetic and metabolic engineering of B. coagulans.

  4. Mechanochemical synthesis and spark plasma sintering of the cerium silicides

    Energy Technology Data Exchange (ETDEWEB)

    Alanko, Gordon A.; Jaques, Brian; Bateman, Allyssa [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Butt, Darryl P., E-mail: darrylbutt@boisestate.edu [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Center for Advanced Energy Studies, 995 University Boulevard, Idaho Falls, ID 83401 (United States)

    2014-12-15

    Highlights: • Ce{sub 5}Si{sub 3}, Ce{sub 3}Si{sub 2}, CeSi, CeSi{sub 2−x} and CeSi{sub 2} were mechanochemically synthesized. • Temperature and pressure were monitored to investigate reaction progress. • All syntheses proceeded through a MSR event followed by rapid solid-state diffusion. • Milling time before MSR correlates well with effective heat of formation. • Some synthesized material was densified by spark plasma sintering. - Abstract: The cerium silicides, Ce{sub 5}Si{sub 3}, Ce{sub 3}Si{sub 2}, CeSi, CeSi{sub 2−y}, and CeSi{sub 2−x}, have been prepared from the elements by mechanochemical processing in a planetary ball mill. Preparation of the cerium silicide Ce{sub 5}Si{sub 4} was unsuccessfully attempted and potential reasons for this are discussed. Temperature and pressure of the milling vial were monitored in situ to gain insight into the mechanochemical reaction kinetics, which include a mechanically-induced self-propagating reaction (MSR). Some prepared powders were consolidated by spark plasma sintering to high density. Starting materials, as-milled powders, and consolidated samples were characterized by X-ray diffraction, scanning electron microscopy, and energy dispersive spectroscopy. The results obtained help elucidate key questions in mechanochemical processing of intermetallics, showing first phase formation similar to thin films, MSR ignition times that are composition- and milling speed-dependent, and sensitivity of stable compound formation on the impact pressure. The results demonstrate mechanochemical synthesis as a viable technique for rare earth silicides.

  5. Hydrogen production by methanol steam reforming carried out in membrane reactor on Cu/Zn/Mg-based catalyst

    NARCIS (Netherlands)

    Basile, A.; Parmaliana, A.; Tosti, S.; Iulianelli, A.; Gallucci, F.; Espro, C.; Spooren, J.

    2008-01-01

    The methanol steam reforming (MSR) reaction was studied by using both a dense Pd-Ag membrane reactor (MR) and a fixed bed reactor (FBR). Both the FBR and the MR were packed with a new catalyst based on CuOAl2O3ZnOMgO, having an upper temperature limit of around 350 °C. A constant sweep gas flow rate

  6. Séquentialisation du comportement des réseaux de Petri temporisés

    Czech Academy of Sciences Publication Activity Database

    Boimond, J.-L.; Komenda, Jan; Lahaye, S.

    2013-01-01

    Roč. 47, 1-3 (2013), s. 139-154 ISSN 1269-6935. [Modélisation des Systèmes Réactifs (MSR) 2013. Rennes, 13.11.2013-15.11.2013] R&D Projects: GA ČR(CZ) GAP103/11/0517 Institutional support: RVO:67985840 Keywords : timed Petri nets * (max,+) automata * race policy Subject RIV: BA - General Mathematics http://jesa.revuesonline.com/article.jsp?articleId=18769

  7. European Conference on Advanced Materials and Processes Held in Aachen, Federal Republic of Germany on November 22-24 1989. Abstracts

    Science.gov (United States)

    1989-11-24

    magnesium alloys were converted to powder by inert gas atomisation and mechnical methods. The alloy used ( AZ91 , MSR, QE21 and ZE63) are a medium...modelling producing loosening of the femoral stem or acetabular cup. It is demonstrated that the interaction between the implant materials and...rather than bone resorption around an implant and offer the prospect of an enhanced prosthesis lifetime. See programme, page 13. HIGH TEMPERATURE MATERIALS

  8. Methylation diet and methyl group genetics in risk for adenomatous polyp occurrence

    Directory of Open Access Journals (Sweden)

    Mark Lucock

    2015-06-01

    Conclusion: A methylation diet influences methyl group synthesis in the regulation of blood homocysteine level, and is modulated by genetic interactions. Methylation-related nutrients also interact with key genes to modify risk of AP, a precursor of colorectal cancer. Independent of diet, two methylation-related genes (A2756G-MS and A66G-MSR were directly associated with AP occurrence.

  9. Multi sensor reanalysis of total ozone

    Directory of Open Access Journals (Sweden)

    R. J. van der A

    2010-11-01

    Full Text Available A single coherent total ozone dataset, called the Multi Sensor Reanalysis (MSR, has been created from all available ozone column data measured by polar orbiting satellites in the near-ultraviolet Huggins band in the last thirty years. Fourteen total ozone satellite retrieval datasets from the instruments TOMS (on the satellites Nimbus-7 and Earth Probe, SBUV (Nimbus-7, NOAA-9, NOAA-11 and NOAA-16, GOME (ERS-2, SCIAMACHY (Envisat, OMI (EOS-Aura, and GOME-2 (Metop-A have been used in the MSR. As first step a bias correction scheme is applied to all satellite observations, based on independent ground-based total ozone data from the World Ozone and Ultraviolet Data Center. The correction is a function of solar zenith angle, viewing angle, time (trend, and effective ozone temperature. As second step data assimilation was applied to create a global dataset of total ozone analyses. The data assimilation method is a sub-optimal implementation of the Kalman filter technique, and is based on a chemical transport model driven by ECMWF meteorological fields. The chemical transport model provides a detailed description of (stratospheric transport and uses parameterisations for gas-phase and ozone hole chemistry. The MSR dataset results from a 30-year data assimilation run with the 14 corrected satellite datasets as input, and is available on a grid of 1× 1 1/2° with a sample frequency of 6 h for the complete time period (1978–2008. The Observation-minus-Analysis (OmA statistics show that the bias of the MSR analyses is less than 1% with an RMS standard deviation of about 2% as compared to the corrected satellite observations used.

  10. Comparisons between different techniques for measuring mass segregation

    Science.gov (United States)

    Parker, Richard J.; Goodwin, Simon P.

    2015-06-01

    We examine the performance of four different methods which are used to measure mass segregation in star-forming regions: the radial variation of the mass function {M}_MF; the minimum spanning tree-based ΛMSR method; the local surface density ΣLDR method; and the ΩGSR technique, which isolates groups of stars and determines whether the most massive star in each group is more centrally concentrated than the average star. All four methods have been proposed in the literature as techniques for quantifying mass segregation, yet they routinely produce contradictory results as they do not all measure the same thing. We apply each method to synthetic star-forming regions to determine when and why they have shortcomings. When a star-forming region is smooth and centrally concentrated, all four methods correctly identify mass segregation when it is present. However, if the region is spatially substructured, the ΩGSR method fails because it arbitrarily defines groups in the hierarchical distribution, and usually discards positional information for many of the most massive stars in the region. We also show that the ΛMSR and ΣLDR methods can sometimes produce apparently contradictory results, because they use different definitions of mass segregation. We conclude that only ΛMSR measures mass segregation in the classical sense (without the need for defining the centre of the region), although ΣLDR does place limits on the amount of previous dynamical evolution in a star-forming region.

  11. Thorium and Molten Salt Reactors: Essential Questions for Classroom Discussions

    Science.gov (United States)

    DiLisi, Gregory A.; Hirsch, Allison; Murray, Meredith; Rarick, Richard

    2018-04-01

    A little-known type of nuclear reactor called the "molten salt reactor" (MSR), in which nuclear fuel is dissolved in a liquid carrier salt, was proposed in the 1940s and developed at the Oak Ridge National Laboratory in the 1960s. Recently, the MSR has generated renewed interest as a remedy for the drawbacks associated with conventional uranium-fueled light-water reactors (LWRs) in use today. Particular attention has been given to the "thorium molten salt reactor" (TMSR), an MSR engineered specifically to use thorium as its fuel. The purpose of this article is to encourage the TPT community to incorporate discussions of MSRs and the thorium fuel cycle into courses such as "Physics and Society" or "Frontiers of Physics." With this in mind, we piloted a pedagogical approach with 27 teachers in which we described the underlying physics of the TMSR and posed five essential questions for classroom discussions. We assumed teachers had some preexisting knowledge of nuclear reactions, but such prior knowledge was not necessary for inclusion in the classroom discussions. Overall, our material was perceived as a real-world example of physics, fit into a standards-based curriculum, and filled a need in the teaching community for providing unbiased references of alternative energy technologies.

  12. Using a standing-tree acoustic tool to identify forest stands for the production of mechanically-graded lumber.

    Science.gov (United States)

    Paradis, Normand; Auty, David; Carter, Peter; Achim, Alexis

    2013-03-12

    This study investigates how the use of a Hitman ST300 acoustic sensor can help identify the best forest stands to be used as supply sources for the production of Machine Stress-Rated (MSR) lumber. Using two piezoelectric sensors, the ST300 measures the velocity of a mechanical wave induced in a standing tree. Measurements were made on 333 black spruce (Picea mariana (Mill.) BSP) trees from the North Shore region, Quebec (Canada) selected across a range of locations and along a chronosequence of elapsed time since the last fire (TSF). Logs were cut from a subsample of 39 trees, and sawn into 77 pieces of 38 mm × 89 mm cross-section before undergoing mechanical testing according to ASTM standard D-4761. A linear regression model was developed to predict the static modulus of elasticity of lumber using tree acoustic velocity and stem diameter at 1.3 m above ground level (R2 = 0.41). Results suggest that, at a regional level, 92% of the black spruce trees meet the requirements of MSR grade 1650Fb-1.5E, whilst 64% and 34% meet the 2100Fb-1.8E and 2400Fb-2.0E, respectively. Mature stands with a TSF < 150 years had 11 and 18% more boards in the latter two categories, respectively, and therefore represented the best supply source for MSR lumber.

  13. Cine MR imaging in mitral valve prolapse; Study on mitral regurgitation and left atrial volume

    Energy Technology Data Exchange (ETDEWEB)

    Kumai, Toshihiko [Chiba Univ. (Japan). School of Medicine

    1993-02-01

    This study was undertaken to assess the ability of cine MR imaging to evaluate the direction, timing, and severity of mitral regurgitation in patients with mitral valve prolapse (MVP). The population of this study was 33 patients with MVP diagnosed by two-dimensional echocardiography and 10 patients with rheumatic mitral valve disease (MSR) for comparison. 7 patients with MVP and 5 with MSR had atrial fibrillation and/or history of congestive heart failure as complications. Mitral regurgitation was graded for severity by color Doppler flow imaging in all patients. Direction and size of systolic flow void in the left atrium were analyzed by contiguous multilevel cine MR images and the maximum volumes of flow void and left atrium were measured. Although flow void was found at the center of the left atrium in most of MSR, it was often directed along the postero-caudal atrial wall in anterior leaflet prolapse and along the anterocranial atrial wall in posterior leaflet prolapse. In MVP, the maximum volume of flow void was often seen in late systole. The maximum volume of flow void and that of left atrium were significantly larger in patients with atrial fibrillation and/or history of congestive heart failure. The length and volume of flow void were increased with clinical severity and degree of regurgitation determined by color Doppler flow imaging. Thus cine MR imaging provides a useful means for detection and semiquantitative evaluation of mitral regurgitation in subjects with MVP. (author).

  14. Physical and chemical feasibility of fueling molten salt reactors with TRU's trifluorides

    International Nuclear Information System (INIS)

    Ignatiev, V.; Feinberg, O.; Konakov, S.; Subbotine, S.; Surenkov, A.; Zakirov, R.

    2001-01-01

    The molten salt reactor (MSR) concept is very important for consideration as an element of future nuclear energy systems. These reactor systems are unique in many ways. Particularly, the MSRs appear to have substantial promise not only as advanced TRU free system operating in U-Th cycle, but also as transmuter of TRU. Physical and chemical feasibility of fueling MSR with TRU trifluorides is examined. Solvent compositions with and without U-Th as fissile / fertile addition are considered. The principle reactor and fuel cycle variables available for optimizing the performance of MSR as TRU transmuting system are discussed. These efforts led to the definition in minimal TRU mass flow rate, reduced total losses to waste and maximum possible burn up rate for the molten salt transmuter. The current status of technology and prospects for revisited interest are summarized. Significant chemical problems are remain to be resolved at the end of prior MSRs programs, notably, graphite life durability, tritium control, fate of noble metal fission products. Questions arising from plutonium and minor actinide fueling include: corrosion and container chemistry, new redox buffer for systems without uranium, analytical chemistry instrumentation, adequate constituent solubilities, suitable fuel processing and waste form development. However these problems appear to be soluble. (author)

  15. A new approach for modeling and analysis of molten salt reactors using SCALE

    Energy Technology Data Exchange (ETDEWEB)

    Powers, J. J.; Harrison, T. J.; Gehin, J. C. [Oak Ridge National Laboratory, PO Box 2008, Oak Ridge, TN 37831-6172 (United States)

    2013-07-01

    The Office of Fuel Cycle Technologies (FCT) of the DOE Office of Nuclear Energy is performing an evaluation and screening of potential fuel cycle options to provide information that can support future research and development decisions based on the more promising fuel cycle options. [1] A comprehensive set of fuel cycle options are put into evaluation groups based on physics and fuel cycle characteristics. Representative options for each group are then evaluated to provide the quantitative information needed to support the valuation of criteria and metrics used for the study. Included in this set of representative options are Molten Salt Reactors (MSRs), the analysis of which requires several capabilities that are not adequately supported by the current version of SCALE or other neutronics depletion software packages (e.g., continuous online feed and removal of materials). A new analysis approach was developed for MSR analysis using SCALE by taking user-specified MSR parameters and performing a series of SCALE/TRITON calculations to determine the resulting equilibrium operating conditions. This paper provides a detailed description of the new analysis approach, including the modeling equations and radiation transport models used. Results for an MSR fuel cycle option of interest are also provided to demonstrate the application to a relevant problem. The current implementation is through a utility code that uses the two-dimensional (2D) TRITON depletion sequence in SCALE 6.1 but could be readily adapted to three-dimensional (3D) TRITON depletion sequences or other versions of SCALE. (authors)

  16. A new approach for modeling and analysis of molten salt reactors using SCALE

    International Nuclear Information System (INIS)

    Powers, J. J.; Harrison, T. J.; Gehin, J. C.

    2013-01-01

    The Office of Fuel Cycle Technologies (FCT) of the DOE Office of Nuclear Energy is performing an evaluation and screening of potential fuel cycle options to provide information that can support future research and development decisions based on the more promising fuel cycle options. [1] A comprehensive set of fuel cycle options are put into evaluation groups based on physics and fuel cycle characteristics. Representative options for each group are then evaluated to provide the quantitative information needed to support the valuation of criteria and metrics used for the study. Included in this set of representative options are Molten Salt Reactors (MSRs), the analysis of which requires several capabilities that are not adequately supported by the current version of SCALE or other neutronics depletion software packages (e.g., continuous online feed and removal of materials). A new analysis approach was developed for MSR analysis using SCALE by taking user-specified MSR parameters and performing a series of SCALE/TRITON calculations to determine the resulting equilibrium operating conditions. This paper provides a detailed description of the new analysis approach, including the modeling equations and radiation transport models used. Results for an MSR fuel cycle option of interest are also provided to demonstrate the application to a relevant problem. The current implementation is through a utility code that uses the two-dimensional (2D) TRITON depletion sequence in SCALE 6.1 but could be readily adapted to three-dimensional (3D) TRITON depletion sequences or other versions of SCALE. (authors)

  17. Reactor physical experimental program EROS in the frame of the molten salt applying reactor concepts development

    International Nuclear Information System (INIS)

    Hron, Miloslav; Kyncl, Jan; Mikisek, Miroslav

    2009-01-01

    After the relatively broad program of experimental activities, which have been involved in the complex R and D program for the Molten Salt Reactor (MSR) - SPHINX (SPent Hot fuel Incinerator by Neutron fluX) concept development in the Czech Republic, there has been a next stage (namely large-scale experimental verification of design inputs by use of MSR-type inserted zones into the existing light water moderated experimental reactor LR-0 called EROS project) started, which will be focused to the experimental verification of the rector physical or neutronic properties of other types of reactor concepts applying molten salts in the role of liquid fuel and/or coolant. This tendency is based on the recently accepted decision of the MSR SSC of GIF to consider for further period of its activity two baseline concepts- fast neutron molten salt reactor non-moderated (FMSR-NM) as a long-term alternative to solid fuelled fast neutron reactors and simultaneously, advanced high temperature reactor (AHTR) with pebble bed type solid fuel cooled by liquid salts. There will be a brief description of the prepared and performed experimental programs in these directions (as well as the preliminary results obtained so far) introduced in the paper. (author)

  18. A novel cooperative localization algorithm using enhanced particle filter technique in maritime search and rescue wireless sensor network.

    Science.gov (United States)

    Wu, Huafeng; Mei, Xiaojun; Chen, Xinqiang; Li, Junjun; Wang, Jun; Mohapatra, Prasant

    2018-07-01

    Maritime search and rescue (MSR) play a significant role in Safety of Life at Sea (SOLAS). However, it suffers from scenarios that the measurement information is inaccurate due to wave shadow effect when utilizing wireless Sensor Network (WSN) technology in MSR. In this paper, we develop a Novel Cooperative Localization Algorithm (NCLA) in MSR by using an enhanced particle filter method to reduce measurement errors on observation model caused by wave shadow effect. First, we take into account the mobility of nodes at sea to develop a motion model-Lagrangian model. Furthermore, we introduce both state model and observation model to constitute a system model for particle filter (PF). To address the impact of the wave shadow effect on the observation model, we develop an optimal parameter derived by Kullback-Leibler divergence (KLD) to mitigate the error. After the optimal parameter is acquired, an improved likelihood function is presented. Finally, the estimated position is acquired. Copyright © 2017 ISA. Published by Elsevier Ltd. All rights reserved.

  19. Mercury Sorption onto Malt Spent Rootlets

    Science.gov (United States)

    Manariotis, I. D.; Anagnostopoulos, V.; Karapanagioti, H. K.; Chrysikopoulos, C.

    2011-12-01

    Mercury is a metal of particular concern due to its toxicity even at relatively low concentrations. The maximum permissible level for mercury in drinking water set by the European Union is 0.001 mg/L. Mercury is released into the environment via four principal pathways: (1) natural processes; i.e. a volcanic eruption, (2) incidental to some other activity; i.e. coal burning power plants, (3) accidentally during the manufacture, breakage or disposal of products that have mercury put into them deliberately, and (4) direct use in industrial settings. The present study focuses on the removal of mercury (II) from aqueous solutions via sorption onto Malt Spent Rootlets (MSR). Batch experiments were conducted employing MSR with size ranging from 0.18 to 1 mm. The effects of pH, mercury concentration, contact time, and solid to liquid ratio on mercury sorption onto MSR were investigated. The highest mercury removal from the aqueous phase, of 41%, was observed at pH of 5.

  20. Molten Salt Reactor in the Overview and Perspective of Technological Assessment

    International Nuclear Information System (INIS)

    Julia Abdul Karim; Khaironie Md Takip; Muhammad Khairul Arif Mustafa; Mohd Hairie Rabir; Lanyau, T.; Tom, P.P.

    2016-01-01

    Full text: A Molten Salt Reactor (MSR) is unique in its characteristics that offer safer operation, deliver efficient power output that can assure in the sustainable energy production without CO_2 emissions. Several concepts of this kind of reactor have been proposed by stake holder with different design and configuration and up to date they are exasperating to obtain an optimum workable solution to the fuel salt composition in the foresee of neutronic properties, operating temperature, actinide and fission products solubility, chemical control and processing, materials compatibility and handling of waste. Hence, these key issues are wide open as the potential Research and Development in the specific areas of studies. In addition to that, concern arise in the viewpoint of socioeconomic, politics, public acceptance, safety and security, proven technology, proliferation resistance and physical protection that also need to give special attention in problem solving. The worldwide collaboration through Gen IV International Forum has discussed the potential of MSR and addresses on the issues globally. Recently, Malaysia has taken an initiative aiming to participate in MSR studies due to its potential as an energy source using thorium. Therefore, this paper is focusing on the technology assessment for Thorium-breeding Molten Salt Reactor (TMSR) especially on the ability of utilizing thorium as fuel. This assessment also will help to enhance the understanding of thorium beneficiation to cater for the energy demand. (author)

  1. Development of a three dimension multi-physics code for molten salt fast reactor

    International Nuclear Information System (INIS)

    Cheng Maosong; Dai Zhimin

    2014-01-01

    Molten Salt Reactor (MSR) was selected as one of the six innovative nuclear reactors by the Generation IV International Forum (GIF). The circulating-fuel in the can-type molten salt fast reactor makes the neutronics and thermo-hydraulics of the reactor strongly coupled and different from that of traditional solid-fuel reactors. In the present paper: a new coupling model is presented that physically describes the inherent relations between the neutron flux, the delayed neutron precursor, the heat transfer and the turbulent flow. Based on the model, integrating nuclear data processing, CAD modeling, structured and unstructured mesh technology, data analysis and visualization application, a three dimension steady state simulation code system (MSR3DS) for the can-type molten salt fast reactor is developed and validated. In order to demonstrate the ability of the code, the three dimension distributions of the velocity, the neutron flux, the delayed neutron precursor and the temperature were obtained for the simplified MOlten Salt Advanced Reactor Transmuter (MOSART) using this code. The results indicate that the MSR3DS code can provide a feasible description of multi-physical coupling phenomena in can-type molten salt fast reactor. Furthermore, the code can well predict the flow effect of fuel salt and the transport effect of the turbulent diffusion. (authors)

  2. Prospect on Desalination and Other Non-Electric Applications of Nuclear Energy In Indonesia

    Directory of Open Access Journals (Sweden)

    G.R. Sunaryo

    2007-01-01

    Full Text Available Molten-Salt Reactor (MSR is a design of an advanced reactor system from the GEN IV family working in thermal or epithermal neutron spectrum and using thorium or transuranium fuel in the form of molten fluorides. It is based on the experience with the development of the molten-salt reactor technology in the Oak-Ridge National Laboratory in the United States. The MSR fuel cycle with integrated reprocessing represents one of the potential ways both for significant decrease of total amount of radioactive wastes for final deposition and for utilization of nuclear energy for electricity and heat production as effectively as possible. There are two pyrochemical reprocessing techniques studied in NRI Rez plc which are considered to be applied both for reprocessing of already existing spent fuel and for preparation and „on-line“ reprocessing of MSR fuel: (i the Fluoride Volatility Method (FVM, which performs chemical conversion of spent thermal oxide fuel components into fluorides and their consequent separation by means of their different volatility, thermal stability and chemical affinity to various sorbents; and (ii electrochemical separation of the actinides (Ans and fission products (FP, represented mainly by lanthanides (Lns, from each other by electrolytic deposition method on solid cathode in molten fluoride media.

