WorldWideScience

Sample records for mgr site recommendation

  1. CLASSIFICATION OF THE MGR SITE WATER SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site water system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  2. CLASSIFICATION OF THE MGR SITE OPERATIONS SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site operations system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  3. CLASSIFICATION OF THE MGR SITE LAYOUT SYSTEM

    International Nuclear Information System (INIS)

    S.E. Salzman

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site layout system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  4. CLASSIFICATION OF THE MGR SITE COMPRESSED AIR SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) site compressed air system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  5. CLASSIFICATION OF THE MGR WASTE EMPLACEMENT/RETRIEVAL SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    2000-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) waste emplacement/retrieved system structures, systems and components (SSCs) performed by the MGR Preclosure Safety and Systems Engineering Section. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 2000). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, Quality Assurance Requirements and Description (QARD) (DOE 2000). This QA classification incorporates the current MGR design and the results of the ''Design Basis Event Frequency and Dose Calculation for Site Recommendation'' (CRWMS M andO 2000a). The content and technical approach of this analysis is in accordance with the development plan ''QA Classification of MGR Structures, Systems, and Components'' (CRWMS M andO 1999b)

  6. CLASSIFICATION OF THE MGR WASTE HANDLING BUILDING VENTILATION SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    2000-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) waste handling building ventilation system structures, systems and components (SSCs) performed by the MGR Preclosure Safety and Systems Engineering Section. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 2000). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 2000). This QA classification incorporates the current MGR design and the results of the ''Design Basis Event Frequency and Dose Calculation for Site Recommendation'' (CRWMS M andO 2000a) and ''Bounding Individual Category 1 Design Basis Event Dose Calculation to Support Quality Assurance Classification'' (Gwyn 2000)

  7. webMGR: an online tool for the multiple genome rearrangement problem.

    Science.gov (United States)

    Lin, Chi Ho; Zhao, Hao; Lowcay, Sean Harry; Shahab, Atif; Bourque, Guillaume

    2010-02-01

    The algorithm MGR enables the reconstruction of rearrangement phylogenies based on gene or synteny block order in multiple genomes. Although MGR has been successfully applied to study the evolution of different sets of species, its utilization has been hampered by the prohibitive running time for some applications. In the current work, we have designed new heuristics that significantly speed up the tool without compromising its accuracy. Moreover, we have developed a web server (webMGR) that includes elaborate web output to facilitate navigation through the results. webMGR can be accessed via http://www.gis.a-star.edu.sg/~bourque. The source code of the improved standalone version of MGR is also freely available from the web site. Supplementary data are available at Bioinformatics online.

  8. CLASSIFICATION OF THE MGR MUCK HANDLING SYSTEM

    International Nuclear Information System (INIS)

    R. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) muck handling system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description (QARD) (DOE 1998). This QA classification incorporates the current MGR design and the results of the ''Preliminary Preclosure Design Basis Event Calculations for the Monitored Geologic Repository (CRWMS M and O 1998a)

  9. Classification of the MGR Assembly Transfer System

    International Nuclear Information System (INIS)

    S.E. Salzman

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) assembly transfer system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  10. CLASSIFICATION OF THE MGR OFFSITE UTILITIES SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) offsite utilities system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  11. CLASSIFICATION OF THE MGR SUBSURFACE EXCAVATION SYSTEM

    International Nuclear Information System (INIS)

    R. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) subsurface excavation system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  12. CLASSIFICATION OF THE MGR SUBSURFACE VENTILATION SYSTEM

    International Nuclear Information System (INIS)

    R.J. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) subsurface ventilation system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P7 ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  13. CLASSIFICATION OF THE MGR EMERGENCY RESPONSE SYSTEM

    International Nuclear Information System (INIS)

    Zeigler, J.A.

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) emergency response system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P7 ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  14. CLASSIFICATION OF THE MGR MAINTENANCE AND SUPPLY SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) maintenance and supply system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  15. CLASSIFICATION OF THE MGR WASTE HANDLING BUILDING ELECTRICAL SYSTEM

    International Nuclear Information System (INIS)

    S.E. Salzman

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) waste handling building electrical system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  16. CLASSIFICATION OF THE MGR OPERATIONS MONITORING AND CONTROL SYSTEM

    International Nuclear Information System (INIS)

    R.J. Garrett

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) Operations Monitoring and Control System structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P7 ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  17. CLASSIFICATION OF THE MGR NON-FUEL COMPONENTS DISPOSAL CONTAINER SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) non-fuel components disposal container system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333P, ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  18. CLASSIFICATION OF THE MGR PERFORMANCE CONFIRMATION DATA ACQUISITION/MONITORING SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) performance confirmation data acquisition/monitoring system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMF 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333PY ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  19. CLASSIFICATION OF THE MGR DEFENSE HIGH-LEVEL WASTE DISPOSAL CONTAINER SYSTEM

    International Nuclear Information System (INIS)

    J.A. Ziegler

    1999-01-01

    The purpose of this analysis is to document the Quality Assurance (QA) classification of the Monitored Geologic Repository (MGR) defense high-level waste disposal container system structures, systems and components (SSCs) performed by the MGR Safety Assurance Department. This analysis also provides the basis for revision of YMP/90-55Q, Q-List (YMP 1998). The Q-List identifies those MGR SSCs subject to the requirements of DOE/RW-0333PY ''Quality Assurance Requirements and Description'' (QARD) (DOE 1998)

  20. Posttranslational modification influences the effects of MgrA on norA expression in Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Ding, Yanpeng; Hooper, David C

    2008-11-01

    MgrA is a global regulator in Staphylococcus aureus. Differences in the effects of MgrA on norA expression have been reported for different strains, which varied in rsbU, a gene that affects the expression of sigB, which encodes an alternative sigma factor involved in stress responses. We hypothesized that MgrA was modified by sigB-dependent factors that affected its ability to control the expression of the norA efflux pump. Heterologously expressed MgrA purified from Escherichia coli was incubated with crude extracts (CE) from strains RN6390 (rsbU) and SH1000 (rsbU(+)) and tested for binding to the norA promoter. Purified MgrA exhibited greater binding to norA promoter DNA after being incubated with SH1000 CE than MgrA incubated with the RN6390 CE. Phosphorylation of MgrA occurring in cell extracts caused it to lose the ability to bind norA promoter DNA. Overexpression of pknB, encoding a candidate serine/threonine kinase, produced increased phospho-MgrA and led to a fivefold increase in the transcript level of norA for both RN6390 and SH1000, as well as a fourfold increase in the MICs of norfloxacin and ciprofloxacin for these two strains. The levels of expression of pknB in RN6390 and SH1000, however, indicated that additional factors related to rsbU or sigB contribute to the differential regulatory effects of MgrA on norA expression.

  1. PRELIMINARY SELECTION OF MGR DESIGN BASIS EVENTS

    International Nuclear Information System (INIS)

    Kappes, J.A.

    1999-01-01

    The purpose of this analysis is to identify the preliminary design basis events (DBEs) for consideration in the design of the Monitored Geologic Repository (MGR). For external events and natural phenomena (e.g., earthquake), the objective is to identify those initiating events that the MGR will be designed to withstand. Design criteria will ensure that radiological release scenarios resulting from these initiating events are beyond design basis (i.e., have a scenario frequency less than once per million years). For internal (i.e., human-induced and random equipment failures) events, the objective is to identify credible event sequences that result in bounding radiological releases. These sequences will be used to establish the design basis criteria for MGR structures, systems, and components (SSCs) design basis criteria in order to prevent or mitigate radiological releases. The safety strategy presented in this analysis for preventing or mitigating DBEs is based on the preclosure safety strategy outlined in ''Strategy to Mitigate Preclosure Offsite Exposure'' (CRWMS M andO 1998f). DBE analysis is necessary to provide feedback and requirements to the design process, and also to demonstrate compliance with proposed 10 CFR 63 (Dyer 1999b) requirements. DBE analysis is also required to identify and classify the SSCs that are important to safety (ITS)

  2. The Staphylococcus aureus Global Regulator MgrA Modulates Clumping and Virulence by Controlling Surface Protein Expression.

    Directory of Open Access Journals (Sweden)

    Heidi A Crosby

    2016-05-01

    Full Text Available Staphylococcus aureus is a human commensal and opportunistic pathogen that causes devastating infections in a wide range of locations within the body. One of the defining characteristics of S. aureus is its ability to form clumps in the presence of soluble fibrinogen, which likely has a protective benefit and facilitates adhesion to host tissue. We have previously shown that the ArlRS two-component regulatory system controls clumping, in part by repressing production of the large surface protein Ebh. In this work we show that ArlRS does not directly regulate Ebh, but instead ArlRS activates expression of the global regulator MgrA. Strains lacking mgrA fail to clump in the presence of fibrinogen, and clumping can be restored to an arlRS mutant by overexpressing either arlRS or mgrA, indicating that ArlRS and MgrA constitute a regulatory pathway. We used RNA-seq to show that MgrA represses ebh, as well as seven cell wall-associated proteins (SraP, Spa, FnbB, SasG, SasC, FmtB, and SdrD. EMSA analysis showed that MgrA directly represses expression of ebh and sraP. Clumping can be restored to an mgrA mutant by deleting the genes for Ebh, SraP and SasG, suggesting that increased expression of these proteins blocks clumping by steric hindrance. We show that mgrA mutants are less virulent in a rabbit model of endocarditis, and virulence can be partially restored by deleting the genes for the surface proteins ebh, sraP, and sasG. While mgrA mutants are unable to clump, they are known to have enhanced biofilm capacity. We demonstrate that this increase in biofilm formation is partially due to up-regulation of SasG, a surface protein known to promote intercellular interactions. These results confirm that ArlRS and MgrA constitute a regulatory cascade, and that they control expression of a number of genes important for virulence, including those for eight large surface proteins.

  3. Phosphorylation of MgrA and its effect on expression of the NorA and NorB efflux pumps of Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Hooper, David C

    2010-05-01

    MgrA is a global regulator in Staphylococcus aureus that controls the expression of diverse genes encoding virulence factors and multidrug resistance (MDR) efflux transporters. We identified pknB, which encodes the (Ser/Thr) kinase PknB, in the S. aureus genome. PknB was able to autophosphorylate as well as phosphorylate purified MgrA. We demonstrated that rsbU, which encodes a Ser/Thr phosphatase and is involved in the activation of the SigB regulon, was able to dephosphorylate MgrA-P but not PknB-P. Serines 110 and 113 of MgrA were found to be phosphorylated, and Ala substitutions at these positions resulted in reductions in the level of phosphorylation of MgrA. DNA gel shift binding assays using norA and norB promoters showed that MgrA-P was able to bind the norB promoter but not the norA promoter, a pattern which was the reverse of that for unphosphorylated MgrA. The double mutant MgrA(S110A-S113A) bound to the norA promoter but not the norB promoter. The double mutant led to a 2-fold decrease in norA transcripts and a 2-fold decrease in the MICs of norfloxacin and ciprofloxacin in strain RN6390. Thus, phosphorylation of MgrA results in loss of binding to the norA promoter, but with a gain of the ability to bind the norB promoter. Loss of the ability to phosphorylate MgrA by Ala substitution resulted in increased repression of norA expression and in reductions in susceptibilities to NorA substrates.

  4. Gold(I) Complexes with N-Donor Ligands. 2.(1) Reactions of Ammonium Salts with [Au(acac-kappaC(2))(PR(3))] To Give [Au(NH(3))L](+), [(AuL)(2)(&mgr;(2)-NH(2))](+), [(AuL)(4)(&mgr;(4)-N)](+), or [(AuL)(3)(&mgr;(3)-O)](+). A New and Facile Synthesis of [Au(NH(3))(2)](+) Salts. Crystal Structure of [{AuP(C(6)H(4)OMe-4)(3)}(3)(&mgr;(3)-O)]CF(3)SO(3).

    Science.gov (United States)

    Vicente, José; Chicote, María-Teresa; Guerrero, Rita; Jones, Peter G.; Ramírez De Arellano, M. Carmen

    1997-09-24

    The complexes [Au(acac-kappaC(2))(PR(3))] (acac = acetylacetonate, R = Ph, C(6)H(4)OMe-4) react with (NH(4))ClO(4) to give amminegold(I), [Au(NH(3))(PR(3))]ClO(4), amidogold(I), [(AuPR(3))(2)(&mgr;(2)-NH(2))]ClO(4), or nitridogold(I), [(AuPR(3))(4)(&mgr;(4)-N)]ClO(4), complexes, depending on the reaction conditions. Similarly, [Au(acac-kappaC(2))(PPh(3))] reacts with (NH(3)R')OTf (OTf = CF(3)SO(3)) (1:1) or with [H(3)N(CH(2))(2)NH(2)]OTf (1:1) to give (amine)gold(I) complexes [Au(NH(2)R')(PPh(3))]OTf (R' = Me, C(6)H(4)NO(2)-4) or [(AuPPh(3))(2){&mgr;(2)-H(2)N(CH(2))(2)NH(2)}](OTf)(2), respectively. The ammonium salts (NH(2)R'(2))OTf (R' = Et, Ph) react with [Au(acac-kappaC(2))(PR(3))] (R = Ph, C(6)H(4)OMe-4) (1:2) to give, after hydrolysis, the oxonium salts [(AuPR(3))(3)(&mgr;(3)-O)]OTf (R = Ph, C(6)H(4)OMe-4). When NH(3) is bubbled through a solution of [AuCl(tht)] (tht = tetrahydrothiophene), the complex [Au(NH(3))(2)]Cl precipitates. Addition of [Au(NH(3))(2)]Cl to a solution of AgClO(4) or TlOTf leads to the isolation of [Au(NH(3))(2)]ClO(4) or [Au(NH(3))(2)]OTf, respectively. The crystal structure of [(AuPR(3))(3)(&mgr;(3)-O)]OTf.Me(2)CO (R = C(6)H(4)OMe-4) has been determined: triclinic, space group P&onemacr;, a = 14.884(3) Å, b = 15.828(3) Å, c = 16.061(3) Å, alpha = 83.39(3) degrees, beta = 86.28(3) degrees, gamma = 65.54(3) degrees, R1 (wR2) = 0.0370 (0.0788). The [(AuPR(3))(3)(&mgr;(3)-O)](+) cation shows an essentially trigonal pyramidal array of three gold atoms and one oxygen atom with O-Au-P bond angles of ca. 175 degrees and Au.Au contacts in the range 2.9585(7)-3.0505(14) Å. These cations are linked into centrosymmetric dimers through two short Au.Au [2.9585(7), 3.0919(9) Å] contacts. The gold atoms of the dimer form a six-membered ring with a chair conformation.

  5. Mapping the heparin-binding site of the BMP antagonist gremlin by site-directed mutagenesis based on predictive modelling.

    Science.gov (United States)

    Tatsinkam, Arnold Junior; Mulloy, Barbara; Rider, Christopher C

    2015-08-15

    Gremlin is a member of the CAN (cerberus and DAN) family of secreted BMP (bone morphogenetic protein) antagonists and also an agonist of VEGF (vascular endothelial growth factor) receptor-2. It is critical in limb skeleton and kidney development and is re-expressed during tissue fibrosis. Gremlin binds strongly to heparin and heparan sulfate and, in the present study, we sought to investigate its heparin-binding site. In order to explore a putative non-contiguous binding site predicted by computational molecular modelling, we substituted a total of 11 key arginines and lysines located in three basic residue sequence clusters with homologous sequences from cerberus and DAN (differential screening selected gene abberative in neuroblastoma), CAN proteins which lack basic residues in these positions. A panel of six Myc-tagged gremlin mutants, MGR-1-MGR-6 (MGR, mutant gremlin), each containing different combinations of targeted substitutions, all showed markedly reduced affinity for heparin as demonstrated by their NaCl elution on heparin affinity chromatography, thus verifying our predictions. Both MGR-5 and MGR-6 retained BMP-4-binding activity comparable to that of wild-type gremlin. Low-molecular-mass heparin neither promoted nor inhibited BMP-4 binding. Finally, glutaraldehyde cross-linking demonstrated that gremlin forms non-covalent dimers, similar behaviour to that of DAN and also PRDC (protein related to cerberus and DAN), another CAN protein. The resulting dimer would possess two heparin-binding sites, each running along an exposed surface on the second β-strand finger loop of one of the monomers. © 2015 Authors; published by Portland Press Limited.

  6. MGR COMPLIANCE PROGRAM GUIDANCE PACKAGE FOR RADIATION PROTECTION EQUIPMENT, INSTRUMENTATION, AND FACILITIES

    International Nuclear Information System (INIS)

    2000-01-01

    This Compliance Program Guidance Package identifies the regulatory guidance and industry codes and standards addressing radiation protection equipment, instrumentation, and support facilities considered to be appropriate for radiation protection at the Monitored Geologic Repository (MGR). Included are considerations relevant to radiation monitoring instruments, calibration, contamination control and decontamination, respiratory protection equipment, and general radiation protection facilities. The scope of this Guidance Package does not include design guidance relevant to criticality monitoring, area radiation monitoring, effluent monitoring, and airborne radioactivity monitoring systems since they are considered to be the topics of specific design and construction requirements (i.e., ''fixed'' or ''built-in'' systems). This Guidance Package does not address radiation protection design issues; it addresses the selection and calibration of radiation monitoring instrumentation to the extent that the guidance is relevant to the operational radiation protection program. Radon and radon progeny monitoring instrumentation is not included in the Guidance Package since such naturally occurring radioactive materials do not fall within the NRC's jurisdiction at the MGR

  7. MGR External Events Hazards Analysis

    International Nuclear Information System (INIS)

    Booth, L.

    1999-01-01

    The purpose and objective of this analysis is to apply an external events Hazards Analysis (HA) to the License Application Design Selection Enhanced Design Alternative 11 [(LADS EDA II design (Reference 8.32))]. The output of the HA is called a Hazards List (HL). This analysis supersedes the external hazards portion of Rev. 00 of the PHA (Reference 8.1). The PHA for internal events will also be updated to the LADS EDA II design but under a separate analysis. Like the PHA methodology, the HA methodology provides a systematic method to identify potential hazards during the 100-year Monitored Geologic Repository (MGR) operating period updated to reflect the EDA II design. The resulting events on the HL are candidates that may have potential radiological consequences as determined during Design Basis Events (DBEs) analyses. Therefore, the HL that results from this analysis will undergo further screening and analysis based on the criteria that apply during the performance of DBE analyses

  8. Development of GT-MGR plant power conversion unit design

    International Nuclear Information System (INIS)

    Kostin, V.I.; Kodochigov, N.G.; Belov, S.E.; Vasyaev, A.V.; Golovko, V.F.; Shenoj, A.

    2007-01-01

    The General Atomic Company (USA) and the Pilot Design Bureau for Machine-Building (Russia) are involved in the efforts to design the GT-MGR modular helium cooled reactor and the energy conversion unit with the direct gas turbine cycle. The reactor capacity is equal to 600 MW, it is cooled by helium under 7 MPa pressure. The energy conversion unit consists of a gas turbine, a recuperator, preliminary and intermediate coolers, a generator. The turbine shaft rotation frequency is equal to 4400 rotation/minute. One analyzed the alternate designs of the energy conversion unit to choose its configuration [ru

  9. Effect of Promoter Region Mutations and mgrA Overexpression on Transcription of norA, Which Encodes a Staphylococcus aureus Multidrug Efflux Transporter

    OpenAIRE

    Kaatz, Glenn W.; Thyagarajan, Rama V.; Seo, Susan M.

    2005-01-01

    NorA is a Staphylococcus aureus multidrug transporter that confers resistance to structurally distinct compounds. The MgrA global regulatory protein is reported to augment norA expression when mgrA is overexpressed from an undefined plasmid-based promoter. Further details about norA regulatory mechanisms are scant. A chromosomal norA::lacZ transcriptional fusion was constructed in different S. aureus strains, and allele replacement was used to define the relevance of promoter region sequences...

  10. RADIATION ACCESS ZONE AND VENTILATION CONFINEMENT ZONE CRITERIA FOR THE MGR SURFACE FACILITIES

    International Nuclear Information System (INIS)

    D. A. Padula

    2000-01-01

    The objectives of this technical report are to: (1) Establish the criteria for Radiation Access Zone (RAZ) designation. (2) Establish the criteria for the Ventilation Confinement Zone (VCZ) designation. The scope will be to formulate the RAZ and VCZ zoning designation for the Monitored Geologic Repository (MGR) surface facilities and to apply the zoning designations to the current Waste Handling Building (WHB), Waste Treatment Building (WTB), and Carrier Preparation Building (CPB) configurations

  11. Illuminating the Decision Path: The Yucca Mountain Site Recommendation

    Energy Technology Data Exchange (ETDEWEB)

    Knox, E.; Slothouber, L.

    2003-02-25

    On February 14, 2002, U.S. Secretary of Energy Spencer Abraham provided to the President the ''Recommendation by the Secretary of Energy Regarding the Suitability of the Yucca Mountain Site for a Repository Under the Nuclear Waste Policy Act of 1982.'' This Recommendation, along with supporting materials, complied with statutory requirements for communicating a site recommendation to the President, and it did more: in 49 pages, the Recommendation also spoke directly to the Nation, illuminating the methodology and considerations that led toward the decision to recommend the site. Addressing technical suitability, national interests, and public concerns, the Recommendation helped the public understand the potential risks and benefits of repository development and placed those risks and benefits in a meaningful national context.

  12. Illuminating the Decision Path: The Yucca Mountain Site Recommendation

    International Nuclear Information System (INIS)

    Knox, E.; Slothouber, L.

    2003-01-01

    On February 14, 2002, U.S. Secretary of Energy Spencer Abraham provided to the President the ''Recommendation by the Secretary of Energy Regarding the Suitability of the Yucca Mountain Site for a Repository Under the Nuclear Waste Policy Act of 1982.'' This Recommendation, along with supporting materials, complied with statutory requirements for communicating a site recommendation to the President, and it did more: in 49 pages, the Recommendation also spoke directly to the Nation, illuminating the methodology and considerations that led toward the decision to recommend the site. Addressing technical suitability, national interests, and public concerns, the Recommendation helped the public understand the potential risks and benefits of repository development and placed those risks and benefits in a meaningful national context

  13. Archive of Geosample Data and Information from the Oregon State University (OSU) College of Earth, Ocean and Atmospheric Sciences (CEOAS) Marine Geology Repository (MGR)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Oregon State University Marine Geology Repository (OSU-MGR) is a partner in the Index to Marine and Lacustrine Geological Samples (IMLGS) database, contributing...

  14. Radioactive waste disposal: Recommendations for a repository site selection

    International Nuclear Information System (INIS)

    Cadelli, N.; Orlowski, S.

    1992-01-01

    This report is a guidebook on recommendations for site selection of radioactive waste repository, based on a consensus in european community. This report describes particularly selection criteria and recommendations for radioactive waste disposal in underground or ground repositories. 14 refs

  15. When Factorization Meets Heterogeneous Latent Topics:An Interpretable Cross-Site Recommendation Framework

    Institute of Scientific and Technical Information of China (English)

    辛欣; 林钦佑; 魏骁驰; 黄河燕

    2015-01-01

    Data sparsity is a well-known challenge in recommender systems. Previous studies alleviate this problem by incorporating the information within the corresponding social media site. In this paper, we solve this challenge by exploring cross-site information. Specifically, we examine: 1) how to effectively and efficiently utilize cross-site ratings and content features to improve recommendation performance and 2) how to make the recommendation interpretable by utilizing content features. We propose a joint model of matrix factorization and latent topic analysis. Heterogeneous content features are modeled by multiple kinds of latent topics. In addition, the combination of matrix factorization and latent topics makes the recommendation result interpretable. Therefore, the above two issues are simultaneously solved. Through a real-world dataset, where user behaviors in three social media sites are collected, we demonstrate that the proposed model is effective in improving recommendation performance and interpreting the rationale of ratings.

  16. DNFSB recommendation 94-1 Hanford site integrated stabilization management plan

    Energy Technology Data Exchange (ETDEWEB)

    McCormack, R.L.

    1997-05-07

    In May 1994, the Defense Nuclear Facilities Safety Board (DNFSB) issued DNFSB Recommendation 94-1 (Conway 1994), which identified concerns related to US Department of Energy (DOE) management of legacy fissile materials remaining from past defense production activities. The DNFSB expressed concern about the existing storage conditions for these materials and the slow pace at which the conditions were being remediated. The DNFSB also expressed its belief that additional delays in stabilizing these fissile materials would be accompanied by further deterioration of safety and unnecessary increased risks to workers and the public. In February 1995, DOE issued the DNFSB Recommendation 94-1 Implementation Plan (O`Leary 1995) to address the concerns identified in DNFSB Recommendation 94-1. The Implementation Plan (IP) identifies several DOE commitments to achieve safe interim storage for the legacy fissile materials, and constitutes DOE`s baseline DNFSB Recommendation 94-1 Integrated Program Plan (IPP). The IPP describes the actions DOE plans to implement within the DOE complex to convert its excess fissile materials to forms or conditions suitable for safe interim storage. The IPP was subsequently supplemented with an Integrated Facilities Plan and a Research and Development Plan, which further develop complex-wide research and development and long-range facility requirements and plans. The additions to the baseline IPP were developed based on a systems engineering approach that integrated facilities and capabilities at the various DOE sites and focused on attaining safe interim storage with minimum safety risks and environmental impacts. Each affected DOE site has developed a Site Integrated Stabilization Management Plan (SISMP) to identify individual site plans to implement the DNFSB Recommendation 94-1 IPP. The SISMPs were developed based on the objectives, requirements, and commitments identified in the DNFSB Recommendation 94-1 IP. The SISMPs also supported

  17. DNFSB recommendation 94-1 Hanford site integrated stabilization management plan

    International Nuclear Information System (INIS)

    McCormack, R.L.

    1997-01-01

    In May 1994, the Defense Nuclear Facilities Safety Board (DNFSB) issued DNFSB Recommendation 94-1 (Conway 1994), which identified concerns related to US Department of Energy (DOE) management of legacy fissile materials remaining from past defense production activities. The DNFSB expressed concern about the existing storage conditions for these materials and the slow pace at which the conditions were being remediated. The DNFSB also expressed its belief that additional delays in stabilizing these fissile materials would be accompanied by further deterioration of safety and unnecessary increased risks to workers and the public. In February 1995, DOE issued the DNFSB Recommendation 94-1 Implementation Plan (O'Leary 1995) to address the concerns identified in DNFSB Recommendation 94-1. The Implementation Plan (IP) identifies several DOE commitments to achieve safe interim storage for the legacy fissile materials, and constitutes DOE's baseline DNFSB Recommendation 94-1 Integrated Program Plan (IPP). The IPP describes the actions DOE plans to implement within the DOE complex to convert its excess fissile materials to forms or conditions suitable for safe interim storage. The IPP was subsequently supplemented with an Integrated Facilities Plan and a Research and Development Plan, which further develop complex-wide research and development and long-range facility requirements and plans. The additions to the baseline IPP were developed based on a systems engineering approach that integrated facilities and capabilities at the various DOE sites and focused on attaining safe interim storage with minimum safety risks and environmental impacts. Each affected DOE site has developed a Site Integrated Stabilization Management Plan (SISMP) to identify individual site plans to implement the DNFSB Recommendation 94-1 IPP. The SISMPs were developed based on the objectives, requirements, and commitments identified in the DNFSB Recommendation 94-1 IP. The SISMPs also supported

  18. Brownfields Recommendations for Sustainable Site Design — Green Landscape Plan

    Science.gov (United States)

    The assessment of conditions contained in this report focuses on site-specific environmental and soil conditions that might affect recommendations related to sustainable landscaping and site design, stormwater management, and stormwater reuse.

  19. Reactor siting risk comparisons related to recommendations of NUREG-0625

    International Nuclear Information System (INIS)

    Barsell, A.W.; Dombek, F.S.; Orvis, D.D.

    1980-11-01

    This document evaluates how implementing the remote siting recommendations for nuclear reactors (NUREG-0625) made by the Siting Policy Task Force of the US Nuclear Regulatory Commission (NRC) can reduce potential public risk. The document analyzes how population density affects site-specific risk for both light water reactors (LWRs) and high-temperature gas-cooled reactors

  20. Site Recommendation Subsurface Layout

    International Nuclear Information System (INIS)

    C.L. Linden

    2000-01-01

    The purpose of this analysis is to develop a Subsurface Facility layout that is capable of accommodating the statutory capacity of 70,000 metric tons of uranium (MTU), as well as an option to expand the inventory capacity, if authorized, to 97,000 MTU. The layout configuration also requires a degree of flexibility to accommodate potential changes in site conditions or program requirements. The objective of this analysis is to provide a conceptual design of the Subsurface Facility sufficient to support the development of the Subsurface Facility System Description Document (CRWMS M andO 2000e) and the ''Emplacement Drift System Description Document'' (CRWMS M andO 2000i). As well, this analysis provides input to the Site Recommendation Consideration Report. The scope of this analysis includes: (1) Evaluation of the existing facilities and their integration into the Subsurface Facility design. (2) Identification and incorporation of factors influencing Subsurface Facility design, such as geological constraints, thermal loading, constructibility, subsurface ventilation, drainage control, radiological considerations, and the Test and Evaluation Facilities. (3) Development of a layout showing an available area in the primary area sufficient to support both the waste inventories and individual layouts showing the emplacement area required for 70,000 MTU and, if authorized, 97,000 MTU

  1. DNFSB Recommendation 94-1 Hanford Site Integrated Stabilization Management Plan. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Gerber, E.W.

    1995-10-01

    The US Department of Energy (DOE) has developed an Integrated Program Plan (IPP) to address concerns identified in Defense Nuclear Facilities Safety Board Recommendation 94-1. The IPP describes the actions that DOE plans to implement at its various sites to convert excess fissile materials to forms or conditions suitable for safe interim storage. The baseline IPP was issued as DOE`s Defense Nuclear Facilities Safety Board (DNFSB) Recommendation 94-1 Implementation Plan (IP), which was transmitted to the DNFSB on February 28, 1995. The IPP is being further developed to include complex-wide requirements for research and development and a long-range facility requirements section. The planned additions to the baseline IPP are being developed based on a systems engineering approach that integrates facilities and capabilities at the various DOE sites and focuses on attaining safe interim storage with minimum safety risks and environmental impacts. Each affected DOE site has developed a Site Integrated Stabilization Management Plan (SISMP) to identify individual site plans to implement the DNFSB Recommendation 94-1 and to provide a basis for formulating planned additions to the IPP. The SISMPs were developed based on the objectives, requirements, and commitments identified in the baseline DNFSB Recommendation 94-1 IPP. The SISMPs will be periodically updated to reflect improved integration between DOE sites as identified during the IPP systems engineering evaluations.

  2. DNFSB Recommendation 94-1 Hanford Site Integrated Stabilization Management Plan. Volume 1

    International Nuclear Information System (INIS)

    Gerber, E.W.

    1995-10-01

    The US Department of Energy (DOE) has developed an Integrated Program Plan (IPP) to address concerns identified in Defense Nuclear Facilities Safety Board Recommendation 94-1. The IPP describes the actions that DOE plans to implement at its various sites to convert excess fissile materials to forms or conditions suitable for safe interim storage. The baseline IPP was issued as DOE's Defense Nuclear Facilities Safety Board (DNFSB) Recommendation 94-1 Implementation Plan (IP), which was transmitted to the DNFSB on February 28, 1995. The IPP is being further developed to include complex-wide requirements for research and development and a long-range facility requirements section. The planned additions to the baseline IPP are being developed based on a systems engineering approach that integrates facilities and capabilities at the various DOE sites and focuses on attaining safe interim storage with minimum safety risks and environmental impacts. Each affected DOE site has developed a Site Integrated Stabilization Management Plan (SISMP) to identify individual site plans to implement the DNFSB Recommendation 94-1 and to provide a basis for formulating planned additions to the IPP. The SISMPs were developed based on the objectives, requirements, and commitments identified in the baseline DNFSB Recommendation 94-1 IPP. The SISMPs will be periodically updated to reflect improved integration between DOE sites as identified during the IPP systems engineering evaluations

  3. Review of site recommendation process in Draft Environmental Assessments

    International Nuclear Information System (INIS)

    Joy, H.; Longo, T.; Burton, E.S.

    1985-01-01

    In December 1984, the US Department of Energy (DOE) published Draft Environmental Assessments (EAs) on nine potentially acceptable nuclear waste repository sites. Five sites in the states of Mississippi, Nevada, Texas, Utah, and Washington were proposed in the Draft EAs for nomination under the Nuclear Waste Policy Act as suitable for further detailed study (site characterization). The Nevada, Texas, and Washington sites were further proposed for recommendation to the President as preferred for site characterization. This paper reviews the process that DOE used in selecting the three sites proposed for site characterization. The process is consistent with DOE's implementation guidelines for selecting repository sites, and proceeds in three steps. First, the sites are ranked in order of preference for each of twenty technical guidelines based on information in the Draft EAs. The second step combines the individual guideline rankings into postclosure and preclosure guideline group rankings, and, finally, into an overall ranking. In the third step, the sensitivity of the choice of the three preferred sites is examined for a range of guideline weightings

  4. DNFSB Recommendation 94-1 Hanford site integrated stabilization management plan, volumes 1 and 2

    International Nuclear Information System (INIS)

    Gerber, E.W.

    1996-01-01

    This document comprises the Hanford Site Integrated Stabilization Management Plan (SISMP). This document describes the DOE's plans at the Hanford Site to address concerns identified in Defense Nuclear Facilites Safety Board (DNFSB) Recommendation 94-1. This document also identifies plans for other spent nuclear fuel (SNF) inventories at the Hanford Site which are not within the scope of DNFSB Recommendation 94-1 for reference purposes because of their interrelationship with plans for SNF within the scope of DNFSB Recommendation 94-1. The SISMP was also developed to assist DOE in initial formulation of the Research and Development Plan and the Integrated Facilities Plan

  5. A Novel Pentadentate Coordination Mode for the Carbonato Bridge: Synthesis, Crystal Structure, and Magnetic Behavior of (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)], a New Trinuclear Nickel(II) Carbonato-Bridged Complex with Strong Antiferromagnetic Coupling.

    Science.gov (United States)

    Escuer, Albert; Vicente, Ramon; Kumar, Sujit B.; Solans, Xavier; Font-Bardía, Mercé; Caneschi, Andrea

    1996-05-22

    The trinuclear complex (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)] was obtained by reaction of basic solutions of nickel(II), Medpt (bis(3aminopropyl)methylamine) and thiocyanate ligand with atmospheric CO(2) or by simple reaction with carbonate anion. (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)] crystallizes in the triclinic system, space group P&onemacr;, with a = 12.107(5) Å, b = 12.535(7) Å, c = 16.169(9) Å, alpha = 102.69(5) degrees, beta = 92.91(5) degrees, gamma = 118.01(4) degrees, Z = 2, and R = 0.043. The three nickel atoms are asymmetrically bridged by one pentadentate carbonato ligand, which shows a novel coordination mode. The (&mgr;(3)-CO(3))[Ni(3)(Medpt)(3)(NCS)(4)] compound shows a very strong antiferromagnetic coupling. Fit as irregular triangular arrangement gave J(1) = -88.4, J(2) = -57.7, and J(3) = -9.6 cm(-)(1), which is the strongest AF coupling observed to date for Ni(3) compounds. The magnetic behavior of the carbonato bridge is discussed.

  6. Recommendations for Benchmarking Web Site Usage among Academic Libraries.

    Science.gov (United States)

    Hightower, Christy; Sih, Julie; Tilghman, Adam

    1998-01-01

    To help library directors and Web developers create a benchmarking program to compare statistics of academic Web sites, the authors analyzed the Web server log files of 14 university science and engineering libraries. Recommends a centralized voluntary reporting structure coordinated by the Association of Research Libraries (ARL) and a method for…

  7. Overall Ventilation System Flow Network Calculation for Site Recommendation

    International Nuclear Information System (INIS)

    Steinhoff, Jeff J.

    2001-01-01

    The scope of this calculation is to determine ventilation system resistances, pressure drops, airflows, and operating cost estimates for the Site Recommendation (SR) design as detailed in the ''Site Recommendation Subsurface Layout'' (BSC (Bechtel SAIC Company) 2001a). The statutory limit for emplacement of waste in Yucca Mountain is 70,000 metric tons of uranium (MTU) and is considered the base case for this report. The objective is to determine the overall repository system ventilation flow network for the monitoring phase during normal operations and to provide a basis for the system description document design descriptions. Any values derived from this calculation will not be used to support construction, fabrication, or procurement. The work scope is identified in the ''Technical Work Plan for Subsurface Design Section FY01 Work Activities'' (CRWMS M and O 2001, pp. 6 and 13). In accordance with the technical work plan this calculation was prepared in accordance with AP-3.12Q, ''Calculations'' and other procedures invoked by AP-3.12Q. It also incorporates the procedure AP-SI1.Q, ''Software Management''

  8. Air pollution prevention at the Hanford Site: Status and recommendations

    International Nuclear Information System (INIS)

    Engel, J.A.

    1995-08-01

    With the introduction of the Clean Air Act Amendments of 1990 and other air and pollution prevention regulations, there has been increased focus on both pollution prevention and air emissions at US DOE sites. The Pollution Prevention (P2) Group of WHC reviewed the status of air pollution prevention with the goal of making recommendations on how to address air emissions at Hanford through pollution prevention. Using the air emissions inventory from Hanford's Title V permit, the P2 Group was able to identify major and significant air sources. By reviewing the literature and benchmarking two other DOE Sites, two major activities were recommended to reduce air pollution and reduce costs at the Hanford Site. First, a pollution prevention opportunity assessment (P2OA) should be conducted on the significant painting sources in the Maintenance group and credit should be taken for reducing the burning of tumbleweeds, another significant source of air pollution. Since they are significant sources, reducing these emissions will reduce air emission fees, as well as have the potential to reduce material and labor costs, and increase worker safety. Second, a P2OA should be conducted on alternatives to the three coal-fired powerhouses (steam plants) on-site, including a significant costs analysis of alternatives. This analysis could be of significant value to other DOE sites. Overall, these two activities would reduce pollution, ease regulatory requirements and fees, save money, and help Hanford take a leadership role in air pollution prevention

  9. ESF Mine Power Center Platforms

    Energy Technology Data Exchange (ETDEWEB)

    T.A. Misiak

    2000-02-10

    The purpose and objective of this analysis is to structurally evaluate the existing Exploratory Studies Facility (ESF) mine power center (MPC) support frames and to design service platforms that will attach to the MPC support frames. This analysis follows the Development Plan titled ''Produce Additional Design for Title 111 Evaluation Report'' (CRWMS M&O 1999a). This analysis satisfies design recommended in the ''Title III Evaluation Report for the Surface and Subsurface Power System'' (CRWMS M&O 1999b, Section 7.6) and concurred with in the ''System Safety Evaluation of Title 111 Evaluation Reports Recommended Work'' (Gwyn 1999, Section 10.1.1). This analysis does not constitute a level-3 deliverable, a level-4 milestone, or a supporting work product. This document is not being prepared in support of the Monitored Geologic Repository (MGR) Site Recommendation (SR), Environmental Impact Statement (EIS), or License Application (LA) and should not be cited as a reference in the MGR SR, EIS, or LA.

  10. Hot Spots on the Web for Teacher Librarians: A Selection of Recommended Web Sites for TLs To Visit.

    Science.gov (United States)

    1996

    Six papers review and recommend sites on the Web as resources for teacher librarians include: "Just Do It: A Guide to Getting Out There and Doing It Yourself" (Catherine Ryan); "A Selection of Recommended Web Sites for TLs To Visit" (Karen Bonanno); "A Selection of Recommended Web Sites for TLs To Visit" (Sandra…

  11. Workshops for state review of site suitability criteria for high-level radioactive waste repositories: analysis and recommendations

    International Nuclear Information System (INIS)

    1978-02-01

    The purpose of this report is to present the views and recommendations of invited State officials and legislators participating in a workshop concerned with preliminary site suitability criteria for high level radioactive waste repositories. The workshops were open to the public and were conducted by the U. S. Nuclear Regulatory Commission (NRC) during September 1977 in three regional locations across the United States. This contractor report is the second of two reports and consolidates the discussion by State officials on the role of a State in siting a repository, NRC's waste management program, the transportation of high level wastes, the number and location of repositories and concerns with the socio-economic impacts of siting a repository in a community. The recommendations to the NRC can be categorized into four areas. These were: (1) general recommendations, (2) procedural recommendations, (3) recommendations for improving communications, and (4) specific recommendations on the preliminary siting criteria. The recommendations emphasized the need for early State involvement in the siting process, the need for an impacted State to assess repository operations, the need for early solution of waste transportation concerns, and the requirement that any repository developed insure the protection of the public health and safety as its most important characteristic. Other participant recommendations are included in the body of the report

  12. Total System Performance Assessment for the Site Recommendation

    Energy Technology Data Exchange (ETDEWEB)

    None

    2000-10-02

    Site Recommendation (SR). The Total System Performance Assessment-Site Recommendation (TSPA-SR) will present a compliance evaluation of overall system performance against the guidelines and requirements in the revision of the DOE siting guidelines to be promulgated at 10 CFR 963, U.S. Nuclear Regulatory Commission (NRC) regulation for HLW disposal at proposed 10 CFR 63 (the proposed rule has been published at 64 FR 8640), and U.S. Environmental Protection Agency (EPA) environmental radiation protection standard to be promulgated at 40 CFR 197. At present, the NRC has issued the proposed 10 CFR 63 (64 FR 8640) for public comment whereas the EPA standard and the revised DOE siting guidelines are currently being developed. EPA has announced the release of 40 CFR 197 proposed rule on its website (www.epa.gov/radiation/yucca/rule.qui.htm) and the Federal Register announcement (which initiates the 90 day public comment period) is expected by the end of August, 1999. The purpose of this document is to present the overall goals, objectives, scope, methods, approach, and assumptions to be used in the development of the TSPA-SR. This document will serve as a communication tool for coordinating the DOE TSPA activities and for keeping the NRC staff informed of the TSPA activities for the SR.

  13. DNFSB Recommendation 94-1 Hanford Site Integrated Stabilization Management Plan. Volume 2

    International Nuclear Information System (INIS)

    Gerber, E.W.

    1995-10-01

    The Hanford Site Integrated Stabilization Management Plan (SISMP) was developed in support of the US Department of Energy's (DOE) Defense Nuclear Facilities Safety Board (DNFSB) Recommendation 94-1 Integrated Program Plan (IPP). Volume 1 of the SISMP identifies the technical scope and costs associated with Hanford Site plans to resolve concerns identified in DNFSB Recommendation 94-1. Volume 2 of the SISMP provides the Resource Loaded Integrated Schedules for Spent Nuclear Fuel Project and Plutonium Finishing Plant activities identified in Volume 1 of the SISMP. Appendix A provides the schedules and progress curves related to spent nuclear fuel management. Appendix B provides the schedules and progress curves related to plutonium-bearing material management. Appendix C provides programmatic logic diagrams that were referenced in Volume 1 of the SISMP

  14. Preliminary risk assessment for nuclear waste disposal in space. Volume I. Executive summary of technical report

    International Nuclear Information System (INIS)

    Rice, E.E.; Denning, R.S.; Friedlander, A.L.

    1982-01-01

    Three major conclusions come from this preliminary risk assessment of nuclear waste disposal in space. Preliminary estimates of space disposal risk are low, even with the estimated uncertainty bounds. If calculated mined geologic repository (MGR) release risks remain low, and the EPA requirements continue to be met, then no additional space disposal study effort is warranted. If risks perceived by the public are significant in the acceptance of mined geologic repositories, then consideration of space disposal as an MGR complement is warranted. As a result of this study, the following recommendations are made to NASA and the US DOE: During the continued evaluation of the mined geologic repository risk over the years ahead by DOE, if any significant increase in the calculated health risk is predicted for the MGR, then space disposal should be reevaluated at that time. The risks perceived by the public for the MGR should be evaluated on a broad basis by an independent organization to evaluate acceptance. If, in the future, MGR risks are found to be significant due to some presently unknown technical or social factor, and space disposal is selected as an alternative that may be useful in mitigating the risks, then the following space disposal study activities are recommended: improvement in chemical processing technology for wastes; payload accident response analysis; risk uncertainty analysis for both MGR and space disposal; health risk modeling that includes pathway and dose estimates; space disposal cost modeling; assessment of space disposal perceived (by public) risk benefit; and space systems analysis supporting risk and cost modeling

  15. Industrial gamma radiography on a building site with a portable device. Recommendations to operators - gammagraphy sheet ED 4243; Recommendations to intervening companies (subcontractors) -gammagraphy sheet ED 4244; Recommendations to user companies - gammagraphy sheet ED 4245

    International Nuclear Information System (INIS)

    Vaisseau, Bernard; Bourdon, Patrick; Laurent, Pierre; Servent, Jean-Pierre; Biau, Alain

    2006-12-01

    Based on best practices, three sheets indicate sets of recommendations regarding the use of an industrial gamma radiography portable device on a building site either by operators, intervening companies (or subcontractors), or user companies. As far as operators are concerned, recommendations concern preparation and transport, arrival on the building site, examination performance, end of examination, occurrence of an incident other than radiological, and occurrence of a radiological incident. As far as subcontractors are concerned, recommendations concern the actors of the intervening company, the permanent storage site of portable devices, the film development laboratory, portable devices and their accessories, other equipment used for examination, vehicles, operators, intervention preparation, the return on experience, and the immediate processing of anomalies. As far as user companies are concerned, recommendations concern actors of the user company, the definition of the operation, the previous inspection of premises and the definition of a prevention plan, the storage of equipment containing depleted uranium, loading and unloading operations, the coordination of exposure doses, the immediate processing of anomalies, and the return on experience. Moreover, the three sheets indicate the associated legal texts

  16. Characterization recommendations for waste sites at the Savannah River Plant

    International Nuclear Information System (INIS)

    Carlton, W.H.; Gordon, D.E.; Johnson, W.F.; Kaback, D.S.; Looney, B.B.; Nichols, R.L.; Shedrow, C.B.

    1987-11-01

    One hundred and sixty six disposal facilities that received or may have received waste materials resulting from operations at the Savannah River Plant (SRP) have been identified. These waste range from innocuous solid and liquid materials (e.g., wood piles) to process effluents that contain hazardous and/or radioactive constituents. The waste sites have been grouped into 45 categories according the the type of waste materials they received. Waste sites are located with SRP coordinates, a local Department of Energy (DOE) grid system whose grid north is 36 degrees 22 minutes west of true north. DOE policy is to close all waste sites at SRP in a manner consistent with protecting human health and environment and complying with applicable environmental regulations (DOE 1984). A uniform, explicit characterization program for SRP waste sites will provide a sound technical basis for developing closure plans. Several elements are summarized in the following individual sections including (1) a review of the history, geohydrology, and available characterization data for each waste site and (2) recommendations for additional characterization necessary to prepare a reasonable closure plan. Many waste sites have been fully characterized, while others have not been investigated at all. The approach used in this report is to evaluate available groundwater quality and site history data. For example, groundwater data are compared to review criteria to help determine what additional information is required. The review criteria are based on regulatory and DOE guidelines for acceptable concentrations of constituents in groundwater and soil

  17. WASTE TREATMENT BUILDING SYSTEM DESCRIPTION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    F. Habashi

    2000-06-22

    The Waste Treatment Building System provides the space, layout, structures, and embedded subsystems that support the processing of low-level liquid and solid radioactive waste generated within the Monitored Geologic Repository (MGR). The activities conducted in the Waste Treatment Building include sorting, volume reduction, and packaging of dry waste, and collecting, processing, solidification, and packaging of liquid waste. The Waste Treatment Building System is located on the surface within the protected area of the MGR. The Waste Treatment Building System helps maintain a suitable environment for the waste processing and protects the systems within the Waste Treatment Building (WTB) from most of the natural and induced environments. The WTB also confines contaminants and provides radiological protection to personnel. In addition to the waste processing operations, the Waste Treatment Building System provides space and layout for staging of packaged waste for shipment, industrial and radiological safety systems, control and monitoring of operations, safeguards and security systems, and fire protection, ventilation and utilities systems. The Waste Treatment Building System also provides the required space and layout for maintenance activities, tool storage, and administrative facilities. The Waste Treatment Building System integrates waste processing systems within its protective structure to support the throughput rates established for the MGR. The Waste Treatment Building System also provides shielding, layout, and other design features to help limit personnel radiation exposures to levels which are as low as is reasonably achievable (ALARA). The Waste Treatment Building System interfaces with the Site Generated Radiological Waste Handling System, and with other MGR systems that support the waste processing operations. The Waste Treatment Building System interfaces with the General Site Transportation System, Site Communications System, Site Water System, MGR

  18. WASTE TREATMENT BUILDING SYSTEM DESCRIPTION DOCUMENT

    International Nuclear Information System (INIS)

    Habashi, F.

    2000-01-01

    The Waste Treatment Building System provides the space, layout, structures, and embedded subsystems that support the processing of low-level liquid and solid radioactive waste generated within the Monitored Geologic Repository (MGR). The activities conducted in the Waste Treatment Building include sorting, volume reduction, and packaging of dry waste, and collecting, processing, solidification, and packaging of liquid waste. The Waste Treatment Building System is located on the surface within the protected area of the MGR. The Waste Treatment Building System helps maintain a suitable environment for the waste processing and protects the systems within the Waste Treatment Building (WTB) from most of the natural and induced environments. The WTB also confines contaminants and provides radiological protection to personnel. In addition to the waste processing operations, the Waste Treatment Building System provides space and layout for staging of packaged waste for shipment, industrial and radiological safety systems, control and monitoring of operations, safeguards and security systems, and fire protection, ventilation and utilities systems. The Waste Treatment Building System also provides the required space and layout for maintenance activities, tool storage, and administrative facilities. The Waste Treatment Building System integrates waste processing systems within its protective structure to support the throughput rates established for the MGR. The Waste Treatment Building System also provides shielding, layout, and other design features to help limit personnel radiation exposures to levels which are as low as is reasonably achievable (ALARA). The Waste Treatment Building System interfaces with the Site Generated Radiological Waste Handling System, and with other MGR systems that support the waste processing operations. The Waste Treatment Building System interfaces with the General Site Transportation System, Site Communications System, Site Water System, MGR

  19. Waste Handling Equipment Development Test and Evaluation Study

    International Nuclear Information System (INIS)

    R.L. Tome

    1998-01-01

    The purpose of this study is to identify candidate Monitored Geologic Repository (MGR) surface waste handling equipment for development testing. This study will also identify strategies for performing the development tests. Development testing shall be implemented to support detail design and reduce design risks. Development testing shall be conducted to confirm design concepts, evaluate alternative design concepts, show the availability of needed technology, and provide design documentation. The candidate equipment will be selected from MGR surface waste handling equipment that is the responsibility of the Management and Operating Contractor (M and O) Surface Design Department. The equipment identified in this study is based on Viability Assessment (VA) design. The ''Monitored Geologic Repository Test and Evaluation Plan'' (MGR T and EP), Reference 5.1, was used as a basis for this study. The MGR T and EP reflects the extent of test planning and analysis that can be conducted, given the current status of the MGR requirements and latest VA design information. The MGR T and EP supports the appropriate sections in the license application (LA) in accordance with 10 CFR 60.2 1(c)(14). The MGR T and EP describes the following test activities: site characterization to confirm, by test and analysis, the suitability of the Yucca Mountain site for housing a geologic repository; development testing to investigate and document design concepts to reduce risk; qualification testing to verify equipment compliance with design requirements, specifications, and regulatory requirements; system testing to validate compliance with MGR requirements, which include the receipt, handling, retrieval, and disposal of waste; periodic performance testing to verify preclosure requirements and to demonstrate safe and reliable MGR operation; and performance confirmation modeling, testing, and analysis to verify adherence to postclosure regulatory requirements. Development test activities can be

  20. An investigation of site diversity and comparison with ITU-R recommendations

    Science.gov (United States)

    Callaghan, S. A.; Boyes, B.; Couchman, A.; Waight, J.; Walden, C. J.; Ventouras, S.

    2008-08-01

    Earth-space radio systems operating at frequencies of 10 GHz and above are badly attenuated by rain, cloud, and atmospheric gases. As the frequencies of operational systems increase, it becomes increasingly uneconomic to compensate for the effects of fading through the use of a fixed fade margin, hence the implementation of fade mitigation techniques (FMT). The spatial and temporal variation of rain provides the justification for the use of site diversity as an FMT. Site diversity employs two or more ground stations receiving the same satellite signal with a separation distance such that the sites encounter intense rainfall at different times, and switching to the site experiencing the least fading improves system performance considerably. Measurements of the 20.7 GHz beacon carried as part of the Global Broadcast Service (GBS) payload on the U.S. Department of Defense satellite UFO-9 have been made at three sites: two are located in the South of England (˜8 km apart), and the third receiver was located in Scotland. These beacon measurements have produced long term attenuation exceedance and site diversity gain and improvement statistics. This attenuation time series data can simulate the performance of an Earth-space system using site diversity, indicating the optimum method of implementing this FMT. In this paper, unbalanced site diversity is investigated, as this is a more likely scenario than the balanced site diversity modeled by the ITU-R recommendations. This paper also investigates the implementation of site diversity from a commercial context, including cost-benefit analysis and technical feasibility.

  1. Mononuclear Amido and Binuclear Imido Zirconium Complexes Supported by Dibenzotetraaza[14]annulene Ligands. X-ray Structure of [(Me(4)taa)Zr(&mgr;-NR)(2)Zr(NHR)(2)] (R = Bu(t) or 2,6-C(6)H(3)Me(2)).

    Science.gov (United States)

    Nikonov, Georgii I.; Blake, Alexander J.; Mountford, Philip

    1997-03-12

    Reaction of 2 equiv of Li[NH-2,6-C(6)H(3)R(2)] with [(Me(4)taa)ZrCl(2)] (Me(4)taaH(2) = tetramethyldibenzotetraaza[14]annulene) gives the bis(amido) derivatives [(Me(4)taa)Zr(NH-2,6-C(6)H(3)R(2))(2)] [R = Pr(i) (1) and Me (2)]. Addition of Me(4)taaH(2) to [Zr(N-2,6-C(6)H(3)Pr(i)(2))(NH-2,6-C(6)H(3)Pr(i)(2))(2)(py)(2)] also affords 1. The reaction of 2 equiv of aryl or alkyl amines H(2)NR with the bis(alkyl) complex [(Me(4)taa)Zr(CH(2)SiMe(3))(2)] is the most versatile method for preparing [(Me(4)taa)Zr(NHR)(2)] (R = 2,6-C(6)H(3)Pr(i)(2), 2,6-C(6)H(3)Me(2), Ph, or Bu(t)). Reaction of 1 equiv of Me(4)taaH(2) with the binuclear complexes [(Bu(t)NH)(2)Zr(&mgr;-NBu(t))(2)Zr(NHBu(t))(2)] or [(py)(HN-2,6-C(6)H(3)Me(2))(2)Zr(&mgr;-N-2,6-C(6)H(3)Me(2))(2)Zr(NH-2,6-C(6)H(3)Me(2))(2)(py)] gives the asymmetrically substituted derivatives [(Me(4)taa)Zr(&mgr;-NR)(2)Zr(NHR)(2)] [R = Bu(t) (6) or 2,6-C(6)H(3)Me(2) (8)], which have been crystallographically characterized.

  2. Social Networking Sites in Education – Governmental Recommendations and Actual Use

    OpenAIRE

    Ingrid Helleve; Aslaug Grov Almås; Brita Bjørkelo

    2013-01-01

    The aim of this paper is to explore to what extent and for what purposes pre-service teachers (Study 1, n = 474) and upper secondary pupils (Study 2, n = 324) use social networking sites (SNS), and how the Government’s recommendations correspond to the two groups’ understanding of their educational institutions’ SNS guidelines. Results show that the majority in both groups want to communicate with peers, not with each other. Both report negative SNS experiences. Pre-service teachers do not us...

  3. Recommended new criteria for the selection of nuclear waste repository sites in Columbia River basalt and US Gulf Coast domed salt

    International Nuclear Information System (INIS)

    Steinborn, T.L.; Wagoner, J.L.; Qualheim, B.; Fitts, C.R.; Stetkar, R.E.; Turnbull, R.W.

    1980-01-01

    Screening criteria and specifications are recommended to aid in the evaluation of sites proposed for nuclear waste disposal in basalt and domed salt. The recommended new criteria proposed in this report are intended to supplement existing repository-related criteria for nuclear waste disposal. The existing criteria are contained in 10 CFR 60 sections which define siting criteria of the Nuclear Regulatory Commission (NRC), and ONWI 33(2) which defines siting criteria of the Office of Nuclear Waste Isolation (ONWI) for the Department of Energy. The specifications are conditions or parameter values that the authors recommend be applied in site acceptance evaluations. The siting concerns covered in this report include repository depth, host rock extent, seismic setting, structural and tectonic conditions, groundwater and rock geochemistry, volcanism, surface and subsurface hydrology, and socioeconomic issues, such as natural resources, land use, and population distribution

  4. Evaluating music emotion recognition

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    A fundamental problem with nearly all work in music genre recognition (MGR)is that evaluation lacks validity with respect to the principal goals of MGR. This problem also occurs in the evaluation of music emotion recognition (MER). Standard approaches to evaluation, though easy to implement, do...... not reliably differentiate between recognizing genre or emotion from music, or by virtue of confounding factors in signals (e.g., equalization). We demonstrate such problems for evaluating an MER system, and conclude with recommendations....

  5. Perspective on safety case to support a possible site recommendation decision

    International Nuclear Information System (INIS)

    Gil, A.V.; Gamble, R.P.

    2002-01-01

    The mission of the US Department of Energy (DOE) is to provide the basis for a national decision regarding the development of a geological repository for spent nuclear fuel and high-level radioactive waste at the Yucca Mountain site in Nevada. There are a number of steps in the decision process defined by US law that must be completed prior to development of a repository at this site. The DOE's focus is currently on the first two steps in this process: characterization of the site to support a determination by the DOE on whether the site is suitable for a geologic repository and a decision by the Secretary of Energy (the Secretary) on whether to recommend to the President that the site be approved for a repository. To enhance the confidence of multiple audiences in the basis for these actions, and to provide a basis for subsequent action by the President and the US Congress, information supporting the decision process must include the elements of a safety case consistent with the statutory and regulatory framework for these decisions. The idea of a safety case is to broaden the basis for confidence by decision-makers and the public in conclusions about safety. A safety case should cite multiple lines of evidence, or reasoning, beyond the results of a safety assessment to support the demonstration of safety, which includes compliance with applicable safety criteria. The multiple lines of evidence should show the basis for confidence in safety. To be most effective, such evidence requires information not directly used in the safety assessment. (author)

  6. Use of Social Networking Sites and Adherence to Physical Activity and Screen Time Recommendations in Adolescents.

    Science.gov (United States)

    Sampasa-Kanyinga, Hugues; Chaput, Jean-Philippe

    2016-05-01

    Adolescents are recommended to achieve ≥ 60 min/day of moderate-to-vigorous physical activity (PA) and ≤2 h/day of screen time (ST). This study examined the relationships between the use of social networking sites (SNSs) and adherence to PA and ST recommendations in a large sample of Canadian adolescents. This cross-sectional school-based survey included a representative sample of 9388 students in grades 7 to 12 across Ontario, Canada. After adjustment for several confounding variables, results showed that male adolescents who use SNSs for fewer hours (≤ 1 h/day) had greater odds of adherence to PA and to both PA and ST recommendations concurrently, while those who use it for more hours (≥ 3 h/day) had lower odds of adherence to the ST recommendation. Female adolescents who use SNSs for more hours had lower odds of adherence to the ST recommendation (use of SNSs ≥ 2 h/day) and to both PA and ST recommendations concurrently (use of SNSs ≥ 5 h/day). Heavy use of SNSs has a negative influence on the adherence to the ST recommendation in both males and females; however, infrequent use of SNSs was related to the adherence to the PA recommendation and concurrent adherence to both recommendations in males only.

  7. Office of Fusion Energy recommendations on the Elmo Bumpy Torus proof-of-principle experiment site selection

    International Nuclear Information System (INIS)

    1980-01-01

    This report provies background information and rationale for the procedures used and decisions made up to this point. A brief history and technical description of the EBT concept are given. The OFE recommendations as to siting are included

  8. Monitored Geologic Repository Project Description Document

    International Nuclear Information System (INIS)

    Curry, P. M.

    2001-01-01

    The primary objective of the Monitored Geologic Repository Project Description Document (PDD) is to allocate the functions, requirements, and assumptions to the systems at Level 5 of the Civilian Radioactive Waste Management System (CRWMS) architecture identified in Section 4. It provides traceability of the requirements to those contained in Section 3 of the ''Monitored Geologic Repository Requirements Document'' (MGR RD) (YMP 2000a) and other higher-level requirements documents. In addition, the PDD allocates design related assumptions to work products of non-design organizations. The document provides Monitored Geologic Repository (MGR) technical requirements in support of design and performance assessment in preparing for the Site Recommendation (SR) and License Application (LA) milestones. The technical requirements documented in the PDD are to be captured in the System Description Documents (SDDs) which address each of the systems at Level 5 of the CRWMS architecture. The design engineers obtain the technical requirements from the SDDs and by reference from the SDDs to the PDD. The design organizations and other organizations will obtain design related assumptions directly from the PDD. These organizations may establish additional assumptions for their individual activities, but such assumptions are not to conflict with the assumptions in the PDD. The PDD will serve as the primary link between the technical requirements captured in the SDDs and the design requirements captured in US Department of Energy (DOE) documents. The approved PDD is placed under Level 3 baseline control by the CRWMS Management and Operating Contractor (M and O) and the following portions of the PDD constitute the Technical Design Baseline for the MGR: the design characteristics listed in Table 1-1, the MGR Architecture (Section 4.1), the Technical Requirements (Section 5), and the Controlled Project Assumptions (Section 6)

  9. Monitored Geologic Repository Project Description Document

    International Nuclear Information System (INIS)

    Curry, P.