  3. Molten Salt Breeder Reactor Analysis Methods

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jinsu; Jeong, Yongjin; Lee, Deokjung [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2015-05-15

    Utilizing the uranium-thorium fuel cycle shows considerable potential for the possibility of MSR. The concept of MSBR should be revised because of molten salt reactor's advantage such as outstanding neutron economy, possibility of continuous online reprocessing and refueling, a high level of inherent safety, and economic benefit by keeping off the fuel fabrication process. For the development of MSR research, this paper provides the MSBR single-cell, two-cell and whole core model for computer code input, and several calculation results including depletion calculation of each models. The calculations are carried out by using MCNP6, a Monte Carlo computer code, which has CINDER90 for depletion calculation using ENDF-VII nuclear data. From the calculation results of various reactor design parameters, the temperature coefficients are all negative at the initial state and MTC becomes positive at the equilibrium state. From the results of core rod worth, the graphite control rod alone cannot makes the core subcritical at initial state. But the equilibrium state, the core can be made subcritical state only by graphite control rods. Through the comparison of the results of each models, the two-cell method can represent the MSBR core model more accurately with a little more computational resources than the single-cell method. Many of the thermal spectrum MSR have adopted a multi-region single-fluid strategy.

  4. Cine MR imaging in mitral valve prolapse

    International Nuclear Information System (INIS)

    Kumai, Toshihiko

    1993-01-01

    This study was undertaken to assess the ability of cine MR imaging to evaluate the direction, timing, and severity of mitral regurgitation in patients with mitral valve prolapse (MVP). The population of this study was 33 patients with MVP diagnosed by two-dimensional echocardiography and 10 patients with rheumatic mitral valve disease (MSR) for comparison. 7 patients with MVP and 5 with MSR had atrial fibrillation and/or history of congestive heart failure as complications. Mitral regurgitation was graded for severity by color Doppler flow imaging in all patients. Direction and size of systolic flow void in the left atrium were analyzed by contiguous multilevel cine MR images and the maximum volumes of flow void and left atrium were measured. Although flow void was found at the center of the left atrium in most of MSR, it was often directed along the postero-caudal atrial wall in anterior leaflet prolapse and along the anterocranial atrial wall in posterior leaflet prolapse. In MVP, the maximum volume of flow void was often seen in late systole. The maximum volume of flow void and that of left atrium were significantly larger in patients with atrial fibrillation and/or history of congestive heart failure. The length and volume of flow void were increased with clinical severity and degree of regurgitation determined by color Doppler flow imaging. Thus cine MR imaging provides a useful means for detection and semiquantitative evaluation of mitral regurgitation in subjects with MVP. (author)

  5. The Opera Instrument: An Advanced Curation Development for Mars Sample Return Organic Contamination Monitoring

    Science.gov (United States)

    Fries, M. D.; Fries, W. D.; McCubbin, F. M.; Zeigler, R. A.

    2018-01-01

    Mars Sample Return (MSR) requires strict organic contamination control (CC) and contamination knowledge (CK) as outlined by the Mars 2020 Organic Contamination Panel (OCP). This includes a need to monitor surficial organic contamination to a ng/sq. cm sensitivity level. Archiving and maintaining this degree of surface cleanliness may be difficult but has been achieved. MSR's CK effort will be very important because all returned samples will be studied thoroughly and in minute detail. Consequently, accurate CK must be collected and characterized to best interpret scientific results from the returned samples. The CK data are not only required to make accurate measurements and interpretations for carbon-depleted martian samples, but also to strengthen the validity of science investigations performed on the samples. The Opera instrument prototype is intended to fulfill a CC/CK role in the assembly, cleaning, and overall contamination history of hardware used in the MSR effort, from initial hardware assembly through post-flight sample curation. Opera is intended to monitor particulate and organic contamination using quartz crystal microbalances (QCMs), in a self-contained portable package that is cleanroom-compliant. The Opera prototype is in initial development capable of approximately 100 ng/sq. cm organic contamination sensitivity, with additional development planned to achieve 1 ng/sq. cm. The Opera prototype was funded by the 2017 NASA Johnson Space Center Innovation Charge Account (ICA), which provides funding for small, short-term projects.

  6. Molten salts as possible fuel fluids for TRU fuelled systems: ISTC no. 1606 approach

    International Nuclear Information System (INIS)

    Ignatiev, V.; Zakirov, R.; Grebenkine, K.

    2001-01-01

    The principle attraction of the molten salt reactor (MSR) technology is the use of fuel/fertile material flexibility (easy of fuel preparation and processing) for gaining additional profits as compared with solid materials. This approach presents important departures from traditional philosophy, applied in current nuclear power plants, and to some extent contradicts the straightforward interpretation of the defence-in-depth principal. Nevertheless we understand there may be potential to use MSR technology to support back end fuel cycle technologies in future commercial environment. The paper aims at reviewing results of the work performed in Russia, relevant to the problems of MSR technology development. Also this contribution aims at evaluation of remaining uncertainties for molten salt burner concept implementation. Fuel properties and behaviour, container materials, and clean-up of fuels with emphasis on experiments will be of priority. Recommendations are made regarding the types of experimental studies needed on a way to implement molten salt technology to the back-end of the fuel cycle. To better understand the potential and limitations of the molten salts as a fuel for reactor of incinerator type, Russian Institutes have submitted to the ISTC the Task no. 1606 Experimental Study of Molten Salt Technology for Safe and Low Waste Treatment of Plutonium and Minor Actinides in Accelerator Driven and Critical Systems. The project goals, technical approach and expected specific results are discussed. (author)

  7. Multiple Smaller Missions as a Direct Pathway to Mars Sample Return

    Science.gov (United States)

    Niles, P. B.; Draper, D. S.; Evans, C. A.; Gibson, E. K.; Graham, L. D.; Jones, J. H.; Lederer, S. M.; Ming, D.; Seaman, C. H.; Archer, P. D.; hide

    2012-01-01

    Recent discoveries by the Mars Exploration Rovers, Mars Express, Mars Odyssey, and Mars Reconnaissance Orbiter spacecraft include multiple, tantalizing astrobiological targets representing both past and present environments on Mars. The most desirable path to Mars Sample Return (MSR) would be to collect and return samples from that site which provides the clearest examples of the variety of rock types considered a high priority for sample return (pristine igneous, sedimentary, and hydrothermal). Here we propose an MSR architecture in which the next steps (potentially launched in 2018) would entail a series of smaller missions, including caching, to multiple landing sites to verify the presence of high priority sample return targets through in situ analyses. This alternative architecture to one flagship-class sample caching mission to a single site would preserve a direct path to MSR as stipulated by the Planetary Decadal Survey, while permitting investigation of diverse deposit types and providing comparison of the site of returned samples to other aqueous environments on early Mars

  8. An Internationally Coordinated Science Management Plan for Samples Returned from Mars

    Science.gov (United States)

    Haltigin, T.; Smith, C. L.

    2015-12-01

    Mars Sample Return (MSR) remains a high priority of the planetary exploration community. Such an effort will undoubtedly be too large for any individual agency to conduct itself, and thus will require extensive global cooperation. To help prepare for an eventual MSR campaign, the International Mars Exploration Working Group (IMEWG) chartered the international Mars Architecture for the Return of Samples (iMARS) Phase II working group in 2014, consisting of representatives from 17 countries and agencies. The overarching task of the team was to provide recommendations for progressing towards campaign implementation, including a proposed science management plan. Building upon the iMARS Phase I (2008) outcomes, the Phase II team proposed the development of an International MSR Science Institute as part of the campaign governance, centering its deliberations around four themes: Organization: including an organizational structure for the Institute that outlines roles and responsibilities of key members and describes sample return facility requirements; Management: presenting issues surrounding scientific leadership, defining guidelines and assumptions for Institute membership, and proposing a possible funding model; Operations & Data: outlining a science implementation plan that details the preliminary sample examination flow, sample allocation process, and data policies; and Curation: introducing a sample curation plan that comprises sample tracking and routing procedures, sample sterilization considerations, and long-term archiving recommendations. This work presents a summary of the group's activities, findings, and recommendations, highlighting the role of international coordination in managing the returned samples.

  9. Depth-based human activity recognition: A comparative perspective study on feature extraction

    Directory of Open Access Journals (Sweden)

    Heba Hamdy Ali

    2018-06-01

    Full Text Available Depth Maps-based Human Activity Recognition is the process of categorizing depth sequences with a particular activity. In this problem, some applications represent robust solutions in domains such as surveillance system, computer vision applications, and video retrieval systems. The task is challenging due to variations inside one class and distinguishes between activities of various classes and video recording settings. In this study, we introduce a detailed study of current advances in the depth maps-based image representations and feature extraction process. Moreover, we discuss the state of art datasets and subsequent classification procedure. Also, a comparative study of some of the more popular depth-map approaches has provided in greater detail. The proposed methods are evaluated on three depth-based datasets “MSR Action 3D”, “MSR Hand Gesture”, and “MSR Daily Activity 3D”. Experimental results achieved 100%, 95.83%, and 96.55% respectively. While combining depth and color features on “RGBD-HuDaAct” Dataset, achieved 89.1%. Keywords: Activity recognition, Depth, Feature extraction, Video, Human body detection, Hand gesture

  10. Thermodynamic characterization of salt components for the Molten Salt Reactor Fuel - 15573

    International Nuclear Information System (INIS)

    Capelli, E.; Konings, R.J.M.; Benes, A.

    2015-01-01

    Molten fluoride salts are considered as primary candidates for nuclear fuel in the Molten Salt Reactor (MSR), one of the 6 generation IV nuclear reactor designs. In order to determine the safety limits and to access the properties of the potential fuel mixtures, thermodynamic studies are very important. This study is a combination of experimental work and thermodynamic modelling and focusses on the fluoride systems with alkaline and alkaline earth fluorides as matrix and ThF 4 , UF 4 and PuF 3 as fertile and fissile materials. The purification of the single components was considered as essential first step for the study of more complex systems and ternary phase diagrams were described using Differential Scanning Calorimetry (DSC) and drop calorimetry, which are used to measure phase transitions, enthalpy of mixing and heat capacity. In addition to the calorimetric techniques, Knudsen Effusion Mass Spectrometry (KEMS) and X-ray Diffraction (XRD) were used to collect data on vapour pressure and crystal structure of fluorides. The results are then coupled with thermodynamic modelling using the Calphad method for the assessment of the phase diagrams. A thermodynamic database describing the most important systems for MSR application has been developed and it has been used to optimize the fuel composition in view of the relevant properties such as melting temperature. A reliable database of thermodynamic properties of fluoride salts has been generated. It includes the key systems for the MSR fuel and it is very useful to predict the properties of the fuel

  11. Mars Sample Return: Do Australians trust NASA?

    Science.gov (United States)

    Joyce, S.; Tomkins, C. S.; Weinstein, P.

    2008-09-01

    Mars Sample Return (MSR) represents an important scientific goal in space exploration. Any sample return mission will be extremely challenging from a scientific, economic and technical standpoint. But equally testing, will be communicating with a public that may have a very different perception of the mission. A MSR mission will generate international publicity and it is vital that NASA acknowledge the nature and extent of public concern about the mission risks and, perhaps equally importantly, the public’s confidence in NASA’s ability to prepare for and manage these risks. This study investigated the level of trust in NASA in an Australian population sample, and whether this trust was dependent on demographic variables. Participants completed an online survey that explored their attitudes towards NASA and a MSR mission. The results suggested that people believe NASA will complete the mission successfully but have doubts as to whether NASA will be honest when communicating with the public. The most significant finding to emerge from this study was that confidence in NASA was significantly (p communication.

  12. Transient response of small molten salt reactor at duct blockage accident

    International Nuclear Information System (INIS)

    Yamamoto, Takahisa; Mitachi, Koshi; Ikeuchi, Koji; Suzuki, Takashi

    2005-01-01

    This paper performed transient core analysis of a small Molten Salt Reactor (MSR) at the time of a duct blockage accident. The numerical model employed in this study consists of continuity and momentum conservation equations for fuel salt flow, two group diffusion equations for fast and thermal neutron fluxes, balance equations for six-group delayed neutron precursors and energy conservation equations for fuel salt and graphite moderator. The analysis shows that (1) the effective multiplication factor and reactor power after the blockage accident hardly change because of the self-control performance of the MSR, (2) fuel salt and graphite moderator temperatures rise at the blockage point and its vicinity, drastically but locally, (3) the highest temperature after the blockage accident is 1 363 K, very lower than the boiling point of fuel salt and melt point of reactor vessel, (4) fast and thermal neutron fluxes distributions after the blockage accident hardly change, and (5) delayed neutron precursors accumulate at the blockage point, especially 1st delayed neutron precursor due to is large decay constant. These results lead that the safety of MSR is assured in the blockage accident. (author)

  13. Simulation tools and new developments of the molten salt fast reactor

    International Nuclear Information System (INIS)

    Merle-Lucotte, E.; Doligez, X.; Heuer, D.; Allibert, M.; Ghetta, V.

    2010-01-01

    Starting from the Molten Salt Breeder Reactor project of Oak-Ridge, we have performed parametric studies in terms of safety coefficients, reprocessing requirements and breeding capabilities. In the frame of this major re-evaluation of the molten salt reactor (MSR), we have developed a new concept called Molten Salt Fast Reactor or MSFR, based on the Thorium fuel cycle and a fast neutron spectrum. This concept has been selected for further studies by the MSR steering committee of the Generation IV International Forum in 2009. Our reactor's studies of the MSFR concept rely on numerical simulations making use of the MCNP neutron transport code coupled with a code for materials evolution which resolves the Bateman's equations giving the population of each nucleus inside each part of the reactor at each moment. Because of MSR's fundamental characteristics compared to classical solid-fuelled reactors, the classical Bateman equations have to be modified by adding two terms representing the reprocessing capacities and the fertile or fissile alimentation. We have thus coupled neutronic and reprocessing simulation codes in a numerical tool used to calculate the extraction efficiencies of fission products, their location in the whole system (reactor and reprocessing unit) and radioprotection issues. (authors)

  14. Estimating rates of decompression from textures of erupted ash particles produced by 1999-2006 eruptions of Tungurahua volcano, Ecuador

    Science.gov (United States)

    Wright, Heather M.N.; Cashman, Katharine V.; Mothes, Patricia A.; Hall, Minard L.; Ruiz, Andrés Gorki; Le Pennec, Jean-Luc

    2012-01-01

    Persistent low- to moderate-level eruptive activity of andesitic volcanoes is difficult to monitor because small changes in magma supply rates may cause abrupt transitions in eruptive style. As direct measurement of magma supply is not possible, robust techniques for indirect measurements must be developed. Here we demonstrate that crystal textures of ash particles from 1999 to 2006 Vulcanian and Strombolian eruptions of Tungurahua volcano, Ecuador, provide quantitative information about the dynamics of magma ascent and eruption that is difficult to obtain from other monitoring approaches. We show that the crystallinity of erupted ash particles is controlled by the magma supply rate (MSR); ash erupted during periods of high magma supply is substantially less crystalline than during periods of low magma supply. This correlation is most easily explained by efficient degassing at very low pressures (<<50 MPa) and degassing-driven crystallization controlled by the time available prior to eruption. Our data also suggest that the observed transition from intermittent Vulcanian explosions at low MSR to more continuous periods of Strombolian eruptions and lava fountains at high MSR can be explained by the rise of bubbles through (Strombolian) or trapping of bubbles beneath (Vulcanian) vent-capping, variably viscous (and crystalline) magma.

  15. Motores sincrónicos de reluctancia controlados con variadores de frecuencia: una aplicación para ahorrar energía ;Synchronous reluctance motors controlled by variable frequency converters: an application to save energy

    Directory of Open Access Journals (Sweden)

    Percy Rafael Viego Felipe

    2015-04-01

    Full Text Available Se presenta un estudio sobre aplicaciones de los motores sincrónicos de reluctancia (MSR controlados por accionamientos de frecuencia variable (AFV, que posibilitan el ahorro de energía. Se realizó una comparación entre las características constructivas de los MSR y los motores asincrónicos de jaula (MA, evaluando las ventajas y limitaciones que aquellos presentan. Una ventaja notable del MSR es que las pérdidas en el rotor se eliminan prácticamente. Una comparación experimental evidenció que para igual momento, el MSR presenta una mayor eficiencia; y que para igual incremento de temperatura, con las mismas dimensiones IEC, se logra más potencia. Por comparaciones entre datos de un fabricante, se demostró las ventajas de utilizar, con el mismo AFV y para cargas centrífugas, un MSR de mayor clase de eficiencia que la de un MA. Un análisis económico con técnicas de descuento, evidenció una atractiva recuperación de la inversión cuando se opera todo el año. A study on applications of synchronous reluctance motor (SynRM controlled by variable frequency drives (VFD for energy saving is presented. A comparison between the basic construction elements of the SynRM and the squirrel cage induction motor (IM is carried out, evaluating advantages and disadvantages. A nearly complete elimination of rotor losses is a significant asset of the SynRM. An experimental comparison showed that at the same torque, the SynRM presents a higher efficiency than the IM; and that at the same temperature rise, more power is obtained with the same IEC frame for both motor types. Comparing data from a manufacturer, the advantages of using, with the same VFD and for centrifugal loads, a higher efficiency class SynRM than that of a lower efficiency IM was demonstrated. An economical study using discount techniques, made evident an attractive pay back when operating all year around.

  16. Characters of neutron noise in full-size molten salt reactor

    International Nuclear Information System (INIS)

    Wang, Jiangmeng; Cao, Xinrong

    2015-01-01

    Highlights: • The larger system size makes full-size MSR deviate from point kinetic behavior. • The increasing velocity has non-monotonic effect on the effective delayed neutron fraction. • The amplitude of Green’s function at low frequencies is inversely proportional to the effective delayed neutron fraction. • The range of plateau region is smaller due to the more prominent point kinetic effect. - Abstract: In the present paper, the frequency-dependent and space-dependent behavior of the neutron noise in a full-size Molten Salt Reactor (MSR) is investigated. The theoretical models considering the fuel circulation are established based on one-group neutron diffusion theory. Green’s function of the neutron noise induced by a propagating perturbation is introduced with linear noise theory, due to the small perturbation. The equations are numerically calculated by developing a code, in which the eigenfunction expansion method is adopted. The static results show that the effective delayed neutron fraction changes non-monotonically with the increasing fuel velocity. In the dynamic case, the results are compared to those obtained in 1D MSR and a traditional reactor, in order to figure out the effects of both the fuel circulation and the system size. It is found that there is no difference in 1D and 3D MSR systems from the view of fuel circulation, i.e., the fuel circulation enhances the spatial neutronic coupling and leads to the stronger point kinetic effect. The more prominent space-dependent effect founded in 3D traditional reactors is also observed in the MSR, due to the looser neutronic coupling and the unique singularity of Green’s function in the location of the perturbation. Another interesting finding is that Green’s function for low frequencies changes non-monotonically with increasing velocity. The largest magnitude of Green’s function is observed at the velocity where the effective delayed neutron fraction reaches its minimum. Finally, the

  17. Produção de matéria seca da braquiária de acordo com os atributos químicos de um Latossolo em Selvíria, Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Rafael Montanari

    2013-08-01

    Full Text Available Forrageiras rústicas, como as braquiárias, são predominantes na região do Cerrado, no sistema de pecuária extensiva, que favorece a degradação do solo. Entretanto, com o tempo, nem mesmo essas forrageiras conseguem bom desenvolvimento nessas áreas. O objetivo deste trabalho foi analisar a variabilidade dos atributos estudados da planta e do solo; definir as correlações lineares e espaciais entre a produtividade do capim-braquiária com os atributos químicos do solo pesquisado, e pesquisar, dentre os atributos químicos do solo, aquele que melhor se apresente para explicar a variabilidade da produtividade dessa forrageira. A pesquisa foi desenvolvida em uma área manejada com pastagem há 30 anos, na Fazenda de Ensino, Pesquisa e Extensão (FEPE da Faculdade de Engenharia de Ilha Solteira - UNESP, em Selvíria - MS. Foi instalada a malha geoestatística num Latossolo Vermelho aluminoférrico, para a coleta de dados do solo e da planta, contendo 121 pontos amostrais, constituídos de 11 transeções, com 160 m de largura, na direção dos eixos cartesianos. A produção de massa de matéria seca de capim-braquiária foi baixa, apresentando alta variação. Os atributos MSr, N, PB, MO1, MO2, pHa1, pHa2, pHk1 e pHk2 não variaram aleatoriamente e apresentaram variabilidade dos dados entre baixa e alta, e seguiram padrões espaciais bem definidos, com alcances entre 17,7 e 162,9 m. Houve correlação linear significativa a 1% entre a MSr e o N, e entre MSr e a PB. A existência dos semivariogramas cruzados MSr=f(N e MSr=f(PB atestou que essa matéria seca pode ser estimada a partir dos dados do teor de nitrogênio foliar e proteína bruta dessa forrageira.

  18. Resorption of maxillary incisors after orthodontic treatment--clinical study of risk factors.

    Science.gov (United States)

    Elhaddaoui, Rajae; Benyahia, Hicham; Azeroual, Mohamed-Faouzi; Zaoui, Fatima; Razine, Rachid; Bahije, Loubna

    2016-03-01

    External apical root resorption (EARR) is one of the major problems associated with orthodontic treatment. Such lesions represent an iatrogenic risk that must be detected as early as possible, with regular radiological follow-up and appropriate therapeutic precautions. The causes and mechanisms leading to susceptibility to root resorption following the application of an orthodontic force are often not clear and are generally said to be of multifactorial origin. The aim of this clinical study was to analyze the factors linked to the occurrence of moderate to severe resorption (MSR) of upper incisors during orthodontic treatment in a group of Moroccan patients treated in the Dento-Facial Orthopedic Department of the Dental Consultation and Treatment Center (Centre de consultation et de traitements dentaires [CCTD]) in Rabat. A total of 82 patients (28% males, 72% females) aged between 12 and 27, with various malocclusions, who had been treated with fixed appliances for at least 1 year and for whom panoramic X-rays at the start, during and at the end of treatment were available, were selected randomly. The reduction in maxillary incisor root length was evaluated using resorption scores. The factors studied in relation to the risk of occurrence of MSR were: age, sex, treatment duration, extraction or non-extraction, type of malocclusion (Class I arch-length discrepancy, Class II, Class III), the vertical diagnosis (normal, supraocclusion, open bite), presence of dysfunction, impacted canines and root morphology. Statistical analysis was performed using SPSS software, version 18.0. Statistical tests used were: Kaplan-Meier analysis and the univariate and multivariate Cox models for the study of factors associated with MSR. The threshold of significance adopted was 0.05. The factors that were significantly associated with the occurrence of MSR at the level of the upper incisors were: tooth type, with a greater risk for the lateral incisor (HR=3.2 95% CI [2.3-4.5] Proot

  19. EFECTO DE FECHA Y TIPO DE PODA EN FRAMBUESA ROJA 'Malling autumn Bliss'

    Directory of Open Access Journals (Sweden)

    R. Á. Parra-Quezada

    2007-01-01

    Full Text Available Se estudiaron fechas de poda al ras del suelo y despuntes en frambuesa roja 'Malling autumn Bliss', en Guerrero, Chihuahua, con el objetivo de conocer los efectos en el crecimiento de los tallos nuevos, periodo de cosecha, rendimiento y calidad de fruta. Se utilizaron plantas de un año de edad y durante el 2001 se realizaron podas al ras del suelo el 15 de marzo, 15 de abril y 15 de mayo, así como poda de despunte el 15 de marzo del mismo año y el testigo sin despuntar y sin poda. En el 2002 se evaluaron podas al ras el 15 de marzo, 15 de abril y el 15 de mayo. En ambos años se utilizaron cuatro repeticiones y unidades experimentales de dos metros de longitud. El distanciamiento entre hileras fue de 1.5 m y se formaron setos de 60 cm de ancho. Antes de la plantación (abril del 2000, el terreno se barbechó y se incorporaron con rastra entre los 10 y 15 cm de profundidad 60 ton·ha-1 de estiércol bovino seco como única fuente nutrimental al cultivo. El sistema de riego fue por goteo superficial, con goteros cada metro. La poda al ras del 15 de abril presentó el mayor rendimiento con 7.4 y 5.0 t·ha-1 en el 2001 y 2002, respectivamente. La poda al ras el 15 de mayo retrasa la fecha de floración y la cosecha en ambos años. La floración de frambuesa evade las heladas tardías. La producción se concentró de agosto a octubre. El número de nuevos tallos por metro lineal fue superior en la poda al ras del 15 de abril. Los frutos de mayor tamaño se produjeron en la poda al ras del 15 de marzo y el 15 de abril y va de 1.8 a 3.6 g por fruto. Se observa una tendencia de disminución de rendimiento conforme pasan los años de producción.

  20. Carcinoma de Colón en recto en menores de 40 años

    Directory of Open Access Journals (Sweden)

    Carlos Mario Salinas Q.

    1990-03-01

    Full Text Available Entre abril de 1986 y abril de 1988 se estudiaron prospectivamente 21 pacientes menores de 40 años, con diagnóstico de cáncer de colon y recto; provinieron de la Consulta Externa del Hospital Universitario San Vicente de Paúl, del Hospital Pablo Tobón Uribe y de consultorios privados. A cada paciente se le investigaron los antecedentes
    personales y familiares; los síntomas y signos de presentación de la enfermedad; la localización segmentaria de las lesiones; el tipo de carcinoma; el estadio tumoral y la sobrevida; se hizo revisión cada
    tres meses.

  1. Distribución geográfica de Scinax nasica (Cope, 1862 (Anura: Hylidae

    Directory of Open Access Journals (Sweden)

    Rozzi Giménez, Cristina

    2000-11-01

    Full Text Available República Argentina, Provincia de Córdoba, Dpto. Unión, Alto Alegre (32º 22' S- 62º 53' W, 14 ejemplares colectados por Cristina Rozzi Giménez y Fernando Gallego entre abril de 1998 y abril de 2000. Depositados en la Colección de Zoología de Vertebrados, Universidad Nacional de Río Cuarto, Río Cuarto, Argentina, números ZVUNRC: 4353, 4354, 4356, 4390, 4411, 4655, 4756, 5123, 6136, 6216, 6217, 6466, 6762, 7118. Dpto. General San Martín, Villa María (32º 25' S y 63º 15' W, un ejemplar, número ZVUNRC: 4329 de la misma especie.

  2. Factores de riesgo asociados a hábitos bucales deformantes en niños de 5 a 11 años. Policlínica “René Vallejo Ortiz”: Manzanillo. 2004 - 2005

    OpenAIRE

    Reyes Romagosa, Daniel Enrique; Rosales Rosales, Katiuska; Roselló Salcedo, Olga; García Arias, Dasha María

    2007-01-01

    RESUMEN Se  realizó un estudio de tipo caso control  de niños afectados por hábitos bucales  deformantes de la  Policlínica III “Rene Vallejo Ortiz”  de  Manzanillo en el periodo comprendido entre abril  del 2004 y abril  del 2005, con el objetivo de identificar los factores de riesgo asociados a esos hábitos bucales deformantes. Del total de niños de 5 a 11 años del área se seleccionaron 180 niños, 60 niños con hábitos bucales deformantes  que se examinaron en consulta y se les realizó una e...

  3. Las tasas máximas de interés convencional y el delito de usura en nuestro país, luego de la vigencia de la Ley 17.569

    Directory of Open Access Journals (Sweden)

    Teresita Mercader

    2014-10-01

    Full Text Available Contenido: Introducción. Indicación sumaria de las pautas diferenciales entre el Decreto - Ley 14.887 de 27 de abril de 1979 y la Ley 17.569 de 22 de octubre de 2002. La coexistencia de ambas leyes.La obligación dineraria. Ley 5.180 de 24 de diciembre de 1914. Artículo 52 de la constitución. La Ley 14.095 de 17 de noviembre de 1972.  Decreto - Ley 14.500 de 17 de marzo de 1976. El Decreto - Ley 14.887 de 27 de abril de 1979 y su decreto reglamentario 450/79. Ley 17.569 de 22 de octubre 2002. Juicio crítico. Conclusiones

  4. 16 CFR 1632.31 - Mattresses/mattress pads-labeling, recordkeeping, guaranties and “one of a kind” exemption.

    Science.gov (United States)

    2010-01-01

    ...) Products intended for one time use (see § 1632.5(b)(1)(i)) are not subject to the requirements of... description of each mattress or mattress pad prototype with an assigned prototype identification number. (2) Test results and details of each prototype test performed in accordance with § 1632.4 or § 1632.5...

  5. Data of evolutionary structure change: 1CG5B-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 C 2QU0C DLHAHKLRVDPence>...0 C 2QU0C FPHFD--LSHGSence...1CG5B-2QU0C 1CG5 2QU0 B C VKLSEDQEHYIKGVWKDVD--HKQITAKALERVFVVYPW... 1CG5 B 1CG5B ence>WKDVD--HKQIT... 384 THR CA 441 2QU0 C 2QU

  6. Data of evolutionary structure change: 1CG5B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available Chain>A 2QU0A ence>AWGKVGGNAGAYence> 2QU0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG5B-2QU0A 1CG5 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...dex>0 1CG5 B 1CG5B

  7. Effect of Grain Refinement and Cooling Rate on the Microstructure and Mechanical Properties of Secondary Al-Si-Cu Alloys

    Science.gov (United States)

    Timelli, Giulio; Camicia, Giordano; Ferraro, Stefano

    2014-02-01

    The effect of AlTi5B1 grain refinement and different solidification rates on metallurgical and mechanical properties of a secondary AlSi7Cu3Mg alloy is reported. While the Ti content ranges from 0.04 up to 0.225 wt.%, the cooling rate varies between 0.1 and 5.5 °C/s. Metallographic and thermal analysis techniques have been used to quantitatively examine the macro- and microstructural changes occurring with grain refiner addition at various cooling rates. The results indicate that a small AlTi5B1 addition produces the greatest refinement, while no significant reduction of grain size is obtained with a great amount of grain refiner. On increasing the cooling rate, a lower amount of AlTi5B1 master alloy is necessary to produce a uniform grain size throughout the casting. The combined addition of AlTi5B1 and Sr does not produce any reciprocal interaction or effect on primary α-Al and eutectic solidification. The grain refinement improves the plastic behavior of the alloy and increases the reliability of castings, as evidenced by the Weibull statistics.

  8. 26 CFR 1.368-2 - Definition of terms.

    Science.gov (United States)

    2010-04-01

    ...) Analysis. The deemed formation by Z of U pursuant to § 1.1361-5(b)(1) (as a consequence of the termination.... Merger of a target corporation into a disregarded entity owned by a partnership. (i) Facts. The facts are the same as in Example 2, except that Y is organized as a partnership under the laws of State W and is...

  9. Estudio sanitario de los recursos hídricos: aguas residuales y aguas de consumo de la zona de Linares

    OpenAIRE

    Román Martínez, Isidoro

    2011-01-01

    Se ha realizado durante el periodo marzo-1987 a abril-1988 un estudio desde el punto de vista sanitario de 45 puntos de muestreo correspondientes a los municipios de Linares (20), Vilches (16), Jabalquinto (6), la Carolina (1), Santa Elena (1) y bailen (1). Las aguas fueron agrupadas por naturalezas. Resultando la distribuci??n siguiente: residuales (12), fluviales (16), aguas tratadas (10) y aguas profundas (7). De estas, se utilizaban para el consumo las correspondientes a 16 puntos. entre ...

  10. Variação anual na abertura do dossel, temperatura e umidade do ar no sub-bosque de três ambientes florestais no sul da Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Marayana Prado Pinheiro

    2013-03-01

    Full Text Available http://dx.doi.org/10.5902/198050988445Visando contribuir para o conhecimento dos fatores físicos que afetam a estrutura da comunidade vegetal em remanescentes de mata atlântica do sul da Bahia foi analisada a variação anual do microclima do sub-bosque num fragmento de floresta de encosta na Reserva Particular do Patrimônio Natural Serra do Teimoso (RST e num sistema agroflorestal rústico utilizado para o cultivo do cacau (Cabruca, localizado nas proximidades da RST. Dados da abertura do dossel (CO, da temperatura do ar (Ta, da umidade relativa do ar (RH e do déficit de pressão de vapor (VPD foram coletados entre abril de 2005 e abril de 2006 na base (RSTB, 340 m e no topo (RSTT, 640 m da RST e na Cabruca (CB, 250 m. Dados de precipitação pluvial, Ta, RH e VPD foram também coletados numa área aberta (OA, 270 m. As maiores precipitações (> 100 mm ocorreram em Novembro de 2005 e Abril de 2006, enquanto outubro de 2005 foi o mês mais seco (< 20 mm. CO variou entre 2,5% na CB (Abril, 2006 e 7,7% na RST (Outubro, 2005. Os baixos valores de pluviosidade registrados em Outubro de 2005 afetaram VPDmax em todos os ambientes. Estes efeitos foram mais pronunciados em OA, seguido de CB, RSTB e RSTT. Os valores de Ta, RH e VPD em CB foram mais próximos aos valores observados em OA do que aos valores observados no interior da floresta.

  11. Lesiones infantiles: Lo que necesita saber (Child Injury: What You Need to Know)

    Centers for Disease Control (CDC) Podcasts

    2012-04-16

    Este podcast se basa en el informe de Vital Signs de los CDC de abril del 2012. Muchas lesiones y muertes infantiles se pueden prevenir, como las causadas por choques automovilísticos, asfixia, envenenamientos, ahogamientos, incendios y caídas. Este podcast habla sobre las formas de prevenir estas lesiones y muertes.  Created: 4/16/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 4/16/2012.

  12. Medida de los beneficios económicos de la integridad ecológica del Río Mameyes en Puerto Rico

    Science.gov (United States)

    Armando Gonzalez-Caban; John Loomis

    1999-01-01

    Se realizó una valoración de contingencia a través de una encuesta en persona de los jefes de familia puertorriqueños, de abril a agosto de 1995, para estimar su consentimiento-parapagar por la preservación de niveles de agua en el Río Mameyes, y evitar la construcción de la represa propuesta...

  13. Buenas prácticas en la gestión de la investigación

    OpenAIRE

    Luján Mora, Sergio

    2016-01-01

    Conferencia "Buenas prácticas en la gestión de la investigación" impartida en la Universidad Católica Santiago de Guayaquil (Guayaquil, Ecuador) el 1 de abril de 2016 en el marco del II Encuentro de vicerrectores de investigación y posgrado, organizado por la Red Ecuatoriana de Universidades y Escuelas Politécnicas para Investigación y Posgrados (REDU).

  14. Cuidado paliativo e enfermeiros de terapia intensiva: sentimentos que ficam

    OpenAIRE

    Silveira, Natyele Rippel; Nascimento, Eliane Regina Pereira do; Rosa, Luciana Martins da; Jung, Walnice; Martins, Sabrina Regina; Fontes, Moisés dos Santos

    2016-01-01

    RESUMO Objetivo: conhecer os sentimentos dos enfermeiros acerca dos cuidados paliativos em unidades de terapia intensiva de adultos. Método: estudo qualitativo, cujo referencial teórico adotado foi o das Representações Sociais, realizado com 30 enfermeiros do estado de Santa Catarina incluídos por amostragem Bola de Neve. Os dados foram coletados por meio de entrevistas semiestruturadas realizadas de abril a agosto de 2015, organizados e analisados por meio do Discurso do Sujeito Coletivo. ...

  15. Superconductivity and their applications

    OpenAIRE

    Roque, António; Sousa, Duarte M.; Fernão Pires, Vítor; Margato, Elmano

    2017-01-01

    Trabalho apresentado em International Conference on Renewable Energies and Power Quality (ICREPQ’17), 4 a 6 de Abril de 2017, Málaga, Espanha The research in the field of superconductivity has led to the synthesis of superconducting materials with features that allow you to expand the applicability of this kind of materials. Among the superconducting materials characteristics, the critical temperature of the superconductor is framing the range and type of industrial applications that can b...

  16. Helder Macedo, por outras palavrasdoi:10.5007/2176-8552.2010n10p105

    Directory of Open Access Journals (Sweden)

    Margarida Calafate Ribeiro

    2010-01-01

    Full Text Available Neste artigo oferece-se uma leitura ampla da obra de Helder Macedo a partir de uma linha que cruza as várias formas de escrita do autor e as suas obsessões temáticas, principalmente os grandes fantasmas da história portuguesa remota e recente – o sebastianismo, o colonialismo português, África, a ditadura salazarista, o 25 de Abril e a democracia portuguesa.

  17. Los centenarios: El bibliotecario don Manuel del Socorro Rodríguez

    Directory of Open Access Journals (Sweden)

    Boletín Cultural y Bibliográfico Banco de la República

    1958-04-01

    Full Text Available Se cumplió en este mes de abril el segundo centenario del nacimiento de don Manuel del Socorro Rodríguez. Con tal motivo, su memoria fue honrada con la celebración del Día del Bibliotecario, una magnífica iniciativa que, como dijo alguien, debe convertirse en una tradición cultural de Colombia.

  18. En el día del bibliotecario: Homenaje al Doctor Luis Ángel Arango

    Directory of Open Access Journals (Sweden)

    Ernesto Delgado

    1962-04-01

    Full Text Available Palabras pronunciadas por el presidente de la Asociación Colombiana de Bibliotecarios, señor Ernesto Delgado, en el Salón de Actos de la Biblioteca Luis Ángel Arango, el sábado 28 de abril, Día del Bibliotecario, con motivo del homenaje que dicha corporación rindió a la memoria del doctor Luis Ángel Arango.

  19. PSA de radio Mes de Concientización sobre las ETS PSA de radio (30 seg) (STD Awareness Month PSA (:30))

    Centers for Disease Control (CDC) Podcasts

    2011-04-19

    Abril es el Mes Nacional de Concientización sobre las Enfermedades de Transmisión Sexual (ETS). Las ETS pueden afectar a cualquier persona. Muchas ETS no tienen síntomas, por lo que es importante hacerse pruebas de detección.  Created: 4/19/2011 by National Center for HIV/AIDS, Viral Hepatitis, STD, and TB Prevention.   Date Released: 4/20/2011.

  20. USSR Report, International Affairs

    Science.gov (United States)

    1986-11-21

    Distribution Unlimited FBIS [» TIC QUALITY BJSPJSOTD 3 FOREIGN BROADCAST INFORMATION SERVICE REPRODUCED BY ....,-r>/-c U S DFPARTMENT OF COMMERCE...death agony." (Footnote 17) 34 ( Relaciones internacionales. Heredia, 1984, No 8/9, P 10; Dialogo social. Panama, 1985, No 177, P 12.) All of this...sovereign Peruvian society." (Footnote 1) (Jorge del Prado. 51 ?Quien gano y quien perido el 14 de abril? Informe Politico a la XIV sesion

  1. JPRS Report, Soviet Union, International Affairs.

    Science.gov (United States)

    1987-06-26

    Visita del presidente de la Republica de Colombia Belisario Betancur a los Estados Unidos: abril, 1985. S. 1., s.a., pp 370, 372. 19. EL ESPECTADOR...Process, Origin of ’Rio de Janeiro Group’ Described (Editorial; LATINSKAYA AMERIKA, No 3, Mar 87) 25 Course of U.S.-Colombia Relations Analyzed...not translated] 39 REPORTS Yu.F. Pogorelov. Science at the Service of Agriculture in Mexico 46 [not translated] MEETINGS, INTERVIEWS The Concerns

  2. Resumos de artigos em Português

    OpenAIRE

    Bogdan Patrut

    2010-01-01

    Resumos de artigos em Português
    BRAIN. Broad Research in Artificial Intelligence and Neuroscience
    CÉREBRO. Ampla pesquisa em Inteligência Artificial e Neurociências
    ISSN 2067-3957
    Volume 1, Número 2
    Abril de 2010, "Feliz Verão 2010!"
    www.brain.edusoft.ro
    Editor - chefe: Bogdan Pătruţ

  3. LOS ROJOS Y LOS AZULES. La violencia de la polarizaci?n bipartidista. Pacho (1930-1956).

    OpenAIRE

    Gait?n Barrero, Clara Helena

    2016-01-01

    C?mo cay? Pacho en ?la Violencia?? Estudio sobre el impacto del 9 de abril y ?la Violencia? en Pacho, Cundinamarca. Se analiza c?mo este municipio, ajeno a la violencia bipartidista, se involucr? en esta contienda que viv?a el pa?s. Sugiere la inversi?n de la pregunta: ?Fue el bipartidismo, m?s que la causa, una consecuencia de la violencia?

  4. Private label brand equity: a conceptual framework

    OpenAIRE

    Xara-Brasil, Duarte; Marreiros, Cristina; Dionísio, Andreia

    2012-01-01

    Trabalho apresentado na AMA/ACRA First Triennial Conference, 18-21 de abril de 2012, Seattle, USA This paper presents a conceptual framework to analyze private label brand equity in a retail context. Several authors proposed brand equity models as Aaker (1996), Keller (1993) and Yoo and Donthu (2001), and specific research has been done in retail industry (Jara & Cliquet, 2009), (Pappu & Quester, 2006). To study private label brand equity, we suggest a framework based on the Yo...

  5. Nota sobre colisiones de aves en las ventanas de edificios universitarios en Puerto Vallarta, México

    Directory of Open Access Journals (Sweden)

    Fabio Germán Cupul-Magaña

    2015-06-01

    Full Text Available Esta nota presenta las observaciones de 15 colisiones de aves en ventanas de edificios de la Universidad de Guadalajara en Puerto Vallarta, Jalisco, México, a lo largo de 94 días de estudio (24 de enero al 27 de abril del 2003. Columbina passerina fue la especie que presentó el mayor número de fatalidades: ocho.

  6. Conferencias Anatomopatológicas

    Directory of Open Access Journals (Sweden)

    San Juan de Dios Hospital de

    1953-01-01

    Full Text Available Caso número cuatro: La enferma ingresa al servicio de Clínica Semiológica el 5 de abril de 1951, por presentar ictericia, fiebre, dolor abdominal intenso, localizado principalmente en el hipocondrio derecho, nauseas, vomitus y cefalea / Caso número cinco: lngresa al Servicio Quirúrgico el 15 de junio de 1951, con sintomatologia de colelitiasis.

  7. Introducing short term flexibility in the EU ETS to assure its long-term credibility: a multi-criteria analysis of policy options. Climate Report no. 45

    International Nuclear Information System (INIS)

    Desai, Zuheir; Alberola, Emilie; Berghmans, Nicolas

    2014-07-01

    It is now well established that the European Union Emissions Trading Scheme (EU ETS) needs to be reformed. After more than 18 months of discussions, the EU Commission disclosed, in its communication published in January 2014 on 'A policy framework for climate and energy in the period from 2020 to 2030', its legislative proposal of a market stability reserve (MSR) in the EU ETS. This measure, that should be implemented from the next compliance period (2021-2028) onwards, would reduce the surplus of allowances growing since 2008 and improve the ETS's resilience to external shocks by automatically adjusting the supply of allowances to be auctioned. The operation of this MSR would be determined by predefined rules that, once agreed on, leave no discretion to either the Commission or Member States. The choice of the EU Commission to introduce a reserve in the EU ETS is very innovative even if other emissions trading schemes have already introduced a reserve in their design. Initial discussions began in March and April 2014 in the European Parliament and Council and the question of whether the MSR really improves the functioning of the EU ETS in the long term is still being debated. What other structural mechanism would be better suited in improving the long-term effectiveness of the EU ETS? To help in the decision making process, this report presents a multi-criteria analysis. Without prejudging their political support, five policy options have been evaluated that would introduce some flexibility in the EU ETS and potentially ensure its long-term credibility: an auction reserve price, permit supply rules that target a certain corridor of surplus (market stability reserve), permit supply rules that target economic activity, permit supply rules that target overlap with other energy policies and a rolling emissions cap. The assessment of these five policy options was based on a criteria tree and on the EU ETS experts' panel's votes that expressed

  8. Caracterização fenológica da videira cv. Itália (Vitis vinifera L. sob diferentes épocas de poda na região norte do estado do Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Murakami Kátia Regina Naomi

    2002-01-01

    Full Text Available O experimento foi instalado no município de Cardoso Moreira, região Norte do Estado do Rio de Janeiro, durante o ano de 2001, com o objetivo de descrever a fenologia da videira 'Itália' e estimar a necessidade térmica em graus-dia (GD, sob diferentes épocas de poda (abril, maio, junho e julho. Avaliou-se o comportamento fenológico para os seguintes períodos: poda à gema algodão, gema algodão à brotação, brotação ao aparecimento da inflorescência, aparecimento da inflorescência ao florescimento, florescimento ao início da maturação e início da maturação à colheita. Foi determinada a soma térmica, em graus-dia, para o ciclo poda-colheita. A duração do ciclo foi de 138; 151; 150 e 157 dias para podas realizadas nos meses de abril, maio, junho e julho, respectivamente. A soma térmica necessária foi de 1727GD para poda realizada em abril, 1564GD para poda realizada em maio, 1702GD para poda realizada em junho e 1840GD para poda realizada em julho, utilizando-se de temperatura-base de 12ºC.

  9. Erico Verissimo: um “pintor” brasileiro de Israel

    Directory of Open Access Journals (Sweden)

    Luciara Lourdes Silva de Assis

    2010-03-01

    Full Text Available O escritor brasileiro Erico Verissimo viajou a Israel em abril de 1966, na companhia da esposa, a convite do Ministério de Negócios Estrangeiros daquele país. As anotações feitas por Verissimo durante o percurso pelas principais cidades israelenses foram transformadas no livro Israel em abril, escrito e publicado três anos após a viagem. Juntamente com os manuscritos da obra, o escritor enviou ao seu editor uma carta, na qual afirma que sua intenção ao iniciar o livro “era ‘pintar’ Israel com a despreocupada alegria lúdica dum artista em férias”. Entretanto, no decorrer do trabalho, ao perceber que começava a fazer “perguntas perigosas” como “Que são os judeus? Uma raça? Um povo? Um conjunto de tribos unidas por uma religião comum?”, Verissimo deixou que o bom senso prevalecesse e voltou à sua “pintura”. Pretende-­se, neste artigo, analisar a obra Israel em abril, verificando em que medida o olhar despreocupado do pintor se confunde com o olhar crítico do intelectual no relato de suas impressões em Israel.