    2000-01-01

    The primary objective of the Monitored Geologic Repository Project Description Document (PDD) is to allocate the functions, requirements, and assumptions to the systems at Level 5 of the Civilian Radioactive Waste Management System (CRWMS) architecture identified in Section 4. It provides traceability of the requirements to those contained in Section 3 of the ''Monitored Geologic Repository Requirements Document'' (MGR RD) (CRWMS M and O 2000b) and other higher-level requirements documents. In addition, the PDD allocates design related assumptions to work products of non-design organizations. The document provides Monitored Geologic Repository (MGR) engineering design basis in support of design and performance assessment in preparing for the Site Recommendation (SR) and License Application (LA) milestones. The engineering design basis documented in the PDD is to be captured in the System Description Documents (SDDs) which address each of the systems at Level 5 of the CRWMS architecture. The design engineers obtain the engineering design basis from the SDDs and by reference from the SDDs to the PDD. The design organizations and other organizations will obtain design related assumptions directly from the PDD. These organizations may establish additional assumptions for their individual activities, but such assumptions are not to conflict with the assumptions in the PDD. The PDD will serve as the primary link between the engineering design basis captured in the SDDs and the design requirements captured in U.S. Department of Energy (DOE) documents. The approved PDD is placed under Level 3 baseline control by the CRWMS Management and Operating Contractor (M and O) and the following portions of the PDD constitute the Technical Design Baseline for the MGR: the design characteristics listed in Table 2-1, the MGR Architecture (Section 4.1),the Engineering Design Bases (Section 5), and the Controlled Project Assumptions (Section 6)

  10. Early Site Permit Demonstration Program: Recommendations for communication activities and public participation in the Early Site Permit Demonstration Program

    International Nuclear Information System (INIS)

    1993-01-01

    On October 24, 1992, President Bush signed into law the National Energy Policy Act of 1992. The bill is a sweeping, comprehensive overhaul of the Nation's energy laws, the first in more than a decade. Among other provisions, the National Energy Policy Act reforms the licensing process for new nuclear power plants by adopting a new approach developed by the US Nuclear Regulatory Commission (NRC) in 1989, and upheld in court in 1992. The NRC 10 CFR Part 52 rule is a three-step process that guarantees public participation at each step. The steps are: early site permit approval; standard design certifications; and, combined construction/operating licenses for nuclear power reactors. Licensing reform increases an organization's ability to respond to future baseload electricity generation needs with less financial risk for ratepayers and the organization. Costly delays can be avoided because design, safety and siting issues will be resolved before a company starts to build a plant. Specifically, early site permit approval allows for site suitability and acceptability issues to be addressed prior to an organization's commitment to build a plant. Responsibility for site-specific activities, including communications and public participation, rests with those organizations selected to try out early site approval. This plan has been prepared to assist those companies (referred to as sponsoring organizations) in planning their communications and public involvement programs. It provides research findings, information and recommendations to be used by organizations as a resource and starting point in developing their own plans

  11. 75 FR 984 - Draft Recommended Interim Preliminary Remediation Goals for Dioxin in Soil at CERCLA and RCRA Sites

    Science.gov (United States)

    2010-01-07

    ...The Environmental Protection Agency (EPA or the Agency) is announcing a 50-day public comment period for draft recommended interim preliminary remediation goals (PRGs) developed in the Draft Recommended Interim Preliminary Remediation Goals for Dioxin in Soil at Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) and Resource Conservation and Recovery Act (RCRA) Sites. EPA's Office of Solid Waste and Emergency and Emergency Response (OSWER) has developed the draft recommended interim PRGs for dioxin in soil. These draft recommended interim PRGs were calculated using existing, peer- reviewed toxicity values and current EPA equations and default exposure assumptions. This Federal Register notice is intended to provide an opportunity for public comment on the draft recommended interim PRGs. EPA will consider any public comments submitted in accordance with this notice and may revise the draft recommended interim PRGs thereafter.

  12. Test methods for on site measurement of resistivity of concrete. A RILEM TC-154 Technical Recommendation

    NARCIS (Netherlands)

    Polder, R.B.

    2000-01-01

    This paper describes methods to assess concrete resistivity on site for various purposes related to corrosion and protection of reinforcement. It is based on a first draft of a RILEM Technical Recommendation. The electrical resistivity of concrete can be related to the two processes involved in

  13. Early Site Permit Demonstration Program: Recommendations for communication activities and public participation in the Early Site Permit Demonstration Program

    Energy Technology Data Exchange (ETDEWEB)

    1993-01-27

    On October 24, 1992, President Bush signed into law the National Energy Policy Act of 1992. The bill is a sweeping, comprehensive overhaul of the Nation`s energy laws, the first in more than a decade. Among other provisions, the National Energy Policy Act reforms the licensing process for new nuclear power plants by adopting a new approach developed by the US Nuclear Regulatory Commission (NRC) in 1989, and upheld in court in 1992. The NRC 10 CFR Part 52 rule is a three-step process that guarantees public participation at each step. The steps are: early site permit approval; standard design certifications; and, combined construction/operating licenses for nuclear power reactors. Licensing reform increases an organization`s ability to respond to future baseload electricity generation needs with less financial risk for ratepayers and the organization. Costly delays can be avoided because design, safety and siting issues will be resolved before a company starts to build a plant. Specifically, early site permit approval allows for site suitability and acceptability issues to be addressed prior to an organization`s commitment to build a plant. Responsibility for site-specific activities, including communications and public participation, rests with those organizations selected to try out early site approval. This plan has been prepared to assist those companies (referred to as sponsoring organizations) in planning their communications and public involvement programs. It provides research findings, information and recommendations to be used by organizations as a resource and starting point in developing their own plans.

  14. ILK statement on the recommendations by the working group on procedures for the selection of repository sites

    International Nuclear Information System (INIS)

    Anon.

    2003-01-01

    The Working Group on Procedures for the Selection of Repository Sites (AkEnd) had been appointed by the German Federal Ministry for the Environment (BMU) to develop procedures and criteria for the search for, and selection of, a repository site for all kinds of radioactive waste in deep geologic formations in Germany. ILK in principle welcomes the attempt on the part of AkEnd to develop a systematic procedure. On the other hand, ILK considers the two constraints imposed by BMU inappropriate: AkEnd was not to take into account the two existing sites of Konrad and Gorleben and, instead, work from a so-called white map of Germany. ILK recommends to perform a comprehensive safety analysis of Gorleben and define a selection procedure including the facts about Gorleben and, in addition, to commission the Konrad repository as soon as possible. The one-repository concept established as a precondition by BMU greatly restricts the selection procedure. There are no technical or scientific reasons for such concept. ILK recommends to plan for separate repositories, which would also correspond to international practice. The geoscientific criteria proposed by AkEnd should be examined and revised. With respect to the site selection procedure proposed, ILK feels that procedure is unable to define a targeted approach. Great importance must be attributed to public participation. The final site selection must be made under the responsibility of the government or the parliament. (orig.) [de

  15. Multihospital Occurrence of Pan-Resistant Klebsiella pneumoniae Sequence Type 147 with an ISEcp1-Directed blaOXA-181 Insertion in the mgrB Gene in the United Arab Emirates.

    Science.gov (United States)

    Sonnevend, Ágnes; Ghazawi, Akela; Hashmey, Rayhan; Haidermota, Aliasgher; Girgis, Safinaz; Alfaresi, Mubarak; Omar, Mohammed; Paterson, David L; Zowawi, Hosam M; Pál, Tibor

    2017-07-01

    The emergence of pan-resistant Klebsiella pneumoniae strains is an increasing concern. In the present study, we describe a cluster of 9 pan-resistant K. pneumoniae sequence type 147 (ST147) isolates encountered in 4 patients over nearly 1 year in 3 hospitals of the United Arab Emirates (UAE). The isolates exhibited highly similar genotypes. All produced chromosomally encoded OXA-181, and the majority also produced the NDM-5 carbapenemase. As with the previously described single isolate from the UAE, MS6671, the mgrB was disrupted by a functional, IS Ecp1 -driven bla OXA-181 insertion causing resistance to carbapenems. The mutation was successfully complemented with an intact mgrB gene, indicating that it was responsible for colistin resistance. bla NDM-5 was located within a resistance island of an approximately 100-kb IncFII plasmid carrying ermB , mph (A), bla TEM-1B , rmtB , bla NDM-5 , sul1 , aadA2 , and dfrA12 resistance genes. Sequencing this plasmid (pABC143-NDM) revealed that its backbone was nearly identical to that of plasmid pMS6671E from which several resistance genes, including bla NDM-5 , had been deleted. More extensive similarities of the backbone and the resistance island were found between pABC143C-NDM and the bla NDM-5 -carrying IncFII plasmids of two K. pneumoniae ST147 isolates from South Korea, one of which was colistin resistant, and both also produced OXA-181. Notably, one of these strains was isolated from a patient transferred from the UAE. Our data show that this pan-resistant clone has an alarming capacity to maintain itself over an extended period of time and is even likely to be transmitted internationally. Copyright © 2017 American Society for Microbiology.

  16. Evaluation of environmental data relating to selected nuclear power plant sites. A synthesis and summary with recommendations

    International Nuclear Information System (INIS)

    Murarka, I.P.; Policastro, A.J.; Ferrante, J.G.; Daniels, E.W.; Marmer, G.J.

    1976-11-01

    An analysis of the fuel data gathered during the monitoring programs at seven nuclear power plant sites show no significant ecological impacts. This conclusion is within the constraints of the quality of available data from these sites. Current monitoring programs are, however, not designed to meet the needs for statistical analysis and, consequently, the monitoring data are often ill-suited for modern statistical procedures. Recommendations are proposed for revising monitoring schemes so that more precise conclusions can be made from fewer field measurements

  17. Recommended criteria for the evaluation of on-site nuclear power plant emergency plans, volume II: criteria

    International Nuclear Information System (INIS)

    1997-01-01

    A critical review of existing Canadian and international nuclear power plant (NPP) emergency plans, evaluation criteria, and approaches has been conducted to provide AECB staff with information which can be used to assess the adequacy of NPP on-site emergency response plans. The results of this work are published in two volumes. Volume I, Basis Document, provides the reasons why certain requirements are in place. It also gives comprehensive references to various standards.Volume II, Criteria, contains the criteria which relate to on-site actions and their integration with control room activities and the roles of off-site responsible organizations. The recommended criteria provide information on what is required, and not on how to accomplish the requirements. The licensees are given the latitude to decide on the methods and processes needed to meet the requirements. The documents do not address NPP off-site plans and response capability, or the control room emergency operating procedures and response capability. This report contains only Volume II: Criteria. 55 refs., 2 tabs., 1 fig

  18. Could we do better? Behavioural tracking on recommended consumer health websites.

    Science.gov (United States)

    Burkell, Jacquelyn; Fortier, Alexandre

    2015-09-01

    This study examines behavioural tracking practices on consumer health websites, contrasting tracking on sites recommended by information professionals with tracking on sites returned by Google. Two lists of consumer health websites were constructed: sites recommended by information professionals and sites returned by Google searches. Sites were divided into three groups according to source (Recommended-Only, Google-Only or both) and type (Government, Not-for-Profit or Commercial). Behavioural tracking practices on each website were documented using a protocol that detected cookies, Web beacons and Flash cookies. The presence and the number of trackers that collect personal information were contrasted across source and type of site; a second set of analyses specifically examined Advertising trackers. Recommended-Only sites show lower levels of tracking - especially tracking by advertisers - than do Google-Only sites or sites found through both sources. Government and Not-for-Profit sites have fewer trackers, particularly from advertisers, than do Commercial sites. Recommended sites, especially those from Government or Not-for-Profit organisations, present a lower privacy threat than sites returned by Google searches. Nonetheless, most recommended websites include some trackers, and half include at least one Advertising tracker. To protect patron privacy, information professionals should examine the tracking practices of the websites they recommend. © 2015 Health Libraries Group.

  19. International Review Team (IRT) Safety Case Recommendations for the Yucca Mountain Total System Performance Assessment (TSPA) Supporting the Site Recommendation

    International Nuclear Information System (INIS)

    Van Luik, Abraham E.

    2004-01-01

    The session started with Abe Van Luik (IGSC Chair, US-DOE-YM, USA) who presented the feedback of the international peer review of the US-DOE Yucca Mountain TSPA (Total System Performance Assessment) supporting the successful designation of the site by the Congress and the President of the U.S. In particular, he listed key implications of the IRT (International Review team) recommendations on the forthcoming US-DOE documentation of its case for safety to be submitted to the regulator, the U.S. Nuclear Regulatory Commission, mainly: - The documentation submitted to the licensing authority should address technical aspects and compliance with regulatory criteria. - That documentation should reflect sound science and good engineering practice; it should present detailed and rigorous modelling. - In addition, it should present both quantitative and qualitative arguments, make a statement on why there can be confidence in the face of uncertainty, acknowledge remaining issues and provide the strategy to resolve them. - Demonstrating understanding is as important as demonstrating compliance. - There is a need to provide a clear explanation of the case made to the regulator for more general audiences to complement the large amount of technical documents that will be produced. The US-DOE response to these recommendations for the License Application, which is under preparation, is that the recommendations will be implemented to the maximum extent possible. In subsequent discussion, with respect to the License Application, it was acknowledged that detailed guidance from the U.S. regulator was very useful, and guidance of this type would be generally useful. At the current time, the words 'safety case' are not mentioned in U.S. regulations, but if one reads both the regulation and guidance documents it becomes evident that all aspects of a safety case need to be provided in the License Application and its accompanying documents

  20. National survey of crystalline rocks and recommendations of regions to be explored for high-level radioactive waste repository sites

    International Nuclear Information System (INIS)

    Smedes, H.W.

    1983-04-01

    A reconnaissance of the geological literature on large regions of exposed crystalline rocks in the United States provides the basis for evaluating if any of those regions warrant further exploration toward identifying potential sites for development of a high-level radioactive waste repository. The reconnaissance does not serve as a detailed evaluation of regions or of any smaller subunits within the regions. Site performance criteria were selected and applied insofar as a national data base exists, and guidelines were adopted that relate the data to those criteria. The criteria include consideration of size, vertical movements, faulting, earthquakes, seismically induced ground motion, Quaternary volcanic rocks, mineral deposits, high-temperature convective ground-water systems, hydraulic gradients, and erosion. Brief summaries of each major region of exposed crystalline rock, and national maps of relevant data provided the means for applying the guidelines and for recommending regions for further study. It is concluded that there is a reasonable likelihood that geologically suitable repository sites exist in each of the major regions of crystalline rocks. The recommendation is made that further studies first be conducted of the Lake Superior, Northern Appalachian and Adirondack, and the Southern Appalachian Regions. It is believed that those regions could be explored more effectively and suitable sites probably could be found, characterized, verified, and licensed more readily there than in the other regions

  1. National survey of crystalline rocks and recommendations of regions to be explored for high-level radioactive waste repository sites

    Energy Technology Data Exchange (ETDEWEB)

    Smedes, H.W.

    1983-04-01

    A reconnaissance of the geological literature on large regions of exposed crystalline rocks in the United States provides the basis for evaluating if any of those regions warrant further exploration toward identifying potential sites for development of a high-level radioactive waste repository. The reconnaissance does not serve as a detailed evaluation of regions or of any smaller subunits within the regions. Site performance criteria were selected and applied insofar as a national data base exists, and guidelines were adopted that relate the data to those criteria. The criteria include consideration of size, vertical movements, faulting, earthquakes, seismically induced ground motion, Quaternary volcanic rocks, mineral deposits, high-temperature convective ground-water systems, hydraulic gradients, and erosion. Brief summaries of each major region of exposed crystalline rock, and national maps of relevant data provided the means for applying the guidelines and for recommending regions for further study. It is concluded that there is a reasonable likelihood that geologically suitable repository sites exist in each of the major regions of crystalline rocks. The recommendation is made that further studies first be conducted of the Lake Superior, Northern Appalachian and Adirondack, and the Southern Appalachian Regions. It is believed that those regions could be explored more effectively and suitable sites probably could be found, characterized, verified, and licensed more readily there than in the other regions.

  2. Recommender systems

    CERN Document Server

    Kembellec, Gérald; Saleh, Imad

    2014-01-01

    Acclaimed by various content platforms (books, music, movies) and auction sites online, recommendation systems are key elements of digital strategies. If development was originally intended for the performance of information systems, the issues are now massively moved on logical optimization of the customer relationship, with the main objective to maximize potential sales. On the transdisciplinary approach, engines and recommender systems brings together contributions linking information science and communications, marketing, sociology, mathematics and computing. It deals with the understan

  3. Procedural justice in wind facility siting: Recommendations for state-led siting processes

    International Nuclear Information System (INIS)

    Ottinger, Gwen; Hargrave, Timothy J.; Hopson, Eric

    2014-01-01

    Evidence suggests that state control of wind facility siting decisions fosters new project development more effectively than local control, yet the literature suggests that affected citizens tend to be more fairly represented in local siting processes. We argue that successful renewable energy policy must satisfy both the need for new project development and the obligation to procedural justice. To suggest how it can do so, we analyze existing state- and county-level siting processes in Washington state, finding that both fall short on measures of procedural justice. To overcome this limitation and address the tension between procedural justice and project development, we then propose a collaborative governance approach to wind facility siting, in which state governments retain ultimate authority over permitting decisions but encourage and support local-level deliberations as the primary means of making those decisions. Such an approach, we argue, would be more just, facilitate wind development by addressing community concerns constructively and result in better projects through the input of diverse stakeholders. - Highlights: • States have made wind energy development a priority. • Local opposition to new projects could hinder future wind energy development. • Procedural justice is necessary to resolve local issues and ensure timely wind facility siting. • Both state- and county-led siting processes fall short with respect to criteria for procedural justice, though local processes have some advantages. • States could instead induce counties, developers to engage in deliberation

  4. Site specific modification of the human plasma proteome by methylglyoxal

    International Nuclear Information System (INIS)

    Kimzey, Michael J.; Kinsky, Owen R.; Yassine, Hussein N.; Tsaprailis, George; Stump, Craig S.; Monks, Terrence J.; Lau, Serrine S.

    2015-01-01

    Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may

  5. Site specific modification of the human plasma proteome by methylglyoxal

    Energy Technology Data Exchange (ETDEWEB)

    Kimzey, Michael J.; Kinsky, Owen R. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Yassine, Hussein N. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Tsaprailis, George [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Stump, Craig S. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Southern Arizona VA Health Care System, Tucson, AZ 85723 (United States); Monks, Terrence J. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Lau, Serrine S., E-mail: lau@pharmacy.arizona.edu [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States)

    2015-12-01

    Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may

  6. Verbal and numerical consumer recommendations: switching between recommendation formats leads to preference inconsistencies.

    Science.gov (United States)

    Maciejovsky, Boris; Budescu, David V

    2013-06-01

    Many Web sites provide consumers with product recommendations, which are typically presented by a sequence of verbal reviews and numerical ratings. In three experiments, we demonstrate that when participants switch between formats (e.g., from verbal to numerical), they are more prone to preference inconsistencies than when they aggregate the recommendations within the same format (e.g., verbal). When evaluating recommendations, participants rely primarily on central-location measures (e.g., mean) and less on other distribution characteristics (e.g., variance). We explain our findings within the theoretical framework of stimulus-response compatibility and we make practical recommendations for the design of recommendation systems and Web portals.

  7. Ensuring treatment fidelity in a multi-site behavioral intervention study: implementing NIH Behavior Change Consortium recommendations in the SMART trial.

    Science.gov (United States)

    Robb, Sheri L; Burns, Debra S; Docherty, Sharron L; Haase, Joan E

    2011-11-01

    The Stories and Music for Adolescent/Young Adult Resilience during Transplant (SMART) study (R01NR008583; U10CA098543; U10CA095861) is an ongoing multi-site Children's Oncology Group randomized clinical trial testing the efficacy of a therapeutic music video intervention for adolescents/young adults (11-24 years of age) with cancer undergoing stem cell transplant. Treatment fidelity strategies from our trial are consistent with the National Institutes of Health (NIH) Behavior Change Consortium Treatment Fidelity Workgroup (BCC) recommendations and provide a successful working model for treatment fidelity implementation in a large, multi-site behavioral intervention study. In this paper, we summarize 20 specific treatment fidelity strategies used in the SMART trial and how these strategies correspond with NIH BCC recommendations in five specific areas: (1) study design, (2) training providers, (3) delivery of treatment, (4) receipt of treatment, and (5) enactment of treatment skills. Increased use and reporting of treatment fidelity procedures is essential in advancing the reliability and validity of behavioral intervention research. The SMART trial provides a strong model for the application of fidelity strategies to improve scientific findings and addresses the absence of published literature, illustrating the application of BCC recommendations in behavioral intervention studies. Copyright © 2010 John Wiley & Sons, Ltd.

  8. Nuclear Waste Policy Act of 1982; proposed general guidelines for recommendation of sites for nuclear waste repositories

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    In accordance with the requirements of the Nuclear Waste Policy Act of 1982 (Pub. L. 97-425), hereinafter referred to as the Act, the Department of Energy is proposing general guidelines for the recommendation of sites for repositories for disposal of high-level radioactive waste and spent nuclear fuel in geologic formations. These guidelines are based on the criteria that the Department has used in its National Waste Terminal Storage program, the criteria proposed by the Nuclear Regulatory Commission (NRC), and the environmental standards proposed by the Environmental Protection Agency. These guidelines establish the performance requirements for a geologic repository system, specify how the Department will implement its site-selection program, and define the technical qualifications that candidate sites must meet in the various steps of the site-selection process mandated by the Act. After considering comments from the public; consulting with the Council on Environmental Quality, the Administrator of the Environmental Protection Agency, the Director of the Geological Survey, and interested Governors; and obtaining NRC concurrence, the Department will issue these guidelines in final form as a new Part 960 to Title 10 of the Code of Federal Regulations (10 CFR Part 960)

  9. Independent technical evaluation and recommendations for contaminated groundwater at the department of energy office of legacy management Riverton processing site

    Energy Technology Data Exchange (ETDEWEB)

    Looney, Brain B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Denham, Miles E. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Eddy-Dilek, Carol A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2014-04-01

    The U.S. Department of Energy Office of Legacy Management (DOE-LM) manages the legacy contamination at the Riverton, WY, Processing Site – a former uranium milling site that operated from 1958 to 1963. The tailings and associated materials were removed in 1988-1989 and contaminants are currently flushing from the groundwater. DOE-LM commissioned an independent technical team to assess the status of the contaminant flushing, identify any issues or opportunities for DOE-LM, and provide key recommendations. The team applied a range of technical frameworks – spatial, temporal, hydrological and geochemical – in performing the evaluation. In each topic area, an in depth evaluation was performed using DOE-LM site data (e.g., chemical measurements in groundwater, surface water and soil, water levels, and historical records) along with information collected during the December 2013 site visit (e.g., plant type survey, geomorphology, and minerals that were observed, collected and evaluated).

  10. Sediment quality criteria: A review with recommendations for developing criteria for the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Driver, C.J.

    1994-05-01

    Criteria for determining the quality of liver sediment are necessary to ensure that concentrations of contaminants in aquatic systems are within acceptable limits for the protection of aquatic and human life. Such criteria should facilitate decision-making about remediation, handling, and disposal of contaminants. Several approaches to the development of sediment quality criteria (SQC) have been described and include both descriptive and numerical methods. However, no single method measures all impacts at all times to all organisms (U.S. EPA 1992b). The U.S. EPA`s interest is primarily in establishing chemically based, numerical SQC that are applicable nation-wide (Shea 1988). Of the approaches proposed for SQC development, only three are being considered for numerical SQC on a national level. These approaches include an Equilibrium Partitioning Approach, a site-specific method using bioassays (the Apparent Effects Threshold Approach), and an approach similar to EPA`s water quality criteria (Pavlou and Weston 1984). Although national (or even regional) criteria address a number of political, litigative, and engineering needs, some researchers feel that protection of benthic communities require site-specific, biologically based criteria (Baudo et al. 1990). This is particularly true for areas where complex mixtures of contaminants are present in sediments. Other scientifically valid and accepted procedures for freshwater SQC include a background concentration approach, methods using field or spiked bioassays, a screening level concentration approach, the Apparent Effects Threshold Approach, the Sediment Quality Triad, the International Joint Commission Sediment Assessment Strategy, and the National Status and Trends Program Approach. The various sediment assessment approaches are evaluated for application to the Hanford Reach and recommendations for Hanford Site sediment quality criteria are discussed.

  11. Recommended well drilling and testing program

    International Nuclear Information System (INIS)

    Long, J.; Wilson, C.

    1978-07-01

    A well drilling and testing program is recommended by Lawrence Berkeley Laboratory to identify the hydrology of deep basalts in the Pasco Basin. The ultimate objective of this program is to assist in determining the feasibility of locating a nuclear waste repository on the Hanford Reservation. The recommended program has been staged for maximum effectiveness. In the first stage, six wells have been identified for drilling and testing which, when coupled with existing wells, will provide sufficient data for a preliminary overview of basin hydrology and a preliminary determination of the hydrologic suitability of the deep basalt for a repository site. The rate at which the first stage wells are drilled and tested will depend upon the date at which a preliminary determination of site suitability is required. It was assumed that a preliminary determination of suitability would be required in 1980, in which case all six first stage wells would be drilled in FY 1979. If the results of the first stage analysis are favorable for repository siting, tentative repository sites can be identified and a second stage hydrology program can be implemented to provide the necessary details of the flow system. To accomplish this stage, a number of deep wells would be required at locations both inside and outside the basin, with specific sites to be identified as the work progresses to obtain maximum utility of existing data. A program is recommended for testing in each new well and for completion of testing in each existing well. Recommended tests include borehole geophysics, pressure and permeability testing, geochemical sampling, tracer testing, hydrofracturing and borehole fracture logging. The entire data collection program is oriented toward providing the information required to establish and verify an accurate numerical model of the Pasco Basin

  12. Preliminary recommendations on the design of the characterization program for the Hanford Site single-shell tanks: A system analysis

    International Nuclear Information System (INIS)

    Buck, J.W.; Peffers, M.S.; Hwang, S.T.

    1991-11-01

    The work described in this volume was conducted by Pacific Northwest Laboratory to provide preliminary recommendations on data quality objectives (DQOs) to support the Waste Characterization Plan (WCP) and closure decisions for the Hanford Site single-shell tanks (SSTs). The WCP describes the first of a two-phase characterization program that will obtain information to assess and implement disposal options for SSTs. This work was performed for the Westinghouse Hanford Company (WHC), the current operating contractor on the Hanford Site. The preliminary DQOs contained in this volume deal with the analysis of SST wastes in support of the WCP and final closure decisions. These DQOs include information on significant contributors and detection limit goals (DLGs) for SST analytes based on public health risk

  13. Implications of NGA for NEHRP site coefficients

    Science.gov (United States)

    Borcherdt, Roger D.

    2012-01-01

    Three proposals are provided to update tables 11.4-1 and 11.4-2 of Minimum Design Loads for Buildings and Other Structures (7-10), by the American Society of Civil Engineers (2010) (ASCE/SEI 7-10), with site coefficients implied directly by NGA (Next Generation Attenuation) ground motion prediction equations (GMPEs). Proposals include a recommendation to use straight-line interpolation to infer site coefficients at intermediate values of ̅vs (average shear velocity). Site coefficients are recommended to ensure consistency with ASCE/SEI 7-10 MCER (Maximum Considered Earthquake) seismic-design maps and simplified site-specific design spectra procedures requiring site classes with associated tabulated site coefficients and a reference site class with unity site coefficients. Recommended site coefficients are confirmed by independent observations of average site amplification coefficients inferred with respect to an average ground condition consistent with that used for the MCER maps. The NGA coefficients recommended for consideration are implied directly by the NGA GMPEs and do not require introduction of additional models.

  14. The Use of Social Networking Sites (SNSs) in Health Communication Campaigns: Review and Recommendations.

    Science.gov (United States)

    Shi, Jingyuan; Poorisat, Thanomwong; Salmon, Charles T

    2018-01-01

    The past decade has witnessed a rapid increase in the use of Social Networking Sites (SNSs) in health communication campaigns seeking to achieve an ambitious range of health-related impacts. This article provides a review of 40 studies and research protocols, with a focus on two key factors that differentiate SNSs from more traditional health communication approaches of the past. The first is the potential dualism between message sender and receiver, in which receivers become receiver-sources who forward and amplify the content and reach of health messages. The second is the potential dualism between message and message impact, in which the act of forwarding and modifying messages by receiver-sources itself becomes a measure of message impact. Each of these dualisms has implications for the design and evaluation of contemporary health communication campaigns. The review concludes with a series of observations and recommendations for future health communication research.

  15. The New World Health Organization Recommendations on Perioperative Administration of Oxygen to Prevent Surgical Site Infections: A Dangerous Reductionist Approach?

    Science.gov (United States)

    Wenk, Manuel; Van Aken, Hugo; Zarbock, Alexander

    2017-08-01

    In October 2016, the World Health Organization (WHO) published recommendations for preventing surgical site infections (SSIs). Among those measures is a recommendation to administer oxygen at an inspired fraction of 80% intra- and postoperatively for up to 6 hours. SSIs have been identified as a global health problem, and the WHO should be commended for their efforts. However, this recommendation focuses only on the patient's "wound," ignores other organ systems potentially affected by hyperoxia, and may ultimately worsen patient outcomes.The WHO advances a "strong recommendation" for the use of a high inspired oxygen fraction even though the quality of evidence is only moderate. However, achieving this goal by disregarding other potentially lethal complications seems inappropriate, particularly in light of the weak evidence underpinning the use of high fractions of oxygen to prevent SSI. Use of such a strategy thus should be intensely discussed by anesthesiologists and perioperative physicians.Normovolemia, normotension, normoglycemia, normothermia, and normoventilation can clearly be safely applied to most patients in most clinical scenarios. But the liberal application of hyperoxemia intraoperatively and up to 6 hours postoperatively, as suggested by the WHO, is questionable from the viewpoint of anesthesia and perioperative medicine, and its effects will be discussed in this article.

  16. Study on Personalized Recommendation Model of Internet Advertisement

    Science.gov (United States)

    Zhou, Ning; Chen, Yongyue; Zhang, Huiping

    With the rapid development of E-Commerce, the audiences put forward higher requirements on personalized Internet advertisement than before. The main function of Personalized Advertising System is to provide the most suitable advertisements for anonymous users on Web sites. The paper offers a personalized Internet advertisement recommendation model. By mining the audiences' historical and current behavior, and the advertisers' and publisher's web site content, etc, the system can recommend appropriate advertisements to corresponding audiences.