  10. Bottom and charm mass determinations from global fits to Q\\overline{Q} bound states at N3LO

    Science.gov (United States)

    Mateu, Vicent; Ortega, Pablo G.

    2018-01-01

    The bottomonium spectrum up to n = 3 is studied within Non-Relativistic Quantum Chromodynamics up to N3LO. We consider finite charm quark mass effects both in the QCD potential and the \\overline{MS} -pole mass relation up to third order in the Y-scheme counting. The u = 1 /2 renormalon of the static potential is canceled by expressing the bottom quark pole mass in terms of the MSR mass. A careful investigation of scale variation reveals that, while n = 1 , 2 states are well behaved within perturbation theory, n = 3 bound states are no longer reliable. We carry out our analysis in the n ℓ = 3 and n ℓ = 4 schemes and conclude that, as long as finite m c effects are smoothly incorporated in the MSR mass definition, the difference between the two schemes is rather small. Performing a fit to b\\overline{b} bound states we find {\\overline{m}}_b({\\overline{m}}_b) = 4 .216 ± 0 .039 GeV. We extend our analysis to the lowest lying charmonium states finding {\\overline{m}}_c({\\overline{m}}_c) = 1 .273 ± 0 .054 GeV. Finally, we perform simultaneous fits for {\\overline{m}}_b and α s finding {α}_s^{({n}_f=5)}({m}_Z)=0.1178± 0.0051 . Additionally, using a modified version of the MSR mass with lighter massive quarks we are able to predict the uncalculated O({α}_s^4) virtual massive quark corrections to the relation between the \\overline{MS} and pole masses.

  11. 2D heat and mass transfer modeling of methane steam reforming for hydrogen production in a compact reformer

    International Nuclear Information System (INIS)

    Ni Meng

    2013-01-01

    Highlights: ► A heat and mass transfer model is developed for a compact reformer. ► Hydrogen production from methane steam reforming is simulated. ► Increasing temperature greatly increases the reaction rates at the inlet. ► Temperature in the downstream is increased at higher rate of heat supply. ► Larger permeability enhances gas flow and reaction rates in the catalyst layer. - Abstract: Compact reformers (CRs) are promising devices for efficient fuel processing. In CRs, a thin solid plate is sandwiched between two catalyst layers to enable efficient heat transfer from combustion duct to the reforming duct for fuel processing. In this study, a 2D heat and mass transfer model is developed to investigate the fundamental transport phenomenon and chemical reaction kinetics in a CR for hydrogen production by methane steam reforming (MSR). Both MSR reaction and water gas shift reaction (WGSR) are considered in the numerical model. Parametric simulations are performed to examine the effects of various structural/operating parameters, such as pore size, permeability, gas velocity, temperature, and rate of heat supply on the reformer performance. It is found that the reaction rates of MSR and WGSR are the highest at the inlet but decrease significantly along the reformer. Increasing the operating temperature raises the reaction rates at the inlet but shows very small influence in the downstream. For comparison, increasing the rate of heat supply raises the reaction rates in the downstream due to increased temperature. A high gas velocity and permeability facilitates gas transport in the porous structure thus enhances reaction rates in the downstream of the reformer.

  12. Solar cycle predicts folate-sensitive neonatal genotypes at discrete phases of the first trimester of pregnancy: a novel folate-related human embryo loss hypothesis.

    Science.gov (United States)

    Lucock, Mark; Glanville, Tracey; Yates, Zoë; Walker, James; Furst, John; Simpson, Nigel

    2012-08-01

    Folate, a key periconceptional nutrient, is ultraviolet light (UV-R) sensitive. We therefore hypothesise that a relationship exists between sunspot activity, a proxy for total solar irradiance (particularly UV-R) reaching Earth, and the occurrence of folate-sensitive, epigenomic-related neonatal genotypes during the first trimester of pregnancy. Limited data is provided to support the hypothesis that the solar cycle predicts folate-related human embryo loss: 379 neonates born at latitude 54°N between 1998 and 2000 were examined for three folate-sensitive, epigenome-related polymorphisms, with solar activity for trimester one accessed via the Royal Greenwich Observatory-US Air force/National Oceanic and Atmospheric Administration Sunspot Database (34,110 total observation days). Logistic regression showed solar activity predicts C677T-methylenetetrahydrofolate reductase (C677T-MTHFR) and A66G-methionine synthase reductase (A66G-MSR) genotype at discrete phases of trimester one. Total and maximal sunspot activity predicts C677T-MTHFR genotype for days 31-60 of trimester one (p=0.0181 and 0.0366, respectively) and A66G-MSR genotype for days 61-90 of trimester one (p=0.0072 and 0.0105, respectively). Loss of UV-R sensitive folate associated with the sunspot cycle might therefore interact with variant folate genes to perturb DNA methylation and/or elaboration of the primary base sequence (thymidylate synthesis), as well as increase embryo-toxic homocysteine. We hypothesise that this may influence embryo viability leading to 677CC-MTHFR and 66GG-MSR embryo loss at times of increased solar activity. This provides an interesting and plausible link between well recognised 'folate gene originated developmental disorders' and 'solar activity/seasonality modulated developmental disorders'. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. Effect of microbial cell-free meat extract on the growth of spoilage bacteria.

    Science.gov (United States)

    Nychas, G-J E; Dourou, D; Skandamis, P; Koutsoumanis, K; Baranyi, J; Sofos, J

    2009-12-01

    This study examined the effect of microbial cell-free meat extract (CFME) derived from spoiled meat, in which quorum sensing (QS) compounds were present, on the growth kinetics (lag phase, and growth rate) of two spoilage bacteria, Pseudomonas fluorescens and Serratia marcescens. Aliquots of CFME from spoiled meat were transferred to Brain Heart Infusion broth inoculated with 10(3) CFU ml(-1) of 18 h cultures of Ps. fluorescens or Ser. marcescens, both fresh meat isolates; CFME derived from unspoiled fresh meat ('clean' meat) served as a control. Changes in impedance measurements were monitored for 48 h, and the detection time (Tdet) was recorded. It was found that in the absence of CFME containing QS compounds the Tdet was shorter (P meat. The rate of growth of Ps. fluorescens, recorded as the maximum slope rate of conductance changes (MSrCC), after Tdet, was higher (P meat. Similar results in MSrCC of impedance changes were obtained for Ser. marcescens. The study indicated that the growth rate (expressed in MSrCC units) of meat spoilage bacteria in vitro was enhanced in samples supplemented with CFME containing QS compounds compared to control samples (i.e., without CFME or with CFME from 'clean' meat). This behaviour may explain the dominant role of these two bacteria in the spoilage of meat. These results illustrate the potential effect of signalling compounds released during storage of meat on the behaviour of meat spoilage bacteria. Understanding such interactions may assist in the control of fresh meat quality and the extension of its shelf life.

  14. Parametric study of natural circulation flow in molten salt fuel in molten salt reactor

    Energy Technology Data Exchange (ETDEWEB)

    Pauzi, Anas Muhamad, E-mail: Anas@uniten.edu.my [Centre of Nuclear Energy, Universiti Tenaga Nasional (UNITEN), Jalan IKRAM-UNITEN, 43000 Kajang, Selangor (Malaysia); Cioncolini, Andrea; Iacovides, Hector [School of Mechanical, Aerospace, and Civil Engineering (MACE), University of Manchester, Oxford Road, M13 9PL Manchester (United Kingdom)

    2015-04-29

    The Molten Salt Reactor (MSR) is one of the most promising system proposed by Generation IV Forum (GIF) for future nuclear reactor systems. Advantages of the MSR are significantly larger compared to other reactor system, and is mainly achieved from its liquid nature of fuel and coolant. Further improvement to this system, which is a natural circulating molten fuel salt inside its tube in the reactor core is proposed, to achieve advantages of reducing and simplifying the MSR design proposed by GIF. Thermal hydraulic analysis on the proposed system was completed using a commercial computation fluid dynamics (CFD) software called FLUENT by ANSYS Inc. An understanding on theory behind this unique natural circulation flow inside the tube caused by fission heat generated in molten fuel salt and tube cooling was briefly introduced. Currently, no commercial CFD software could perfectly simulate natural circulation flow, hence, modeling this flow problem in FLUENT is introduced and analyzed to obtain best simulation results. Results obtained demonstrate the existence of periodical transient nature of flow problem, hence improvements in tube design is proposed based on the analysis on temperature and velocity profile. Results show that the proposed system could operate at up to 750MW core power, given that turbulence are enhanced throughout flow region, and precise molten fuel salt physical properties could be defined. At the request of the authors and the Proceedings Editor the name of the co-author Andrea Cioncolini was corrected from Andrea Coincolini. The same name correction was made in the Acknowledgement section on page 030004-10 and in reference number 4. The updated article was published on 11 May 2015.

  15. Study of trans-uranian incineration in molten salt reactor; Etude de l'incineration des transuraniens en reacteur a sel fondu

    Energy Technology Data Exchange (ETDEWEB)

    Valade, M

    2000-10-27

    With the emergence of new options for nuclear power, molten salt reactors are envisaged for waste management. The aim of this thesis is to show how molten salt reactors can help to solve the transuranics issue. Their high versatility regarding to isotopic vector allows to accommodate large fractions of minor actinides as compared to solid fuel system. In this thesis, a neutronics study of molten salt reactors, MSR, has been conducted. For this purpose, two reference systems were considered, TIER1 and AMSTER. In the case of TIER1, an optimisation was made to reach an equilibrium. The analysis of both systems showed the main characteristics of MSR: their link to chemistry and on line reprocessing. In this work, several methods to drive the system to a state of equilibrium have been implemented and compared. During this process the isotopic composition and neutron spectrum, thus the nuclear reaction cross sections, vary tremendously. It is essential to take these evolutions into account in order to accurately estimate the equilibrium state. This has been accomplished inside the multi-recycling procedure we set with ERANOS. A dedicated calculation schema has been realized to simulate superthermal systems with this computation code. These results were checked through a benchmark against other computer codes. Then, with multi-recycling method, several molten salt systems have been compared in order to define the optimal reactor for transuranics incineration. Nevertheless, a final choice can not only be done using only neutronics characteristics since chemistry and thermal-hydraulics constraints are really important for MSR. Moreover, a complete safety study would be required. (author)

  16. An Out-of-Core GPU based dimensionality reduction algorithm for Big Mass Spectrometry Data and its application in bottom-up Proteomics.

    Science.gov (United States)

    Awan, Muaaz Gul; Saeed, Fahad

    2017-08-01

    Modern high resolution Mass Spectrometry instruments can generate millions of spectra in a single systems biology experiment. Each spectrum consists of thousands of peaks but only a small number of peaks actively contribute to deduction of peptides. Therefore, pre-processing of MS data to detect noisy and non-useful peaks are an active area of research. Most of the sequential noise reducing algorithms are impractical to use as a pre-processing step due to high time-complexity. In this paper, we present a GPU based dimensionality-reduction algorithm, called G-MSR, for MS2 spectra. Our proposed algorithm uses novel data structures which optimize the memory and computational operations inside GPU. These novel data structures include Binary Spectra and Quantized Indexed Spectra (QIS) . The former helps in communicating essential information between CPU and GPU using minimum amount of data while latter enables us to store and process complex 3-D data structure into a 1-D array structure while maintaining the integrity of MS data. Our proposed algorithm also takes into account the limited memory of GPUs and switches between in-core and out-of-core modes based upon the size of input data. G-MSR achieves a peak speed-up of 386x over its sequential counterpart and is shown to process over a million spectra in just 32 seconds. The code for this algorithm is available as a GPL open-source at GitHub at the following link: https://github.com/pcdslab/G-MSR.

  17. Neurospora discreta as a model to assess adaptation of soil fungi to warming.

    Science.gov (United States)

    Romero-Olivares, Adriana L; Taylor, John W; Treseder, Kathleen K

    2015-09-16

    Short-term experiments have indicated that warmer temperatures can alter fungal biomass production and CO2 respiration, with potential consequences for soil C storage. However, we know little about the capacity of fungi to adapt to warming in ways that may alter C dynamics. Thus, we exposed Neurospora discreta to moderately warm (16 °C) and warm (28 °C) selective temperatures for 1500 mitotic generations, and then examined changes in mycelial growth rate, biomass, spore production, and CO2 respiration. We tested the hypothesis that strains will adapt to its selective temperature. Specifically, we expected that adapted strains would grow faster, and produce more spores per unit biomass (i.e., relative spore production). In contrast, they should generate less CO2 per unit biomass due to higher efficiency in carbon use metabolism (i.e., lower mass specific respiration, MSR). Indeed, N. discreta adapted to warm temperatures, based on patterns of relative spore production. Adapted strains produced more spores per unit biomass than parental strains in the selective temperature. Contrary to our expectations, this increase in relative spore production was accompanied by an increase in MSR and a reduction in mycelial growth rate and biomass, compared to parental strains. Adaptation of N. discreta to warm temperatures may have elicited a tradeoff between biomass production and relative spore production, possibly because relative spore production required higher MSR rates. Therefore, our results do not support the idea that adaptation to warm temperatures will lead to a more efficient carbon use metabolism. Our data might help improve climate change model simulations and provide more concise predictions of decomposition processes and carbon feedbacks to the atmosphere.

  18. High temperature materials

    International Nuclear Information System (INIS)

    2003-01-01

    The aim of this workshop is to share the needs of high temperature and nuclear fuel materials for future nuclear systems, to take stock of the status of researches in this domain and to propose some cooperation works between the different research organisations. The future nuclear systems are the very high temperature (850 to 1200 deg. C) gas cooled reactors (GCR) and the molten salt reactors (MSR). These systems include not only the reactor but also the fabrication and reprocessing of the spent fuel. This document brings together the transparencies of 13 communications among the 25 given at the workshop: 1) characteristics and needs of future systems: specifications, materials and fuel needs for fast spectrum GCR and very high temperature GCR; 2) high temperature materials out of neutron flux: thermal barriers: materials, resistance, lifetimes; nickel-base metal alloys: status of knowledge, mechanical behaviour, possible applications; corrosion linked with the gas coolant: knowledge and problems to be solved; super-alloys for turbines: alloys for blades and discs; corrosion linked with MSR: knowledge and problems to be solved; 3) materials for reactor core structure: nuclear graphite and carbon; fuel assembly structure materials of the GCR with fast neutron spectrum: status of knowledge and ceramics and cermets needs; silicon carbide as fuel confinement material, study of irradiation induced defects; migration of fission products, I and Cs in SiC; 4) materials for hydrogen production: status of the knowledge and needs for the thermochemical cycle; 5) technologies: GCR components and the associated material needs: compact exchangers, pumps, turbines; MSR components: valves, exchangers, pumps. (J.S.)

  19. Ultra-low field MRI food inspection system prototype

    Energy Technology Data Exchange (ETDEWEB)

    Kawagoe, Satoshi, E-mail: s133413@edu.tut.ac.jp; Toyota, Hirotomo; Hatta, Junichi; Ariyoshi, Seiichiro; Tanaka, Saburo, E-mail: tanakas@ens.tut.ac.jp

    2016-11-15

    Highlights: • We have developed a ULF-MRI system using HTS-SQUID for food inspection. • We developed a compact magnetically shielded box to attenuate environmental noise. • The 2D-MR image was reconstructed from the grid processing data using 2D-FFT method. • The 2D-MR images of a disk-shaped and a multiple cell water sample were obtained. • The results showed the possibility of applying the ULF-MRI system to food inspection. - Abstract: We develop an ultra-low field (ULF) magnetic resonance imaging (MRI) system using a high-temperature superconducting quantum interference device (HTS-SQUID) for food inspection. A two-dimensional (2D)-MR image is reconstructed from the grid processing raw data using the 2D fast Fourier transform method. In a previous study, we combined an LC resonator with the ULF-MRI system to improve the detection area of the HTS-SQUID. The sensitivity was improved, but since the experiments were performed in a semi-open magnetically shielded room (MSR), external noise was a problem. In this study, we develop a compact magnetically shielded box (CMSB), which has a small open window for transfer of a pre-polarized sample. Experiments were performed in the CMSB and 2D-MR images were compared with images taken in the semi-open MSR. A clear image of a disk-shaped water sample is obtained, with an outer dimension closer to that of the real sample than in the image taken in the semi-open MSR. Furthermore, the 2D-MR image of a multiple cell water sample is clearly reconstructed. These results show the applicability of the ULF-MRI system in food inspection.

  20. High temperature materials; Materiaux a hautes temperatures

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    The aim of this workshop is to share the needs of high temperature and nuclear fuel materials for future nuclear systems, to take stock of the status of researches in this domain and to propose some cooperation works between the different research organisations. The future nuclear systems are the very high temperature (850 to 1200 deg. C) gas cooled reactors (GCR) and the molten salt reactors (MSR). These systems include not only the reactor but also the fabrication and reprocessing of the spent fuel. This document brings together the transparencies of 13 communications among the 25 given at the workshop: 1) characteristics and needs of future systems: specifications, materials and fuel needs for fast spectrum GCR and very high temperature GCR; 2) high temperature materials out of neutron flux: thermal barriers: materials, resistance, lifetimes; nickel-base metal alloys: status of knowledge, mechanical behaviour, possible applications; corrosion linked with the gas coolant: knowledge and problems to be solved; super-alloys for turbines: alloys for blades and discs; corrosion linked with MSR: knowledge and problems to be solved; 3) materials for reactor core structure: nuclear graphite and carbon; fuel assembly structure materials of the GCR with fast neutron spectrum: status of knowledge and ceramics and cermets needs; silicon carbide as fuel confinement material, study of irradiation induced defects; migration of fission products, I and Cs in SiC; 4) materials for hydrogen production: status of the knowledge and needs for the thermochemical cycle; 5) technologies: GCR components and the associated material needs: compact exchangers, pumps, turbines; MSR components: valves, exchangers, pumps. (J.S.)

  1. Axial Skeletal Scintigraphy in Cancer of the Breast

    Energy Technology Data Exchange (ETDEWEB)

    Galasko, C. S.B. [Royal Postgraduate Medical School and Hammersmith Hospital, London (United Kingdom)

    1969-05-15

    An initial study was made on eight patients shown to have osseous metastases on X-ray. Each patient was examined on two occasions after the injection of {sup 87m}Sr and {sup 18}F. Regions known to contain metastases were examined at regular intervals after each injection. The scintigrams were compared with X-ray skeletal surveys. In all patients the {sup 18}F scintigram gave better results than the {sup 87m}Sr scan. All metastases present on X-ray were detected with the gamma camera and in six patients the scintigram revealed additional lesions. The optimum times for scanning were 1 1/4-3 hours after injection of {sup 18}F and 3-4 1/2 hours after {sup 87m}Sr. Axial skeleton scintigrams using {sup 18}F and a gamma camera are now being done on: (i) patients with apparently 'early' cancer of the breast. (ii) patients who have had a mastectomy and in whom there is a suspicion but no overt evidence of metastases. (iii) patients with advanced cancer of the breast. By means of this method it is hoped: (a) to detect lesions not present on X-ray. (b) to assess progress following hormonal therapy. 'Healing' lesions tend to have a diminished uptake of the isotope, and the varying pattern may prove to be more easy to interpret than conventional X-rays. The technique of axial skeleton scanning with the gamma camera and {sup 18}F, and the results obtained in over 60 patients with cancer of the breast, are reported. (author)

  2. Expression of an engineered heterologous antimicrobial peptide in potato alters plant development and mitigates normal abiotic and biotic responses.

    Directory of Open Access Journals (Sweden)

    Ravinder K Goyal

    Full Text Available Antimicrobial cationic peptides (AMPs are ubiquitous small proteins used by living cells to defend against a wide spectrum of pathogens. Their amphipathic property helps their interaction with negatively charged cellular membrane of the pathogen causing cell lysis and death. AMPs also modulate signaling pathway(s and cellular processes in animal models; however, little is known of cellular processes other than the pathogen-lysis phenomenon modulated by AMPs in plants. An engineered heterologous AMP, msrA3, expressed in potato was previously shown to cause resistance of the transgenic plants against selected fungal and bacterial pathogens. These lines together with the wild type were studied for growth habits, and for inducible defense responses during challenge with biotic (necrotroph Fusarium solani and abiotic stressors (dark-induced senescence, wounding and temperature stress. msrA3-expression not only conferred protection against F. solani but also delayed development of floral buds and prolonged vegetative phase. Analysis of select gene transcript profiles showed that the transgenic potato plants were suppressed in the hypersensitive (HR and reactive oxygen species (ROS responses to both biotic and abiotic stressors. Also, the transgenic leaves accumulated lesser amounts of the defense hormone jasmonic acid upon wounding with only a slight change in salicylic acid as compared to the wild type. Thus, normal host defense responses to the pathogen and abiotic stressors were mitigated by msrA3 expression suggesting MSRA3 regulates a common step(s of these response pathways. The stemming of the pathogen growth and mitigating stress response pathways likely contributes to resource reallocation for higher tuber yield.

  3. Study of trans-uranian incineration in molten salt reactor

    International Nuclear Information System (INIS)

    Valade, M.

    2000-01-01

    With the emergence of new options for nuclear power, molten salt reactors are envisaged for waste management. The aim of this thesis is to show how molten salt reactors can help to solve the transuranics issue. Their high versatility regarding to isotopic vector allows to accommodate large fractions of minor actinides as compared to solid fuel system. In this thesis, a neutronics study of molten salt reactors, MSR, has been conducted. For this purpose, two reference systems were considered, TIER1 and AMSTER. In the case of TIER1, an optimisation was made to reach an equilibrium. The analysis of both systems showed the main characteristics of MSR: their link to chemistry and on line reprocessing. In this work, several methods to drive the system to a state of equilibrium have been implemented and compared. During this process the isotopic composition and neutron spectrum, thus the nuclear reaction cross sections, vary tremendously. It is essential to take these evolutions into account in order to accurately estimate the equilibrium state. This has been accomplished inside the multi-recycling procedure we set with ERANOS. A dedicated calculation schema has been realized to simulate superthermal systems with this computation code. These results were checked through a benchmark against other computer codes. Then, with multi-recycling method, several molten salt systems have been compared in order to define the optimal reactor for transuranics incineration. Nevertheless, a final choice can not only be done using only neutronics characteristics since chemistry and thermal-hydraulics constraints are really important for MSR. Moreover, a complete safety study would be required. (author)

  4. Study of trans-uranian incineration in molten salt reactor; Etude de l'incineration des transuraniens en reacteur a sel fondu

    Energy Technology Data Exchange (ETDEWEB)

    Valade, M

    2000-10-27

    With the emergence of new options for nuclear power, molten salt reactors are envisaged for waste management. The aim of this thesis is to show how molten salt reactors can help to solve the transuranics issue. Their high versatility regarding to isotopic vector allows to accommodate large fractions of minor actinides as compared to solid fuel system. In this thesis, a neutronics study of molten salt reactors, MSR, has been conducted. For this purpose, two reference systems were considered, TIER1 and AMSTER. In the case of TIER1, an optimisation was made to reach an equilibrium. The analysis of both systems showed the main characteristics of MSR: their link to chemistry and on line reprocessing. In this work, several methods to drive the system to a state of equilibrium have been implemented and compared. During this process the isotopic composition and neutron spectrum, thus the nuclear reaction cross sections, vary tremendously. It is essential to take these evolutions into account in order to accurately estimate the equilibrium state. This has been accomplished inside the multi-recycling procedure we set with ERANOS. A dedicated calculation schema has been realized to simulate superthermal systems with this computation code. These results were checked through a benchmark against other computer codes. Then, with multi-recycling method, several molten salt systems have been compared in order to define the optimal reactor for transuranics incineration. Nevertheless, a final choice can not only be done using only neutronics characteristics since chemistry and thermal-hydraulics constraints are really important for MSR. Moreover, a complete safety study would be required. (author)

  5. Thermal Protection for Mars Sample Return Earth Entry Vehicle: A Grand Challenge for Design Methodology and Reliability Verification

    Science.gov (United States)

    Venkatapathy, Ethiraj; Gage, Peter; Wright, Michael J.

    2017-01-01

    Mars Sample Return is our Grand Challenge for the coming decade. TPS (Thermal Protection System) nominal performance is not the key challenge. The main difficulty for designers is the need to verify unprecedented reliability for the entry system: current guidelines for prevention of backward contamination require that the probability of spores larger than 1 micron diameter escaping into the Earth environment be lower than 1 million for the entire system, and the allocation to TPS would be more stringent than that. For reference, the reliability allocation for Orion TPS is closer to 11000, and the demonstrated reliability for previous human Earth return systems was closer to 1100. Improving reliability by more than 3 orders of magnitude is a grand challenge indeed. The TPS community must embrace the possibility of new architectures that are focused on reliability above thermal performance and mass efficiency. MSR (Mars Sample Return) EEV (Earth Entry Vehicle) will be hit with MMOD (Micrometeoroid and Orbital Debris) prior to reentry. A chute-less aero-shell design which allows for self-righting shape was baselined in prior MSR studies, with the assumption that a passive system will maximize EEV robustness. Hence the aero-shell along with the TPS has to take ground impact and not break apart. System verification will require testing to establish ablative performance and thermal failure but also testing of damage from MMOD, and structural performance at ground impact. Mission requirements will demand analysis, testing and verification that are focused on establishing reliability of the design. In this proposed talk, we will focus on the grand challenge of MSR EEV TPS and the need for innovative approaches to address challenges in modeling, testing, manufacturing and verification.

  6. Parents of two-phase flow and theory of “gas-lift”

    Directory of Open Access Journals (Sweden)

    Zitek Pavel

    2014-03-01

    Full Text Available This paper gives a brief overview of types of two-phase flow. Subsequently, it deals with their mutual division and problems with accuracy boundaries among particular types. It also shows the case of water flow through a pipe with external heating and the gradual origination of all kinds of flow. We have met it in solution of safety condition of various stages in pressurized and boiling water reactors. In the MSR there is a problem in the solution of gas-lift using helium as a gas and its secondary usage for clearing of the fuel mixture from gaseous fission products. Theory of gas-lift is described.

  7. Plutonium and minor actinides utilization in Thorium molten salt reactor

    International Nuclear Information System (INIS)

    Waris, Abdul; Aji, Indarta K.; Novitrian,; Kurniadi, Rizal; Su'ud, Zaki

    2012-01-01

    FUJI-12 reactor is one of MSR systems that proposed by Japan. The original FUJI-12 design considers Th/ 233 U or Th/Pu as main fuel. In accordance with the currently suggestion to stay away from the separation of Pu and minor actinides (MA), in this study we evaluated the utilization of Pu and MA in FUJI-12. The reactor grade Pu was employed in the present study as a small effort of supporting THORIMS-NES scenario. The result shows that the reactor can achieve its criticality with the Pu and MA composition in the fuel of 5.96% or more.

  8. Calculation of β-effective of a molten salt reactor

    International Nuclear Information System (INIS)

    Hirakawa, N.; Sakaba, H.

    1987-01-01

    A method to calculate the β eff of a molten salt reactor was developed taking the effect of the flow of the molten salt into account. The method was applied to the 1000MW MSR design made by ORNL. The change in β eff due to the change in the residence time outside of the core of the fuel salt and to the change in the flow velocity when the total amount of the fuel salt is kept constant were investigated. It was found that β eff was reduced to 47.9% of the value when the fuel salt is at rest for the present design. (author)

  9. Kinetics, dynamics and neutron noise in Molten Salt Reactors

    International Nuclear Information System (INIS)

    Pazsit, Imre

    2013-01-01

    Reactor kinetic and dynamic properties of Molten Salt Reactors (MSR) are investigated in a simple model, which allows closed compact analytical solutions to be obtained. The goal is to gain insight, rather than to produce high-quality quantitative data. Through an interpretation of the different terms in the basic equations, and by means of analytical solutions, various approximations are introduced and their validity discussed. The dynamical behaviour of MSRs and their response to small stationary perturbations is described and discussed in comparison with traditional systems. (author)

  10. SMART: A Propositional Logic-Based Trade Analysis and Risk Assessment Tool for a Complex Mission

    Science.gov (United States)

    Ono, Masahiro; Nicholas, Austin; Alibay, Farah; Parrish, Joseph

    2015-01-01

    This paper introduces a new trade analysis software called the Space Mission Architecture and Risk Analysis Tool (SMART). This tool supports a high-level system trade study on a complex mission, such as a potential Mars Sample Return (MSR) mission, in an intuitive and quantitative manner. In a complex mission, a common approach to increase the probability of success is to have redundancy and prepare backups. Quantitatively evaluating the utility of adding redundancy to a system is important but not straightforward, particularly when the failure of parallel subsystems are correlated.

  11. Multiplex PCR To Identify Macrolide Resistance Determinants in Mannheimia haemolytica and Pasteurella multocida

    DEFF Research Database (Denmark)

    Rose, Simon; Desmolaize, Benoit; Jaju, Puneet

    2012-01-01

    The bacterial pathogens Mannheimia haemolytica and Pasteurella multocida are major etiological agents in respiratory tract infections of cattle. Although these infections can generally be successfully treated with veterinary macrolide antibiotics, a few recent isolates have shown resistance...... to these drugs. Macrolide resistance in members of the family Pasteurellaceae is conferred by combinations of at least three genes: erm(42), which encodes a monomethyltransferase and confers a type I MLS(B) (macrolide, lincosamide, and streptogramin B) phenotype; msr(E), which encodes a macrolide efflux pump...

  12. Project for a high resolution magnetic spectrometer for heavy ions

    International Nuclear Information System (INIS)

    Birien, P.; Valero, S.

    1981-05-01

    The energy loss spectrometer presented in this report has an energy resolution of 2x10 -4 with the full solid angle of 5 msr. The maximum magnetic rigidity of the particles analysed is 2.88 Tesla-meters on the optical axis and the total acceptance in energy is 14%. Experiments with reaction angles near 0 0 are possible. Kinematic compensation is adapted to heavy ion physics. In this report, we have paid special attention to the simplicity of the construction and of the use of this spectrometer by experimentalists. This report is addressed both to non-specialists and to future users as well [fr

  13. The source term and waste optimization of molten salt reactors with processing

    International Nuclear Information System (INIS)

    Gat, U.; Dodds, H.L.

    1993-01-01

    The source term of a molten salt reactor (MSR) with fuel processing is reduced by the ratio of processing time to refueling time as compared to solid fuel reactors. The reduction, which can be one to two orders of magnitude, is due to removal of the long-lived fission products. The waste from MSRs can be optimized with respect to its chemical composition, concentration, mixture, shape, and size. The actinides and long-lived isotopes can be separated out and returned to the reactor for transmutation. These features make MSRs more acceptable and simpler in operation and handling

  14. Recommendations for a restart of Molten Salt Reactor development

    International Nuclear Information System (INIS)

    Moir, R. W.

    2007-01-01

    The concept of the molten salt reactor (MSR) refuses to go away. The Generation-IV process lists the MSR as one of the six concepts to be considered for extending fuel resources. Good fuel utilization and good economics are required to meet the often cited goal of 10 TWe globally and 1 TWe for the US by non-carbon energy sources in this century by nuclear fission. A strong incentive for the molten salt reactor design is its good fuel utilization, good economics, amazing flexibility and promised large benefits. It can: - use thorium or uranium; o be designed with lots of graphite to have a fairly thermal neutron spectrum or without graphite moderator to have a fast neutron spectrum reactor; - fission uranium isotopes and plutonium isotopes; - operate with non-weapon grade fissile fuel, or in suitable sites it can operate with enrichment between reactor-grade and weapon-grade fissile fuel; - be a breeder or near breeder; - operate at temperature >1100 degree C if carbon composites are successfully employed. Enhancing 2 32U content in the uranium to over 500 pm makes the fuel undesirable for weapons, but it should not detract from its economic use in liquid fuel reactors: a big advantage in nonproliferation. Economics of the MSR is enhanced by operating at low pressure and high temperature and may even lead to the preferred route to hydrogen production. The cost of the electricity produced from low enriched fuel averaged over the life of the entire process, has been predicted to be about 10% lower than that from LWRs, and 20% lower for high enriched fuel, with uncertainties of about 10%. The development cost has been estimated at about 1 B$ (e.g., a 100 M$/y base program for ten years) not including construction of a series of reactors leading up to the deployment of multiple commercial units at an assumed cost of 9 B$ (450 M$/y over 20 years). A benefit of liquid fuel is that smaller power reactors can faithfully test features of larger reactors, thereby reducing the

  15. In-situ reconstruction of the MSRs at the Beaver Valley Nuclear Power Station

    International Nuclear Information System (INIS)

    Deahna, S.T.; Yarden, A.L.; Tam, C.W.

    1992-01-01

    Moisture Separator Reheaters (MSRs) have been problem components at Beaver Valley Unit 1 since the initial plant start-up in 1976. Their performance had been ineffective and reheater tube reliability was becoming a limiting factor in MSR operation. Many of the problems encountered were common to the nuclear industry. In 1991, Duquesne Light performed a major overhaul of the Beaver Valley Unit 1 MSRs in an attempt to restore them to an acceptable level of performance. This paper summarizes the operating history, engineering redesign, field reconstruction, and subsequent performance of these MSRs

  16. DISEASE DETECTION FROM FIELD SPECTROMETER DATA

    Directory of Open Access Journals (Sweden)

    O. H. Tawfik

    2013-11-01

    Full Text Available ABSTRACT: Oil palm plants have been planted in large scale of areas. Ganoderma disease has been recognized and diagnosed in oil palm plants to infect almost half of the oil palm plants in Malaysia. To deal with this problem, the use of vegetation indices analysis on hyper spectral field data we will examine the ability of this data in discrimination between Ganoderma disease stages in oil palm plants which will be helpful in control the spread of the diseases. By using vegetation indices the oil palm plants could be classified into 1 (T1 healthy, 2 (T2 semi healthy and 3 (T3 severe damage plant classes accurately. The results showed that the best vegetation index is the Modified Red Edge Simple Ratio (MSR705 among the vegetation indices to discriminate between oil palm health stages. It was realized that the modification that was applied to the Modified Red Edge Simple Ratio (MSR705 index of Narrowband greenness VIs has been exhibited an acceptable results in differentiate between the oil palm plant stage 1 (T1 healthy and stage 2 (T2 semi healthy. ABSTRAK: Tanaman kelapa sawit ditanam secara meluas.  Penyakit ganoderma dikenali dan didiagnosikan menjangkiti hampir separuh tanaman kelapa sawit di Malaysia. Untuk mengawal penyakit ini daripada merebak, analisis indeks tanaman dijalankan ke atas data kawasan spektrum melampau di mana keupayaan data ini diuji dalam membezakan peringkat-peringkat penyakit Ganoderma terhadap tanaman kelapa sawit. Dengan menggunakan indeks tanaman, kelapa sawit dapat diklasifikasikan kepada 1 (T1 sihat, 2 (T2 separa sihat dan 3 (T3 rosak; kelas tanaman dengan tepat. Keputusan menunjukkan indeks tanaman terbaik sebagai Modified Red Edge Simple Ratio (MSR705 yang merupakan indeks tanaman dalam membezakan peringkat kesihatan kelapa sawit. Adalah didapati pengubahsuaian terhadap indeks Modified Red Edge Simple Ratio (MSR705 yang juga indeks Jalur Sempit Hijau VI telah memberikan keputusan yang munasabah dalam

  17. A Non-Proteinaceious Toxin from the Venomous Spines of the Lionfish Pterois Volitans (Linnaeus)

    Science.gov (United States)

    1985-01-01

    Spines of the Lionfish Pterois Volitans (Linnaeus) 6. PERFORMING ORG. REPORT NUMBER 7. AUTHOR(a) S. CONTRACT OR GRANT NUMBER(&) Nair, M.S.R. Cheung, P...and Identify by block number) Tinon Lionfish , Non-Proteinaceous Toxin, Ichthyotoxin 20. A9ST’ACT ? ( mt.e ,vmM N , mid ify by block nusmber) "!;The...COMMUNICATIONS A NON-PROTEINACEOUS TOXIN FROM THE VENOMOUS SPINES OF THE LIONFISH PTEROIS VOLITANS (LINNAEUS) 2 20 M. S. R. NAIR,’ PAUL CHEUNG, INA

  18. Seasonal and Annual Survival of East-Atlantic Pale-Bellied Brent Geese Branta hrota Assessed by Capture-Recapture Analysis

    DEFF Research Database (Denmark)

    Clausen, P.; Frederiksen, M.; Percival, S. M.

    2001-01-01

    areas by intensive field studies. In this paper we use standard capture-recapture analysis to investigate seasonal and annual survival rates of the population. We divided the year into three periods with different spatial distribution of the geese, autumn (September-December), winter (Jan...... spring to autumn (0.982 MSR), -resulting in an overall annual survival rate of 0.870. We discuss the variation in seasonal and annual mortality rates in relation to constraints faced by the birds such as seasonal changes in availability of food resources, severe winters, long-distance migration...

  19. Studies on components for a molten salt reactor

    International Nuclear Information System (INIS)

    Nejedly, M.; Matal, O.

    2003-01-01

    The aim is contribute to a design of selected components of molten salt reactors with fuel in the molten fluoride salt matrix. Molten salt reactors (MSRs) permit the utilization of plutonium and minor actinides as new nuclear fuel from a traditional nuclear power station with production of electric energy. Results of preliminary feasibility studies of an intermediate heat exchanger, a small power molten salt pump and a modular conception of a steam generator for a demonstration unit of the MSR (30 MW) are summarized. (author)

  20. Single room control for user-optimised room air conditions; Einzelraumregelung fuer nutzungsoptimiertes Raumklima

    Energy Technology Data Exchange (ETDEWEB)

    Lezius, A. [Staefa Control System GmbH, Leinfelden-Echterdingen (Germany)

    1995-12-31

    In chapter 14 of the anthology about building control the single room control for achieving user-optimised room air conditions is described. The following aspects are discussed: What is comfort? What is economic efficiency? Systems for secondary air treatment, adapted functions of the measurement and control technique, management functions, orientation of the demand at the use, investment and amortisation. (BWI) [Deutsch] Kapitel 14 des Sammelbandes ueber Building control ist dem Thema der Einzelraumregelung zur Erzielung eines nutzungsoptimierten Raumklimas gewidmet. In diesem Zusammenhang werden folgende Themenbereiche angesprochen: Was ist Komfort? Was ist Wirtschaftlichkeit? Systeme fuer sekundaere Luftbehandlung; Angepasste Funktionen der MSR-Technik; Managementfunktionen; Bedarfsorientierung an der Nutzung; Investition und Amortisation. (BWI)

  1. Upgrading the SPP-500-1 moisture separators-steam reheaters used in the Leningrad NPP turbine units

    Science.gov (United States)

    Legkostupova, V. V.; Sudakov, A. V.

    2015-03-01

    The specific features of existing designs of moisture separators-steam reheaters (MSRs) and experience gained with using them at nuclear power plants are considered. Main factors causing damage to and failures of MSRs are described: nonuniform distribution of wet steam flow among the separation modules, breakthrough of moisture through the separator (and sometimes also through the steam reheater), which may lead to the occurrence of additional thermal stresses and, hence, to thermal-fatigue damage to or stress corrosion cracking of metal. MSR failure results in a less efficient operation of the turbine unit as a whole and have an adverse effect on the reliability of the low-pressure cylinder's last-stage blades. By the time the design service life of the SPP-500-1 MSRs had been exhausted in power units equipped with RBMK-1000 reactors, the number of damages inflicted to both the separation part and to the pipework and heating surface tubes was so large, that a considerable drop of MSR effectiveness and turbine unit efficiency as a whole occurred. The design of the upgraded separation part used in the SPP-500-1 MSR at the Leningrad NPP is described and its effectiveness is shown, which was confirmed by tests. First, efforts taken to achieve more uniform distribution of moisture content over the perimeter and height of steam space downstream of the separation modules and to bring it to values close to the design ones were met with success. Second, no noticeable effect of the individual specific features of separation modules on the moisture content was revealed. Recommendations on elaborating advanced designs of moisture separators-steam reheaters are given: an MSR arrangement in which the separator is placed under or on the side from the steam reheater; axial admission of wet steam for ensuring its uniform distribution among the separation modules; inlet chambers with an extended preliminary separation system and devices for uniformly distributing steam flows in the

  2. Static Validation of Security Protocols

    DEFF Research Database (Denmark)

    Bodei, Chiara; Buchholtz, Mikael; Degano, P.

    2005-01-01

    We methodically expand protocol narrations into terms of a process algebra in order to specify some of the checks that need to be made in a protocol. We then apply static analysis technology to develop an automatic validation procedure for protocols. Finally, we demonstrate that these techniques ...... suffice to identify several authentication flaws in symmetric and asymmetric key protocols such as Needham-Schroeder symmetric key, Otway-Rees, Yahalom, Andrew secure RPC, Needham-Schroeder asymmetric key, and Beller-Chang-Yacobi MSR...

  3. Parents of two-phase flow and theory of "gas-lift"

    Science.gov (United States)

    Zitek, Pavel; Valenta, Vaclav

    2014-03-01

    This paper gives a brief overview of types of two-phase flow. Subsequently, it deals with their mutual division and problems with accuracy boundaries among particular types. It also shows the case of water flow through a pipe with external heating and the gradual origination of all kinds of flow. We have met it in solution of safety condition of various stages in pressurized and boiling water reactors. In the MSR there is a problem in the solution of gas-lift using helium as a gas and its secondary usage for clearing of the fuel mixture from gaseous fission products. Theory of gas-lift is described.

  4. Angular intensity of a gas-phase field ionization source

    International Nuclear Information System (INIS)

    Orloff, J.; Swanson, L.W.

    1979-01-01

    Angular intensities of 1 μA sr -1 have been measured for a gas-phase field ionization source in an optical column under practical operating conditions. The source, which was differentially pumped and cooled to 77 K, utilized a -oriented iridium emitter and precooled hydrogen gas at 10 -2 Torr. The ion beam was collimated with an electrostatic lens and detected below an aperture subtending 0.164 msr. A transmitted current of approx.10 -10 A was measured at voltages corresponding to a field of approx. =2.2 V/A at the emitter

  5. Modular approach for conversion to the ion-hybrid wave and α gyroresonance

    International Nuclear Information System (INIS)

    Kaufman, A.N.; Morehead, J.J.; Brizard, A.J.; Tracy, E.R.

    1997-01-01

    Linear conversion of an incoming magnetosonic wave (a.k.a. fast or compressional wave) to an ion-hybrid wave can be considered as a 3-step process in ray phase space. This is demonstrated by casting the cold-fluid model into the Friedland-Kaufman normal form for linear mode conversion. First, the incoming magnetosonic ray (MSR) converts a fraction of its action to an intermediate ion-hybrid ray (IHR), with the transmitted ray proceeding through the conversion layer. The IHR propagates in k-space to a second conversion point, where it converts in turn a fraction of its action into a reflected MSR, with the remainder of the its action constituting the converted IHR. The modular approach gives exact agreement with the more standard Budden formulation for the transmission, reflection and conversion coefficients, but has the important advantage of exposing the intermediate IHR. The existence of the intermediate IHR has important physical consequences as it can resonate with α particles. We estimate the time-integrated damping coefficient between the two conversions and show that ∫γdt is of order -100, thus the IH wave is completely annihilated between conversions and transfers its energy to the α close-quote s. This suggests that proposals to use the IH mode for current drive or DT heating are likely to fail in the presence of fusion α close-quote s. copyright 1997 American Institute of Physics

  6. Mesocarbon microbead based graphite for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, Yajuan, E-mail: yajuan.zhong@gmail.com [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); CAS Key Laboratory of Carbon Materials, Institute of Coal Chemistry, Chinese Academy of Sciences, Taiyuan 030001 (China); Zhang, Junpeng [CAS Key Laboratory of Carbon Materials, Institute of Coal Chemistry, Chinese Academy of Sciences, Taiyuan 030001 (China); Lin, Jun, E-mail: linjun@sinap.ac.cn [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Xu, Liujun [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhang, Feng; Xu, Hongxia; Chen, Yu; Jiang, Haitao; Li, Ziwei; Zhu, Zhiyong [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Guo, Quangui [CAS Key Laboratory of Carbon Materials, Institute of Coal Chemistry, Chinese Academy of Sciences, Taiyuan 030001 (China)

    2017-07-15

    Mesocarbon microbeads (MCMB) and quasi-isostatic pressing method were used to prepare MCMB based graphite (MG) for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor (MSR). Characteristics of mercury infiltration and molten salt infiltration in MG were investigated and compared with A3-3 (graphite for spherical fuel element in high temperature gas cooled reactor) to identify the infiltration behaviors. The results indicated that MG had a low porosity about 14%, and an average pore diameter of 96 nm. Fluoride salt occupation of A3-3 (average pore diameter was 760 nm) was 10 wt% under 6.5 atm, whereas salt gain did not infiltrate in MG even up to 6.5 atm. It demonstrated that MG could inhibit the infiltration of liquid fluoride salt effectively. Coefficient of thermal expansion (CTE) of MG lies in 6.01 × 10{sup −6} K{sup −1} (α{sub ∥}) and 6.15 × 10{sup −6} K{sup −1} (α{sub ⊥}) at the temperature range of 25–700 °C. The anisotropy factor of MG calculated by CTE maintained below 1.02, which could meet the requirement of the spherical fuel element (below 1.30). The constant isotropic property of MG is beneficial for the integrity and safety of the graphite used in the spherical fuel element for a MSR.