  17. Technical assistance to Ohio closure sites; Recommendations toaddress contaminated soils, concrete, and corrective action managementunit/groundwater contamination at Ashtabula, Ohio

    Energy Technology Data Exchange (ETDEWEB)

    Charoglu, Emily; Eddy-Dilek, Carol; Gombert, Dirk; Hazen, Terry; Johnson, Bob; Looney, Brian; Krstich, Michael A.; Rautman, Chris; Tripp,Julia; Whitmill, Larry

    2002-08-26

    The Ashtabula Environmental Management Project (AEMP) at Department of Energy-Ohio (DOE-OH) requested technical assistance from the EM-50 Lead Lab to aid in defining new cost and time effective approaches in the following problem areas: soils, concrete, and groundwater/Corrective Action Management Unit (CAMU) at RMIES in Ashtabula, Ohio. Attachment 1 provides the site request for assistance. The technical assistance team assembled for this request is provided in Attachment 2. These individuals reviewed key site information prior to convening with DOE and contractor personnel (RMIES and Earthline) for a three-and-a-half-day meeting to better understand baseline technologies, limitations, and site-specific issues. After listening to presentations about the nature and extent of known contamination, the team broke out into several groups to brainstorm ideas and develop viable solutions. This executive summary details unresolved issues requiring management attention as well as recommendations to address soils, concrete, and groundwater/CAMU. It also provides a summary of additional technical assistance that could be provided to the site. More details are presented in the body of this report.

  18. Recommendations for the management of old uranium mining sites in France. From Limousin sites to other sites, from short- to medium- and long-terms. Final report of the pluralist expertise group on Limousin uranium mines (GEP). Synthesis and final report

    International Nuclear Information System (INIS)

    2010-01-01

    The final report of the Pluralistic Experts Group for the Uranium mines of Limousin (GEP) brings together the main conclusions and recommendations arising from three and half years of work having mobilized, at the request and with the financial support of French authorities, more than forty experts from a varying range of disciplines and backgrounds. The mission given to GEP by the Ministers of Ecology, Industry and Health, as well as the President of the Nuclear safety Authority, was ambitious. It was not simply a matter of conducting an exhaustive and vigorous investigation of actual impacts, but also to analyse the present situation from a technical point of view starting with actual cases to clarify the options for management and monitoring, and to make recommendations on their development in order to reduce the current impacts and to foresee those in the long term according to the preparation of a long term plan. This final report attempts to develop a coherent framework of recommendations that are as operationally feasible as possible. Thus, the proposals of the GEP underline the need for an comprehensive approach, on the basis of work on the institutional perspectives, of a programme for improvement of knowledge and including a reinforcement of information and dialogue, to frame and guide the characterization of the risks and impacts, the evolution of the surveillance devices and the consolidation of the existing protection systems. These final proposals take account of a whole range of activities undertaken by Areva NC as well as the relevant local and national government organizations; and which integrate certain recommendations already produced by the GEP within the framework of its three interim reports. The GEP sets out six main areas of improvements, within which the GEP makes 15 major recommendations addressed to the public authorities, the owner and all of the stakeholders concerned. These recommendations, largely detailed in the report, aim to: - 1

  19. Towards Geosocial Recommender Systems

    NARCIS (Netherlands)

    de Graaff, V.; van Keulen, Maurice; de By, R.A.; de By, Rolf A.

    2012-01-01

    The usage of social networks sites (SNSs), such as Facebook, and geosocial networks (GSNs), such as Foursquare, has increased tremendously over the past years. The willingness of users to share their current locations and experiences facilitate the creation of geographical recommender systems based

  20. A trajectory-based recommender system for tourism

    OpenAIRE

    Baraglia, Ranieri; Frattari, Claudio; Muntean, Cristina Ioana; Nardini, Franco Maria; Silvestri, Fabrizio

    2012-01-01

    Recommendation systems provide focused information to users on a set of objects belonging to a specific domain. The proposed recommender system provides personalized suggestions about touristic points of interest. The system generates recommendations, consisting of touristic places, according to the current position of a tourist and previously collected data describing tourist movements in a touristic location/city. The touristic sites correspond to a set of points of interest identified a pr...

  1. Models and methods for building web recommendation systems

    OpenAIRE

    Stekh, Yu.; Artsibasov, V.

    2012-01-01

    Modern Word Wide Web contains a large number of Web sites and pages in each Web site. Web recommendation system (recommendation system for web pages) are typically implemented on web servers and use the data obtained from the collection viewed web templates (implicit data) or user registration data (explicit data). In article considering methods and algorithms of web recommendation system based on the technology of data mining (web mining). Сучасна мережа Інтернет містить велику кількість веб...

  2. The State of the Art Ten Years After a State of the Art

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2014-01-01

    A decade has passed since the first review of research on a ``flagship application" of music information retrieval (MIR): the problem of music genre recognition (MGR). During this time, about 500 works addressing MGR have been published, and at least 10 campaigns have been run to evaluate MGR sys......, the problems of validity in evaluation also affect research in music emotion recognition and autotagging. We conclude by discussing the implications of our work for MGR and MIR in the next ten years....

  3. Network-based recommendation algorithms: A review

    Science.gov (United States)

    Yu, Fei; Zeng, An; Gillard, Sébastien; Medo, Matúš

    2016-06-01

    Recommender systems are a vital tool that helps us to overcome the information overload problem. They are being used by most e-commerce web sites and attract the interest of a broad scientific community. A recommender system uses data on users' past preferences to choose new items that might be appreciated by a given individual user. While many approaches to recommendation exist, the approach based on a network representation of the input data has gained considerable attention in the past. We review here a broad range of network-based recommendation algorithms and for the first time compare their performance on three distinct real datasets. We present recommendation topics that go beyond the mere question of which algorithm to use-such as the possible influence of recommendation on the evolution of systems that use it-and finally discuss open research directions and challenges.

  4. RECOMMENDER SYSTEMS IN E-COMMERCE APPLICATIONS

    Directory of Open Access Journals (Sweden)

    Gyöngyvér KOVÁCS

    2016-12-01

    Full Text Available One of the major problem with online shopping is finingd the right product, because finding the right product presumes that we know its name, but in most cases it is not so. For this reason the users need help in the process of online searching/shopping. Recommender systems have became a popular technique and strategy for helping users to select desirable products or services. In the past few years the recommender systems have changed from novelties used by a few big e-commerce sites, to serious business tools that are re-shaping the world of e-commerce. In this paper, we provide a brief overview of the classification of recommendation systems based on technology used to create recommendations, and inputs they need from the customers. Furthermore we analyze a few algorithms used by recommender systems and we will also present some marketing recommender systems and their comparative analysis.

  5. Effect of magnetic reconnection in stellar plasma

    Science.gov (United States)

    Hammoud, M.; El Eid, M.; Darwish, M.

    2017-06-01

    An important phenomenon in Astrophysics is the process of magnetic reconnection (MGR), which is envisaged to understand the solar flares, coronal mass ejection, interaction of the solar wind with the Earth’s magnetic field (so called geomagnetic storm) and other phenomena. In addition, it plays a role in the formation of stars. MGR involves topological change of a set of magnetic field lines leading to a new equilibrium configuration of lower magnetic energy. The MGR is basically described in the framework of the Maxwell’s equations linked to Navier-Stockes equations. Nevertheless, many details are still not understood. In this paper, we investigate the MGR process in the framework of the Magnetohydrodynamic (MHD) model of a single conducting fluid using a modern powerful computational tool (OpenFOAM). We will show that the MGR process takes place only if resistivity exists. However, despite the high conductivity of the plasma, resistivity becomes effective in a very thin layer generating sharp gradients of the magnetic field, and thus accelerating the reconnection process. The net effect of MGR is that magnetic energy is converted into thermal and kinetic energies leading to heating and acceleration of charged particles. The Sun’s coronal ejection is an example of the MGR process.

  6. A Federated Recommender System for Online Learning Environments

    OpenAIRE

    Zhou, Lei; El Helou, Sandy; Moccozet, Laurent; Opprecht, Laurent; Benkacem, Omar; Salzmann, Christophe; Gillet, Denis

    2012-01-01

    From e-commerce to social networking sites, recommender systems are gaining more and more interest. They provide connections, news, resources, or products of interest. This paper presents a federated recommender system, which exploits data from different online learning platforms and delivers personalized recommendation. The underlying educational objective is to enable academic institutions to provide a Web 2.0 dashboard bringing together open resources from the Cloud and proprietary content...

  7. Personalized recommendation via unbalance full-connectivity inference

    Science.gov (United States)

    Ma, Wenping; Ren, Chen; Wu, Yue; Wang, Shanfeng; Feng, Xiang

    2017-10-01

    Recommender systems play an important role to help us to find useful information. They are widely used by most e-commerce web sites to push the potential items to individual user according to purchase history. Network-based recommendation algorithms are popular and effective in recommendation, which use two types of elements to represent users and items respectively. In this paper, based on consistence-based inference (CBI) algorithm, we propose a novel network-based algorithm, in which users and items are recognized with no difference. The proposed algorithm also uses information diffusion to find the relationship between users and items. Different from traditional network-based recommendation algorithms, information diffusion initializes from users and items, respectively. Experiments show that the proposed algorithm is effective compared with traditional network-based recommendation algorithms.

  8. Recommender system based on scarce information mining.

    Science.gov (United States)

    Lu, Wei; Chung, Fu-Lai; Lai, Kunfeng; Zhang, Liang

    2017-09-01

    Guessing what user may like is now a typical interface for video recommendation. Nowadays, the highly popular user generated content sites provide various sources of information such as tags for recommendation tasks. Motivated by a real world online video recommendation problem, this work targets at the long tail phenomena of user behavior and the sparsity of item features. A personalized compound recommendation framework for online video recommendation called Dirichlet mixture probit model for information scarcity (DPIS) is hence proposed. Assuming that each clicking sample is generated from a representation of user preferences, DPIS models the sample level topic proportions as a multinomial item vector, and utilizes topical clustering on the user part for recommendation through a probit classifier. As demonstrated by the real-world application, the proposed DPIS achieves better performance in accuracy, perplexity as well as diversity in coverage than traditional methods. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. NRC staff site characterization analysis of the Department of Energy's Site Characterization Plan, Yucca Mountain Site, Nevada

    International Nuclear Information System (INIS)

    1989-08-01

    This Site Characterization Analysis (SCA) documents the NRC staff's concerns resulting from its review of the US Department of Energy's (DOE's) Site Characterization Plan (SCP) for the Yucca Mountain site in southern Nevada, which is the candidate site selected for characterization as the nation's first geologic repository for high-level radioactive waste. DOE's SCP explains how DOE plans to obtain the information necessary to determine the suitability of the Yucca Mountain site for a repository. NRC's specific objections related to the SCP, and major comments and recommendations on the various parts of DOE's program, are presented in SCA Section 2, Director's Comments and Recommendations. Section 3 contains summaries of the NRC staff's concerns for each specific program, and Section 4 contains NRC staff point papers which set forth in greater detail particular staff concerns regarding DOE's program. Appendix A presents NRC staff evaluations of those NRC staff Consultation Draft SCP concerns that NRC considers resolved on the basis of the SCP. This SCA fulfills NRC's responsibilities with respect to DOE's SCP as specified by the Nuclear Waste Policy Act (NWPA) and 10 CFR 60.18. 192 refs., 2 tabs

  10. Performance of Pleurotus pulmonarius mushroom grown on maize stalk residues supplemented with various levels of maize flour and wheat bran

    Directory of Open Access Journals (Sweden)

    Senzosenkosi Surprise MKHIZE

    2017-10-01

    Full Text Available Abstract The use of supplemented agricultural waste in mushroom cultivation can be one of the environmentally friendly strategies for poverty alleviation. The study evaluated the performance of Pleurotus pulmonarius mushroom grown on maize stalk supplemented with varying levels of wheat bran (WB and maize flour (MF. A completely random design was used for the experiments. It was observed that Pleurotus pulmonarius was significantly affected by varying levels of supplementation, as 20% WB supplementation encountered higher contamination. The lower supplementation levels gave significantly shorter colonisation period with better mycelial growth rate (MGR. The 2% MF, 2% WB and 4% WB gave significantly higher MGR and faster colonisation. The shortest pinning time (TP was observed at the first flush with the minimum of 2 days. Higher supplementation levels gave maximum yield and biological efficiency (BE. With further increase of supplementation above a 12% WB and 14% MF, the BE and yield declined. Lower supplementation levels resulted in quicker colonisation period and improved growth rate, whereas high supplementation gave better production in terms of yield and BE. Therefore, for the purpose of maximum production, 12% WB and 14% MF may be recommended while for fast production time, 2% MF and 2% WB are recommended.

  11. Savannah River Site (SRS) implementation program plan for DNFSB Recommendation 90-2

    International Nuclear Information System (INIS)

    Talukdar, B.K.; Loceff, F.

    1993-01-01

    The Defense Nuclear Facilities Safety Board (DNFSB) based on its review and evaluation of the content and implementation of standards relating to design, construction, operation, and decommissioning of Defense Nuclear Facilities has made the recommendations (90-2) which when implemented would assure comparable or equivalent levels of safety to the environment, public and workers as required for the commercial nuclear facilities. DOE has accepted the DNFSB 90-2 recommendations and have directed SRS and other M ampersand Os to implement them. This report discusses implementation program which commits to developing Requirement Identification Documents (RID's) for all defense nuclear facilities in the DOE complex

  12. Marketing E-Commerce by Social media using Product Recommendations and user Embedding

    Science.gov (United States)

    Ramalingam, V. V.; Pandian, A.; Masilamani, Kirthiga

    2018-04-01

    MarketingE-CommercebySodal media is the best way to improve marketing and business widely.The major issues faced with E-commerce and Social media interfacing is cold- start cross-site problem. The cold-start problem occurs at a situation when user is not having the history of purchase records.For the user who does not have a history of purchase records, we have introduced a method of finding the users’ interested product without knowing any of the demographic information of the user. The product is recommended on basesof visits i.e., the item which is most likely to be visited by the users occur in the hit list. This product is rated at the top position for the users to purchase. The e-commerce with social media sites uses the strategy of user embedding and product recommendations. The product recommendations are achieved by incorporating LatentDirichlet Allocation(LDA), Re Ranking and Collaborative Filtering algorithms. The proposed framework can enhance the recommendation system by embedding products and users. This shows the potential of solving cold-start cross-site problem across the e-commerce and social media sites and enhances the marketing strategy.

  13. Distance matters. Assessing socioeconomic impacts of the Dukovany nuclear power plant in the Czech Republic: Local perceptions and statistical evidence

    Czech Academy of Sciences Publication Activity Database

    Frantál, Bohumil; Malý, Jiří; Ouředníček, M.; Nemeškal, J.

    2016-01-01

    Roč. 24, č. 1 (2016), s. 2-13 ISSN 1210-8812 R&D Projects: GA MŠk(CZ) EE2.3.20.0025 Institutional support: RVO:68145535 Keywords : nuclear power plant impacts * spatial analysis * risk perceptions Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.149, year: 2016 http://www.degruyter.com/view/j/mgr.2016.24.issue-1/mgr-2016-0001/mgr-2016-0001.xml?format=INT

  14. Preconception care policy, guidelines, recommendations and services across six European countries

    DEFF Research Database (Denmark)

    Shawe, Jill; Delbaere, Ilse; Ekstrand, Maria

    2015-01-01

    : Governmental policy and legislation; Professional bodies and organisations; Healthcare providers; Charitable organisations; Web-based public information and internet sites. Results All countries had preconception recommendations for women with chronic diseases, such as diabetes and epilepsy. Recommendations...

  15. Building Personalized and Non Personalized Recommendation Systems

    OpenAIRE

    SNEHA KHATWANI; DR. M.B. CHANDAK

    2016-01-01

    The contents of e-Commerce such as music, movies, books and electronics goods are necessary for a modern life style. But, it becomes difficult to find content according to users likes and users preference. An approach which produces desirable results to solve such the problem is to develop "Recommender System." The Recommender System of an e-Commerce site selects and suggests the contents to meet user's preference automatically using data sets of previous users stored in database. There ca...

  16. Recommendations for the hydrogeologic review and assessment of sites for nuclear power installations within the framework of the radiation protection licensing procedure

    International Nuclear Information System (INIS)

    Adam, C.; Petschel, M.; Koerner, W.

    1985-01-01

    Article 4 of the Nuclear Facility Licensing Ordinance requires the information to be submitted in support of licensing applications for nuclear power installations to include an expertise on the hydrogeologic characteristics of the site environment with main emphasis on the movement of radionuclides through groundwater in the event of accident conditions, and on measures to protect ground and surface waters. Recommendations are given for the conduct of a hydrogeologic review and assessment process and its timing relative to the individual stages in the licensing procedure. (author)

  17. Development of a Recommender System based on Personal History

    Science.gov (United States)

    Tanaka, Katsuaki; Hori, Koichi; Yamamoto, Masato

    The flood of information on the Internet makes a person who surf it without some strong intention strayed into it. One of the ways to control the balance between a person and the flood is a recommender system by computer, and many web sites use it. These systems work on a web site for the same kind of items. However the field of personal activity is not limited to handle the same kind of thing and a web site, but also offline area in the real world. To handle personal offline activities, LifeLog is proposed as method to record it, but the main purpose of LifeLog is recording a personal history. How to use a history has still been studied stage. The authors have developed a recommender system that captures personal context from history of personal online and offline activities, treats information on web sites as a large set of context, and finds out and extends overlap of them, then recommends information located there. The aim of the system is that a person can enjoy waves of information again. The system worked as a part of My-life Assist Service. It was a service for mobile phones provided by NTT DoCoMo, Inc. as a field experiment from Dec. 2007 to Feb. 2008.

  18. Deep-sea genetic resources: New frontiers for science and stewardship in areas beyond national jurisdiction

    Science.gov (United States)

    Harden-Davies, Harriet

    2017-03-01

    The deep-sea is a large source of marine genetic resources (MGR), which have many potential uses and are a growing area of research. Much of the deep-sea lies in areas beyond national jurisdiction (ABNJ), including 65% of the global ocean. MGR in ABNJ occupy a significant gap in the international legal framework. Access and benefit sharing of MGR is a key issue in the development of a new international legally-binding instrument under the United Nations Convention on the Law of the Sea (UNCLOS) for the conservation and sustainable use of marine biological diversity in ABNJ. This paper examines how this is relevant to deep-sea scientific research and identifies emerging challenges and opportunities. There is no internationally agreed definition of MGR, however, deep-sea genetic resources could incorporate any biological material including genes, proteins and natural products. Deep-sea scientific research is the key actor accessing MGR in ABNJ and sharing benefits such as data, samples and knowledge. UNCLOS provides the international legal framework for marine scientific research, international science cooperation, capacity building and marine technology transfer. Enhanced implementation could support access and benefit sharing of MGR in ABNJ. Deep-sea scientific researchers could play an important role in informing practical new governance solutions for access and benefit sharing of MGR that promote scientific research in ABNJ and support deep-sea stewardship. Advancing knowledge of deep-sea biodiversity in ABNJ, enhancing open-access to data and samples, standardisation and international marine science cooperation are significant potential opportunity areas.

  19. Recommending Peers for Learning: Matching on Dissimilarity in Interpretations to Provoke Breakdown

    Science.gov (United States)

    Rajagopal, Kamakshi; van Bruggen, Jan M.; Sloep, Peter B.

    2017-01-01

    People recommenders are a widespread feature of social networking sites and educational social learning platforms alike. However, when these systems are used to extend learners' Personal Learning Networks, they often fall short of providing recommendations of learning value to their users. This paper proposes a design of a people recommender based…

  20. New Insulin Delivery Recommendations.

    Science.gov (United States)

    Frid, Anders H; Kreugel, Gillian; Grassi, Giorgio; Halimi, Serge; Hicks, Debbie; Hirsch, Laurence J; Smith, Mike J; Wellhoener, Regine; Bode, Bruce W; Hirsch, Irl B; Kalra, Sanjay; Ji, Linong; Strauss, Kenneth W

    2016-09-01

    Many primary care professionals manage injection or infusion therapies in patients with diabetes. Few published guidelines have been available to help such professionals and their patients manage these therapies. Herein, we present new, practical, and comprehensive recommendations for diabetes injections and infusions. These recommendations were informed by a large international survey of current practice and were written and vetted by 183 diabetes experts from 54 countries at the Forum for Injection Technique and Therapy: Expert Recommendations (FITTER) workshop held in Rome, Italy, in 2015. Recommendations are organized around the themes of anatomy, physiology, pathology, psychology, and technology. Key among the recommendations are that the shortest needles (currently the 4-mm pen and 6-mm syringe needles) are safe, effective, and less painful and should be the first-line choice in all patient categories; intramuscular injections should be avoided, especially with long-acting insulins, because severe hypoglycemia may result; lipohypertrophy is a frequent complication of therapy that distorts insulin absorption, and, therefore, injections and infusions should not be given into these lesions and correct site rotation will help prevent them; effective long-term therapy with insulin is critically dependent on addressing psychological hurdles upstream, even before insulin has been started; inappropriate disposal of used sharps poses a risk of infection with blood-borne pathogens; and mitigation is possible with proper training, effective disposal strategies, and the use of safety devices. Adherence to these new recommendations should lead to more effective therapies, improved outcomes, and lower costs for patients with diabetes. Copyright © 2016 Mayo Foundation for Medical Education and Research. Published by Elsevier Inc. All rights reserved.

  1. Areal thermal loading recommendations for nuclear waste repositories in salt

    International Nuclear Information System (INIS)

    Russell, J.E.

    1979-06-01

    This document gives a wider understanding of the history of the recommended thermal loadings in salt for both high-level waste (HLW) from fresh UO 2 -fueled, light-water reactors (LWR) with no recycle and spent unreprocessed fuel (SURF) from LWRs. Aspects of the current recommendations that need further study are identified. Finally, an interim set of design thermal-loading recommendations are given that have a common rationale of satisfying performance limits within our current state of knowledge. These recommendations are made on a generic rather than a site-specific basis. 11 figures, 5 tables

  2. NRC staff site characterization analysis of the Department of Energy`s Site Characterization Plan, Yucca Mountain Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1989-08-01

    This Site Characterization Analysis (SCA) documents the NRC staff`s concerns resulting from its review of the US Department of Energy`s (DOE`s) Site Characterization Plan (SCP) for the Yucca Mountain site in southern Nevada, which is the candidate site selected for characterization as the nation`s first geologic repository for high-level radioactive waste. DOE`s SCP explains how DOE plans to obtain the information necessary to determine the suitability of the Yucca Mountain site for a repository. NRC`s specific objections related to the SCP, and major comments and recommendations on the various parts of DOE`s program, are presented in SCA Section 2, Director`s Comments and Recommendations. Section 3 contains summaries of the NRC staff`s concerns for each specific program, and Section 4 contains NRC staff point papers which set forth in greater detail particular staff concerns regarding DOE`s program. Appendix A presents NRC staff evaluations of those NRC staff Consultation Draft SCP concerns that NRC considers resolved on the basis of the SCP. This SCA fulfills NRC`s responsibilities with respect to DOE`s SCP as specified by the Nuclear Waste Policy Act (NWPA) and 10 CFR 60.18. 192 refs., 2 tabs.

  3. Brownfields Green Avenue Sites: Technical Memorandum - Conceptual Design for Sustainable Redevelopment

    Science.gov (United States)

    This technical memorandum briefly describes the site and proposed conceptual site plan, indicates conceptual design considerations, specifies recommended green and sustainable features, and offers other recommendations

  4. Testing the ecological site group concept

    Science.gov (United States)

    The 2016 “Ecological Sites for Landscape Management” special issue of Rangelands recommended an update to our thinking of Ecological Sites, suggesting that in our desire to make Ecological Sites more quantitative, we abandoned consideration of Ecological Sites’ spatial context. In response, Ecologic...

  5. Report of the Peer Review Panel on the early site suitability evaluation of the Potential Repository Site at Yucca Mountain, Nevada; Yucca Mountain Site Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-01-01

    The US Department of Energy (DOE) Yucca mountain Site Characterization Project Office (YMPO) assigned Science Applications International Corporation (SAIC), the Technical and Management Support Services (T&MSS) contractor to the YmPo, the task of conducting an Early Site Suitability Evaluation (ESSE) of the Yucca mountain site as a potential site for a high-level radioactive waste repository. First, the assignment called for the development of a method to evaluate a single site against the DOE General Guidelines for Recommendation of Sites for Nuclear Waste Repositories, 10 CFR Part 960. Then, using this method, an evaluation team, the ESSE Core Team, of senior YMP scientists, engineers, and technical experts, evaluated new information obtained about the site since publication of the final Environmental Assessment (DOE, 1986) to determine if new suitability/unsuitability findings could be recommended. Finally, the Core Team identified further information and analyses needed to make final determinations for each of the guidelines. As part of the task, an independent peer review of the ESSE report has been conducted. Expertise was solicited that covered the entire spectrum of siting guidelines in 10 CFR Part 960 in order to provide a complete, in-depth critical review of the data evaluated and cited in the ESSE report, the methods used to evaluate the data, and the conclusions and recommendations offered by the report. Fourteen nationally recognized technical experts (Table 2) served on the Peer Review Panel. The comments from the Panel and the responses prepared by the ESSE Core Team, documented on formal Comment Response Forms, constitute the body of this document.

  6. The joint industry development of a recommended practice for the site specific assessment of mobile jackup units

    International Nuclear Information System (INIS)

    Jones, D.E.; Bennett, W.T.; Hoyle, M.J.R.

    1993-01-01

    The mobile self-elevating (drilling) unit, or jack-up, has been central to the exploration and development of offshore oil and gas reserves. In recent years there has been an increased desire to benefit from the potential economics of using these units in longer term production roles either in association with a fixed platform or as a stand-alone facility. However, until recently there had been no concerted effort to develop a consistent and commonly accepted standard for general industry use in site specific assessment of jack-ups. This paper describes the background and work carried out to develop such a standard. The project is nearing completion and has resulted in the publication of a Guideline document. A Recommended Practice and associated Commentary are (at the time of writing) in the final stage of drafting for release to the project sponsors for trial and comment prior to issuing the first Edition early in 1994

  7. Hypocholesterolemic Response to Karaya Saponin and Rhodobacter capsulatus in Broiler Chickens

    OpenAIRE

    Afrose, Sadia; Hossain, Md. Sharoare; Maki, Takaaki; Tsujii, Hirotada

    2010-01-01

    Dietary karaya saponin and Rhodobacter capsulatus (R. capsulatus) are known to have hypocholesterolemic actions, as reported in our previous studies. This study examined possible synergistic hypocholesterolemic effects of karaya saponin and R. capsulatus in broilers. A total of 150 broilers were allocated into 10 treatments: control, saponin 25 mg, saponin 50 mg, saponin 75 mg, saponin 25 mg+R. capsulatus 0.2 g, saponin 25 mg+R. capsulatus 0.4 g, saponin 50 mg+R. capsulatus 0.2 g, saponin 50 ...

  8. SITE GENERATED RADIOLOGICAL WASTE HANDLING SYSTEM DESCRIPTION DOCUMENT

    Energy Technology Data Exchange (ETDEWEB)

    S. C. Khamankar

    2000-06-20

    The Site Generated Radiological Waste Handling System handles radioactive waste products that are generated at the geologic repository operations area. The waste is collected, treated if required, packaged for shipment, and shipped to a disposal site. Waste streams include low-level waste (LLW) in solid and liquid forms, as-well-as mixed waste that contains hazardous and radioactive constituents. Liquid LLW is segregated into two streams, non-recyclable and recyclable. The non-recyclable stream may contain detergents or other non-hazardous cleaning agents and is packaged for shipment. The recyclable stream is treated to recycle a large portion of the water while the remaining concentrated waste is packaged for shipment; this greatly reduces the volume of waste requiring disposal. There will be no liquid LLW discharge. Solid LLW consists of wet solids such as ion exchange resins and filter cartridges, as-well-as dry active waste such as tools, protective clothing, and poly bags. Solids will be sorted, volume reduced, and packaged for shipment. The generation of mixed waste at the Monitored Geologic Repository (MGR) is not planned; however, if it does come into existence, it will be collected and packaged for disposal at its point of occurrence, temporarily staged, then shipped to government-approved off-site facilities for disposal. The Site Generated Radiological Waste Handling System has equipment located in both the Waste Treatment Building (WTB) and in the Waste Handling Building (WHB). All types of liquid and solid LLW are processed in the WTB, while wet solid waste from the Pool Water Treatment and Cooling System is packaged where received in the WHB. There is no installed hardware for mixed waste. The Site Generated Radiological Waste Handling System receives waste from locations where water is used for decontamination functions. In most cases the water is piped back to the WTB for processing. The WTB and WHB provide staging areas for storing and shipping LLW

  9. SITE GENERATED RADIOLOGICAL WASTE HANDLING SYSTEM DESCRIPTION DOCUMENT

    International Nuclear Information System (INIS)

    S. C. Khamankar

    2000-01-01

    The Site Generated Radiological Waste Handling System handles radioactive waste products that are generated at the geologic repository operations area. The waste is collected, treated if required, packaged for shipment, and shipped to a disposal site. Waste streams include low-level waste (LLW) in solid and liquid forms, as-well-as mixed waste that contains hazardous and radioactive constituents. Liquid LLW is segregated into two streams, non-recyclable and recyclable. The non-recyclable stream may contain detergents or other non-hazardous cleaning agents and is packaged for shipment. The recyclable stream is treated to recycle a large portion of the water while the remaining concentrated waste is packaged for shipment; this greatly reduces the volume of waste requiring disposal. There will be no liquid LLW discharge. Solid LLW consists of wet solids such as ion exchange resins and filter cartridges, as-well-as dry active waste such as tools, protective clothing, and poly bags. Solids will be sorted, volume reduced, and packaged for shipment. The generation of mixed waste at the Monitored Geologic Repository (MGR) is not planned; however, if it does come into existence, it will be collected and packaged for disposal at its point of occurrence, temporarily staged, then shipped to government-approved off-site facilities for disposal. The Site Generated Radiological Waste Handling System has equipment located in both the Waste Treatment Building (WTB) and in the Waste Handling Building (WHB). All types of liquid and solid LLW are processed in the WTB, while wet solid waste from the Pool Water Treatment and Cooling System is packaged where received in the WHB. There is no installed hardware for mixed waste. The Site Generated Radiological Waste Handling System receives waste from locations where water is used for decontamination functions. In most cases the water is piped back to the WTB for processing. The WTB and WHB provide staging areas for storing and shipping LLW

  10. Siting of a low-level radioactive waste management facility - environmental assessment experiences of the Canadian siting task force

    International Nuclear Information System (INIS)

    Gorber, D.M.; Story, V.A.