  7. A neuroanatomical predictor of mirror self-recognition in chimpanzees.

    Science.gov (United States)

    Hecht, E E; Mahovetz, L M; Preuss, T M; Hopkins, W D

    2017-01-01

    The ability to recognize one's own reflection is shared by humans and only a few other species, including chimpanzees. However, this ability is highly variable across individual chimpanzees. In humans, self-recognition involves a distributed, right-lateralized network including frontal and parietal regions involved in the production and perception of action. The superior longitudinal fasciculus (SLF) is a system of white matter tracts linking these frontal and parietal regions. The current study measured mirror self-recognition (MSR) and SLF anatomy in 60 chimpanzees using diffusion tensor imaging. Successful self-recognition was associated with greater rightward asymmetry in the white matter of SLFII and SLFIII, and in SLFIII's gray matter terminations in Broca's area. We observed a visible progression of SLFIII's prefrontal extension in apes that show negative, ambiguous, and compelling evidence of MSR. Notably, SLFIII's terminations in Broca's area are not right-lateralized or particularly pronounced at the population level in chimpanzees, as they are in humans. Thus, chimpanzees with more human-like behavior show more human-like SLFIII connectivity. These results suggest that self-recognition may have co-emerged with adaptations to frontoparietal circuitry. © The Author (2016). Published by Oxford University Press.

  8. Are horses capable of mirror self-recognition? A pilot study.

    Science.gov (United States)

    Baragli, Paolo; Demuru, Elisa; Scopa, Chiara; Palagi, Elisabetta

    2017-01-01

    Mirror Self-Recognition (MSR) unveils complex cognitive, social and emotional skills and it has been found only in humans and few other species, such as great apes, dolphins, elephants and magpies. In this pilot study, we tested if horses show the capacity of MSR. Four subjects living socially under naturalistic conditions were selected for the experiment. We adopted the classical mark test, which consists in placing a coloured mark on an out-of-view body part, visible only through mirror inspection. If the animal considers the image as its own, it will use its reflection to detect the mark and will try to explore it. We enhanced the classical paradigm by introducing a double-check control. Only in the presence of the reflecting surface, animals performed tactile and olfactory exploration of the mirror and looked behind it. These behaviors suggest that subjects were trying to associate multiple sensory cues (visual, tactile and olfactory) to the image in the mirror. The lack of correspondence between the collected stimuli in front of the mirror and the response to the colored mark lead us to affirm that horses are able to perceive that the reflected image is incongruent when compared with the memorized information of a real horse. However, without replication of data, the self-directed behavior towards the colored marks showed by our horses cannot be sufficient per se to affirm that horses are capable of self-recognition.

  9. Is Mars Sample Return Required Prior to Sending Humans to Mars?

    Science.gov (United States)

    Carr, Michael; Abell, Paul; Allwood, Abigail; Baker, John; Barnes, Jeff; Bass, Deborah; Beaty, David; Boston, Penny; Brinkerhoff, Will; Budney, Charles; hide

    2012-01-01

    Prior to potentially sending humans to the surface of Mars, it is fundamentally important to return samples from Mars. Analysis in Earth's extensive scientific laboratories would significantly reduce the risk of human Mars exploration and would also support the science and engineering decisions relating to the Mars human flight architecture. The importance of measurements of any returned Mars samples range from critical to desirable, and in all cases these samples will would enhance our understanding of the Martian environment before potentially sending humans to that alien locale. For example, Mars sample return (MSR) could yield information that would enable human exploration related to 1) enabling forward and back planetary protection, 2) characterizing properties of Martian materials relevant for in situ resource utilization (ISRU), 3) assessing any toxicity of Martian materials with respect to human health and performance, and 4) identifying information related to engineering surface hazards such as the corrosive effect of the Martian environment. In addition, MSR would be engineering 'proof of concept' for a potential round trip human mission to the planet, and a potential model for international Mars exploration.

  10. Methanol steam reforming over Pd/ZnO and Pd/CeO{sub 2} catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Ranganathan, Easwar S.; Bej, Shyamal K.; Thompson, Levi T. [University of Michigan, Department of Chemical Engineering, 3026 H.H. Dow Building, 2300 Hayward Avenue, Ann Arbor, MI 48109-2136 (United States)

    2005-08-10

    The goal of work described in this paper was to better understand the methanol steam reforming (MSR) activity and selectivity patterns of ZnO and CeO{sub 2} supported Pd catalysts. This reaction is being used to produce H{sub 2}-rich gas for a number of applications including hydrogen fuel cells. The Pd/ZnO catalysts had lower MSR rates but were more selective for the production of CO{sub 2} than the Pd/CeO{sub 2} catalysts. The CH{sub 3}OH conversion rates were proportional to the H{sub 2} chemisorption uptake suggesting that the rate determining step was catalyzed by Pd. The corresponding turnover frequencies averaged 0.8+/-0.3s{sup -1} and 0.4+/-0.2s{sup -1} at 230{sup o}C for the Pd/ZnO and Pd/CeO{sub 2} catalysts, respectively. The selectivities are explained based on the reaction pathways, and characteristics of the support. The key surface intermediate appeared to be a formate. The ZnO supported catalysts had a higher density of acidic sites and favored pathways where the intermediate was converted to CO{sub 2} while the CeO{sub 2} supported catalysts had a higher density of basic sites and favored the production of CO.

  11. Scenarios and innovative systems

    International Nuclear Information System (INIS)

    2001-11-01

    The purpose of this workshop is to present to the GEDEON community the scenarios for the deployment of innovative nuclear solutions. Both steady state situations and possible transitions from the present to new reactors and fuel cycles are considered. Innovative systems that satisfy improved natural resource utilization and waste minimization criteria will be described as well as the R and D orientations of various partners. This document brings together the transparencies of 17 communications given at this workshop: general policy for transmutation and partitioning; Amster: a molten salt reactor (MSR) concept; MSR capabilities; potentials and capabilities of accelerator driven systems (ADS); ADS demonstrator interest as an experimental facility; innovative systems: gas coolant technologies; Pu management in EPR; scenarios with thorium fuel; scenarios at the equilibrium state; scenarios for transition; partitioning and specific conditioning; management of separated radio-toxic elements; European programs; DOE/AAA (Advanced Accelerator Applications) program; OECD scenario studies; CEA research programs and orientations; partitioning and transmutation: an industrial point of view. (J.S.)

  12. Common for heating boilers, planned for air conditioning plants: Transfer of intelligence to the field level; Bei Heizkesseln ueblich, fuer Klimaanlagen im Kommen: Verlagerung der Intelligenz in die Feldebene

    Energy Technology Data Exchange (ETDEWEB)

    Baumgarth, S.; Schernus, G.P. [Institut fuer Verbrennungstechnik und Prozessautomation, Fachhochschule Braunschweig/Wolfenbuettel (Germany)

    2002-11-01

    Central switching plants and a highly individual design of the MSR-technology and the programming continue to be standard for the control of ventilation and air condition plants. In the field of heating boilers it generally became established several years ago, to transfer the control and supervision function directly to the plant component. The disadvantage very often proved to be, that an integration into the building control technology was only limited and could only be realised at high costs. Due to the introduction of the open bus technology in the field of building automation, these interface problems do not any longer occur and it proves to be useful to transfer the intelligence for ventilation and air condition plants to the field level as well. (orig.) [German] Zur Steuerung und Regelung von Lueftungs- und Klimaanlagen sind zentrale Schaltanlagen und eine hohe Individualitaet bei der Ausfuehrung der MSR-Technik und der Programmierung noch aktueller Standard. Bei Heizkesseln hat es sich hingegen bereits vor mehreren Jahren durchgesetzt, die Steuerungs- und Ueberwachungsfunktionen direkt an das betreffende Anlagenteil zu verlagern. Nachteilig war allerdings oftmals, dass eine Einbindung in die Gebaeudeleittechnik nur begrenzt oder mit hohem Kostenaufwand verbunden, moeglich war. Durch den Einzug der offenen Bustechnologie in die Gebaeudeautomation entfallen derartige Schnittstellenprobleme und es bietet sich an, auch fuer die Lueftungs- und Klimaanlagen die Verlagerung der Intelligenz in die Feldebene vorzunehmen. (orig.)

  13. On the study of fragments from heavy ion collisions

    International Nuclear Information System (INIS)

    Nolte, H.M.

    1989-06-01

    In order to study the mechanism of nucleus nucleus collisions, a dedicated apparaturs was built. The detectors have large solid angles (17 msr each), and are therefore good tools for coincidence measurements. Also time of flight measurements were possible. The developed ionization chamber showed a good charge resolution up to Z ≅ 20. With this new developed apparatus coincidence measurements with a relative large solid angle of 27 msr and time of flight measurements for mass determination were performed. The following reactions were studied (E 0 = 1012.4 MeV): Inclusive measurements: A( 32 S,f)X with A = 51 V, 109 Ag, 197 Au and 238 U. The angles θ lab (f) were: +17 0 , -35 0 , +53 0 , -71 0 , +89 0 and -107 0 . Coincidence measurements: A( 32 S;f 1 ,f 2 )X with A = 109 Ag and 197 Au, with θ(f 1 ) = 17 0 and θ(f 2 ) = -35 0 . The fragments were separated with respect to their charge number up to Z = 16. The ejectile mass was determined with the time of flight measurements at 17 0 . (orig./HSI) [de

  14. Mixed Sequence Reader: A Program for Analyzing DNA Sequences with Heterozygous Base Calling

    Science.gov (United States)

    Chang, Chun-Tien; Tsai, Chi-Neu; Tang, Chuan Yi; Chen, Chun-Houh; Lian, Jang-Hau; Hu, Chi-Yu; Tsai, Chia-Lung; Chao, Angel; Lai, Chyong-Huey; Wang, Tzu-Hao; Lee, Yun-Shien

    2012-01-01

    The direct sequencing of PCR products generates heterozygous base-calling fluorescence chromatograms that are useful for identifying single-nucleotide polymorphisms (SNPs), insertion-deletions (indels), short tandem repeats (STRs), and paralogous genes. Indels and STRs can be easily detected using the currently available Indelligent or ShiftDetector programs, which do not search reference sequences. However, the detection of other genomic variants remains a challenge due to the lack of appropriate tools for heterozygous base-calling fluorescence chromatogram data analysis. In this study, we developed a free web-based program, Mixed Sequence Reader (MSR), which can directly analyze heterozygous base-calling fluorescence chromatogram data in .abi file format using comparisons with reference sequences. The heterozygous sequences are identified as two distinct sequences and aligned with reference sequences. Our results showed that MSR may be used to (i) physically locate indel and STR sequences and determine STR copy number by searching NCBI reference sequences; (ii) predict combinations of microsatellite patterns using the Federal Bureau of Investigation Combined DNA Index System (CODIS); (iii) determine human papilloma virus (HPV) genotypes by searching current viral databases in cases of double infections; (iv) estimate the copy number of paralogous genes, such as β-defensin 4 (DEFB4) and its paralog HSPDP3. PMID:22778697

  15. MULTIVARIABLE ANALYSIS OF 2,4-D HERBICIDE PHOTOCATALYTIC DEGRADATION

    Directory of Open Access Journals (Sweden)

    ANDRÉS F. LÓPEZ-VÁSQUEZ

    2011-01-01

    Full Text Available La degradación del herbicida 2,4-D en suspensiones de TiO2 en agua real fue evaluada bajo condiciones de irradiación artificial. El análisis multivariable de metodología de superficie de respuesta (MSR, se aplicó para evaluar el efecto de variables como la concentración de catalizador y pesticida, el pH y el caudal volumétrico sobre la reacción fotocatalítica en dos fotorreactores catalíticos: placa plana y tubular. La variable de respuesta fue la mineralización del pesticida expresada como porcentaje de degradación de carbono orgánico total (COT después de cuatro horas de irradiación. Para el fotorreactor tubular, los cuatro factores tuvieron la misma significancia sobre la degradación, mientras que para el fotorreactor de placa plana inclinada, sólo la concentración de catalizador y el pH tuvieron significancia. La MSR fue una técnica adecuada para obtener parámetros de operación óptimos de un proceso fotocatalítico con un reactor específico y dentro de un rango de estudio determinado.

  16. Mesocarbon microbead based graphite for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor

    International Nuclear Information System (INIS)

    Zhong, Yajuan; Zhang, Junpeng; Lin, Jun; Xu, Liujun; Zhang, Feng; Xu, Hongxia; Chen, Yu; Jiang, Haitao; Li, Ziwei; Zhu, Zhiyong; Guo, Quangui

    2017-01-01

    Mesocarbon microbeads (MCMB) and quasi-isostatic pressing method were used to prepare MCMB based graphite (MG) for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor (MSR). Characteristics of mercury infiltration and molten salt infiltration in MG were investigated and compared with A3-3 (graphite for spherical fuel element in high temperature gas cooled reactor) to identify the infiltration behaviors. The results indicated that MG had a low porosity about 14%, and an average pore diameter of 96 nm. Fluoride salt occupation of A3-3 (average pore diameter was 760 nm) was 10 wt% under 6.5 atm, whereas salt gain did not infiltrate in MG even up to 6.5 atm. It demonstrated that MG could inhibit the infiltration of liquid fluoride salt effectively. Coefficient of thermal expansion (CTE) of MG lies in 6.01 × 10 −6 K −1 (α ∥ ) and 6.15 × 10 −6 K −1 (α ⊥ ) at the temperature range of 25–700 °C. The anisotropy factor of MG calculated by CTE maintained below 1.02, which could meet the requirement of the spherical fuel element (below 1.30). The constant isotropic property of MG is beneficial for the integrity and safety of the graphite used in the spherical fuel element for a MSR.

  17. Creep resistance and material degradation of a candidate Ni–Mo–Cr corrosion resistant alloy

    Energy Technology Data Exchange (ETDEWEB)

    Shrestha, Sachin L., E-mail: sachin@ansto.gov.au [Institute of Materials Engineering, Australian Nuclear Science and Technology Organisation (ANSTO), Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia); Bhattacharyya, Dhriti [Institute of Materials Engineering, Australian Nuclear Science and Technology Organisation (ANSTO), Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia); Yuan, Guangzhou; Li, Zhijun J. [Center of Thorium Molten Salts Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences (China); Budzakoska-Testone, Elizabeth; De Los Reyes, Massey; Drew, Michael; Edwards, Lyndon [Institute of Materials Engineering, Australian Nuclear Science and Technology Organisation (ANSTO), Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia)

    2016-09-30

    This study investigated the creep deformation properties of GH3535, a Ni–Mo–Cr corrosion resistant structural alloy being considered for use in future Gen IV molten salt nuclear reactors (MSR) operating at around 700 °C. Creep testing of the alloy was conducted at 650–750 °C under applied stresses between 85–380 MPa. From the creep rupture results the long term creep strain and rupture life of the alloy were estimated by applying the Dorn Shepard and Larson Miller time-temperature parameters and the alloy's allowable ASME design stresses at the MSR's operating temperature were evaluated. The material's microstructural degradation at creep rupture was characterised using scanning electron microscopy (SEM), electron backscatter diffraction (EBSD) and transmission electron microscopy (TEM). The microstructural study revealed that the material failure was due to wedge cracking at triple grain boundary points and cavitation at coarse secondary grain boundary precipitates, nucleated and grown during high temperature exposure, leading to intergranular crack propagation. EBSD local misorientation maps clearly show that the root cause of cavitation and crack propagation was due to large strain localisation at the grain boundaries and triple points instigated by grain boundary sliding during creep deformation. This caused the grain boundary decohesion and subsequent material failure.

  18. Transient core characteristics of small molten salt reactor coupling problem between heat transfer/flow and nuclear fission reaction

    International Nuclear Information System (INIS)

    Yamamoto, Takahisa; Mitachi, Koshi

    2004-01-01

    This paper performed the transient core analysis of a small Molten Salt Reactor (MSR). The emphasis is that the numerical model employed in this paper takes into account the interaction among fuel salt flow, nuclear reaction and heat transfer. The model consists of two group diffusion equations for fast and thermal neutron fluexs, balance equations for six-group delayed neutron precursors and energy conservation equations for fuel salt and graphite moderator. The results of transient analysis are that (1) fission reaction (heat generation) rate significantly increases soon after step reactivity insertion, e.g., the peak of fission reaction rate achieves about 2.7 times larger than the rated power 350 MW when the reactivity of 0.15% Δk/k 0 is inserted to the rated state, and (2) the self-control performance of the small MSR effectively works under the step reactivity insertion of 0.56% Δk/k 0 , putting the fission reaction rate back on the rated state. (author)

  19. Vehicle Position Estimation Based on Magnetic Markers: Enhanced Accuracy by Compensation of Time Delays

    Directory of Open Access Journals (Sweden)

    Yeun-Sub Byun

    2015-11-01

    Full Text Available The real-time recognition of absolute (or relative position and orientation on a network of roads is a core technology for fully automated or driving-assisted vehicles. This paper presents an empirical investigation of the design, implementation, and evaluation of a self-positioning system based on a magnetic marker reference sensing method for an autonomous vehicle. Specifically, the estimation accuracy of the magnetic sensing ruler (MSR in the up-to-date estimation of the actual position was successfully enhanced by compensating for time delays in signal processing when detecting the vertical magnetic field (VMF in an array of signals. In this study, the signal processing scheme was developed to minimize the effects of the distortion of measured signals when estimating the relative positional information based on magnetic signals obtained using the MSR. In other words, the center point in a 2D magnetic field contour plot corresponding to the actual position of magnetic markers was estimated by tracking the errors between pre-defined reference models and measured magnetic signals. The algorithm proposed in this study was validated by experimental measurements using a test vehicle on a pilot network of roads. From the results, the positioning error was found to be less than 0.04 m on average in an operational test.

  20. Assessment of coronary arteries in infants by 64-detector-row multislice spiral computed tomography

    International Nuclear Information System (INIS)

    Tahara, Masahiro; Waki, Chiaki; Komatsu, Hiroaki; Hayashi, Tomohiro; Sato, Tomoyasu

    2008-01-01

    Heart rate is one of the most important factors for optimal visualization of cardiac CT. We investigated the relation between heart rate and visibility of the coronary arteries with 64-detector row multislice spiral computed tomography (MSCT). Three simulated coronary artery stenosis models (3, 4, and 5 mm) were attached to a moving heart phantom and scanned using 64-detector row MSCT. The heart rate of the phantom was varied between 60 and 150 beats per minutes (bpm). The visibility of simulated coronary arteries was assessed in comparison between cardiac half reconstruction (CHR) and multi-sector reconstruction (MSR). Then contrast-enhanced 64-detector row MSCT was performed in 16 patients under 3 years of age with congenital heart disease and Kawasaki disease without heart rate control. The visibility of coronary artery segments was graded on a three-point scale. The simulated coronary artery patency was detected in the moving phantom at maximum heart rate (150 bpm) with MSR. Minimum lumen diameter was 0.75 mm. Electrocardiogram (ECG)-gated cardiac CT was performed in 9 patients, and non-ECG-gated cardiac CT was performed in 7 patients. The origin and proximal course of coronary arteries in all 9 patients with ECG-gated acquisition were visually evaluated. 64-detector row MSCT with ECG-gated acquisition is able to visualize the origin and proximal course of coronary arteries in infants under 3 years of age. (author)

  1. Solubilization properties of polycyclic aromatic hydrocarbons by saponin, a plant-derived biosurfactant

    Energy Technology Data Exchange (ETDEWEB)

    Zhou Wenjun, E-mail: wenjunzhou@zju.edu.cn [Department of Environmental Science, Zhejiang University, Hangzhou, Zhejiang 310028 (China); Zhejiang Provincial Key Laboratory of Organic Pollution Process and Control, Hangzhou, Zhejiang 310028 (China); Yang Juanjuan; Lou Linjie [Department of Environmental Science, Zhejiang University, Hangzhou, Zhejiang 310028 (China); Zhu Lizhong [Department of Environmental Science, Zhejiang University, Hangzhou, Zhejiang 310028 (China); Zhejiang Provincial Key Laboratory of Organic Pollution Process and Control, Hangzhou, Zhejiang 310028 (China)

    2011-05-15

    The enhanced solubilization of polycyclic aromatic hydrocarbons (PAHs) by saponin, a plant-derived non-ionic biosurfactant, was investigated. The results indicated that the solubilization capabilities of saponin for PAHs were greater than some representative synthetic non-ionic surfactants and showed strong dependence on solution pH and ionic strength. The molar solubilization ratio (MSR) of saponin for phenanthrene was about 3-6 times of those of the synthetic non-ionic surfactants, and decreased by about 70% with the increase of solution pH from 4.0 to 8.0, but increased by approximately 1 times with NaCl concentration increased from 0.01 to 1.0 M. Heavy metal ions can enhance saponin solubilization for phenanthrene and the corresponding MSR values increased by about 25% with the presence of 0.01 M of Cd{sup 2+} or Zn{sup 2+}. Saponin is more effective in enhancing PAHs solubilization than synthetic non-ionic surfactants and has potential application in removing organic pollutants from contaminated soils. - Highlights: > The enhanced solubilization of PAHs by saponin was investigated in this study. > Saponin showed great solubilization capability for PAHs. > Saponin is more effective in enhancing HOCs solubilization at lower solution pH. > Increasing ionic strength can enhance HOCs solubilization in saponin solution. > Heavy metal ions can also enhance phenanthrene solubilization in saponin solution. - Saponin showed different solubilization properties for PAHs from the synthetic non-ionic surfactants and anionic rhamnolipid biosurfactants.

  2. Solubilization properties of polycyclic aromatic hydrocarbons by saponin, a plant-derived biosurfactant

    International Nuclear Information System (INIS)

    Zhou Wenjun; Yang Juanjuan; Lou Linjie; Zhu Lizhong

    2011-01-01

    The enhanced solubilization of polycyclic aromatic hydrocarbons (PAHs) by saponin, a plant-derived non-ionic biosurfactant, was investigated. The results indicated that the solubilization capabilities of saponin for PAHs were greater than some representative synthetic non-ionic surfactants and showed strong dependence on solution pH and ionic strength. The molar solubilization ratio (MSR) of saponin for phenanthrene was about 3-6 times of those of the synthetic non-ionic surfactants, and decreased by about 70% with the increase of solution pH from 4.0 to 8.0, but increased by approximately 1 times with NaCl concentration increased from 0.01 to 1.0 M. Heavy metal ions can enhance saponin solubilization for phenanthrene and the corresponding MSR values increased by about 25% with the presence of 0.01 M of Cd 2+ or Zn 2+ . Saponin is more effective in enhancing PAHs solubilization than synthetic non-ionic surfactants and has potential application in removing organic pollutants from contaminated soils. - Highlights: → The enhanced solubilization of PAHs by saponin was investigated in this study. → Saponin showed great solubilization capability for PAHs. → Saponin is more effective in enhancing HOCs solubilization at lower solution pH. → Increasing ionic strength can enhance HOCs solubilization in saponin solution. → Heavy metal ions can also enhance phenanthrene solubilization in saponin solution. - Saponin showed different solubilization properties for PAHs from the synthetic non-ionic surfactants and anionic rhamnolipid biosurfactants.

  3. Scenarios and innovative systems; Scenarii et systemes innovants

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-11-01

    The purpose of this workshop is to present to the GEDEON community the scenarios for the deployment of innovative nuclear solutions. Both steady state situations and possible transitions from the present to new reactors and fuel cycles are considered. Innovative systems that satisfy improved natural resource utilization and waste minimization criteria will be described as well as the R and D orientations of various partners. This document brings together the transparencies of 17 communications given at this workshop: general policy for transmutation and partitioning; Amster: a molten salt reactor (MSR) concept; MSR capabilities; potentials and capabilities of accelerator driven systems (ADS); ADS demonstrator interest as an experimental facility; innovative systems: gas coolant technologies; Pu management in EPR; scenarios with thorium fuel; scenarios at the equilibrium state; scenarios for transition; partitioning and specific conditioning; management of separated radio-toxic elements; European programs; DOE/AAA (Advanced Accelerator Applications) program; OECD scenario studies; CEA research programs and orientations; partitioning and transmutation: an industrial point of view. (J.S.)

  4. Numerical analysis method for reheater performance of moisture separator reheater for Nuclear Power Plants

    International Nuclear Information System (INIS)

    Oda, Tsuyoshi; Fujisawa, Kyosuke; Akamatsu, Hiroshi

    2014-01-01

    Nuclear power generation uses saturated steam of 6 MPa and 275degC level due to the restrictions imposed by the materials used in the nuclear reactor, and its efficiency, approximately 33-35%, is not high compared with fossil fuel power generation. Therefore, thermal engineers working on nuclear power generation have the important responsibility toward society of achieving the highest efficiency under the given restrictions. The use of a moisture separator reheater (MSR) is one of the measures we can take to achieve higher efficiency. Because the bottom of the MSR tube bundle making contact with the cycle steam at its lowest temperature is subcooled and inadequate drainage of the condensate inside the tubes causes cyclic flooding and temperature oscillations in some cases, it is necessary to have a minimum flow rate of excess heating steam slightly beyond the demand of/what is required for the heat transfer, and the consequent subcooling must be kept below a certain level. This report describes the numerical analysis method developed for the design of heat transfer performance and evaluation of the tube bundle integrity of MSRs. (author)

  5. Design, fabrication and performance evaluation of an integrated reformed methanol fuel cell for portable use

    Science.gov (United States)

    Zhang, Shubin; Zhang, Yufeng; Chen, Junyu; Yin, Congwen; Liu, Xiaowei

    2018-06-01

    In this paper, an integrated reformed methanol fuel cell (RMFC) as a portable power source is designed, fabricated and tested. The RMFC consists of a methanol steam reformer (MSR), a high temperature proton exchange membrane fuel cell (HT-PEMFC) stack, a microcontroller unit (MCU) and other auxiliaries. First, a system model based on Matlab/Simulink is established to investigate the mass and energy transport characteristics within the whole system. The simulation results suggest a hydrogen flow rate of at least 670 sccm is needed for the system to output 30 W and simultaneously maintain thermal equilibrium. Second, a metallic MSR and an HT-PEMFC stack with 12 cells are fabricated and tested. The tests show that the RMFC system is able to function normally when the performances of all the components meet the minimum requirements. At last, in the experiment of successfully powering a laptop, the RMFC system exhibits a stable performance during the complete work flow of all the phases, namely start-up, output and shutdown. Moreover, with a conservative design of 20 W power rating, maximum energy conversion efficiency of the RMFC system can be achieved (36%), and good stability in long-term operation is shown.

  6. Modeling and parametric simulations of solid oxide fuel cells with methane carbon dioxide reforming

    International Nuclear Information System (INIS)

    Ni, Meng

    2013-01-01

    Highlights: ► A 2D model is developed for solid oxide fuel cells (SOFCs). ► CH 4 reforming by CO 2 (MCDR) is included. ► SOFC with MCDR shows comparable performance with methane steam reforming SOFC. ► Increasing CO electrochemical oxidation greatly enhances the SOFC performance. ► Effects of potential and temperature on SOFC performance are also discussed. - Abstract: A two-dimensional model is developed to simulate the performance of solid oxide fuel cells (SOFCs) fed with CO 2 and CH 4 mixture. The electrochemical oxidations of both CO and H 2 are included. Important chemical reactions are considered in the model, including methane carbon dioxide reforming (MCDR), reversible water gas shift reaction (WGSR), and methane steam reforming (MSR). It’s found that at a CH 4 /CO 2 molar ratio of 50/50, MCDR and reversible WGSR significantly influence the cell performance while MSR is negligibly small. The performance of SOFC fed with CO 2 /CH 4 mixture is comparable to SOFC running on CH 4 /H 2 O mixtures. The electric output of SOFC can be enhanced by operating the cell at a low operating potential or at a high temperature. In addition, the development of anode catalyst with high activity towards CO electrochemical oxidation is important for SOFC performance enhancement. The model can serve as a useful tool for optimization of the SOFC system running on CH 4 /CO 2 mixtures

  7. Development status and potential program for development of proliferation-resistant molten-salt reactors

    International Nuclear Information System (INIS)

    Engel, J.R.; Bauman, H.F.; Dearing, J.F.; Grimes, W.R.; McCoy, H.E. Jr.

    1979-03-01

    Preliminary studies of existing and conceptual molten-salt reactor (MSR) designs have led to the identification of conceptual systems that are technologically attractive when operated with denatured uranium as the principal fissile fuel. These denatured MSRs would also have favorable resource-utilization characteristics and substantial resistance to proliferation of weapons-usable nuclear materials. The report presents a summary of the current status of technology and a discussion of the major technical areas of a possible base program to develop commercial denatured MSRs. The general areas treated are (1) reactor design and development, (2) safety and safety related technology, (3) fuel-coolant behavior and fuel processing, and (4) reactor materials. A substantial development effort could lead to authorization for construction of a molten-salt test reactor about 5 years after the start of the program and operation of the unit about 10 years later. A prototype commercial denatured MSR could be expected to begin operating 25 years from the start of the program. The postulated base program would extend over 32 years and would cost about $700 million (1978 dollars, unescalated). Additional costs to construct the MSTR, $600 million, and the prototype commercial plant, $1470 million, would bring the total program cost to about $2.8 billion. Additional allowances probably should be made to cover contingencies and incidental technology areas not explicitly treated in this preliminary review

  8. Steady state investigation on neutronics of a molten salt reactor considering the flow effect of fuel salt

    International Nuclear Information System (INIS)

    Zhang Dalin; Qiu Suizheng; Su Guanghui; Liu Changliang

    2008-01-01

    The Molten Salt Reactor (MSR), one of the 'Generation IV' concepts, is a liquid-fuel reactor, which is different from the conventional reactors using solid fissile materials due to the flow effect of fuel salt. The study on its neutronics considering the fuel salt flow, which is the base of the thermal-hydraulic calculation and safety analysis, must be done. In this paper, the theoretical model on neutronics under steady condition for a single-liquid-fueled MSR is conducted and calculated by numerical method. The neutronics model consists of two group neutron diffusion equations for fast and thermal neutron fluxes, and balance equations for six-group delayed neutron precursors considering the flow effect of fuel salt. The spatial discretization of the above models is based on the finite volume method, and the discretization equations are computed by the source iteration method. The distributions of neutron fluxes and the distributions of the delayed neutron precursors in the core are obtained. The numerical calculated results show that, the fuel salt flow has little effect on the distribution of fast and thermal neutron fluxes and the effective multiplication factor; however, it affects the distribution of the delayed neutron precursors significantly, especially the long-lived one. In addition, it could be found that the delayed neutron precursors influence the neutronics slightly under the steady condition. (authors)

  9. Steady state investigation on neutronics of a molten salt reactor considering the flow effect of fuel salt

    Institute of Scientific and Technical Information of China (English)

    ZHANG Da-Lin; QIU Sui-Zheng; LIU Chang-Liang; SU Guang-Hui

    2008-01-01

    The Molten Salt Reactor (MSR),one of the‘Generation Ⅳ'concepts,is a liquid-fuel reactor,which is different from the conventional reactors using solid fissile materials due to the flow effect of fuel salt.The study on its neutronice considering the fuel salt flow,which is the base of the thermal-hydraulic calculation and safety analysis,must be done.In this paper,the theoretical model on neutronics under steady condition for a single-liquid-fueled MSR is conducted and calculated by numerical method.The neutronics model consists of two group neutron diffusion equations for fast and thermal neutron fluxes,and balance equations for six-group delayed neutron precursors considering the flow effect of fuel salt. The spatial discretization of the above models is based on the finite volume method,and the discretization equations are computed by the source iteration method.The distributions of neutron fluxes and the distributions of the delayed neutron precursors in the core are obtained.The numerical calculated results show that,the fuel salt flow has little effect on the distribution of fast and thermal neutron fluxes and the effective multiplication factor;however,it affects the distribution of the delayed neutron precursors significantly,especially the long-lived one.In addition,it could be found that the delayed neutron precursors influence the nentronics slightly under the steady condition.

  10. Comparison of Simultaneous Nitrification and Denitrification for Three Different Reactors

    Directory of Open Access Journals (Sweden)

    W. Khanitchaidecha

    2015-01-01

    Full Text Available Discharge of high NH4-N containing wastewater into water bodies has become a critical and serious issue due to its negative impact on water and environmental quality. In this research, the performance of three different reactors was assessed and compared with regard to the removal of NH4-N from wastewater. The highest nitrogen removal efficiency of 98.3% was found when the entrapped sludge reactor (ESR, in which the sludge was entrapped in polyethylene glycol polymer, was used. Under intermittent aeration, nitrification and denitrification occurred simultaneously in the aerobic and anaerobic periods. Moreover, internal carbon was consumed efficiently for denitrification. On the other hand, internal carbon consumption was not found to occur in the suspended sludge reactor (SSR and the mixed sludge reactor (MSR and this resulted in nitrogen removal efficiencies of SSR and MSR being 64.7 and 45.1%, respectively. Nitrification and denitrification were the main nitrogen removal processes in the aerobic and anaerobic periods, respectively. However, due to the absence of sufficient organic carbon, denitrification was uncompleted resulting in high NO3-N contents in the effluent.

  11. Molecular markers validation to drought resistance in wheat meal (Triticum aestivum L. under greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Gabriel Julio

    2013-08-01

    Full Text Available With the aim to study the genetic resistance to drought and validate molecular markers co-localized with genes/QTLs for this factor, 16 varieties were evaluated as well as advanced lines of wheat meal (Triticum aestivum in two stages of crop development. Physiological parameters were considered: amount of chlorophyll (clo, wilting or severity degree (SEV and recovery (reco, morphological parameters: foliage dry matter (FDM and root dry matter (RDM, the integrated resistance mechanisms: water use efficiency (WUE, other parameters: number of grains (Ngrain and grain weight (Wgrain, biochemical parameters: Catalaza (CAT, Ascorbate Peroxidase (APX and Guaiacol Peroxidase (POX and three microsatellite markers (Xwmc603, Xwmc596, Xwmc9. Results showed significant differences for MSR and Ngrain. It was observed that Anzaldo, ERR2V.L-20, EARII2V.L-5, EARIZV.L-11, ERR2V.L-11 and EE2V.L-19 were the most resistant to drough water stress. There was a highly significant negative correlation between the MSR and Ngrain. All other variables showed low and non-significant correlations. In biochemical analyzes, the Anzaldo variety showed an increased enzymatic activity compared to controls in all cases (CAT-APX and POX, being the most resistant to water stress by drought. Finally, it was found that SSR markers (Xwmc596 and Xwmc9 are co-located with the gene / QTL of drought resistance and can be used for marker-assisted selection.

  12. Modeling report of DYMOND code (DUPIC version)

    International Nuclear Information System (INIS)

    Park, Joo Hwan; Yacout, Abdellatif M.

    2003-04-01

    The DYMOND code employs the ITHINK dynamic modeling platform to assess the 100-year dynamic evolution scenarios for postulated global nuclear energy parks. Firstly, DYMOND code has been developed by ANL(Argonne National Laboratory) to perform the fuel cycle analysis of LWR once-through and LWR-FBR mixed plant. Since the extensive application of DYMOND code has been requested, the first version of DYMOND has been modified to adapt the DUPIC, MSR and RTF fuel cycle. DYMOND code is composed of three parts; the source language platform, input supply and output. But those platforms are not clearly distinguished. This report described all the equations which were modeled in the modified DYMOND code (which is called as DYMOND-DUPIC version). It divided into five parts;Part A deals model in reactor history which is included amount of the requested fuels and spent fuels. Part B aims to describe model of fuel cycle about fuel flow from the beginning to the end of fuel cycle. Part C is for model in re-processing which is included recovery of burned uranium, plutonium, minor actinide and fission product as well as the amount of spent fuels in storage and disposal. Part D is for model in other fuel cycle which is considered the thorium fuel cycle for MSR and RTF reactor. Part E is for model in economics. This part gives all the information of cost such as uranium mining cost, reactor operating cost, fuel cost etc

  13. Modeling report of DYMOND code (DUPIC version)

    Energy Technology Data Exchange (ETDEWEB)

    Park, Joo Hwan [KAERI, Taejon (Korea, Republic of); Yacout, Abdellatif M [Argonne National Laboratory, Ilinois (United States)

    2003-04-01

    The DYMOND code employs the ITHINK dynamic modeling platform to assess the 100-year dynamic evolution scenarios for postulated global nuclear energy parks. Firstly, DYMOND code has been developed by ANL(Argonne National Laboratory) to perform the fuel cycle analysis of LWR once-through and LWR-FBR mixed plant. Since the extensive application of DYMOND code has been requested, the first version of DYMOND has been modified to adapt the DUPIC, MSR and RTF fuel cycle. DYMOND code is composed of three parts; the source language platform, input supply and output. But those platforms are not clearly distinguished. This report described all the equations which were modeled in the modified DYMOND code (which is called as DYMOND-DUPIC version). It divided into five parts;Part A deals model in reactor history which is included amount of the requested fuels and spent fuels. Part B aims to describe model of fuel cycle about fuel flow from the beginning to the end of fuel cycle. Part C is for model in re-processing which is included recovery of burned uranium, plutonium, minor actinide and fission product as well as the amount of spent fuels in storage and disposal. Part D is for model in other fuel cycle which is considered the thorium fuel cycle for MSR and RTF reactor. Part E is for model in economics. This part gives all the information of cost such as uranium mining cost, reactor operating cost, fuel cost etc.

  14. Macrophage heterogeneity and cholesterol homeostasis: classically-activated macrophages are associated with reduced cholesterol accumulation following treatment with oxidized LDL.

    Science.gov (United States)

    Chu, Eugene M; Tai, Daven C; Beer, Jennifer L; Hill, John S

    2013-02-01

    Macrophages are centrally involved during atherosclerosis development and are the predominant cell type that accumulates cholesterol in the plaque. Macrophages however, are heterogeneous in nature reflecting a variety of microenvironments and different phenotypes may be more prone to contribute towards atherosclerosis progression. Using primary human monocyte-derived macrophages, we sought to evaluate one aspect of atherogenic potential of different macrophage phenotypes by determining their propensity to associate with and accumulate oxidized low density lipoprotein (oxLDL). Classically-activated macrophages treated simultaneously with interferon γ (IFNγ) and tumor necrosis factor α (TNFα) associated with less oxLDL and accumulated less cholesterol compared to untreated controls. The combined treatment of IFNγ and TNFα reduced the mRNA expression of CD36 and the expression of both cell surface CD36 and macrophage scavenger receptor 1 (MSR1) protein. Under oxLDL loaded conditions, IFNγ and TNFα did not reduce macrophage protein expression of the transcription factor peroxisome proliferator-actived receptor γ (PPARγ) which is known to positively regulate CD36 expression. However, macrophages treated with IFNγ attenuated the ability of the PPARγ-specific agonist rosiglitazone from upregulating cell surface CD36 protein expression. Our results demonstrate that the observed reduction of cholesterol accumulation in macrophages treated with IFNγ and TNFα following oxLDL treatment was due at least in part to reduced cell surface CD36 and MSR1 protein expression. Copyright © 2012 Elsevier B.V. All rights reserved.

  15. Heat and fuel coupled operation of a high temperature polymer electrolyte fuel cell with a heat exchanger methanol steam reformer

    Science.gov (United States)

    Schuller, G.; Vázquez, F. Vidal; Waiblinger, W.; Auvinen, S.; Ribeirinha, P.

    2017-04-01

    In this work a methanol steam reforming (MSR) reactor has been operated thermally coupled to a high temperature polymer electrolyte fuel cell stack (HT-PEMFC) utilizing its waste heat. The operating temperature of the coupled system was 180 °C which is significantly lower than the conventional operating temperature of the MSR process which is around 250 °C. A newly designed heat exchanger reformer has been developed by VTT (Technical Research Center of Finland LTD) and was equipped with commercially available CuO/ZnO/Al2O3 (BASF RP-60) catalyst. The liquid cooled, 165 cm2, 12-cell stack used for the measurements was supplied by Serenergy A/S. The off-heat from the electrochemical fuel cell reaction was transferred to the reforming reactor using triethylene glycol (TEG) as heat transfer fluid. The system was operated up to 0.4 A cm-2 generating an electrical power output of 427 Wel. A total stack waste heat utilization of 86.4% was achieved. It has been shown that it is possible to transfer sufficient heat from the fuel cell stack to the liquid circuit in order to provide the needed amount for vaporizing and reforming of the methanol-water-mixture. Furthermore a set of recommendations is given for future system design considerations.

  16. Development status and potential program for development of proliferation-resistant molten-salt reactors

    Energy Technology Data Exchange (ETDEWEB)

    Engel, J.R.; Bauman, H.F.; Dearing, J.F.; Grimes, W.R.; McCoy, H.E. Jr.

    1979-03-01

    Preliminary studies of existing and conceptual molten-salt reactor (MSR) designs have led to the identification of conceptual systems that are technologically attractive when operated with denatured uranium as the principal fissile fuel. These denatured MSRs would also have favorable resource-utilization characteristics and substantial resistance to proliferation of weapons-usable nuclear materials. The report presents a summary of the current status of technology and a discussion of the major technical areas of a possible base program to develop commercial denatured MSRs. The general areas treated are (1) reactor design and development, (2) safety and safety related technology, (3) fuel-coolant behavior and fuel processing, and (4) reactor materials. A substantial development effort could lead to authorization for construction of a molten-salt test reactor about 5 years after the start of the program and operation of the unit about 10 years later. A prototype commercial denatured MSR could be expected to begin operating 25 years from the start of the program. The postulated base program would extend over 32 years and would cost about $700 million (1978 dollars, unescalated). Additional costs to construct the MSTR, $600 million, and the prototype commercial plant, $1470 million, would bring the total program cost to about $2.8 billion. Additional allowances probably should be made to cover contingencies and incidental technology areas not explicitly treated in this preliminary review.

  17. A combined joint diagonalization-MUSIC algorithm for subsurface targets localization

    Science.gov (United States)

    Wang, Yinlin; Sigman, John B.; Barrowes, Benjamin E.; O'Neill, Kevin; Shubitidze, Fridon

    2014-06-01

    This paper presents a combined joint diagonalization (JD) and multiple signal classification (MUSIC) algorithm for estimating subsurface objects locations from electromagnetic induction (EMI) sensor data, without solving ill-posed inverse-scattering problems. JD is a numerical technique that finds the common eigenvectors that diagonalize a set of multistatic response (MSR) matrices measured by a time-domain EMI sensor. Eigenvalues from targets of interest (TOI) can be then distinguished automatically from noise-related eigenvalues. Filtering is also carried out in JD to improve the signal-to-noise ratio (SNR) of the data. The MUSIC algorithm utilizes the orthogonality between the signal and noise subspaces in the MSR matrix, which can be separated with information provided by JD. An array of theoreticallycalculated Green's functions are then projected onto the noise subspace, and the location of the target is estimated by the minimum of the projection owing to the orthogonality. This combined method is applied to data from the Time-Domain Electromagnetic Multisensor Towed Array Detection System (TEMTADS). Examples of TEMTADS test stand data and field data collected at Spencer Range, Tennessee are analyzed and presented. Results indicate that due to its noniterative mechanism, the method can be executed fast enough to provide real-time estimation of objects' locations in the field.

  18. Effect of a muscle relaxant, chlorphenesin carbamate, on the spinal neurons of rats.

    Science.gov (United States)

    Kurachi, M; Aihara, H

    1984-09-01

    The effects of chlorphenesin carbamate (CPC) and mephenesin on spinal neurons were investigated in spinal rats. CPC (50 mg/kg i.v.) inhibited the mono-(MSR) and poly-synaptic reflex (PSR), the latter being more susceptible than the former to CPC depression. Mephenesin also inhibited MSR and PSR, though the effects were short in duration. CPC had no effect on the dorsal root potential evoked by the stimulation of the dorsal root, while mephenesin reduced the dorsal root-dorsal root reflex. The excitability of motoneuron was reduced by the administration of CPC or mephenesin. The excitability of primary afferent terminal was unchanged by CPC, while it was inhibited by mephenesin. Neither CPC nor mephenesin influenced the field potential evoked by the dorsal root stimulation. Both CPC and mephenesin had no effect on the synaptic recovery. These results suggest that both CPC and mephenesin inhibit the firing of motoneurons by stabilizing the neuronal membrane, while mephenesin additionally suppresses the dorsal root reflex and the excitability of the primary afferent terminal. These inhibitory actions of CPC on spinal activities may contribute, at least partly, to its muscle relaxing action.

  19. Integration of Methane Steam Reforming and Water Gas Shift Reaction in a Pd/Au/Pd-Based Catalytic Membrane Reactor for Process Intensification.

    Science.gov (United States)

    Castro-Dominguez, Bernardo; Mardilovich, Ivan P; Ma, Liang-Chih; Ma, Rui; Dixon, Anthony G; Kazantzis, Nikolaos K; Ma, Yi Hua

    2016-09-19

    Palladium-based catalytic membrane reactors (CMRs) effectively remove H₂ to induce higher conversions in methane steam reforming (MSR) and water-gas-shift reactions (WGS). Within such a context, this work evaluates the technical performance of a novel CMR, which utilizes two catalysts in series, rather than one. In the process system under consideration, the first catalyst, confined within the shell side of the reactor, reforms methane with water yielding H₂, CO and CO₂. After reforming is completed, a second catalyst, positioned in series, reacts with CO and water through the WGS reaction yielding pure H₂O, CO₂ and H₂. A tubular composite asymmetric Pd/Au/Pd membrane is situated throughout the reactor to continuously remove the produced H₂ and induce higher methane and CO conversions while yielding ultrapure H₂ and compressed CO₂ ready for dehydration. Experimental results involving (i) a conventional packed bed reactor packed (PBR) for MSR, (ii) a PBR with five layers of two catalysts in series and (iii) a CMR with two layers of two catalysts in series are comparatively assessed and thoroughly characterized. Furthermore, a comprehensive 2D computational fluid dynamics (CFD) model was developed to explore further the features of the proposed configuration. The reaction was studied at different process intensification-relevant conditions, such as space velocities, temperatures, pressures and initial feed gas composition. Finally, it is demonstrated that the above CMR module, which was operated for 600 h, displays quite high H₂ permeance and purity, high CH₄ conversion levels and reduced CO yields.