    1995-01-01

    After public opposition to the plans for a low-level radioactive waste facility at one of two candidate areas at Port Hope, Canada the Environmental Assessment process was postponed, and an independent Siting Process Task Force was set-up to assess the most suitable technologies for LLRW disposal, the areas with the best potential in the province to use these technologies, and the most promising approaches to site selection. The Task Force recommended a five-phased siting process known as the 'Co-operative Siting Process', which was based on the voluntary participation of local communities and a collaborative, joint-planning style of decision making. An independent Siting Task Force was to be established to ensure that the principles of the recommended process was upheld. This siting process is still underway, and problems and successes that have been encountered are summarized in this contribution

  11. THE DECISION TO RECOMMEND YUCCA MOUNTAIN AND THE NEXT STEPS TOWARD LICENSED REPOSITORY DEVELOPMENT

    International Nuclear Information System (INIS)

    Barrett, L. H.

    2002-01-01

    After more than 20 years of carefully planned and reviewed scientific field work by the U.S. Department of Energy, the U.S. Geological Survey, and numerous other organizations, Secretary of Energy Abraham concluded in January that the Yucca Mountain site is suitable, within the meaning of the Nuclear Waste Policy Act, for development as a permanent nuclear waste and spent fuel repository. In February, the Secretary recommended to the President that the site be developed for licensed disposal of these wastes, and the President transmitted this recommendation to Congress. This paper summarizes key technical and national interest considerations that provided the basis for the recommendation. It also discusses the program's near-term plans for repository development if Congress designates the site

  12. Volcanic Hazards in Site Evaluation for Nuclear Installations

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-10-15

    This publication provides comprehensive and updated guidance for site evaluation in relation to volcanic hazards. It includes recommendations on assessing the volcanic hazards at a nuclear installation site, in order to identify and characterize, in a comprehensive manner, all potentially hazardous phenomena that may be associated with future volcanic events. It describes how some of these volcanic phenomena may affect the acceptability of the selected site, resulting in exclusion of a site or determining the corresponding design basis parameters for the installation. This Safety Guide is applicable to both existing and new sites, and a graded approach is recommended to cater for all types of nuclear installations. Contents: 1. Introduction; 2. Overview of volcanic hazard assessment; 3. General recommendations; 4. Necessary information and investigations (database); 5. Screening of volcanic hazards; 6. Site specific volcanic hazard assessment; 7. Nuclear installations other than nuclear power plants; 8. Monitoring and preparation for response; 9. Management system for volcanic hazard assessment; Annex I: Volcanic hazard scenarios; Annex II: Worldwide sources of information.

  13. Assessment of candidate sites for disposal of treated effluents at the Hanford Site, Washington

    International Nuclear Information System (INIS)

    Davis, J.D.

    1992-01-01

    A rigidly defined evaluation process was used to recommend a preferred location to dispose of treated effluents from facilities in the 200 Areas of the US Department of Energy's Hanford Site in Washington State. First, siting constraints were defined based on functional design considerations and siting guidelines. Then, criteria for selecting a preferred site from among several candidates were identified and their relative importance defined. Finally, the weighted criteria were applied and a site was selected for detailed characterization by subsurface investigations

  14. Recommendations for communication to enhance informed consent ...

    African Journals Online (AJOL)

    Recommendations for communication to enhance informed consent and enrolment at multilingual research sites. Claire Penn, Melanie Evans. Abstract. Language issues can affect HIV and AIDS research trial enrolment, but little is understood about variables in this process. Some evidence indicates barriers exist even ...

  15. FAVL work group: report and recommendations

    International Nuclear Information System (INIS)

    2011-01-01

    This document reports the works of a work group dedicated to the process of search for storage site for low activity and long life radioactive wastes. The authors recall the history of this process which started in the early 1990's, and resulted in the selection of two sites, in Auxon and in Pars-les-Chavanges, and finally in the withdrawal of both towns. Then, the authors analyse the whole process in terms of intervention or participation of local authorities, of information and participation of waste producers. They also discuss the roles of the ASN, IRSN, DGEC, ANDRA and ANDRA's Coesdic. They make recommendations regarding site selection, agenda, responsibilities, preferential representative at the local level, public information, consultation, and project support

  16. Recommended Determination of Region IV Concerning the Yazoo Backwater Area Pumps Project

    Science.gov (United States)

    This document explains the basis for EPA Region IV’s recommendation to prohibit the specification of certain waters of the United States as a discharge site for dredge site for dredged or fill material.

  17. Recommending peers for learning: Matching on dissimilarity in interpretations to provoke breakdown

    NARCIS (Netherlands)

    Rajagopal, Kamakshi; Van Bruggen, Jan; Sloep, Peter

    2016-01-01

    People recommenders are a widespread feature of social networking sites and educational social learning platforms alike. However, when these systems are used to extend learners’ Personal Learning Networks, they often fall short of providing recommendations of learning value to their users. This

  18. Recommendation 93-5 Implementation Plan

    International Nuclear Information System (INIS)

    1994-01-01

    On July 19, 1993, the Defense Nuclear Facilities Safety Board (DNFSB) provided to the Secretary of Energy its Recommendation 93-5, which commented on the Hanford Tank Waste Characterization effort. Recommendation 93-5 highlighted the need to accelerate the characterization of the Hanford Site tank wastes to expedite the resolution of identified tank safety issues, and to provide timely design data in support of activities addressing the disposal of the tank wastes. The Department of Energy (DOE) and its prime contractor, Westinghouse Hanford Company (WHC), are in full agreement with the content of Recommendation 93-5 and have prepared this Implementation Plan to document those actions that have been or will be taken to meet Recommendation 93-5. The new Characterization Strategy embodied by this Plan acknowledges that waste distribution within a tank is the critical unknown with respect to successfully characterizing the tank for any Tank Waste Remediation Systems (TWRS) programmatic need. The new strategy has been incorporated into the following seven task: (1) strengthen technical management; (2) accelerate safety related characterization; (3) improve the quality and quantity of sampling (4) streamline tank access; (5) improve the quality and quantity of analyses; (6) improve data management; and (7) change control

  19. EnTagRec : an enhanced tag recommendation system for software information sites

    NARCIS (Netherlands)

    Wang, S.; Lo, D.; Vasilescu, B.N.; Serebrenik, A.

    2014-01-01

    Software engineers share experiences with modern technologies by means of software information sites, such as STACK OVERFLOW. These sites allow developers to label posted content, referred to as software objects, with short descriptions, known as tags. However, tags assigned to objects tend to be

  20. Evaluation of breastfeeding Web sites for patient education.

    Science.gov (United States)

    Dornan, Barbara A; Oermann, Marilyn H

    2006-01-01

    To evaluate the quality of Web sites on breastfeeding for patient education. Descriptive study of 30 Web sites on breastfeeding for patient education, evaluated based on the Health Information Technology Institute (HITI) criteria, readability, and eight content criteria from the American Academy of Pediatrics (AAP) policy statement on breastfeeding. The mean Flesch-Kincaid Grade Level for readability of the 30 sites was 9.2. Seven of the sites included all eight of the content criteria from the AAP, and three sites did not include any of the information recommended by the AAP content criteria. Nurses should be able to recommend best patient education materials for their patients. The five best Web sites for breastfeeding education are identified for patient teaching, and the HITI criteria are explained for nurses to learn how to evaluate Web sites for themselves and their patients.

  1. SITE-94. Site specific base data for the performance assessment

    International Nuclear Information System (INIS)

    Geier, J.; Tiren, S.; Dverstorp, B.; Glynn, P.

    1996-06-01

    This report documents the site specific base data that were available, and the utilization of these data within SITE-94. A brief summary is given of SKB's preliminary site investigations for the Aespoe Hard Rock Laboratory (HRL), which were the main source of site-specific data for SITE-94, and an overview is given of the field methods and instrumentation for the preliminary investigations. A compilation is given of comments concerning the availability and quality of the data for Aespoe, and specific recommendations are given for future site investigations. It was found that the HRL pre-investigations produced a large quantity of data which were, for the most part, of sufficient quality to be valuable for a performance assessment. However, some problems were encountered regarding documentation, procedural consistency, positional information, and storage of the data from the measurements. 77 refs, 4 tabs

  2. INDUSTRIAL/MILITARY ACTIVITY-INITIATED ACCIDENT SCREENING ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    D.A. Kalinich

    1999-09-27

    Impacts due to nearby installations and operations were determined in the Preliminary MGDS Hazards Analysis (CRWMS M&O 1996) to be potentially applicable to the proposed repository at Yucca Mountain. This determination was conservatively based on limited knowledge of the potential activities ongoing on or off the Nevada Test Site (NTS). It is intended that the Industrial/Military Activity-Initiated Accident Screening Analysis provided herein will meet the requirements of the ''Standard Review Plan for the Review of Safety Analysis Reports for Nuclear Power Plants'' (NRC 1987) in establishing whether this external event can be screened from further consideration or must be included as a design basis event (DBE) in the development of accident scenarios for the Monitored Geologic Repository (MGR). This analysis only considers issues related to preclosure radiological safety. Issues important to waste isolation as related to impact from nearby installations will be covered in the MGR performance assessment.

  3. Implementation plan for the Defense Nuclear Facilities Safety Board Recommendation 90-7

    International Nuclear Information System (INIS)

    Borsheim, G.L.; Cash, R.J.; Dukelow, G.T.

    1992-12-01

    This document revises the original plan submitted in March 1991 for implementing the recommendations made by the Defense Nuclear Facilities Safety Board in their Recommendation 90-7 to the US Department of Energy. Recommendation 90-7 addresses safety issues of concern for 24 single-shell, high-level radioactive waste tanks containing ferrocyanide compounds at the Hanford Site. The waste in these tanks is a potential safety concern because, under certain conditions involving elevated temperatures and low concentrations of nonparticipating diluents, ferrocyanide compounds in the presence of oxidizing materials can undergo a runaway (propagating) chemical reaction. This document describes those activities underway by the Hanford Site contractor responsible for waste tank safety that address each of the six parts of Defense Nuclear Facilities Safety Board Recommendation 90-7. This document also identifies the progress made on these activities since the beginning of the ferrocyanide safety program in September 1990. Revised schedules for planned activities are also included

  4. Area recommendation report for the crystalline repository project: An evaluation

    International Nuclear Information System (INIS)

    Beck, J.E.; Lowe, H.; Yurkovich, S.P.

    1986-01-01

    An evaluation is given of DOE's recommendation of the Elk River complex in North Carolina for siting the second repository. Twelve recommendations are made including a strong suggestion that the Cherokee Tribe appeal both through political and legal avenues for inclusion as an affected area primarily due to projected impacts upon economy and public health as a consequence of the potential for reduced tourism

  5. Remarks of the SFRP working group about ICRP recommendations

    International Nuclear Information System (INIS)

    Schieber, C.; Cordoliani, Y.S.

    2005-01-01

    Remarks of the SFRP working group about ICRP recommendations. The International Commission on Radiological Protection has proposed last summer on its Web site the draft text of the 2005 ICRP recommendations for consultation. As it was done for the previous drafts, the French Society for Radiation Protection, has sent his comments to the ICRP, through a specific working group. The text sent to the ICRP is presented here to the readers of the SFRP's Journal. (author)

  6. Site Selection for Surplus Plutonium Disposition Facilities at the Savannah River Site

    International Nuclear Information System (INIS)

    Wike, L.D.

    2000-01-01

    A site selection study was conducted to evaluate locations for the proposed Surplus Plutonium Disposition Facilities. Facilities to be located include the Mixed Oxide (MOX) Fuel Fabrication Facility, the Pit Disassembly and Conversion Facility (PDCF), and the Plutonium Immobilization Project (PIP) facility. Objectives of the study include: (1) Confirm that the Department of Energy (DOE) selected locations for the MOX and PDCF were suitable based on selected siting criteria, (2) Recommend a site in the vicinity of F Area that is suitable for the PIP, and (3) Identify alternative suitable sites for one or more of these facilities in the event that further geotechnical characterization or other considerations result in disqualification of a currently proposed site

  7. Parental awareness and use of online physician rating sites.

    Science.gov (United States)

    Hanauer, David A; Zheng, Kai; Singer, Dianne C; Gebremariam, Achamyeleh; Davis, Matthew M

    2014-10-01

    The US public is increasingly using online rating sites to make decisions about a variety of consumer goods and services, including physicians. We sought to understand, within the context of other types of rating sites, parents' awareness, perceptions, and use of physician-rating sites for choosing primary care physicians for their children. This cross-sectional, nationally representative survey of 3563 adults was conducted in September 2012. Participants were asked about rating Web sites in the context of finding a primary care physician for their children and about their previous experiences with such sites. Overall, 2137 (60%) of participants completed the survey. Among these respondents, 1619 were parents who were included in the present analysis. About three-quarters (74%) of parents were aware of physician-rating sites, and about one-quarter (28%) had used them to select a primary care physician for their children. Based on 3 vignettes for which respondents were asked if they would follow a neighbor's recommendation about a primary care physician and using multivariate analyses, respondents exposed to a neighbor's recommendation and positive online physician ratings were significantly more likely to choose the recommended physician (adjusted odds ratio: 3.0 [95% confidence interval: 2.1-4.4]) than respondents exposed to the neighbor's recommendation alone. Conversely, respondents exposed to the neighbor's recommendation and negative online ratings were significantly less likely to choose the neighbor children's physician (adjusted odds ratio: 0.09 [95% confidence interval: 0.03-0.3]). Parents are beginning to use online physician ratings, and these ratings have the potential to influence choices of their children's primary care physician. Copyright © 2014 by the American Academy of Pediatrics.

  8. Site survey for nuclear power plants

    International Nuclear Information System (INIS)

    1984-01-01

    This Safety Guide describes the first stage of the siting process for nuclear power plants - the site survey to select one or more preferred candidate sites. Its purpose is to recommend procedures and provide information for use in implementing a part of the Code of Practice on Safety in Nuclear Power Plant Siting (IAEA Safety Series No.50-C-S). The organization, procedures, methodologies, guidance for documenting the site survey process and examples of detailed procedures on some safety-related site characteristics are given in the Guide

  9. The GTZAN dataset

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    The GTZAN dataset appears in at least 100 published works, and is the most-used public dataset for evaluation in machine listening research for music genre recognition (MGR). Our recent work, however, shows GTZAN has several faults (repetitions, mislabelings, and distortions), which challenge...... of GTZAN, and provide a catalog of its faults. We review how GTZAN has been used in MGR research, and find few indications that its faults have been known and considered. Finally, we rigorously study the effects of its faults on evaluating five different MGR systems. The lesson is not to banish GTZAN...

  10. Nutrient uptake by intact mycorrhizal Pinus sylvestris seedlings: a diagnostic tool to detect copper toxicity.

    Science.gov (United States)

    Van Tichelen, Katia K.; Vanstraelen, Tom; Colpaert, Jan V.

    1999-03-01

    We developed a nondestructive method for detecting early toxic effects of inflethal copper (Cu) concentrations on ectomycorrhizal and non-mycorrhizal (NM) Scots pine (Pinus sylvestris L.) seedlings. The fungal symbionts examined were Paxillus involutus (Fr.) Fr., Suillus luteus (Fr.) S.F. Gray and Thelephora terrestris (Ehrh.) Fr. The accumulation of Cu in needles and fungal development (ergosterol) in roots and infstrate were assessed. Inorganic phosphate (P(i)) and ammonium (NH(4) (+)) uptake capacities were determined in a semi-hydroponic cultivation system on intact P-limited plants that were exposed for 3 weeks to 0.32 (control), 8 or 16 &mgr;moles Cu(2+). Short-term effects of a 1-hour exposure to 32 &mgr;moles Cu(2+) on nutrient uptake rates were also determined. None of the Cu(2+) treatments affected plant growth or root ergosterol concentrations. The active fungal biomass in infstrate invaded by S. luteus was reduced by 50% in the 16 &mgr;M Cu(2+) treatment compared with the control treatment; however, colonization by S. luteus prevented an increased accumulation of Cu in the needles. In contrast, the 16 &mgr;M Cu(2+) treatment caused a 2.2-fold increase in needle Cu concentration in NM plants. Ergosterol concentrations in the infstrate colonized by P. involutus and T. terrestris were not affected by 16 &mgr;molar Cu(2+). Although P. involutus and T. terrestris were less sensitive to Cu(2+) than S. luteus, T. terrestris did not prevent the accumulation of Cu in needles of its host plant in the 16 &mgr;molar Cu(2+) treatment. Mycorrhizal plants consistently had higher P(i) and NH(4) (+) uptake capacities than NM plants. In the control treatment, specific P(i) uptake rates were almost 10, 4 and 3 times higher in plants associated with P. involutus, S. luteus and T. terrestris, respectively, than in NM plants, and specific NH(4) (+) uptake rates were about 2, 2 and 5 times higher, respectively, than those of NM seedlings. Compared with the corresponding

  11. InterTechnology Corporation proposed criteria and recommendations for selection of PON non-residential demonstration sites

    Energy Technology Data Exchange (ETDEWEB)

    None

    1976-12-01

    This report has been prepared with the objective of providing ERDA with recommended procedures for implementing the strategies set forth in the Systems Level Plan which are considered essential to the success of the National Demonstration Program. In order to logically develop these recommendations, this report is divided into three sections: A. Overview of the Demonstration Program to date. B. Essential Overall Program Strategies. C. Candidate Screening and Selection Criteria. (WDM)

  12. Music genre recognition with risk and rejection

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    We explore risk and rejection for music genre recognition (MGR) within the minimum risk framework of Bayesian classification. In this way, we attempt to give an MGR system knowledge that some misclassifications are worse than others, and that deferring classification to an expert may be a better...

  13. Site observational work plan for the UMTRA Project site at Falls City, Texas

    International Nuclear Information System (INIS)

    1995-06-01

    Produced by the US Department of Energy (DOE), this site observational work plan (SOWP) will be used to determine site-specific activities to comply with the US Environmental Protection Agency (EPA) ground water standards at this Uranium Mill Tailings Remedial Action (UMTRA) Project site. The purpose of the SOWP is to recommend a site-specific ground water compliance strategy at the Falls City UMTRA Project site. The Falls City SOWP presents a comprehensive summary of site hydrogeological data, delineates a conceptual model of the aquifer system, and discusses the origins of milling-related ground water contamination. It also defines the magnitude of ground water contamination, potential environmental and health risks associated with ground water contamination and data gaps, and targets a proposed compliance strategy

  14. Mobile-Based Recommendation System in Conferences

    OpenAIRE

    Hernández de la Iglesia, Daniel; Moreno García, María N.; Omatu, Sigeru

    2017-01-01

    Today information is a very important asset for organizations. Obtaining and interpreting information in real time can be a major benefit in decision making. For this reason, we have developed a mobile application that uses WiFi access points to locate users who are attending conferences and exhibits. The application can generate a dataset according to the user’s preferences and on-site location, and provide personalized recommendations accordingly.

  15. Installation restoration program site investigation. Gulfport Field Training Site, Mississippi Air National Guard Gulfport-Biloxi Regional Airport Gulfport, Mississippi. Volume 2. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-12-01

    Site Investigation Report, Volume: 2. A Site Investigation was performed at 3 sites at the Combat Readiness Training Center, Gulfport-Bolixi. The 3 sites investigated are the: Former Fire Training Area (Site 1), the Former JP-4 Bulk Storage Area, Mill Road (Site 2), and the Motor Pool Above-Ground Diesel Fuel Storage Tank Area (Site 3). The findings of this investigation recommended further investigation at the Fire Training Area and the JP-4 Bulk Storage Tank. At Site 3 the levels of contamination did not represent a risk to human health or the environment; therefore, no further action was recommended. Volume two of this report consisted of the following Appendixes: Site Photographs (A), Well Inventory (B), Boring Logs (C), CSL Technical Memorandum (D), Data Review and Validation (E), GPS Memorandum (F), Level C Analytical Data Summary Tables (G), Slug Test (H), Special-Status Species (I), and Representative Species of Less Mobile Fish and Wildlife (J).

  16. SITE-94. Chemical and physical transport parameters for SITE-94

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Karin [Chalmers Univ. of Technology, Goeteborg (Sweden). Technical Environmental Planning

    1996-02-01

    Important parameters are the interactions of radionuclides with solid surfaces, parameters describing the geometrical conditions like porosity, data on water composition (ionic strength, pH, redox conditions, complex formers etc) and data on the solids that may be of importance to the water and radionuclide chemistry. In this report some of these data of relevance for the Aespoe site are discussed. Based on a literature survey, sorption data as well as values for some other parameters have been selected for rock, fracture fillings and bentonite relevant to the chemical conditions in and around a repository at Aespoe. A comparison to data used for earlier, site-specific as well as general, safety assessments of underground repositories has been performed. The data are recommendations for modelling of radionuclide release from a hypothetical high level waste repository at Aespoe. Since the data to a large extent are not based on experimental measurements, more accurate predictions may be expected if more experimental data are available. Before such studies are performed for a specific site, a variational analysis in order to evaluate the importance of the single parameters is recommended. After such a study, the key parameters may be investigated in detail and the modelling can be expected to be more accurate what concerns influence of single parameters. However, the uncertainty in conceptual areas like how to model accurately the long term hydrology of the site etc still remains. 32 refs.

  17. A Survey of Evaluation in Music Genre Recognition

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2012-01-01

    Much work is focused upon music genre recognition (MGR) from audio recordings, symbolic data, and other modalities. While reviews have been written of some of this work before, no survey has been made of the approaches to evaluating approaches to MGR. This paper compiles a bibliography of work...

  18. Procyon LLC: From Music Recommendations to Preference Mapping

    Science.gov (United States)

    Chinn, Susan J.

    2011-01-01

    Procyon LLC had re-launched and renamed their music discovery site, Electra, to Capella, in 2008. Its core strength had originated from Electra's proprietary technology, which used music libraries from real people, its members, to generating "automated word-of-mouth" recommendations, targeted advertising and editorial content. With the re-launch,…

  19. Implications of recent ICRP recommendations for risk assessments for radioactive waste disposal and cleanup

    International Nuclear Information System (INIS)

    Devgun, J.S.

    1992-01-01

    The International Commission on Radiological Protection (ICRP) adopted a new set of recommendations in November 1990 which were issued at ICRP Publication No. 60 in March 1991. These recommendations incorporate new radiobiological information and outline a comprehensive system of radiological protection. This paper evaluates the implications of these new recommendations vis a vis risk assessments for radioactive waste disposal and remediation of radioactively contaminated sites

  20. Collaborative Filtering Recommendation Based on Trust Model with Fused Similar Factor

    Directory of Open Access Journals (Sweden)

    Ye Li

    2017-01-01

    Full Text Available Recommended system is beneficial to e-commerce sites, which provides customers with product information and recommendations; the recommendation system is currently widely used in many fields. In an era of information explosion, the key challenges of the recommender system is to obtain valid information from the tremendous amount of information and produce high quality recommendations. However, when facing the large mount of information, the traditional collaborative filtering algorithm usually obtains a high degree of sparseness, which ultimately lead to low accuracy recommendations. To tackle this issue, we propose a novel algorithm named Collaborative Filtering Recommendation Based on Trust Model with Fused Similar Factor, which is based on the trust model and is combined with the user similarity. The novel algorithm takes into account the degree of interest overlap between the two users and results in a superior performance to the recommendation based on Trust Model in criteria of Precision, Recall, Diversity and Coverage. Additionally, the proposed model can effectively improve the efficiency of collaborative filtering algorithm and achieve high performance.

  1. Report of the Peer Review Panel on the early site suitability evaluation of the Potential Repository Site at Yucca Mountain, Nevada

    International Nuclear Information System (INIS)

    1992-01-01

    The US Department of Energy (DOE) Yucca mountain Site Characterization Project Office (YMPO) assigned Science Applications International Corporation (SAIC), the Technical and Management Support Services (T ampersand MSS) contractor to the YmPo, the task of conducting an Early Site Suitability Evaluation (ESSE) of the Yucca mountain site as a potential site for a high-level radioactive waste repository. First, the assignment called for the development of a method to evaluate a single site against the DOE General Guidelines for Recommendation of Sites for Nuclear Waste Repositories, 10 CFR Part 960. Then, using this method, an evaluation team, the ESSE Core Team, of senior YMP scientists, engineers, and technical experts, evaluated new information obtained about the site since publication of the final Environmental Assessment (DOE, 1986) to determine if new suitability/unsuitability findings could be recommended. Finally, the Core Team identified further information and analyses needed to make final determinations for each of the guidelines. As part of the task, an independent peer review of the ESSE report has been conducted. Expertise was solicited that covered the entire spectrum of siting guidelines in 10 CFR Part 960 in order to provide a complete, in-depth critical review of the data evaluated and cited in the ESSE report, the methods used to evaluate the data, and the conclusions and recommendations offered by the report. Fourteen nationally recognized technical experts (Table 2) served on the Peer Review Panel. The comments from the Panel and the responses prepared by the ESSE Core Team, documented on formal Comment Response Forms, constitute the body of this document

  2. Selectrion procedures for sites of rdatioactive waste disposal. Recommendations of the AkEnd

    International Nuclear Information System (INIS)

    2002-12-01

    The Working Group on Procedures for the Selection of Repository Sites (AkEnd) had been appointed by the German Federal Ministry for the Environment (BMU) to develop procedures and criteria for the search for, and selection of, a repository site for all kinds of radioactive waste in deep geologic formations in Germany. ILK in principle welcomes the attempt on the part of AkEnd to develop a systematic procedure. On the other hand, ILK considers the two constraints imposed by BMU inappropriate: AkEnd was not to take into account the two existing sites of Konrad and Gorleben and, instead, work from a so-called white map of Germany

  3. RECOMMENDED TRITIUM OXIDE DEPOSITION VELOCITY FOR USE IN SAVANNAH RIVER SITE SAFETY ANALYSES

    Energy Technology Data Exchange (ETDEWEB)

    Lee, P.; Murphy, C.; Viner, B.; Hunter, C.; Jannik, T.

    2012-04-03

    The Defense Nuclear Facilities Safety Board (DNFSB) has recently questioned the appropriate value for tritium deposition velocity used in the MELCOR Accident Consequence Code System Ver. 2 (Chanin and Young 1998) code when estimating bounding dose (95th percentile) for safety analysis (DNFSB 2011). The purpose of this paper is to provide appropriate, defensible values of the tritium deposition velocity for use in Savannah River Site (SRS) safety analyses. To accomplish this, consideration must be given to the re-emission of tritium after deposition. Approximately 85% of the surface area of the SRS is forested. The majority of the forests are pine plantations, 68%. The remaining forest area is 6% mixed pine and hardwood and 26% swamp hardwood. Most of the path from potential release points to the site boundary is through forested land. A search of published studies indicate daylight, tritiated water (HTO) vapor deposition velocities in forest vegetation can range from 0.07 to 2.8 cm/s. Analysis of the results of studies done on an SRS pine plantation and climatological data from the SRS meteorological network indicate that the average deposition velocity during daylight periods is around 0.42 cm/s. The minimum deposition velocity was determined to be about 0.1 cm/s, which is the recommended bounding value. Deposition velocity and residence time (half-life) of HTO in vegetation are related by the leaf area and leaf water volume in the forest. For the characteristics of the pine plantation at SRS the residence time corresponding to the average, daylight deposition velocity is 0.4 hours. The residence time corresponding to the night-time deposition velocity of 0.1 cm/s is around 2 hours. A simple dispersion model which accounts for deposition and re-emission of HTO vapor was used to evaluate the impact on exposure to the maximally exposed offsite individual (MOI) at the SRS boundary (Viner 2012). Under conditions that produce the bounding, 95th percentile MOI exposure

  4. Site-Based Management: Teachers' Attitudes and Administrative Style. A Literary Review and Recommendations.

    Science.gov (United States)

    Blanchard, Charles Patrick; Karr-Kidwell, PJ

    Many kinds of educational reform, especially site-based management, have contributed to teacher empowerment. The success of these reforms, however, is contingent upon administrative leadership that is willing to share power. This paper describes the attitudes of teachers toward site-based management (SBM), with a focus on the effects of…

  5. 75 FR 65310 - Environmental Management Site-Specific Advisory Board, Nevada

    Science.gov (United States)

    2010-10-22

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Nevada AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Nevada Test Site. The Federal Advisory... Board is to make recommendations to DOE-EM and site management in the areas of environmental restoration...

  6. A Hybrid Recommender System Based on User-Recommender Interaction

    OpenAIRE

    Zhang, Heng-Ru; Min, Fan; He, Xu; Xu, Yuan-Yuan

    2015-01-01

    Recommender systems are used to make recommendations about products, information, or services for users. Most existing recommender systems implicitly assume one particular type of user behavior. However, they seldom consider user-recommender interactive scenarios in real-world environments. In this paper, we propose a hybrid recommender system based on user-recommender interaction and evaluate its performance with recall and diversity metrics. First, we define the user-recommender interaction...