  20. Bacterização de sementes e desenvolvimento de mudas de pepino Bacterization of seeds and development of cucumber seedlings

    Directory of Open Access Journals (Sweden)

    Elineide B. Silveira

    2004-06-01

    Full Text Available Bactérias epifíticas e endofíticas foram isoladas de plantas de pepino sadias, coletadas em diversos municípios do estado de Pernambuco e avaliadas na promoção de crescimento de plântulas em casa de vegetação. Foram realizados três bioensaios. No primeiro, foram testados 93 isolados; no segundo, 32 isolados e; no terceiro, oito isolados de pepino e mais 10 isolados provenientes de outras culturas. As sementes de pepino foram bacterizadas por imersão na suspensão bacteriana ajustada à concentração de A580 = 0,7, semeadas em substrato orgânico contido em bandejas de isopor; mantidas em casa de vegetação e, analisadas dez dias após a semeadura quanto às matérias secas da parte aérea (MSPA, raiz (MSR e total (MST. No último bioensaio, os isolados epifíticos PEP52, PEP8, PEP82, PEP91 e C22 foram selecionados por aumentarem significativamente a MSR e MST das plântulas em relação à testemunha, com valores superiores a 70 e 40%, respectivamente. Após o teste de compatibilidade in vitro, esses cinco isolados, testados separadamente e em misturas, aumentaram o índice de MSPA, MSR e MST das plântulas de pepino, sem diferirem significativamente entre si. Os isolados PEP81 (Bacillus amyloliquefaciens e PEP91 (Enterobacter cloacae destacaram-se com índices de aumentos de 55,5 e 39,5% (MSPA, 42,9 e 37,2% (MSR e 41,6 e 34,0% (MST, respectivamente. A produção do ácido indol acético, ácido cianídrico, solubilização de fosfatos e alteração nos teores foliares de N, P, K, Ca e Mg, foram avaliados como possíveis mecanismos de ação desses dois isolados, porém com resultados negativos. A bacterização das sementes com B. amyloliquefaciens PEP81 e E. cloacae PEP91 pode melhorar a qualidade das mudas de pepino.Epiphytic and endophytic bacteria were isolated from healthy cucumber plants, collected in several counties of Pernambuco State, Brazil, and evaluated for seedling growth promotion under greenhouse conditions. Three

  1. Descomposición de hojarasca y liberación de nutrientes en plantaciones de Acacia mangium (Mimosaceae establecidas en suelos degradados de Colombia

    Directory of Open Access Journals (Sweden)

    Jeiner Castellanos-Barliza

    2011-03-01

    Full Text Available La descomposición de hojarasca en los ecosistemas terrestres está regulada por varios factores, entre ellos, la humedad, temperatura, calidad de la hojarasca y la actividad de los microoganismos. Estudiamos el efecto de la precipitación y el tratamiento de subsolado del suelo previo establecimiento de plantaciones de Acacia mangium, usando la técnica de bolsas de descomposición durante seis meses en plantaciones del Bajo Cauca (Colombia. La constante de descomposición anual (k del modelo simple exponencial, osciló entre 1.24 y 1.80. Las constantes k1 y k2 del modelo doble exponencial fluctuaron entre 0.88-1.81 y 0.58-7.01. Al final del experimento la materia seca residual promedio (MSR fue del 47%. Las cantidades residuales de N, Ca y Mg en la hojarasca de A. mangium mostraron un patrón de liberación lento. La evolución del P en la MSR mostró un proceso dominante de inmovilización, dada su baja disponibilidad en el suelo. Algunos parámetros de calidad del sustrato (N, P, C/N, N/P y fenoles fueron buenos predictores del proceso, así como la precipitación, situación contraria a la del tratamiento de subsolado.

  2. Polityka rachunkowości spółek notowanych na GPW w Warszawie w zakresie ujmowania przychodów z kontraktów deweloperskich

    Directory of Open Access Journals (Sweden)

    Renata Dyląg

    2010-04-01

    Full Text Available Głównym przedmiotem działalności jednostek z branży deweloperskiej jest rea-lizacja kontraktów deweloperskich, polegających na budowie (bezpośrednio lub poprzez podwykonawców a następnie sprzedaży powierzchni w budynkach handlowych, rozrywkowych, biurowych, hotelowych i mieszkalnych. Brak precyzyjnych rozwią-zań dotyczących ujmowania przychodów z tych kontraktów powodował, że niektóre jednostki ujmowały przychody w momencie przekazania nieruchomości nabywcy (zgodnie z MSR 18 „Przychody”, natomiast inne ujmowały przychody w trakcie trwania okresu budowy tej nieruchomości (zgodnie z MSR 11 „Umowy o budowę”. Celem artykułu jest ocena – przyjmowanych przez spółki deweloperskie noto-wane na warszawskiej Giełdzie Papierów Wartościowych – rozwiązań dotyczących ujmowania przychodów i wyników z kontraktów deweloperskich oraz zaprezento-wanie wpływu interpretacji KIMSF 15 „Umowy dotyczące budowy nieruchomości” na sprawozdawczość tych spółek.

  3. Landslide mapping with multi-scale object-based image analysis – a case study in the Baichi watershed, Taiwan

    Directory of Open Access Journals (Sweden)

    T. Lahousse

    2011-10-01

    Full Text Available We developed a multi-scale OBIA (object-based image analysis landslide detection technique to map shallow landslides in the Baichi watershed, Taiwan, after the 2004 Typhoon Aere event. Our semi-automated detection method selected multiple scales through landslide size statistics analysis for successive classification rounds. The detection performance achieved a modified success rate (MSR of 86.5% with the training dataset and 86% with the validation dataset. This performance level was due to the multi-scale aspect of our methodology, as the MSR for single scale classification was substantially lower, even after spectral difference segmentation, with a maximum of 74%. Our multi-scale technique was capable of detecting landslides of varying sizes, including very small landslides, up to 95 m2. The method presented certain limitations: the thresholds we established for classification were specific to the study area, to the landslide type in the study area, and to the spectral characteristics of the satellite image. Because updating site-specific and image-specific classification thresholds is easy with OBIA software, our multi-scale technique is expected to be useful for mapping shallow landslides at watershed level.

  4. Thermodynamics of soluble fission products cesium and iodine in the Molten Salt Reactor

    Science.gov (United States)

    Capelli, E.; Beneš, O.; Konings, R. J. M.

    2018-04-01

    The present study describes the full thermodynamic assessment of the Li,Cs,Th//F,I system. The existing database for the relevant fluoride salts considered as fuel for the Molten Salt Reactor (MSR) has been extended with two key fission products, cesium and iodine. A complete evaluation of all the common-ion binary and ternary sub-systems of the LiF-ThF4-CsF-LiI-ThI4-CsI system has been performed and the optimized parameters are presented in this work. New equilibrium data have been measured using Differential Scanning Calorimetry and were used to assess the reciprocal ternary systems and confirm the extrapolated phase diagrams. The developed database significantly contributes to the understanding of the behaviour of cesium and iodine in the MSR, which strongly depends on their concentration and chemical form. Cesium bonded with fluorine is well retained in the fuel mixture while in the form of CsI the solubility of these elements is very limited. Finally, the influence of CsI and CsF on the physico-chemical properties of the fuel mixture was calculated as function of composition.

  5. Substratos alternativos na produção de mudas de flamboyant e ipê-mirim

    Directory of Open Access Journals (Sweden)

    Marília Dutra Massad

    2015-12-01

    Full Text Available O trabalho teve como objetivo avaliar o efeito do uso de bagaço de cana, casca de urucum e serragem, em diferentes proporções, na composição de substratos alternativos, constituídos a partir da mistura do substrato comercial Rohrbacher®, para a produção de mudas de flamboyant e ipê-mirim. Foi adotado o delineamento experimental de blocos ao acaso, com três repetições, no esquema fatorial (5 x 2, sendo avaliados cinco tipos de substratos e duas espécies. Os substratos avaliados foram: 100% Rohrbacher®; 70% Rohrbacher® + 30% Bagaço de cana; 70% Rohrbacher® + 30% Casca de urucum; 70% Rohrbacher® + 30% Serragem; 50% Rohrbacher® + 16,67% Bagaço de cana + 16,67% Casca de urucum + 16,67% Serragem. Foram avaliados: altura da parte aérea; diâmetro de coleto; massa seca da parte aérea; massa seca da raiz e massa seca total, além das relações H/DC, H/MSPA, MSPA/MSR e Índice de Qualidade de Dickson. Os substratos Rohrbacher®, 70%R+30%CA e 70%R+30%UR promoveram maior ganho em altura nas mudas de flamboyant e ipê-mirim. O substrato Rohrbacher® proporcionou às mudas maior produção de MSR. O flamboyant apresentou valores superiores para H, DC, MSPA, MSR, MST MSPA/MSR e IQD, conferindo um padrão de qualidade de mudas superior ao ipê-mirim.Alternative substrates in the production of seedlings of flamboyant and ipe-mirimAbstract: The study aimed to assess the effect of using sugarcane bagasse, bark and sawdust annatto, in different proportions, the composition of alternative substrates, made from a mixture of commercial substrate Rohrbacher®, to produce flamboyant and seedlings ipe-mirim. The experimental design of randomized blocks was adopted with three replications, in a factorial scheme (5 x 2, being evaluated five types of substrates and two species. The substrates were evaluated: 100% Rohrbacher®; Rohrbacher® 70% + 30% Sugar cane bagasse; Rohrbacher® 70% + 30% annatto bark; Rohrbacher® 70% + 30% sawdust; 50

  6. Prevalence of Genotypes That Determine Resistance of Staphylococci to Macrolides and Lincosamides in Serbia

    Directory of Open Access Journals (Sweden)

    Milena Mišić

    2017-08-01

    Full Text Available Macrolides, lincosamides, and streptogramins (MLS resistance genes are responsible for resistance to these antibiotics in Staphylococcus infections. The purpose of the study was to analyze the distribution of the MLS resistance genes in community- and hospital-acquired Staphylococcus isolates. The MLS resistance phenotypes [constitutive resistance to macrolide–lincosamide–streptogramin B (cMLSb, inducible resistance to macrolide–lincosamide–streptogramin B (iMLSb, resistance to macrolide/macrolide–streptogramin B (M/MSb, and resistance to lincosamide–streptogramin A/streptogramin B (LSa/b] were determined by double-disc diffusion method. The presence of the MLS resistance genes (ermA, ermB, ermC, msrA/B, lnuA, lnuB, and lsaA were determined by end-point polymerase chain reaction in 179 isolates of staphylococci collected during 1-year period at the Center for Microbiology of Public Health Institute in Vranje. The most frequent MLS phenotype among staphylococcal isolates, both community-acquired and hospital-acquired, was iMLSb (33.4%. The second most frequent was M/MSb (17.6% with statistically significantly higher number of hospital-acquired staphylococcal isolates (p < 0.05. MLS resistance was mostly determined by the presence of msrA/B (35.0% and ermC (20.8% genes. Examined phenotypes were mostly determined by the presence of one gene, especially by msrA/B (26.3% and ermC (14.5%, but 15.6% was determined by a combination of two or more genes. M/MSb phenotype was the most frequently encoded by msrA/B (95.6% gene, LSa/b phenotype by lnuA (56.3% gene, and iMLSb phenotype by ermC (29.4% and ermA (25.5% genes. Although cMLSb phenotype was mostly determined by the presence of ermC (28.9%, combinations of two or more genes have been present too. This pattern was particularly recorded in methicillin-resistant Staphylococcus aureus (MRSA (58.3% and methicillin-resistant coagulase-negative staphylococci (MRCNS (90.9% isolates with c

  7. Synthesis, characterization and theoretical studies of 5-(benzylthio)-1-cylopentyl-1H-tetrazole

    Science.gov (United States)

    Saglam, S.; Disli, A.; Erdogdu, Y.; Marchewka, M. K.; Kanagathara, N.; Bay, B.; Güllüoğlu, M. T.

    2015-01-01

    In this study, 5-(benzylthio)-1-cylopentyl-1H-tetrazole (5B1C1HT) have been synthesized. Boiling points of the obtained compound have been determined and it has been characterized by FT-IR, 1H NMR, 13C-APT and LC-MS spectroscopy techniques. The FT-IR, 1H NMR and 13C-APT spectral measurements of the 5B1C1HT compound and complete assignment of the vibrational bands observed in spectra has been discussed. The spectra were interpreted with the aid of normal coordinate analysis following full structure optimization and force field calculations based on Density Functional Theory (DFT) at 6-311++G**, cc-pVDZ and cc-pVTZ basis sets. The optimized geometry with 6-311++G** basis sets were used to determine the total energy distribution, harmonic vibrational frequencies, IR intensities.

  8. Evaluation of the Operational Stress Control and Readiness (OSCAR) Program

    Science.gov (United States)

    2015-01-01

    should receive training to fill the role of OSCAR team member. The divisions can be attributed to different ways that com- manders balance three...potential advantages have to be balanced against the suggestion by participants in the focus groups and the interviews that Marines are unlikely to...www.uscg.mil/ worklife /docs/pdf/Navy_and_Marine_Corps_OSC_Doctrine_Dec_2010%5b1%5d.pdf Dawson, Deborah A., Bridget F. Grant, Frederick S. Stinson

  9. ExcelNet Concept Papers. Volume 1.

    Science.gov (United States)

    1985-10-01

    Interservice sports coUpetitions. Post baseball, men’s and women’s basketball, and rugby teams had outstanding seasons, and the boxing team is world class...enter 5.) B1 . Performance 1 2 3 4 5 6 7 8 9 10 B2. Potential 1 2 3 4 5 6 7 8 9 10 ,q . BI + B2 B _" ._- C. Rater Cl. Performance 1 2 3 4 5 6 7 8 9 10

  10. 22 CFR 303.7 - Index of records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Index of records. 303.7 Section 303.7 Foreign... Index of records. The Peace Corps will maintain a current index identifying any matter within the scope of § 303.4 or § 303.5(b)(1) through (5). The index will be maintained and made available for public...

  11. 45 CFR 1602.7 - Index of records.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Index of records. 1602.7 Section 1602.7 Public... DISCLOSURE OF INFORMATION UNDER THE FREEDOM OF INFORMATION ACT § 1602.7 Index of records. The Corporation will maintain a current index identifying any matter within the scope of § 1602.4 and § 1602.5(b) (1...

  12. HfMV1 and another putative mycovirus in Central European populations of Hymenoscyphus fraxineus, the causal agent of ash dieback in Europe

    Czech Academy of Sciences Publication Activity Database

    Čermáková, V.; Eichmeier, A.; Herrero, Noemi; Botella, L.

    2017-01-01

    Roč. 23, č. 1 (2017), s. 107-115 ISSN 1392-1355 Institutional support: RVO:60077344 Keywords : Chalara fraxinea * Illumina sequencing * mycoviruses Subject RIV: EE - Microbiology, Virology OBOR OECD: Virology Impact factor: 0.635, year: 2016 https://www.balticforestry.mi.lt/bf/PDF_Articles/2017-23%5B1%5D/Baltic%20Forestry%202017.1_107-115.pdf

  13. Validation of the TRACE code for the system dynamic simulations of the molten salt reactor experiment and the preliminary study on the dual fluid molten salt reactor

    International Nuclear Information System (INIS)

    He, Xun

    2016-01-01

    Molten Salt Reactor (MSR), which was confirmed as one of the six Generation IV reactor types by the GIF (Generation IV International Forum in 2008), recently draws a lot of attention all around the world. Due to the application of liquid fuels the MSR can be regarded as the most special one among those six GEN-IV reactor types in a sense. A unique advantage of using liquid nuclear fuel lies in that the core melting accident can be thoroughly eliminated. Besides, a molten salt reactor can have several fuel options, for instance, the fuel can be based on "2"3"5U, "2"3"2Th-"2"3"3U, "2"3"8U-"2"3"9Pu cycle or even the spent nuclear fuel (SNF), so the reactor can be operated as a breeder or as an actinides burner both with fast, thermal or epi-thermal neutron spectrum and hence, it has excellent features of the fuel sustainability and for the non-proliferation. Furthermore, the lower operating pressure not only means a lower risk of the explosion as well as the radioactive leakage but also implies that the reactor vessel and its components can be lightweight, thus lowering the cost of equipments. So far there is no commercial MSR being operated. However, the MSR concept and its technical validation dates back to the 1960s to 1970s, when the scientists and engineers from ORNL (Oak Ridge National Laboratory) in the United States managed to build and run the world's first civilian molten salt reactor called MSRE (Molten Salt Reactor Experiment). The MSRE was an experimental liquid-fueled reactor with 10 MW thermal output using "4LiF-BeF_2-ZrF_4-UF_4 as the fuel also as the coolant itself. The MSRE is usually taken as a very important reference case for many current researches to validate their codes and simulations. Without exception it works also as a benchmark for this thesis. The current thesis actually consists of two main parts. The first part is about the validation of the current code for the old MSRE concept, while the second one is about the demonstration of a new

  14. Validation of the TRACE code for the system dynamic simulations of the molten salt reactor experiment and the preliminary study on the dual fluid molten salt reactor

    Energy Technology Data Exchange (ETDEWEB)

    He, Xun

    2016-06-14

    Molten Salt Reactor (MSR), which was confirmed as one of the six Generation IV reactor types by the GIF (Generation IV International Forum in 2008), recently draws a lot of attention all around the world. Due to the application of liquid fuels the MSR can be regarded as the most special one among those six GEN-IV reactor types in a sense. A unique advantage of using liquid nuclear fuel lies in that the core melting accident can be thoroughly eliminated. Besides, a molten salt reactor can have several fuel options, for instance, the fuel can be based on {sup 235}U, {sup 232}Th-{sup 233}U, {sup 238}U-{sup 239}Pu cycle or even the spent nuclear fuel (SNF), so the reactor can be operated as a breeder or as an actinides burner both with fast, thermal or epi-thermal neutron spectrum and hence, it has excellent features of the fuel sustainability and for the non-proliferation. Furthermore, the lower operating pressure not only means a lower risk of the explosion as well as the radioactive leakage but also implies that the reactor vessel and its components can be lightweight, thus lowering the cost of equipments. So far there is no commercial MSR being operated. However, the MSR concept and its technical validation dates back to the 1960s to 1970s, when the scientists and engineers from ORNL (Oak Ridge National Laboratory) in the United States managed to build and run the world's first civilian molten salt reactor called MSRE (Molten Salt Reactor Experiment). The MSRE was an experimental liquid-fueled reactor with 10 MW thermal output using {sup 4}LiF-BeF{sub 2}-ZrF{sub 4}-UF{sub 4} as the fuel also as the coolant itself. The MSRE is usually taken as a very important reference case for many current researches to validate their codes and simulations. Without exception it works also as a benchmark for this thesis. The current thesis actually consists of two main parts. The first part is about the validation of the current code for the old MSRE concept, while the second

  15. Análisis de los impactos ambientales generados por parques eólicos en base al nuevo Decreto-Ley 5/2014

    OpenAIRE

    Avilés Benítez, Antonio

    2016-01-01

    ANÁLISIS DE LOS IMPACTOS AMBIENTALES GENERADOS POR PARQUES EÓLICOS EN BASE AL NUEVO DECRETO-LEY 5/2014 Con el nuevo Decreto -ley 5/2014, de 22 de abril, de medidas normativas para reducir las trabas administrativas para las empresas, los parques eólicos se encuentran incluidos en el Anexo III, exigiéndoseles para su instalación tener favorable el trámite de Autorización Ambiental Unificada (AAU). Dicha autorización exige la redacción de un Estudio de Impacto Ambiental que analice y cuanti...

  16. Análisis de los impactos ambientales generados por parques eólicos. Caso práctico

    OpenAIRE

    Avilés, Antonio

    2017-01-01

    De conformidad con el Anexo II del Decreto -ley 5/2014, de 22 de abril, de medidas normativas para reducir las trabas administrativas para las empresas, los parques eólicos si tienen más de 6 aerogeneradores o 10 MW de potencia instalada, requieren una Autorización Ambiental Unificada ordinaria (AAU). Dicha autorización exige la redacción de un Estudio de Impacto Ambiental que analice y cuantifique los principales impactos a lo largo de las distintas fases del proyecto y establezca la...

  17. Método heurístico en el aprendizaje de ecuaciones diferenciales en estudiantes de ingenierías de la UNA - Puno - 2010

    OpenAIRE

    Condori Concha, Martín

    2012-01-01

    La presente investigación denominado "Método heurístico en el aprendizaje de ecuaciones diferenciales en estudiantes de ingenierías de la Universidad Nacional del Altiplano Puno" durante el primer semestre del 2009 que corresponde desde 21 de abril hasta 14 de Junio del 2010; tiene como objetivo de contribuir al proceso enseñanza-aprendizaje, la utilización del método heurístico en el aprendizaje de ecuaciones diferenciales en estudiantes de Ingenierías. La hipótesis con que se desarrolló la ...

  18. Características clínicas y epidemiológicas de enterobiasis en niños escolarizados de una zona rural del estado falcón, Venezuela

    OpenAIRE

    PERFETTI, DALMIRO CAZORLA; ACOSTA-QUINTERO, MARÍA; MORALES-MORENO, PEDRO

    2016-01-01

    El entero-helminto Enterobius vermicularis es el agente causal de la enterobiasis u oxiuriasis, la cual se encuentra con mayor prevalencia en niños. Se realizó un estudio para determinar la prevalencia y los parámetros clínicos y epidemiológicos de la enterobiasis en niños escolarizados de la población rural El Paso Acurigua, estado Falcón, Venezuela. El estudio de tipo descriptivo, prospectivo y transversal, se llevó a cabo entre noviembre 2006 y abril de 2007, en un total de 82 niños. Para ...

  19. Programa de Control de Emisiones Vehiculares y la contaminación atmosférica

    OpenAIRE

    Rogelio Palomo A.

    2011-01-01

    De acuerdo al proyecto de Análisis Comparativo de Riesgos (ACR) y solicitado por la Comisión Centroamericana de Ambiente y Desarrollo, que estudia llevar a cabo acciones en la región, Costa Rica obtiene el mayor puntaje en contaminación del aire.El Consejo de Seguridad Vial, en 1986, intentó controlar la contaminación vehicular pero sin éxito, aunque desde abril de 1982 ya se había elaborado el decreto No. 13470-T para realizar legalmente esa labor. Aun, la anterior ley de Tránsito de 1976 mu...

  20. Programa de Control de Emisiones Vehiculares y la contaminación atmosférica

    OpenAIRE

    Palomo A., Rogelio

    1997-01-01

    De acuerdo al proyecto de Análisis Comparativo de Riesgos (ACR) y solicitado por la Comisión Centroamericana de Ambiente y Desarrollo, que estudia llevar a cabo acciones en la región, Costa Rica obtiene el mayor puntaje en contaminación del aire.El Consejo de Seguridad Vial, en 1986, intentó controlar la contaminación vehicular pero sin éxito, aunque desde abril de 1982 ya se había elaborado el decreto No. 13470-T para realizar legalmente esa labor. Aun, la anterior ley de Tránsito de 1976 mu...