  7. Site observational work plan for the UMTRA Project site at Riverton, Wyoming

    International Nuclear Information System (INIS)

    1994-09-01

    The site observational work plan (SOWP) for the Riverton, Wyoming, Uranium Mill Tailings Remedial Action (UMTRA) Project Site is the first document for the UMTRA Ground Water Project to address site-specific activities to meet compliance with the U.S. Environmental Protection Agency (EPA) proposed ground water standards (52 FR 36000 (1987)). In support of the activities the regulatory framework and drivers are presented along with a discussion of the relationship of this SOWP to other UMTRA Ground Water Project programmatic documents. A combination of the two compliance strategies that will be recommended for this site are no remediation with the application of alternate concentration levels (ACL) and natural flushing in conjunction with institutional controls. ACLs are to be applied to constituents that occur at concentrations above background levels but which are essential nutrients and occur within nutritional ranges and/or have very low toxicity and high dietary intake rates compared to the levels detected in the ground water. The essential premise of natural flushing is that ground water movement and natural attenuation processes will reduce the detected contamination to background levels within 1 00 years. These two recommended compliance strategies were evaluated by applying Riverton site-specific data to the compliance framework developed in the UMTRA Ground Water programmatic environmental impact statement. There are three aquifers beneath the site: a surficial unconfined aquifer, a middle semiconfined aquifer, and a deeper confined aquifer. The milling-related contamination at the site has affected both the surficial and semiconfined aquifers, although the leaky shale aquifers separating these units limits the downward migration of contamination into the semiconfined aquifer. A shale aquitard separates the semiconfined aquifer from the underlying confined aquifer which has not been contaminated by milling-related constituents

  8. Record of responses to public comments on proposed general guidelines for recommendation of sites for nuclear waste repositories

    International Nuclear Information System (INIS)

    1983-01-01

    The Nuclear Waste Policy Act of 1982 (Public Law 97-425, referred to in this document as the Act) assigned to the US Department of Energy (DOE) the authority for the disposal of high-level radioactive waste and spent nuclear fuel. Among other provisions, the Act specifies a process and schedule for the siting of two geologic repositories for this purpose. The Act requires that the DOE issue general guidelines for the recommendation of sites for repositories. The guidelines are to be developed in consultation with three Federal agencies (the Council on Environmental Quality, the US Environmental Protection Agency, and the US Geological Survey) and with interested Governors and issued with the concurrence of the US Nuclear Regulatory Commission. To meet this directive, the DOE convened a task force of program experts to develop proposed guidelines, issued the proposed guidelines on February 7, 1983, and invited comments from the specified Federal agencies, interested Governors, and the general public. Public hearings on the proposed guidelines were held in March at the following locations: Chicago, New Orleans, Washington, DC, Salt Lake City, and Seattle. After considering the resulting comments and preparing responses to them, the task force prepared a draft of this comment-response document and a set of alternative guidelines; these documents were issued on May 27, 1983. This document summarizes the record of comments that directly led to the alternative guidelines of May 27, 1983. It contains synopses of comments, presents the responses of the task force to the comments, and briefly describes how the proposed guidelines of February 7, 1983, were revised to produce the alternative guidelines of May 27, 1983. 13 references

  9. Crystalline Repository Project: Review and comment of the Leech Lake Reservation Business Committee: Draft area recommendation report

    International Nuclear Information System (INIS)

    1986-09-01

    The Leech Lake Reservation Business Committee (LLRBC) has reviewed five documents related to the US Department of Energy's Crystalline Repository Project (CRP). They are the ''National Survey of Crystalline Rocks,'' ''General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories;' Final Siting Guidelines (10 CFR Part 960),'' ''Regional Characterization Reports for the North Central Region,'' the ''Region to Area Screening Methodology Document'' (SMD) and the ''Draft Area Recommendation Report'' (DARR). The comments and discussions of issues contained in this review will be considered in the preparation of the Final Area Recommendation Report, which will formally identify potentially acceptable sites for a second national repository for the permanent disposal of high level nuclear waste. Following a review of the above referenced documents, the LLRBC has concluded that the identification of potentially acceptable sites in the Draft Area Recommendation Report is based upon inferior and incomplete technical information being applied to a flawed screening process which, among other deficiencies, pays little attention to the importance of hydrological factors in the siting process. Although the DOE prefers that comments from states and tribes be directed at the Draft Area Recommendation Report alone, the Leech Lake Reservation Business Committee is extremely concerned about inadequacies in the ''National Survey of Crystalline Rocks'' (ORCD-1), which serves as the foundation for all siting work done to date. The national survey was conducted utilizing little of the time or staffing required for this important phase of the Crystalline Repository Program. As a result, the national survey is based upon out-of-date scientific literature, exaggerates certain screening variables that favor the selection of regions in the eastern US and arbitrarily eliminated the few western crystalline rock bodies that passed the questionable screening process utilized

  10. Nuclear health and safety. Status of GAO's environmental, safety, and health recommendations to DOE

    International Nuclear Information System (INIS)

    England-Joseph, Judy; Bannerman, Carl J.; Fenzel, William F.; Brack, David L.; Harter, Frederick A.

    1990-04-01

    DOE's operations are carried out at many contractor-operated sites around the country, including major sites within the nuclear weapons complex that are involved in the production of nuclear material for weapons and naval fuel. At these sites DOE contractors routinely use and generate large quantities of a wide range of hazardous and radioactive materials. Because these materials require special handling by workers. Also pursuant to Mar. 15, 1989, request, we provided you a report entitled Nuclear Health and Safety: Need for Improved Responsiveness to Problems at DOE Sites (GAO/RCED-90-101, Mar. 28, 1990). to prevent exposure to themselves or releases into the environment, DOE's weapons complex, considered in its entirety, is among the potentially more dangerous industrial operations in the world. Over the last decade, at the request of the Congress, we have carried out a series of assessments and evaluations of various aspects of the complex. In over 60 reports and testimonies published since 1990, we have called attention to the mounting problems facing DOE's nuclear weapons complex. This body of work includes (1) identifying serious, costly, and widespread environmental, safety, and health problems at DOE facilities, (2) calling for outside independent oversight of DOE's nuclear operations, and (3) making recommendations to DOE to strengthen its oversight, providing more detailed information and plans to the Congress, and improving its management and accounting practices. In total, our reports and testimonies have included 54 recommendations to DOE, in addition to recommendations to the Congress, concerning environmental, safety, and health matters at the complex. We consider 23 of the 54 recommendations to be still open. The open recommendations call for improvements such as tighter program controls and clearer standards and policies related to environmental, safety, and health matters

  11. Critical review of the draft Area Recommendation Report and region-to-area screening methodology for the Crystalline Repository Project

    International Nuclear Information System (INIS)

    1986-01-01

    Two documents related to the Crystalline Repository Project have been reviewed. Comments and concerns related to the review of the ''Region-To-Area Screening Methodology'' and the ''Draft Area Recommendation Report'' are presented. These comments will be considered in preparation of the Final Area Recommendation Report, which will serve to formally identify potentially acceptable sites for a second repository in crystalline rock. Following a detailed review of the aforementioned documents, it is concluded that the identification of proposed potentially acceptable sites in the Draft Area Recommendation Report is based on questionable screening methodology and often incomplete data. As a result, ''favorable characteristics'' that are ascribed to each of the proposed potentially acceptable sites are, in many cases, misleading

  12. Opinion on the radio-ecological monitoring of waters around nuclear installations and on the management of old nuclear waste warehousing sites: 18 recommendations to improve information, transparency and dialogue with involved parties

    International Nuclear Information System (INIS)

    2008-01-01

    After a presentation of the different actors (agencies, institutions, companies) involved in the activities of the various French nuclear installations (base nuclear installations and those concerning the national defence), this report describes the radio-ecological monitoring performed around these nuclear sites: water surveillance on these sites and within their environment, regulatory requirements on effluents and surveillance, information provided by operators and by institutional organisations, assessment of the radio-ecological status of nuclear sites and of potential environmental and health impacts. It describes regulatory obligation in terms of public information, information and communication actions, and gives an assessment of the High committee about public information quality. It discusses ways to improve this quality for a higher transparency, to reinforce the role of local information commissions (CLI), and improve site monitoring. All these aspects are grouped in 18 recommendations

  13. The ICRP 2007 recommendations

    International Nuclear Information System (INIS)

    Streffer, C.

    2007-01-01

    Protection). These documents are: - Committee 1: Low-Dose Extrapolation of Radiation-Related Cancer Risks, ICRP Publication 99(2); - Committee 1: Biological and Epidemiological Information on Health Risks Attributable to Ionising Radiation (FD-C-1); (Annex A) - Committee 2: Quantities used in Radiological Protection (FD-C-2); (Annex B) - Committee 3: Radiological Protection in Medicine; - Committee 4: Optimisation of Radiological Protection; - Committee 4: Assessing Dose to the Representative Person. Drafts have been presented on the web-site of ICRP (www.icrp.org). Many constructive comments have been made which have been evaluated and considered for possible changes. In this publication it is focussed on the chapters with data from physics and biology and only a rough overview of the later parts of the recommendations are given. (author)

  14. The ICRP 2007 recommendations

    Energy Technology Data Exchange (ETDEWEB)

    Streffer, C. [Chairman of ICRP Committee 2, Institute of Science and Ethics, University Duisburg-Essen, 45117 Essen (Germany)

    2007-07-01

    Protection). These documents are: - Committee 1: Low-Dose Extrapolation of Radiation-Related Cancer Risks, ICRP Publication 99(2); - Committee 1: Biological and Epidemiological Information on Health Risks Attributable to Ionising Radiation (FD-C-1); (Annex A) - Committee 2: Quantities used in Radiological Protection (FD-C-2); (Annex B) - Committee 3: Radiological Protection in Medicine; - Committee 4: Optimisation of Radiological Protection; - Committee 4: Assessing Dose to the Representative Person. Drafts have been presented on the web-site of ICRP (www.icrp.org). Many constructive comments have been made which have been evaluated and considered for possible changes. In this publication it is focussed on the chapters with data from physics and biology and only a rough overview of the later parts of the recommendations are given. (author)

  15. Site characterization plan:

    International Nuclear Information System (INIS)

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed

  16. Hanford site implementation plan for buried, transuranic-contaminated waste

    International Nuclear Information System (INIS)

    1987-05-01

    The GAO review of DOE's Defense Waste Management Plan (DWMP) identified deficiencies and provided recommendations. This report responds to the GAO recommendations with regard to the Hanford Site. Since the issuance of the DWMP, an extensive planning base has been developed for all high-level and transuranic waste at the Hanford Site. Thirty-three buried sites have been identified as possibly containing waste that can be classified as transuranic waste. Inventory reports and process flowsheets were used to provide an estimate of the radionuclide and hazardous chemical content of these sites and approximately 370 additional sites that can be classified as low-level waste. A program undertaken to characterize select sites suspected of having TRU waste to refine the inventory estimates. Further development and evaluation are ongoing to determine the appropriate remedial actions, with the objectives of balancing long-term risks with costs and complying with regulations. 18 refs., 7 figs., 6 tabs

  17. Hanford Site emergency response needs, Volumes 1 and 2

    Energy Technology Data Exchange (ETDEWEB)

    Good, D.E.

    1996-04-16

    This report presents the results of a comprehensive third party needs assessment of the Hanford Fire Department (HFD), conducted by Hughes Associates Inc. The assessment was commissioned with the intent of obtaining an unbiased report which could be used as a basis for identifying needed changes/modifications to the fire department and its services. This report serves several functions: (1) it documents current and future site operations and associated hazards and risks identified as a result of document review, site and facility surveys, and interviews with knowledgeable personnel; (2) describes the HFD in terms of organization, existing resources and response capabilities; (3) identifies regulatory and other requirements that are applicable to the HFD and includes a discussion of associated legal liabilities; and (4) provides recommendations based on applicable requirements and existing conditions. Each recommendation is followed by a supporting statement to clarify the intent or justification of the recommendation. This report will be followed by a Master Plan document which will present an implementation method for the recommendations (with associated costs) considered to be essential to maintaining adequate, cost effective emergency services at the Hanford site in the next five to seven years.

  18. Hanford Site emergency response needs, Volumes 1 and 2

    International Nuclear Information System (INIS)

    Good, D.E.

    1996-01-01

    This report presents the results of a comprehensive third party needs assessment of the Hanford Fire Department (HFD), conducted by Hughes Associates Inc. The assessment was commissioned with the intent of obtaining an unbiased report which could be used as a basis for identifying needed changes/modifications to the fire department and its services. This report serves several functions: (1) it documents current and future site operations and associated hazards and risks identified as a result of document review, site and facility surveys, and interviews with knowledgeable personnel; (2) describes the HFD in terms of organization, existing resources and response capabilities; (3) identifies regulatory and other requirements that are applicable to the HFD and includes a discussion of associated legal liabilities; and (4) provides recommendations based on applicable requirements and existing conditions. Each recommendation is followed by a supporting statement to clarify the intent or justification of the recommendation. This report will be followed by a Master Plan document which will present an implementation method for the recommendations (with associated costs) considered to be essential to maintaining adequate, cost effective emergency services at the Hanford site in the next five to seven years

  19. 76 FR 5147 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2011-01-28

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  20. 77 FR 59598 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2012-09-28

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  1. 75 FR 13269 - Environmental Management Site-Specific Advisory Board, Hanford

    Science.gov (United States)

    2010-03-19

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Hanford AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Hanford. The Federal Advisory Committee Act... is to make recommendations to DOE-EM and site management in the areas of environmental restoration...

  2. 75 FR 54600 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2010-09-08

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  3. 75 FR 66074 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2010-10-27

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  4. 75 FR 8050 - Environmental Management Site-Specific Advisory Board, Hanford

    Science.gov (United States)

    2010-02-23

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Hanford AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Hanford. The Federal Advisory Committee Act... is to make recommendations to DOE-EM and site management in the areas of environmental restoration...

  5. 75 FR 24686 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2010-05-05

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  6. 76 FR 80355 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2011-12-23

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... make recommendations to DOE-EM and site management in the areas of environmental restoration, waste...

  7. 75 FR 9404 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2010-03-02

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  8. 75 FR 56526 - Environmental Management Site-Specific Advisory Board, Portsmouth

    Science.gov (United States)

    2010-09-16

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Portsmouth AGENCY... Initiative Workshop of the Environmental Management Site-Specific Advisory Board (EM SSAB), Portsmouth. The... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  9. 77 FR 43583 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2012-07-25

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  10. 75 FR 61711 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2010-10-06

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  11. 75 FR 82002 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2010-12-29

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  12. 76 FR 61350 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2011-10-04

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... make recommendations to DOE-EM and site management in the areas of environmental restoration, waste...

  13. 76 FR 4645 - Environmental Management Site-Specific Advisory Board, Hanford

    Science.gov (United States)

    2011-01-26

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Hanford AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Hanford. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management, and...

  14. 76 FR 48148 - Environmental Management Site-Specific Advisory Board, Paducah

    Science.gov (United States)

    2011-08-08

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Paducah AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Paducah. The Federal Advisory Committee Act... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management and...

  15. Recommending blood glucose monitors, a pharmacy perspective.

    Science.gov (United States)

    Carter, Alan

    2007-03-01

    Selection of what blood glucose monitoring system to utilize has become an issue for physicians, diabetes educators, pharmacists, and patients. The field of competing makes and models of blood glucose monitoring systems has become crowded, with manufacturers touting improvements in accuracy, ease of use/alternate site options, stored results capacity, software evaluation tools, and/or price point. Personal interviews of 12 pharmacists from community and academic practice settings about monitor preference, as well as results from a national survey of pharmacist recommendations, were compared to actual wholesale sales data to estimate the impact of such recommendations on final monitor selection by the patient. Accu-Chek monitors were recommended 34.65% of the time and represented 28.58% of sales, with a success rate of 82.48% of being the monitor selected. OneTouch monitors had 27.72% of recommendations but represented 31.43% of sales, indicating possible patient brand loyalty or formulary preference for that product. FreeStyle(R) monitors came in third for pharmacist recommendations and were selected by the patient 61.68% of the time when recommended. The category of "other monitor" choices was selected 60.89% of the time by patients given those suggestions. Included in the "other monitor" category was the new disposable monitor marketed as the Sidekick. Based on sales data provided, the Sidekick made up 2.87% of "other monitor" category sales, representing 68% of the "other monitor" segment. While patients frequently follow pharmacist monitoring system suggestions, the ultimate deciding factor is most often the final out-of-pocket cost to the patient. As a result, cost of supplies often becomes the most important determining factor in final monitor selection at the patient level. If the patient cannot afford to perform the recommended daily testing intervals, all other determining factors and suggestions become moot.

  16. Monitoring program design recommendations for uranium mining communities

    International Nuclear Information System (INIS)

    1978-10-01

    Environmental radiological monitoring requirements and their rationale have been developed for operating uranium mine/mill sites including the pre-operational phase, and for non-operating tailings areas, in order to assess the radiological impact on the environment and follow long-term trends. These recommendations have been based on a review of regulatory standards, sources and nature of releases from mines, mills and tailings, and environmental pathway analysis. Media and measurements considered in the routine on-going programs include airborne radon, airborne particulates, external radiation, terrestrial biota, surface water, drinking water, ground water, fish and sediment. Program implementation guides are provided. An overview of sampling and field technique and specific recommendations have been made. (auth)

  17. YUCCA MOUNTAIN PROJECT RECOMMENDATION BY THE SECRETARY OF ENERGY REGARDING THE SUITABILITY OF THE YUCCA MOUNTAIN SITE FOR A REPOSITORY UNDER THE NUCLEAR WASTE POLICY ACT OF 1982

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2002-03-26

    For more than half a century, since nuclear science helped us win World War II and ring in the Atomic Age, scientists have known that !he Nation would need a secure, permanent facility in which to dispose of radioactive wastes. Twenty years ago, when Congress adopted the Nuclear Waste Policy Act of 1982 (NWPA or ''the Act''), it recognized the overwhelming consensus in the scientific community that the best option for such a facility would be a deep underground repository. Fifteen years ago, Congress directed the Secretary of Energy to investigate and recommend to the President whether such a repository could be located safely at Yucca Mountain, Nevada. Since then, our country has spent billions of dollars and millions of hours of research endeavoring to answer this question. I have carefully reviewed the product of this study. In my judgment, it constitutes sound science and shows that a safe repository can be sited there. I also believe that compelling national interests counsel in favor of proceeding with this project. Accordingly, consistent with my responsibilities under the NWPA, today I am recommending that Yucca Mountain be developed as the site for an underground repository for spent fuel and other radioactive wastes. The first consideration in my decision was whether the Yucca Mountain site will safeguard the health and safety of the people, in Nevada and across the country, and will be effective in containing at minimum risk the material it is designed to hold. Substantial evidence shows that it will. Yucca Mountain is far and away the most thoroughly researched site of its kind in the world. It is a geologically stable site, in a closed groundwater basin, isolated on thousands of acres of Federal land, and farther from any metropolitan area than the great majority of less secure, temporary nuclear waste storage sites that exist in the country today. This point bears emphasis. We are not confronting a hypothetical problem. We have a

  18. YUCCA MOUNTAIN PROJECT RECOMMENDATION BY THE SECRETARY OF ENERGY REGARDING THE SUITABILITY OF THE YUCCA MOUNTAIN SITE FOR A REPOSITORY UNDER THE NUCLEAR WASTE POLICY ACT OF 1982

    International Nuclear Information System (INIS)

    2002-01-01

    For more than half a century, since nuclear science helped us win World War II and ring in the Atomic Age, scientists have known that the Nation would need a secure, permanent facility in which to dispose of radioactive wastes. Twenty years ago, when Congress adopted the Nuclear Waste Policy Act of 1982 (NWPA or ''the Act''), it recognized the overwhelming consensus in the scientific community that the best option for such a facility would be a deep underground repository. Fifteen years ago, Congress directed the Secretary of Energy to investigate and recommend to the President whether such a repository could be located safely at Yucca Mountain, Nevada. Since then, our country has spent billions of dollars and millions of hours of research endeavoring to answer this question. I have carefully reviewed the product of this study. In my judgment, it constitutes sound science and shows that a safe repository can be sited there. I also believe that compelling national interests counsel in favor of proceeding with this project. Accordingly, consistent with my responsibilities under the NWPA, today I am recommending that Yucca Mountain be developed as the site for an underground repository for spent fuel and other radioactive wastes. The first consideration in my decision was whether the Yucca Mountain site will safeguard the health and safety of the people, in Nevada and across the country, and will be effective in containing at minimum risk the material it is designed to hold. Substantial evidence shows that it will. Yucca Mountain is far and away the most thoroughly researched site of its kind in the world. It is a geologically stable site, in a closed groundwater basin, isolated on thousands of acres of Federal land, and farther from any metropolitan area than the great majority of less secure, temporary nuclear waste storage sites that exist in the country today. This point bears emphasis. We are not confronting a hypothetical problem. We have a staggering amount of

  19. Springs on the Nevada Test Site and their use by wildlife

    International Nuclear Information System (INIS)

    Giles, K.R.

    1976-04-01

    During August 1972, natural springs located on the Nevada Test Site were surveyed to determine the use by wildlife and the effort required for improving flow. Each spring is described and its use by wildlife noted. Methods of improving spring flow are suggested. It is believed that minimal effort at most of the springs would result in a significant improvement of waterflow with resulting benefits to wildlife. The intention of the recommendations in this report is to encourage development of the Nevada Test Site springs and to maintain the wildlife now at the Site. There is no recommendation to bring in or support wildlife outside the Nevada Test Site area

  20. Towards Small-Sized Long Tail Business with the Dual-Directed Recommendation System

    Science.gov (United States)

    Takahashi, Masakazu; Yamada, Takashi; Tsuda, Kazuhiko; Terano, Takao

    This paper describes a novel architecture to promote retail businesses using information recommendation systems. The main features of the architecture are 1) Dual-directed Recommendation system, 2) Portal site for three kinds of users: Producers, Retailers, and Consumers, which are considered to be Prosumers, and 3) Agent-based implementation. We have developed a web-based system DAIKOC (Dynamic Advisor for Information and Knowledge Oriented Communities) with the above architecture. In this paper, we focus on the recommendation functions to extract the items that will achieve the large sales in the future from the ID (IDentification)-POS (Point-Of-Sales) data.

  1. 75 FR 82004 - Environmental Management Site-Specific Advisory Board, Nevada

    Science.gov (United States)

    2010-12-29

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Nevada AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Nevada. The Federal Advisory Committee Act (Pub... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management, and...

  2. 77 FR 4027 - Environmental Management Site-Specific Advisory Board, Nevada

    Science.gov (United States)

    2012-01-26

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Nevada AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Nevada. The Federal Advisory Committee Act (Pub... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management, and...

  3. 76 FR 80354 - Environmental Management Site-Specific Advisory Board, Nevada

    Science.gov (United States)

    2011-12-23

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Nevada AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Nevada. The Federal Advisory Committee Act (Pub... recommendations to DOE-EM and site management in the areas of environmental restoration, waste management, and...

  4. 77 FR 12044 - Environmental Management Site-Specific Advisory Board, Nevada

    Science.gov (United States)

    2012-02-28

    ... DEPARTMENT OF ENERGY Environmental Management Site-Specific Advisory Board, Nevada AGENCY... Environmental Management Site-Specific Advisory Board (EM SSAB), Nevada. The Federal Advisory Committee Act (Pub... Board is to make recommendations to DOE-EM and site management in the areas of environmental restoration...

  5. Nuclear Energy Center study. Phase II. Site suitability analysis. Final report

    International Nuclear Information System (INIS)

    Fellows, W.S.; Sharp, J.M.; Benator, B.I.

    1978-06-01

    A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis

  6. 73. Surgical site infection after CABG: Root cause analysis and quality measures recommendation SSI quality improvement project

    Directory of Open Access Journals (Sweden)

    A. Arifi

    2016-07-01

    Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the

  7. Library Web Sites in Pakistan: An Analysis of Content

    Science.gov (United States)

    Qutab, Saima; Mahmood, Khalid

    2009-01-01

    Purpose: The purpose of this paper is to investigate library web sites in Pakistan, to analyse their content and navigational strengths and weaknesses and to give recommendations for developing better web sites and quality assessment studies. Design/methodology/approach: Survey of web sites of 52 academic, special, public and national libraries in…

  8. WE-G-BRA-05: IROC Houston On-Site Audits and Parameters That Affect Performance

    International Nuclear Information System (INIS)

    Kry, S; Dromgoole, L; Alvarez, P; Lowenstein, J; Molineu, A; Taylor, P; Followill, D

    2015-01-01

    Purpose: To highlight the IROC Houston on-site dosimetry audit program, and to investigate the impact of clinical conditions on the frequency of errors/recommendations noted by IROC Houston. Methods: The results of IROC Houston on-site audits from 2000-present were abstracted and compared to clinical parameters, this included 409 institutions and 1020 linacs. In particular, we investigated the frequency of recommendations versus year, and the impact of repeat visits on the number of recommendations. We also investigated the impact on the number of recommendations of several clinical parameters: the number and age of the linacs, the linac/TPS combination, and the scope of the QA program. Results: The number of recommendations per institution (3.1 average) has shown decline between 2000 and present, although the number of recommendations per machine (0.89) has not changed. Previous IROC Houston site visits did not Result in fewer recommendations on a repeat visit, but IROC Houston tests have changed substantially during the last 15 years as radiotherapy technology has changed. There was no impact on the number of recommendations based on the number of machines at the institution or the age of a given machine. The fewest recommendations were observed for Varian-Eclipse combinations (0.71 recs/machine), while Elekta- Pinnacle combinations yielded the most (1.62 recs/machine). Finally, in the TG-142 era (post-2010), those institutions that had a QA recommendation (n=77) had significantly more other recommendations (1.83 per institution) than those that had no QA rec (n=12, 1.33 per institution). Conclusion: Establishing and maintaining a successful radiotherapy program is challenging and areas of improvement can routinely be identified. Clinical conditions such as linac-TPS combinations and the establishment of a good QA program impact the frequency of errors/deficiencies identified by IROC Houston during their on-site review process

  9. WE-G-BRA-05: IROC Houston On-Site Audits and Parameters That Affect Performance

    Energy Technology Data Exchange (ETDEWEB)

    Kry, S; Dromgoole, L; Alvarez, P; Lowenstein, J; Molineu, A; Taylor, P; Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: To highlight the IROC Houston on-site dosimetry audit program, and to investigate the impact of clinical conditions on the frequency of errors/recommendations noted by IROC Houston. Methods: The results of IROC Houston on-site audits from 2000-present were abstracted and compared to clinical parameters, this included 409 institutions and 1020 linacs. In particular, we investigated the frequency of recommendations versus year, and the impact of repeat visits on the number of recommendations. We also investigated the impact on the number of recommendations of several clinical parameters: the number and age of the linacs, the linac/TPS combination, and the scope of the QA program. Results: The number of recommendations per institution (3.1 average) has shown decline between 2000 and present, although the number of recommendations per machine (0.89) has not changed. Previous IROC Houston site visits did not Result in fewer recommendations on a repeat visit, but IROC Houston tests have changed substantially during the last 15 years as radiotherapy technology has changed. There was no impact on the number of recommendations based on the number of machines at the institution or the age of a given machine. The fewest recommendations were observed for Varian-Eclipse combinations (0.71 recs/machine), while Elekta- Pinnacle combinations yielded the most (1.62 recs/machine). Finally, in the TG-142 era (post-2010), those institutions that had a QA recommendation (n=77) had significantly more other recommendations (1.83 per institution) than those that had no QA rec (n=12, 1.33 per institution). Conclusion: Establishing and maintaining a successful radiotherapy program is challenging and areas of improvement can routinely be identified. Clinical conditions such as linac-TPS combinations and the establishment of a good QA program impact the frequency of errors/deficiencies identified by IROC Houston during their on-site review process.

  10. Site characterization plan:

    International Nuclear Information System (INIS)

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in acordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and eveloping a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing prinicples, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed. 880 refs., 130 figs., 25 tabs

  11. Mass relation for neutrinos

    Science.gov (United States)

    Babu; Barr

    2000-08-07

    A generalization of the well-known Georgi-Jarlskog relation (m(&mgr;)/m(tau)) = 3(m(s)/m(b)) to neutrinos is found in the context of SO(10). This new relation is (m(nu(&mgr;))/m(nu(tau))) = 16(m(c)/m(t)), which is consistent with present data, assuming the Mikheyev-Smirnov-Wolfenstein solution to the solar neutrino problem.

  12. Environmental assessment, Richton Dome site, Mississippi

    International Nuclear Information System (INIS)

    1986-05-01

    The Nuclear Waste Policy Act of 1982 (42 USC Sections 10101-10226) requires the environmental assessment of a potential site to include a statement of the basis for the nomination of a site as suitable for characterization. Volume 2 of this environmental assessment provides a detailed evaluation of the Richton Dome Site and its suitability as the site for a radioactive waste disposal facility under DOE siting guidelines, as well as a comparison of the Richton Dome site with other proposed sites. Evaluation of the Richton Dome site is based on the reference repository design, but the evaluation will not change if based on the Mission Plan repository concept. The comparative evaluation of proposed sites is required under DOE guidelines, but is not intended to directly support the subsequent recommendation of three sites for characterization as candidate sites. 428 refs., 24 figs., 62 tabs

  13. Mining and representing recommendations in actively evolving recommender systems

    DEFF Research Database (Denmark)

    Assent, Ira

    2010-01-01

    Recommender systems provide an automatic means of filtering out interesting items, usually based on past similarity of user ratings. In previous work, we have suggested a model that allows users to actively build a recommender network. Users express trust, obtain transparency, and grow (anonymous......) recommender connections. In this work, we propose mining such active systems to generate easily understandable representations of the recommender network. Users may review these representations to provide active feedback. This approach further enhances the quality of recommendations, especially as topics...... of interest change over time. Most notably, it extends the amount of control users have over the model that the recommender network builds of their interests....

  14. Siting controversial facilities

    International Nuclear Information System (INIS)

    Baird, R.D.; Blacker, P.B.

    1985-01-01

    There is often significant difficulty involved with siting controversial facilities. The social and political problems are frequently far more difficult to resolve than the technical and economic issues. The tendancy for most developing organizations is to address only technical issues in the search for a technically optimal site, to the exclusion of such weighting considerations as the social and political climate associated with potential sites--an approach which often imperils the success of the project. The site selection processes currently suggested is summarized and two contemporary examples of their application are cited. The difference between developers' real objectives and the objectives they have implicitly assumed by adopting the recommended approaches without augmentation are noted. The resulting morass of public opposition is attributed to the failure to consider the needs of individuals and groups who stand to be negatively impacted by the development. A comprehensive implementation strategy which addresses non-technical consideration in parallel with technical ones is presented and evaluated

  15. Solid waste management complex site development plan

    International Nuclear Information System (INIS)

    Greager, T.M.

    1994-01-01

    The main purpose of this Solid Waste Management Complex Site Development Plan is to optimize the location of future solid waste treatment and storage facilities and the infrastructure required to support them. An overall site plan is recommended. Further, a series of layouts are included that depict site conditions as facilities are constructed at the SWMC site. In this respect the report serves not only as the siting basis for future projects, but provides siting guidance for Project W-112, as well. The plan is intended to function as a template for expected growth of the site over the next 30 years so that future facilities and infrastructure will be properly integrated

  16. Solid waste management complex site development plan

    Energy Technology Data Exchange (ETDEWEB)

    Greager, T.M.

    1994-09-30

    The main purpose of this Solid Waste Management Complex Site Development Plan is to optimize the location of future solid waste treatment and storage facilities and the infrastructure required to support them. An overall site plan is recommended. Further, a series of layouts are included that depict site conditions as facilities are constructed at the SWMC site. In this respect the report serves not only as the siting basis for future projects, but provides siting guidance for Project W-112, as well. The plan is intended to function as a template for expected growth of the site over the next 30 years so that future facilities and infrastructure will be properly integrated.

  17. Optometry and ophthalmology: the Internet connection--assessing consumer health web sites.

    Science.gov (United States)

    Soroka, M; Schachne, E; Saludes, I

    2001-11-01

    The Internet is a major conduit of health information. Consumers frequently rely on it without verifying its validity. The purpose of this study was to assess the accuracy and currency of Internet-based information on the roles and practice of optometrists, which has been found to be misleading, inaccurate, and often outdated. Using search engines and ranking directories, 16 popular health Web sites were examined for differentiation between optometry and ophthalmology. Each site's eye care content was reviewed for syndication, definitions, provider directories, linkages to eye organizations, and provider recommendations in treatment of certain conditions. Many Web sites use a syndicated source for their health content and several use Merriam-Webster as their primary dictionary. A majority of sites provided poor definitions for optometry. Most Web sites were biased in recommending ophthalmologists and do not include optometrists as licensed providers in treatment of certain eye diseases. For example, Intelihealth, Aetnaushc, and Noah-Health recommend only ophthalmologists for the treatment of conjunctivitis. Inaccuracies and misleading information about optometry do exist and undermine the role of optometrists in delivery of eye care. When alerted, several Web sites were receptive to proposed changes. While some efforts have been undertaken to monitor Web sites, the profession must develop a concrete effort to ensure that it is correctly represented on the Internet.

  18. Wire-type MnO2/Multilayer graphene/Ni electrode for high-performance supercapacitors

    Science.gov (United States)

    Hu, Minglei; Liu, Yuhao; Zhang, Min; Wei, Helin; Gao, Yihua

    2016-12-01

    Commercially available wearable energy storage devices need a wire-type electrode with high strength, conductivity and electrochemical performance, as well as stable structure under deformation. Herein, we report a novel wire-type electrode of hierarchically structure MnO2 on Ni wire with multilayer graphene (MGr) as a buffer layer to enhance the electrical conductivity of the MnO2 and interface contact between the MnO2 and Ni wire. Thus, the wire-type MnO2/MGr/Ni electrode has a stable and high quality interface. The wire-type supercapacitor (WSC) based on wire-type MnO2/MGr/Ni electrode exhibits good electrochemical performance, high rate capability, extraordinary flexibility, and superior cycle lifetime. Length (area, volumetric) specific capacitance of the WSC reaches 6.9 mF cm-1 (73.2 mF cm-2, 9.8 F cm-3). Maximum length (volumetric) energy density of the WSC based on MnO2/MGr/Ni reaches 0.62 μWh cm-1 (0.88 mWh cm-3). Furthermore, the WSC has a short time constant (0.5-400 ms) and exhibits minimal change in capacitance under different bending shapes.

  19. Nuclear Energy Center study. Phase II. Site suitability analysis. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Fellows, W.S.; Sharp, J.M.; Benator, B.I.

    1978-06-01

    A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis.

  20. The Nirex Sellafield site investigation: the role of geophysical interpretation

    International Nuclear Information System (INIS)

    Muir Wood, R.; Woo, G.; MacMillan, G.

    1992-01-01

    This report reviews the methods by which geophysical data are interpreted, and used to characterize the 3-D geology of a site for potential storage of radioactive waste. The report focuses on the NIREX site investigation at Sellafield, for which geophysical observations provide a significant component of the structural geological understanding. In outlining the basic technical principles of seismic data processing and interpretation, and borehole logging, an attempt has been made to identify errors, uncertainties, and the implicit use of expert judgement. To enhance the reliability of a radiological probabilistic risk assessment, recommendations are proposed for independent use of the primary NIREX geophysical site investigation data in characterizing the site geology. These recommendations include quantitative procedures for undertaking an uncertainty audit using a combination of statistical analysis and expert judgement. (author)

  1. Geological discrete fracture network model for the Laxemar site. Site Descriptive Modelling. SDM-Site Laxemar

    Energy Technology Data Exchange (ETDEWEB)

    La Pointe, Paul; Fox, Aaron (Golder Associates Inc (United States)); Hermanson, Jan; Oehman, Johan (Golder Associates AB, Stockholm (Sweden))

    2008-12-15

    The Swedish Nuclear Fuel and Waste Management Company (SKB) is performing site characterization at two different locations, Forsmark and Laxemar, in order to locate a site for a final geologic repository for spent nuclear fuel. The program is built upon the development of Site Descriptive Models (SDMs) at specific timed data freezes. Each SDM is formed from discipline-specific reports from across the scientific spectrum. This report describes the methods, analyses, and conclusions of the modelling team in the production of the SDM-Site Laxemar geological discrete-fracture network (DFN) model. The DFN builds upon the work of other geological models, including the deformation zone and rock domain models. The geological DFN is a statistical model for stochastically simulating rock fractures and minor deformation zones at a scale of less than 1,000 m (the lower cut-off of the DZ models). The geological DFN is valid within six distinct fracture domains inside the Laxemar local model subarea: FSM{sub C}, FSM{sub E}W007, FSM{sub N}, FSM{sub N}E005, FSM{sub S}, and FSM{sub W}. The models are built using data from detailed surface outcrop maps, geophysical lineament maps, and the cored borehole record at Laxemar. The conceptual model for the SDM-Site Laxemar geological DFN model revolves around the identification of fracture domains based on relative fracture set intensities, orientation clustering, and the regional tectonic framework (including deformation zones). A single coupled fracture size/fracture intensity concept (the Base Model) based on a Pareto (power-law) distribution for fracture sizes was chosen as the recommended parameterisation. A slew of alternative size-intensity models were also carried through the fracture analyses and into the uncertainty and model verification analyses. Uncertainty is modelled by analysing the effects on fracture intensity (P32) that alternative model cases can have. Uncertainty is parameterised as a ratio between the P32 of the

  2. Geological discrete fracture network model for the Laxemar site. Site Descriptive Modelling. SDM-Site Laxemar

    International Nuclear Information System (INIS)

    La Pointe, Paul; Fox, Aaron; Hermanson, Jan; Oehman, Johan

    2008-10-01

    The Swedish Nuclear Fuel and Waste Management Company (SKB) is performing site characterization at two different locations, Forsmark and Laxemar, in order to locate a site for a final geologic repository for spent nuclear fuel. The program is built upon the development of Site Descriptive Models (SDMs) at specific timed data freezes. Each SDM is formed from discipline-specific reports from across the scientific spectrum. This report describes the methods, analyses, and conclusions of the modelling team in the production of the SDM-Site Laxemar geological discrete-fracture network (DFN) model. The DFN builds upon the work of other geological models, including the deformation zone and rock domain models. The geological DFN is a statistical model for stochastically simulating rock fractures and minor deformation zones at a scale of less than 1,000 m (the lower cut-off of the DZ models). The geological DFN is valid within six distinct fracture domains inside the Laxemar local model subarea: FSM C , FSM E W007, FSM N , FSM N E005, FSM S , and FSM W . The models are built using data from detailed surface outcrop maps, geophysical lineament maps, and the cored borehole record at Laxemar. The conceptual model for the SDM-Site Laxemar geological DFN model revolves around the identification of fracture domains based on relative fracture set intensities, orientation clustering, and the regional tectonic framework (including deformation zones). A single coupled fracture size/fracture intensity concept (the Base Model) based on a Pareto (power-law) distribution for fracture sizes was chosen as the recommended parameterisation. A slew of alternative size-intensity models were also carried through the fracture analyses and into the uncertainty and model verification analyses. Uncertainty is modelled by analysing the effects on fracture intensity (P32) that alternative model cases can have. Uncertainty is parameterised as a ratio between the P32 of the alternative model and the P

  3. Wildlife resource utilisation at Moremi Game Reserve and Khwai community area in the Okavango Delta, Botswana.

    Science.gov (United States)

    Mbaiwa, Joseph E

    2005-10-01

    This paper uses the concept of sustainable development to examine the utilisation of wildlife resources at Moremi Game Reserve (MGR) and Khwai community area (NG 18/19) in the Okavango Delta, Botswana. Using both secondary and primary data sources, results show that the establishment of MGR in 1963 led to the displacement of Khwai residents from their land; affected Basarwa's hunting and gathering economy; marked the beginning of resource conflicts between Khwai residents and wildlife managers; and, led to the development of negative attitudes of Khwai residents towards wildlife conservation. Since the late 1980s, a predominantly foreign owned tourism industry developed in and around MGR, however, Khwai residents derive insignificant benefits from it and hence resource conflicts increased. In an attempt to address problems of resource conflicts and promote sustainable wildlife utilisation, the Botswana Government adopted the Community-Based Natural Resource Management (CBNRM) programme, which started operating at Khwai village in 2000. The CBNRM programme promotes local participation in natural resource management and rural development through tourism. It is beginning to have benefits to Khwai residents such as income generation, employment opportunities and local participation in wildlife management. These benefits from CBNRM are thus having an impact in the development of positive attitudes of Khwai residents towards wildlife conservation and tourism development. This paper argues that if extended to MGR, CBNRM has the potential of minimising wildlife conflicts between Khwai residents and the wildlife-tourism sectors. This approach may in the process promote the sustainable wildlife use in and around MGR.

  4. Recommendation on changing interfaces of W-058 and W-236A

    International Nuclear Information System (INIS)

    Light, J.M.

    1994-01-01

    This position paper recommends changes to improve the interface between the Cross-Site Transfer System (Project W-058) and the Multi-Function Waste Tank Facility (Project W-236A) to handle planned waste retrieval and storage operations. Appendix A includes cost estimates and schedule impacts for each project. The cost estimates, schedule impacts, and this position paper will be the basis for writing a change request to formally implement these changes on Project W-236A and Project W-058/W-028. Recommendations are made on pipeline rerouting, pump and configuration, and flushing configuration

  5. Fires involving radioactive materials : transference model; operative recommendations

    International Nuclear Information System (INIS)

    Rodriguez, C.E.; Puntarulo, L.J.; Canibano, J.A.

    1988-01-01

    In all aspects related to the nuclear activity, the occurrence of an explosion, fire or burst type accident, with or without victims, is directly related to the characteristics of the site. The present work analyses the different parameters involved, describing a transference model and recommendations for evaluation and control of the radiological risk for firemen. Special emphasis is placed on the measurement of the variables existing in this kind of operations

  6. Recommended Tritium Oxide Deposition Velocity For Use In Savannah River Site Safety Analyses

    Energy Technology Data Exchange (ETDEWEB)

    Lee, P. L.; Murphy, C. E.; Viner, B. J.; Hunter, C. H.

    2012-07-31

    This report documents the results of examining the deposition velocity of water to forests, the residence time of HTO in forests, and the relation between deposition velocity and residence time with specific consideration given to the topography and experimental work performed at SRS. A simple mechanistic model is used to obtain plausible deposition velocity and residence time values where experimental data are not available and recommendations are made for practical application in a safety analysis model.

  7. Crystal Structure and Magnetic Behavior of Two New Dinuclear Carbonato-Bridged Copper(II) Compounds. Superexchange Pathway for the Different Coordination Modes of the Carbonato Bridge in Polynuclear Copper(II) Compounds.

    Science.gov (United States)

    Escuer, Albert; Mautner, Franz A.; Peñalba, Evaristo; Vicente, Ramon

    1998-08-24

    Four new &mgr;-CO(3)(2-) copper(II) complexes with different coordination modes for the carbonato bridge have been obtained by fixation of atmospheric CO(2): {(&mgr;(3)-CO(3))[Cu(3)(ClO(4))(3)(Et(3)dien)(3)]}(ClO(4)) (1), Et(3)dien = N,N',N"-triethylbis(2-aminoethane)amine; {(&mgr;-CO(3))[Cu(2)(H(2)O)(Et(4)dien)(2)]}(ClO(4))(2).H(2)O (2), Et(4)dien = N,N,N",N"-tetraethyl-bis(2-aminoethane)amine; {(&mgr;-CO(3))[Cu(2)(H(2)O)(2)(EtMe(4)dien)(2)]} (ClO(4))(2).2H(2)O (3), EtMe(4)dien = N'-ethyl-N,N,N",N"-tetramethylbis(2-aminoethane)amine; and {(&mgr;-CO(3))[Cu(2)(H(2)O)(Me(5)dien)(2)]}(ClO(4))(2).H(2)O (4), Me(5)dien = N,N,N',N",N"-pentamethylbis(2-aminoethane)amine. The crystal structures have been solved for 2, monoclinic system, space group P2(1)/n, formula [C(25)H(62)Cl(2)Cu(2)N(6)O(13)] with a = 12.763(6) Å, b = 25.125(8) Å, c = 13.261(4) Å, beta = 111.85(3) degrees, Z = 4, and for 3, triclinic system, space group P&onemacr;, formula [C(21)H(58)Cl(2)Cu(2)N(6)O(15)] with a = 8.412(3) Å, b = 14.667(4) Å, c = 16.555(5) Å, alpha = 99.66(2) degrees, beta = 102.14(2) degrees, gamma = 104.72(2) degrees, Z = 2. Susceptibility measurements show ferromagnetic behavior (J = +6.7(6) cm(-)(1)) for the trinuclear compound 1 whereas 2-4 are antiferromagnetically coupled with J = -17.8(8), -125.5(9), and -21.2(3) cm(-)(1) respectively. Certain synthetic aspects that may be related to the nuclearity of the copper(II) &mgr;-CO(3)(2-) compounds and the superexchange pathway for the different coordination modes of the carbonato bridge are discussed.

  8. Report of the Siting Policy Task Force

    International Nuclear Information System (INIS)

    1979-08-01

    In August 1978, the Nuclear Regulatory Commission directed the staff to develop a general policy statement on nuclear power reactor siting. A Task Force was formed for that purpose and has prepared a statement of current NRC policy and practice and has recommended a number of changes to current policy. Recommendations were made to accomplish the following goals: (1) To strengthen siting as a factor in defense in depth by establishing requirements for site approval that are independent of plant design consideration. The present policy of permitting plant design features to compensate for unfavorable site characteristics has resulted in improved designs but has tended to deemphasize site isolation. (2) To take into consideration in siting the risk associated with accidents beyond the design basis (Class 9) by establishing population density and distribution criteria. Plant design improvements have reduced the probability and consequences of design basis accidents, but there remains the residual risk from accidents not considered in the design basis. Although this risk cannot be completely reduced to zero, it can be significantly reduced by selective siting. (3) To require that sites selected will minimize the risk from energy generation. The selected sites should be among the best available in the region where new generating capacity is needed. Siting requirements should be stringent enough to limit the residual risk of reactor operation but not so stringent as to eliminate the nuclear option from large regions of the country. This is because energy generation from any source has its associated risk, with risks from some energy sources being greater than that of the nuclear option

  9. User Adoption Tendency Modeling for Social Contextual Recommendation

    Directory of Open Access Journals (Sweden)

    Wang Zhisheng

    2015-01-01

    Full Text Available Most of studies on the existing recommender system for Netflix-style sites (scenarios with explicit user feedback focus on rating prediction, but few have systematically analyzed users’ motivations to make decisions on which items to rate. In this paper, the authors study the difficult and challenging task Item Adoption Prediction (IAP for predicting the items users will rate or interact with. It is not only an important supplement to previous works, but also a more realistic requirement of recommendation in this scenario. To recommend the items with high Adoption Tendency, the authors develop a unified model UATM based on the findings of Marketing and Consumer Behavior. The novelty of the model in this paper includes: First, the authors propose a more creative and effective optimization method to tackle One-Class Problem where only the positive feedback is available; second, the authors systematically and conveniently integrate the user adoption information (both explicit and implicit feedbacks included and the social contextual information with quantitatively characterizing different users’ personal sensitivity to various social contextual influences.

  10. Site acceptability and power availability: needed institutional changes

    International Nuclear Information System (INIS)

    Haggard, J.E.

    1975-01-01

    Timely assurance of power plant site availability is threatened by institutional inabilities to resolve often competing environmental/energy requirements. Institutional changes are needed. The issue of site approval should be separated from that of plant approval. A ''one-stop'' forum for site approval, modeled after Washington State's Thermal Power Plant Siting Act, is needed. The one-stop process utilizes one forum composed of officials drawn from all agencies involved in site related issues. A joint Federal/State Siting Council, with sole jurisdiction over site approval, is recommended. The State Council would have a determinative vote on all issues not otherwise preempted by federal legislation. 21 references. (U.S.)

  11. Quarterly report on Defense Nuclear Facilities Safety Board Recommendation 90-7 for the period ending December 31, 1992

    International Nuclear Information System (INIS)

    Cash, R.J.; Dukelow, G.T.; Forbes, C.J.

    1993-03-01

    This is the seventh quarterly report on the progress of activities addressing safety issues associated with Hanford Site high-level radioactive waste tanks that contain ferrocyanide compounds. In the presence of oxidizing materials, such as nitrates or nitrites, ferrocyanide can be made to explode in the laboratory by heating it to high temperatures [above 285 degrees C (545 degrees F)]. In the mid 1950s approximately 140 metric tons of ferrocyanide were added to 24 underground high-level radioactive waste tanks. An implementation plan (Cash 1991) responding to the Defense Nuclear Facilities Safety Board Recommendation 90-7 (FR 1990) was issued in March 1991 describing the activities that were planned and underway to address each of the six parts of Recommendation 90-7. A revision to the original plan was transmitted to US Department of Energy by Westinghouse Hanford Company in December 1992. Milestones completed this quarter are described in this report. Contents of this report include: Introduction; Defense Nuclear Facilities Safety Board Implementation Plan Task Activities (Defense Nuclear Facilities Safety Board Recommendation for enhanced temperature measurement, Recommendation for continuous temperature monitoring, Recommendation for cover gas monitoring, Recommendation for ferrocyanide waste characterization, Recommendation for chemical reaction studies, and Recommendation for emergency response planning); Schedules; and References. All actions recommended by the Defense Nuclear Facilities Safety Board for emergency planning by Hanford Site emergency preparedness organizations have been completed

  12. Corrective Action Investigation Plan for Corrective Action Unit 573: Alpha Contaminated Sites, Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick

    2014-05-01

    Corrective Action Unit (CAU) 573 is located in Area 5 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 573 is a grouping of sites where there has been a suspected release of contamination associated with non-nuclear experiments and nuclear testing. This document describes the planned investigation of CAU 573, which comprises the following corrective action sites (CASs): • 05-23-02, GMX Alpha Contaminated Area • 05-45-01, Atmospheric Test Site - Hamilton These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives.

  13. Siting guidelines and their role in repository site selection

    International Nuclear Information System (INIS)

    Hanlon, C.L.

    1985-01-01

    The first requirement of the Nuclear Waste Policy Act was for the Secretary of Energy to issue general guidelines for siting repositories. The guidelines were to specify detailed geologic considerations that would be the primary criteria for the selection of sites in various host rocks, as well as factors that would qualify or disqualify any site from development as a repository. These guidelines were clearly intended to provide not only the framework for the siting program but also the stimulus for establishing effective communication and consultation among the parties involved in the program. The Act further required that the guidelines be a factor in the development of all future decision documents of the Office of Civilian Radioactive Waste Management, including the environmental assessments that would accompany the nomination of sites for characterization, the site-characterization plans that are to be prepared before the sinking of exploratory shafts at any candidate site, and the environmental impact statement that is to support the recommendation of a site for development as a repository. More than two years after its passage, the intention of the Act for the guidelines has been realized. Concurred in by the Nuclear Regulatory Commission on June 22, 1984, and issued by the Department in November 1984, the guidelines include postclosure technical guidelines that apply to conditions governing the long-term performance of the repository system; preclosure technical guidelines that apply to conditions governing the siting, construction, operation, and closure of the repository; and system guidelines whose objective is to ensure that the regulatory requirements of the Environmental Protection Agency and the Nuclear Regulatory Commission are met

  14. Expert Panel Recommendations for Hanford Double-Shell Tank Life Extension

    Energy Technology Data Exchange (ETDEWEB)

    Stewart, Charles W; Bush, Spencer H; Berman, Herbert Stanton; Czajkowski, Carl J; Divine, James R; Posakony, Gerald J; Johnson, A B; Elmore, Monte R; Reynolds, D A; Anantatmula, Ramamohan P; Sindelar, Robert L; Zapp, Philip E

    2001-06-29

    Expert workshops were held in Richland in May 2001 to review the Hanford Double-Shell Tank Integrity Project and make recommendations to extend the life of Hanford's double-shell waste tanks. The workshop scope was limited to corrosion of the primary tank liner, and the main areas for review were waste chemistry control, tank inspection, and corrosion monitoring. Participants were corrosion experts from Hanford, Savannah River Site, Brookhaven National Lab., Pacific Northwest National Lab., and several consultants. This report describes the current state of the three areas of the program, the final recommendations of the workshop, and the rationale for their selection.

  15. Environmental assessment, Richton Dome site, Mississippi (US)

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    The Nuclear Waste Policy Act of 1982 (42 USC Sections 10101-10226) requires the environmental assessment of a potential site to include a statement of the basis for the nomination of a site as suitable for characterization. Volume 2 of this environmental assessment provides a detailed evaluation of the Richton Dome Site and its suitability as the site for a radioactive waste disposal facility under DOE siting guidelines, as well as a comparison of the Richton Dome site with other proposed sites. Evaluation of the Richton Dome site is based on the reference repository design, but the evaluation will not change if based on the Mission Plan repository concept. The comparative evaluation of proposed sites is required under DOE guidelines, but is not intended to directly support the subsequent recommendation of three sites for characterization as candidate sites. 428 refs., 24 figs., 62 tabs. (MHB)

  16. Environmental assessment overview: Richton Dome site, Mississippi

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Richton Dome site in Mississippi as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Richton Dome site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. The site is in the Gulf interior region, which is one of five distinct geohydrologic settings considered for the first repository. On the basis of the evaluations reported in this EA, the DOE has found that the Richton Dome site is not disqualified under the guidelines. On the basis of these findings, the DOE is nominating the Richton Dome site as one of five sites suitable for characterization. 3 figs

  17. General guidelines for recommendation of sites for nuclear waste repositories

    International Nuclear Information System (INIS)

    1983-01-01

    These guidelines were developed in accordance with the requirements of Section 112(a) of the Nuclear Waste Policy Act of 1982 for use by the Secretary of Energy in evaluating the suitability of sites for the development of repositories. The guidelines will be used for suitability evaluations and determinations made pursuant to Section 112(b) and any preliminary suitability determinations required by Section 114(f). The guidelines set forth in this Part are intended to complement the requirements set forth in the Act, 10 CFR Part 60, and 40 CFR Part 191. In applying these guidelines, the DOE will resolve any inconsistencies between these guidelines and the above documents in a manner determined by the DOE to most closely agree with the intent of the Act

  18. Bald eagle site management plan for the Hanford Site, south-central Washington

    International Nuclear Information System (INIS)

    Fitzner, R.F.; Weiss, S.G.

    1994-12-01

    The CERCLA remedial investigations of waste sites on the Hanford Site will involve lands containing or adjacent to a bald eagle nest, winter concentration areas, or communal night roost. Because these CERCLA investigations may affect bald eagles, the DOE has prepared this Bald Eagle Site Management Plan (BESMP). However, it is intended that this BESMP be used or updated so as to be also applicable to future activities that affect bald eagles on the Hanford Site. Bald eagles regularly use the US Department of Energy's (DOE) Hanford Site in south-central Washington State during winter months for roosting, perching, and foraging. Each of these activities requires buffer zones to protect eagles from human disturbances. Buffer zones developed in this plan follow recommended guidelines and are intended to be used in planning. If Hanford Site activities in the vicinity of identified bald eagle use areas are carried out in accordance with this plan, such actions are not likely to adversely affect the eagles or their habitat. Activities that may be exceptions will involve informal or formal (whichever is appropriate) consultation with the US Fish and Wildlife Service as required by the Endangered Species Act

  19. Preliminary recommendations of the Noise Working Group

    International Nuclear Information System (INIS)

    Legerton, M.L.

    1995-01-01

    In 1993 the DTI set up a Working Group largely consisting of independent experts on wind turbine noise. The main objectives of the Working Group were to define a framework which can be used to measure and rate the noise from wind turbines and to provide indicative noise levels thought to offer a reasonable degree of protection to wind farm neighbours and encourage best practice in turbine design and wind farm siting and layout. This paper presents the preliminary recommendations of the Working Group. (Author)

  20. Mutations in new cell cycle genes that fail to complement a multiply mutant third chromosome of Drosophila.

    Science.gov (United States)

    White-Cooper, H; Carmena, M; Gonzalez, C; Glover, D M

    1996-11-01

    We have simultaneously screened for new alleles and second site mutations that fail to complement five cell cycle mutations of Drosphila carried on a single third chromosome (gnu, polo, mgr, asp, stg). Females that are either transheterozygous for scott of the antartic (scant) and polo, or homozygous for scant produce embryos that show mitotic defects. A maternal effect upon embryonic mitoses is also seen in embryos derived from females transheterozygous with helter skelter (hsk) and either mgr or asp. cleopatra (cleo), fails to complement asp but is not uncovered by a deficiency for asp. The mitotic phenotype of larvae heterozygous for cleo and the multiple mutant chromosome is similar to weak alleles of asp, but there are no defects in male meiosis. Mutations that failed to complement stg fell into two complementation groups corresponding to stg and a new gene noose. Three of the new stg alleles are early zygotic lethals, whereas the fourth is a pharate adult lethal allele that affects both mitosis and meiosis. Mutations in noose fully complement a small deficiency that removes stg, but when placed in trans to certain stg alleles, result in late lethality and mitotic abnormalities in larval brains.

  1. Replacement Power Facility site selection report

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L.D.; Toole, G.L.; Specht, W.L.

    1992-06-01

    The Department of Energy (DOE) has proposed the construction and operation of a Replacement Power Facility (RPF) for supplementing and replacing existing sources of steam and possibly electricity at the Savannah River Site (SRS). DOE is preparing an Environmental Impact Statement (EIS) for this project As part of the impact analysis of the proposed action, the EIS will include a detailed description of the environment where the RPF will be constructed. This description must be specific to the recommended site at SRS, which contains more than 300 square miles of land including streams, lakes, impoundments, wetlands, and upland areas. A formal site-selection process was designed and implemented to identify the preferred RPF site.

  2. Environmental assessment: Deaf Smith County site, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a location in Deaf Smith County, Texas, as one of the nine potentially acceptable sites for mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Deaf Smith County site and eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. The Deaf Smith County site is in the Permian Basin, which is one of five distinct geohydrologic settings considered for the first repository. On the basis of the evaluations reported in this EA, the DOE has found that the Deaf Smith County site is not disqualified under the guidelines.

  3. Environmental assessment: Deaf Smith County site, Texas

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a location in Deaf Smith County, Texas, as one of the nine potentially acceptable sites for mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Deaf Smith County site and eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. The Deaf Smith County site is in the Permian Basin, which is one of five distinct geohydrologic settings considered for the first repository. On the basis of the evaluations reported in this EA, the DOE has found that the Deaf Smith County site is not disqualified under the guidelines

  4. Site Selection for the Salt Disposition Facility at the Savannah River Site

    International Nuclear Information System (INIS)

    Gladden, J.B.; Rueter, K.J.; Morin, J.P.

    2000-01-01

    A site selection study was conducted to identify a suitable location for the construction and operation of a new Salt Disposition Facility (SDF) at the Savannah River Site (SRS). The facility to be sited is a single processing facility and support buildings that could house either of three technology alternatives being developed by the High Level Waste Systems Engineering Team: Small Tank Tetraphenylborate Precipitation, Crystalline Silicotitanate Non-Elutable Ion Exchange or Caustic Side Solvent Extraction. A fourth alternative, Direct Disposal in grout, is not part of the site selection study because a location has been identified that is unique to this technology (i.e., Z-Area). Facility site selection at SRS is a formal, documented process that seeks to optimize siting of new facilities with respect to facility-specific engineering requirements, sensitive environmental resources, and applicable regulatory requirements. In this manner, the prime objectives of cost minimization, environmental protection, and regulatory compliance are achieved. The results from this geotechnical characterization indicated that continued consideration be given to Site B for the proposed SDF. Suitable topography, the lack of surface hydrology and floodplain issues, no significant groundwater contamination, the presence of minor soft zones along the northeast portion of footprint, and no apparent geological structure in the Gordon Aquitard support this recommendation

  5. Classification of Recommender Expertise in the Wikipedia Recommender System

    DEFF Research Database (Denmark)

    Jensen, Christian D.; Pilkauskas, Povilas; Lefévre, Thomas

    2011-01-01

    to the quality of articles. The Wikipedia Recommender System (WRS) was developed to help users determine the credibility of articles based on feedback from other Wikipedia users. The WRS implements a collaborative filtering system with trust metrics, i.e., it provides a rating of articles which emphasizes...... an evaluation of four existing knowledge classification schemes with respect to these requirements. This evaluation helped us identify a classification scheme, which we have implemented in the current version of the Wikipedia Recommender System....... feedback from recommenders that the user has agreed with in the past. This exposes the problem that most recommenders are not equally competent in all subject areas. The first WRS prototype did not include an evaluation of the areas of expertise of recommenders, so the trust metric used in the article...

  6. Classification of Recommender Expertise in the Wikipedia Recommender System

    DEFF Research Database (Denmark)

    Jensen, Christian D.; Pilkauskas, Povilas; Lefevre, Thomas

    2011-01-01

    to the quality of articles. The Wikipedia Recommender System (WRS) was developed to help users determine the credibility of articles based on feedback from other Wikipedia users. The WRS implements a collaborative filtering system with trust metrics, i.e., it provides a rating of articles "which emphasizes...... an evaluation of four existing knowledge classification schemes with respect to these requirements. This evaluation helped us identify a classification scheme, which we have implemented in the current version of the Wikipedia Recommender System....... feedback from recommenders that the user has agreed with in the past. This exposes the problem that most recommenders are not equally competent in all subject areas. The first WRS prototype did not include an evaluation of the areas of expertise of recommenders, so the trust metric used in the article...

  7. Site-characterization data needs for hydrogeological evaluation

    International Nuclear Information System (INIS)

    Geier, J.

    1997-12-01

    A review of data utilization and data sufficiency for the multiple lines of hydrological analysis in the SITE-94 study yields insight regarding how site characterization relates to key uncertainties in geologic-barrier performance for performance assessment (PA). Significant uncertainties arise from (1) lack of data regarding interrelationships between hydraulic and transport properties in water-conducting features, (2) insufficient data to discriminate between different conceptual models for large-scale spatial correlation of hydraulic properties, and (3) inadequate determination of effective boundary conditions for site-scale models. For future site characterization in support of hydrological modelling for PA, recommendations that can be offered includes: (1) to develop methods for the evaluation of site-specific transport properties, particularly flow porosity, flow wetted surface, matrix diffusion coefficients, and possibly effective sorption coefficients, (2) to emphasize the use of multiple tracers and multiple scales of observation in pumping and tracer tests, in order to allow evaluation of the effects of scale and heterogeneity in hydrologic and transport properties, (3) to develop a structured, systematic approach to borehole investigations, sampling, and core logging, in order to ensure that the data thus gathered will support meaningful statistical analysis, and to ensure that the development of alternative conceptual models is supported, and finally (4) to improve documentation and checking of site-characterization data in order to avoid unnecessary introduction of uncertainty in PA. A full list of recommendations is given in Chapter 4 of this report

  8. Site-characterization data needs for hydrogeological evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Geier, J. [Clearwater Hardrock Consulting, Monmouth, ON (United States)

    1997-12-01

    A review of data utilization and data sufficiency for the multiple lines of hydrological analysis in the SITE-94 study yields insight regarding how site characterization relates to key uncertainties in geologic-barrier performance for performance assessment (PA). Significant uncertainties arise from (1) lack of data regarding interrelationships between hydraulic and transport properties in water-conducting features, (2) insufficient data to discriminate between different conceptual models for large-scale spatial correlation of hydraulic properties, and (3) inadequate determination of effective boundary conditions for site-scale models. For future site characterization in support of hydrological modelling for PA, recommendations that can be offered includes: (1) to develop methods for the evaluation of site-specific transport properties, particularly flow porosity, flow wetted surface, matrix diffusion coefficients, and possibly effective sorption coefficients, (2) to emphasize the use of multiple tracers and multiple scales of observation in pumping and tracer tests, in order to allow evaluation of the effects of scale and heterogeneity in hydrologic and transport properties, (3) to develop a structured, systematic approach to borehole investigations, sampling, and core logging, in order to ensure that the data thus gathered will support meaningful statistical analysis, and to ensure that the development of alternative conceptual models is supported, and finally (4) to improve documentation and checking of site-characterization data in order to avoid unnecessary introduction of uncertainty in PA. A full list of recommendations is given in Chapter 4 of this report. 31 refs.

  9. Subsurface characterization and geohydrologic site evaluation West Chestnut Ridge site

    International Nuclear Information System (INIS)

    1984-01-01

    The West Chestnut Ridge Site at the Oak Ridge National Laboratory is being considered for use as a repository for low-level radioactive waste. The purposes of this study were to provide a geohydrological characterization of the site for use in pathways analysis, and to provide preliminary geotechnical recommendations that would be used for development of a site utilization plan. Subsurface conditions were investigated at twenty locations and observation wells were installed. Field testing at each location included the Standard Penetration Test and permeability tests in soil and rock. A well pumping test was ocmpleted at one site. Laboratory testing included permeability, deformability, strength and compaction tests, as well as index and physical property tests. The field investigations showed that the subsurface conditions include residual soil overlying a weathered zone of dolomite which grades into relatively unweathered dolomite at depth. The thickness of residual soil is typically 80 ft (24 m) on the ridges, but can be as little as 10 ft (3 m) in the valleys. Trench excavations to depths of 30 ft (9 m) should not present serious slope stability problems above the water table. On-site soils can be used for liners or trench backfill but these soils may require moisture conditioning to achieve required densities. 19 figures, 8 tables

  10. Evaluation of a committed fusion site. Final report

    International Nuclear Information System (INIS)

    1979-07-01

    This report is divided into five technical sections. Section 2 is a summary. In Section 3, which covers device and site analyses the major characteristics of devices that might be placed at the site, as envisioned by major fusion laboratories, are described; the characteristics of a site (baseline site) which would accommodate these devices are defined; and various approaches to a committed site meeting the baseline site requirements are discussed. Section 4 describes the scenarios selected to represent possible site development outcomes; these scenarios are evaluated with respect to comparative cost and schedule effects. Section 5 presents a brief evaluation of the effects fusion-fission hybrids might have on the committed site. Major conclusions and recommendations are discussed in Section 6

  11. Role of Magnetic Reconnection in Heating Astrophysical Plasmas

    Science.gov (United States)

    Hammoud, M. M.; El Eid, M.; Darwish, M.; Dayeh, M. A.

    2017-12-01

    The description of plasma in the context of a fluid model reveals the important phenomenon of magnetic reconnection (MGR). This process is thought to be the cause of particle heating and acceleration in various astrophysical phenomena. Examples are geomagnetic storms, solar flares, or heating the solar corona, which is the focus of the present contribution. The magnetohydrodynamic approach (MHD) provides a basic description of MGR. However, the simulation of this process is rather challenging. Although it is not yet established whether waves or reconnection play the dominant role in heating the solar atmosphere, the present goal is to examine the tremendous increase of the temperature between the solar chromosphere and the corona in a very narrow transition region. Since we are dealing with very-high temperature plasma, the modeling of such heating process seems to require a two-fluid description consisting of ions and electrons. This treatment is an extension of the one-fluid model of resistive MHD that has been recently developed by [Hammoud et al., 2017] using the modern numerical openfoam toolbox. In this work, we outline the two-fluid approach using coronal conditions, show evidence of MGR in the two-fluid description, and investigate the temperature increase as a result of this MGR process.

  12. Remediation management of complex sites using an adaptive site management approach.

    Science.gov (United States)

    Price, John; Spreng, Carl; Hawley, Elisabeth L; Deeb, Rula

    2017-12-15

    Complex sites require a disproportionate amount of resources for environmental remediation and long timeframes to achieve remediation objectives, due to their complex geologic conditions, hydrogeologic conditions, geochemical conditions, contaminant-related conditions, large scale of contamination, and/or non-technical challenges. A recent team of state and federal environmental regulators, federal agency representatives, industry experts, community stakeholders, and academia worked together as an Interstate Technology & Regulatory Council (ITRC) team to compile resources and create new guidance on the remediation management of complex sites. This article summarizes the ITRC team's recommended process for addressing complex sites through an adaptive site management approach. The team provided guidance for site managers and other stakeholders to evaluate site complexities and determine site remediation potential, i.e., whether an adaptive site management approach is warranted. Adaptive site management was described as a comprehensive, flexible approach to iteratively evaluate and adjust the remedial strategy in response to remedy performance. Key aspects of adaptive site management were described, including tools for revising and updating the conceptual site model (CSM), the importance of setting interim objectives to define short-term milestones on the journey to achieving site objectives, establishing a performance model and metrics to evaluate progress towards meeting interim objectives, and comparing actual with predicted progress during scheduled periodic evaluations, and establishing decision criteria for when and how to adapt/modify/revise the remedial strategy in response to remedy performance. Key findings will be published in an ITRC Technical and Regulatory guidance document in 2017 and free training webinars will be conducted. More information is available at www.itrc-web.org. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Environmental assessment, Deaf Smith County site, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1986-05-01

    The Nuclear Waste Policy Act of 1982 (42 USC sections 10101-10226) requires the environmental assessment of a proposed site to include a statement of the basis for nominating a site as suitable for characterization. Volume 2 provides a detailed statement evaluating the site suitability of the Deaf Smith County Site under DOE siting guidelines, as well as a comparison of the Deaf Smith County Site to the other sites under consideration. The evaluation of the Deaf Smith County Site is based on the impacts associated with the reference repository design, but the evaluation will not change if based on the Mission Plan repository concept. The second part of this document compares the Deaf Smith County Site to Davis Canyon, Hanford, Richton Dome and Yucca Mountain. This comparison is required under DOE guidelines and is not intended to directly support subsequent recommendation of three sites for characterization as candidate sites. 259 refs., 29 figs., 66 refs. (MHB)

  14. Environmental assessment, Deaf Smith County site, Texas

    International Nuclear Information System (INIS)

    1986-05-01

    The Nuclear Waste Policy Act of 1982 (42 USC sections 10101-10226) requires the environmental assessment of a proposed site to include a statement of the basis for nominating a site as suitable for characterization. Volume 2 provides a detailed statement evaluating the site suitability of the Deaf Smith County Site under DOE siting guidelines, as well as a comparison of the Deaf Smith County Site to the other sites under consideration. The evaluation of the Deaf Smith County Site is based on the impacts associated with the reference repository design, but the evaluation will not change if based on the Mission Plan repository concept. The second part of this document compares the Deaf Smith County Site to Davis Canyon, Hanford, Richton Dome and Yucca Mountain. This comparison is required under DOE guidelines and is not intended to directly support subsequent recommendation of three sites for characterization as candidate sites. 259 refs., 29 figs., 66 refs

  15. Statistical and Economic Techniques for Site-specific Nematode Management.

    Science.gov (United States)

    Liu, Zheng; Griffin, Terry; Kirkpatrick, Terrence L

    2014-03-01

    Recent advances in precision agriculture technologies and spatial statistics allow realistic, site-specific estimation of nematode damage to field crops and provide a platform for the site-specific delivery of nematicides within individual fields. This paper reviews the spatial statistical techniques that model correlations among neighboring observations and develop a spatial economic analysis to determine the potential of site-specific nematicide application. The spatial econometric methodology applied in the context of site-specific crop yield response contributes to closing the gap between data analysis and realistic site-specific nematicide recommendations and helps to provide a practical method of site-specifically controlling nematodes.

  16. Use of Ion-Channel Modulating Agents to Study Cyanobacterial Na+ - K+ Fluxes

    Directory of Open Access Journals (Sweden)

    Pomati Francesco

    2004-01-01

    Full Text Available Here we describe an experimental design aimed to investigate changes in total cellular levels of Na+ and K+ ions in cultures of freshwater filamentous cyanobacteria. Ion concentrations were measured in whole cells by flame photometry. Cellular Na+ levels increased exponentially with rising alkalinity, with K+ levels being maximal for optimal growth pH (~8. At standardized pH conditions, the increase in cellular Na+, as induced by NaCl at 10 mM, was coupled by the two sodium channel-modulating agents lidocaine hydrochloride at 1 &mgr;M and veratridine at 100 &mgr;M. Both the channel-blockers amiloride (1 mM and saxitoxin (1 &mgr;M, decreased cell-bound Na+ and K+ levels. Results presented demonstrate the robustness of well-defined channel blockers and channel-activators in the study of cyanobacterial Na+- K+ fluxes.

  17. Environmental assessment overview, Davis Canyon site, Utah

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. The Davis Canyon site is in the Paradox Basin, which is one of five distinct geohydrologic settings considered for the first repository. On the basis of the evaluations reported in this EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. On the basis of these findings, the DOE is nominating the Davis Canyon site as one of five sites suitable for characterization. 3 figs

  18. Session II-A. Site characterization

    International Nuclear Information System (INIS)

    McIntosh, W.

    1981-01-01

    Section II-A on Site Characterization consists of the following papers which describe the progress made during the past fiscal year toward identifying sites for high-level radioactive waste repositories in deep geologic formations: (1) progress in expanded studies for repository sites; (2) evaluation of geologic and hydrologic characteristics in the Basin and Range Province relative to high-level nuclear waste disposal; (3) siting progress: Permian region; (4) Paradox Basin site exploration: a progress report; (5) progress toward recommending a salt site for an exploratory shaft; (6) status of geologic investigations for nuclear waste disposal at the Nevada Test Site; (7) geohydrologic investigation of the Hanford Site, Washington: basalt waste isolation project. Highlights include: expanding studies in crystalline rocks, both in the Appalachian and Lake Superior regions; laying the ground work with the states in the Basin and Range Province to kick off a joint USGS-state province study; narrowing areas of the Permian and Paradox bedded salt regions to a few promising locations; issuing a Gulf Coast Salt Dome Evaluation report (ONWI-109) for public review and comment; narrowing the Nevada Test Site area and Hanford Site area to locations for detailed site investigations and exploratory shafts; progress in developing the subseabed and space disposals alternatives

  19. Adherence to Follow-up Recommendations Among Individuals in the Philadelphia Glaucoma Detection and Treatment Project.

    Science.gov (United States)

    Hark, Lisa A; Leiby, Benjamin E; Waisbourd, Michael; Myers, Jonathan S; Fudemberg, Scott J; Mantravadi, Anand V; Dai, Yang; Gilligan, John P; Resende, Arthur F; Katz, L Jay

    2017-08-01

    To evaluate rates of adherence to free follow-up eye exam appointments among participants in the Philadelphia Glaucoma Detection and Treatment Project. Ophthalmologists and testing equipment were brought directly to participants at risk for glaucoma at 43 community sites in Philadelphia. Those diagnosed with glaucoma-related pathology were recommended to return for follow-up to be reexamined on site. Rates of adherence and clinical and demographic risk factors for adherence were evaluated. Five hundred thirty-one participants were diagnosed with glaucoma-related conditions and recommended to attend community-based follow-up exams. Follow-up adherence rate was 61.2% (n=325/531). Significant factors associated with greater eye exam appointment adherence, based on our univariable analysis, included final diagnosis of glaucoma (risk ratio [RR]=1.33; 95% confidence interval [CI], 1.13-1.57), male sex (RR=1.19; 95% CI, 1.04-1.36), white race (RR=1.26; 95% CI, 1.08-1.48), age (RR=1.17; 95% CI, 1.00-1.37) recommendation for glaucoma medication (RR=1.52; 95% CI, 1.35-1.71), recommendation for laser peripheral iridotomy (RR=1.18; 95% CI, 1.02-1.35), diagnosis of age-related macular degeneration (RR=1.42; 95% CI, 1.13-1.77) and an increased intraocular pressure (>22 mm Hg in the worse eye) (RR=1.23; 95% CI, 1.06-1.42). On the basis of our multivariable model, diagnosis, sex, and recommended glaucoma medications were significantly associated with follow-up adherence. This study demonstrates that individuals living in underserved urban communities would take advantage of free eye exams in community sites and return for follow-up eye exams in these same settings. Future studies could investigate interventions to improve eye exam appointment adherence in community-based settings to detect glaucoma-eye conditions.

  20. Siting of research reactors

    International Nuclear Information System (INIS)

    1987-01-01

    The purpose of this document is to develop criteria for siting and the site-related design basis for research reactors. The concepts presented in this document are intended as recommendations for new reactors and are not suggested for backfitting purposes for facilities already in existence. In siting research reactors serious consideration is given to minimizing the effects of the site on the reactor and the reactor on the site and the potential impact of the reactor on the environment. In this document guidance is first provided on the evaluation of the radiological impact of the installation under normal reactor operation and accident conditions. A classification of research reactors in groups is then proposed, together with a different approach for each group, to take into account the relevant safety problems associated with facilities of different characteristics. Guidance is also provided for both extreme natural events and for man-induced external events which could affect the safe operation of the reactor. Extreme natural events include earthquakes, flooding for river or coastal sites and extreme meteorological phenomena. The feasibility of emergency planning is finally considered for each group of reactors

  1. Local antimicrobial administration for prophylaxis of surgical site infections.

    Science.gov (United States)

    Huiras, Paul; Logan, Jill K; Papadopoulos, Stella; Whitney, Dana

    2012-11-01

    Despite a lack of consensus guidelines, local antibiotic administration for prophylaxis of surgical site infections is used during many surgical procedures. The rationale behind this practice is to provide high antibiotic concentrations at the site of surgery while minimizing systemic exposure and adverse effects. Local antibiotic administration for surgical site prophylaxis has inherent limitations in that antibiotics are applied after the incision is made, rather than the current standard for surgical site prophylaxis that recommends providing adequate antibiotic concentrations at the site before the incision. The efficacy and safety of local application of antibiotics for surgical site prophylaxis have been assessed in different types of surgery with a variety of antibiotic agents and methods of application. We identified 22 prospective, randomized, controlled trials that evaluated local application of antibiotics for surgical site prophylaxis. These trials were subsequently divided and analyzed based on the type of surgical procedure: dermatologic, orthopedic, abdominal, colorectal, and cardiothoracic. Methods of local application analyzed included irrigations, powders, ointments, pastes, beads, sponges, and fleeces. Overall, there is a significant lack of level I evidence supporting this practice for any of the surgical genres evaluated. In addition, the literature spans several decades, and changes in surgical procedures, systemic antibiotic prophylaxis, and microbial flora make conclusions difficult to determine. Based on available data, the efficacy of local antibiotic administration for the prophylaxis of surgical site infections remains uncertain, and recommendations supporting this practice for surgical site prophylaxis cannot be made. © 2012 Pharmacotherapy Publications, Inc.

  2. Robust detection of discordant sites in regional frequency analysis

    NARCIS (Netherlands)

    Neykov, N.M.; Neytchev, P.N.; Van Gelder, P.H.A.J.M.; Todorov, V.K.

    2007-01-01

    The discordancy measure in terms of the sample L?moment ratios (L?CV, L?skewness, L?kurtosis) of the at?site data is widely recommended in the screening process of atypical sites in the regional frequency analysis (RFA). The sample mean and the covariance matrix of the L?moments ratios, on which the

  3. Lower-Temperature Subsurface Layout and Ventilation Concepts

    International Nuclear Information System (INIS)

    Christine L. Linden; Edward G. Thomas

    2001-01-01

    This analysis combines work scope identified as subsurface facility (SSF) low temperature (LT) Facilities System and SSF LT Ventilation System in the Technical Work Plan for Subsurface Design Section FY 01 Work Activities (CRWMS M and O 2001b, pp. 6 and 7, and pp. 13 and 14). In accordance with this technical work plan (TWP), this analysis is performed using AP-3.10Q, Analyses and Models. It also incorporates the procedure AP-SI.1Q, Software Management. The purpose of this analysis is to develop an overall subsurface layout system and the overall ventilation system concepts that address a lower-temperature operating mode for the Monitored Geologic Repository (MGR). The objective of this analysis is to provide a technical design product that supports the lower-temperature operating mode concept for the revision of the system description documents and to provide a basis for the system description document design descriptions. The overall subsurface layout analysis develops and describes the overall subsurface layout, including performance confirmation facilities (also referred to as Test and Evaluation Facilities) for the Site Recommendation design. This analysis also incorporates current program directives for thermal management

  4. Siting Practices and Site Licensing Process for New Reactors in Canada

    International Nuclear Information System (INIS)

    Vos, Marcel de

    2011-01-01

    'Siting' in Canada is composed of Site Evaluation and Site Selection. As outlined in CNSC Regulatory Document RD-346 Site Evaluation for New Nuclear Power Plants (based on IAEA NS-R-3), prior to the triggering of the Environmental Assessment (EA) and licensing processes, the proponent is expected to use a robust process to characterize proposed sites over the full life cycle of the facility, and then develop a fully documented defense of the site selection case. This case forms the backbone for submissions in support of the EA and the application for a License to Prepare Site which will be reviewed by the CNSC and other applicable federal authorities. The Environmental Assessment process and License to Prepare Site in Canada do not require a proponent to select a specific design; however, CNSC does not accept a 'black box' approach to siting. CNSC balances the level of design information required with the extent of safety assurance desired for any designs being contemplated for the proposed site. Nevertheless, the design information submitted must be sufficient to justify the site as suitable for all future licensing stages. The depth of plant design information contributes significantly to the credibility of the applicant's case for both the EA and application for License to Prepare Site. The review process utilizes an assessment plan with defined review stages and timelines. The outcome of these reviews is a series of recommendations to a federal government appointed Joint Review Panel (which also serves as a panel of the 'Commission') which, following public hearings, renders a decision regarding the EA, and subsequently, the application for a License to Prepare Site. (author)

  5. Site-specific analysis of the cobbly soils at the Grand Junction processing site

    International Nuclear Information System (INIS)

    1992-06-01

    This report describes a recent site-specific analysis to evaluate the necessity of a recommendation to install a slurry trench around the Grand Junction processing site. The following analysis addresses the cobbly nature of the site's radiologically contaminated foundation soil, reassesses the excavation depths based on bulk radionuclide concentrations, and presents data-based arguments that support the elimination of the initially proposed slurry trench. The slurry trench around the processing site was proposed by the Remedial Action Contractor (RAC) to minimize the amount of water encountered during excavation. The initial depths of excavation developed during conceptual design, which indicated the need for a slurry wall, were reexamined as part of this analysis. This reanalysis, based on bulk concentrations of a cobbly subsoil, supports decreasing the original excavation depth, limiting the dewatering quantities to those which can be dissipated by normal construction activities. This eliminates the need for a slurry trench andseparate water treatment prior to permitted discharge

  6. Oak Ridge Reservation site management plan for the environmental restoration program

    International Nuclear Information System (INIS)

    1995-09-01

    This report describes the overall approach for addressing environmental contamination on the Oak Ridge Reservation (ORR) National Priorities List site located in east Tennessee. The cleanup strategy reflected in this site management plan (SMP) has been developed to accelerate the transition of areas of concern (AOCs) from characterization to remediation by making decisions at the watershed scale based on recommended land uses. Project scoping involves the use of defined remedial action objectives, which are based in part on the land uses selected for the project sites. To provide a consistent land use approach that accommodates the needs of all stakeholders responsible for the remediation and reutilization of the ORR, a reservation-wide strategy has been developed. The Common Ground process is a stakeholder-driven process to determine preferred land use options for the ORR so that clean-up operations will be based on the most likely and acceptable land uses. DOE utilized the information gathered in the Common Ground process to recommend desired land uses for the ORR. The land uses recommended by DOE as a result of the Common Ground process are being used for planning land and facility use/reuse for the next 25 years. Land uses recommended for the ORR in conducting CERCLA remedial activities are conservation, industrial use, and waste management

  7. Permian Basin location recommendation report

    International Nuclear Information System (INIS)

    1983-09-01

    Candidate study areas are screened from the Palo Duro and Dalhart Basin areas using data obtained from studies to date and criteria and specifications that consider: rock geometry; rock characteristics; human intrusion potential; surface characteristics; and environmental and socioeconomic conditions. Two preferred locations are recommended from among these areas for additional characterization to identify potential National Waste Terminal Storage (NWTS) salt repository sites. One location, in northeastern Deaf Smith County and southeastern Oldham County, is underlain by two salt units that meet the adopted screening specifications. The other location, in northcentral Swisher County, is underlain by one salt unit that meets the adopted screening specifications. Both locations have several favorable features, relative to surrounding areas, and no obviously undesirable characteristics. Both lie wholly on the Southern High Plains surface, are in relatively sparsely populated areas, contain no unique land use conflicts, and comprise large enough geographic areas to provide flexibility in site selection. Data gathered to date indicate that these locations contain salt units sufficient in thickness and in depth for the safe construction and operation of the underground facilities under consideration. 93 references, 34 figures, 6 tables

  8. Corrective Action Decision Document/Corrective Action Plan for Corrective Action Unit 104: Area 7 Yucca Flat Atmospheric Test Sites Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Patrick Matthews

    2012-10-01

    CAU 104 comprises the following corrective action sites (CASs): • 07-23-03, Atmospheric Test Site T-7C • 07-23-04, Atmospheric Test Site T7-1 • 07-23-05, Atmospheric Test Site • 07-23-06, Atmospheric Test Site T7-5a • 07-23-07, Atmospheric Test Site - Dog (T-S) • 07-23-08, Atmospheric Test Site - Baker (T-S) • 07-23-09, Atmospheric Test Site - Charlie (T-S) • 07-23-10, Atmospheric Test Site - Dixie • 07-23-11, Atmospheric Test Site - Dixie • 07-23-12, Atmospheric Test Site - Charlie (Bus) • 07-23-13, Atmospheric Test Site - Baker (Buster) • 07-23-14, Atmospheric Test Site - Ruth • 07-23-15, Atmospheric Test Site T7-4 • 07-23-16, Atmospheric Test Site B7-b • 07-23-17, Atmospheric Test Site - Climax These 15 CASs include releases from 30 atmospheric tests conducted in the approximately 1 square mile of CAU 104. Because releases associated with the CASs included in this CAU overlap and are not separate and distinguishable, these CASs are addressed jointly at the CAU level. The purpose of this CADD/CAP is to evaluate potential corrective action alternatives (CAAs), provide the rationale for the selection of recommended CAAs, and provide the plan for implementation of the recommended CAA for CAU 104. Corrective action investigation (CAI) activities were performed from October 4, 2011, through May 3, 2012, as set forth in the CAU 104 Corrective Action Investigation Plan.

  9. Recommendations for future low-level and mixed waste management practices at Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Jennrich, E.A.; Klein, R.B.; Murphy, E.S.; Shuman, R.; Hickman, W.W.; Rutz, A.C.; Uhl, D.L.

    1989-01-01

    This report describes recommendations concerning the management of low-level radioactive wastes and mixtures at Los Alamos National Laboratory. Performance assessments, characterization, site disposal design, shipment, and storage are discussed

  10. Environmental assessment: Richton Dome site, Mississippi

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Richton Dome site in Mississippi as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Richton Dome site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. The site is in the Gulf interior region, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains two other potentially acceptable sites--the Cypress Creek Dome site in Mississippi and the Vacherie Dome site in Louisiana. Although the Cypress Creek Dome and the Vacherie Dome sites are suitable for site characterization, the DOE has concluded that the Richton Dome site is the preferred site in the Gulf interior region. On the basis of the evaluations reported in this EA, the DOE has found that the Richton Dome site is not disqualified under the guidelines

  11. Environmental assessment: Richton Dome Site, Mississippi

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Richton Dome site in Mississippi as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Richton Dome site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. The site is in the Gulf interior region, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains two other potentially acceptable sites--the Cypress Creek Dome site in Mississippi and the Vacherie Dome site in Louisiana. Although the Cypress Creek Dome and the Vacherie Dome sites are suitable for site characterization, the DOE has concluded that the Richton Dome site is the preferred site in the Gulf interior region. On the basis of the evaluations reported in this EA, the DOE has found that the Richton Dome site is not disqualified under the guidelines.

  12. Environmental assessment: Richton Dome site, Mississippi

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Richton Dome site in Mississippi as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Richton Dome site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. The site is in the Gulf interior region, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains two other potentially acceptable sites--the Cypress Creek Dome site in Mississippi and the Vacherie Dome site in Louisiana. Although the Cypress Creek Dome and the Vacherie Dome sites are suitable for site characterization, the DOE has concluded that the Richton Dome site is the preferred site in the Gulf interior region. On the basis of the evaluations reported in this EA, the DOE has found that the Richton Dome site is not disqualified under the guidelines.

  13. Environmental assessment: Richton Dome Site, Mississippi

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Richton Dome site in Mississippi as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Richton Dome site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. The site is in the Gulf interior region, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains two other potentially acceptable sites--the Cypress Creek Dome site in Mississippi and the Vacherie Dome site in Louisiana. Although the Cypress Creek Dome and the Vacherie Dome sites are suitable for site characterization, the DOE has concluded that the Richton Dome site is the preferred site in the Gulf interior region. On the basis of the evaluations reported in this EA, the DOE has found that the Richton Dome site is not disqualified under the guidelines

  14. Evaluating music emotion recognition:Lessons from music genre recognition?

    OpenAIRE

    Sturm, Bob L.

    2013-01-01

    A fundamental problem with nearly all work in music genre recognition (MGR)is that evaluation lacks validity with respect to the principal goals of MGR. This problem also occurs in the evaluation of music emotion recognition (MER). Standard approaches to evaluation, though easy to implement, do not reliably differentiate between recognizing genre or emotion from music, or by virtue of confounding factors in signals (e.g., equalization). We demonstrate such problems for evaluating an MER syste...

  15. Prophylactic Antibiotic Choice and Risk of Surgical Site Infection After Hysterectomy.

    Science.gov (United States)

    Uppal, Shitanshu; Harris, John; Al-Niaimi, Ahmed; Swenson, Carolyn W; Pearlman, Mark D; Reynolds, R Kevin; Kamdar, Neil; Bazzi, Ali; Campbell, Darrell A; Morgan, Daniel M

    2016-02-01

    To evaluate associations between prophylactic preoperative antibiotic choice and surgical site infection rates after hysterectomy. A retrospective cohort study was performed of patients in the Michigan Surgical Quality Collaborative undergoing hysterectomy from July 2012 to February 2015. The primary outcome was a composite outcome of any surgical site infection (superficial surgical site infections or combined deep organ space surgical site infections). Preoperative antibiotics were categorized based on the recommendations set forth by the American College of Obstetricians and Gynecologists and the Surgical Care Improvement Project. Patients receiving a recommended antibiotic regimen were categorized into those receiving β-lactam antibiotics and those receiving alternatives to β-lactam antibiotics. Patients receiving nonrecommended antibiotics were categorized into those receiving overtreatment (excluded from further analysis) and those receiving nonstandard antibiotics. Multivariable logistic regression models were developed to estimate the independent effect of antibiotic choice. Propensity score matching analysis was performed to validate the results. The study included 21,358 hysterectomies. The overall rate of any surgical site infection was 2.06% (n=441). Unadjusted rates of "any surgical site infection" were 1.8%, 3.1%, and 3.7% for β-lactam, β-lactam alternatives, and nonstandard groups, respectively. After adjusting for patient and operative factors within clusters of hospitals, compared with the β-lactam antibiotics (reference group), the risk of "any surgical site infection" was higher for the group receiving β-lactam alternatives (odds ratio [OR] 1.7, confidence interval [CI] 1.27-2.07) or the nonstandard antibiotics (OR 2.0, CI 1.31-3.1). Compared with women receiving β-lactam antibiotic regimens, there is a higher risk of surgical site infection after hysterectomy among those receiving a recommended β-lactam alternative or nonstandard regimen.

  16. Environmental assessment: Deaf Smith County site, Texas

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a location in Deaf Smith County, Texas, as one of nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Deaf Smith County site and the eight other potentially sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. The Deaf Smith County site is in the Permian Basin, which is one of five distinct geohydrologic settings considered for the first repository. On the basis of the evaluations reported in this EA, the DOE has found that the Deaf Smith County site is not disqualified under the guidelines. On the basis of these findings, the DOE is nominating the Deaf Smith County site as one of the five sites suitable for characterization. 591 refs., 147 figs., 173 tabs

  17. Environmental assessment: Deaf Smith County site, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a location in Deaf Smith County, Texas, as one of nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Deaf Smith County site and the eight other potentially sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. The Deaf Smith County site is in the Permian Basin, which is one of five distinct geohydrologic settings considered for the first repository. On the basis of the evaluations reported in this EA, the DOE has found that the Deaf Smith County site is not disqualified under the guidelines. On the basis of these findings, the DOE is nominating the Deaf Smith County site as one of the five sites suitable for characterization. 591 refs., 147 figs., 173 tabs.

  18. An effective trust-based recommendation method using a novel graph clustering algorithm

    Science.gov (United States)

    Moradi, Parham; Ahmadian, Sajad; Akhlaghian, Fardin

    2015-10-01

    Recommender systems are programs that aim to provide personalized recommendations to users for specific items (e.g. music, books) in online sharing communities or on e-commerce sites. Collaborative filtering methods are important and widely accepted types of recommender systems that generate recommendations based on the ratings of like-minded users. On the other hand, these systems confront several inherent issues such as data sparsity and cold start problems, caused by fewer ratings against the unknowns that need to be predicted. Incorporating trust information into the collaborative filtering systems is an attractive approach to resolve these problems. In this paper, we present a model-based collaborative filtering method by applying a novel graph clustering algorithm and also considering trust statements. In the proposed method first of all, the problem space is represented as a graph and then a sparsest subgraph finding algorithm is applied on the graph to find the initial cluster centers. Then, the proposed graph clustering algorithm is performed to obtain the appropriate users/items clusters. Finally, the identified clusters are used as a set of neighbors to recommend unseen items to the current active user. Experimental results based on three real-world datasets demonstrate that the proposed method outperforms several state-of-the-art recommender system methods.

  19. TBV 361 RESOLUTION ANALYSIS: EMPLACEMENT DRIFT ORIENTATION

    International Nuclear Information System (INIS)

    Lin, M.; Kicker, D.C.; Sellers, M.D.

    1999-01-01

    The purpose of this To Be Verified/To Be Determined (TBX) resolution analysis is to release ''To Be Verified'' (TBV)-361 related to the emplacement drift orientation. The system design criterion in ''Subsurface Facility System Description Document'' (CRWMS M andO 1998a, p.9) specifies that the emplacement drift orientation relative to the dominant joint orientations should be at least 30 degrees. The specific objectives for this analysis include the following: (1) Collect and evaluate key block data developed for the repository host horizon rock mass. (2) Assess the dominant joint orientations based on available fracture data. (3) Document the maximum block size as a function of drift orientation. (4) Assess the applicability of the drift orientation/joint orientation offset criterion in the ''Subsurface Facility System Description Document'' (CRWMS M andO 1998a, p.9). (5) Consider the effects of seepage on drift orientation. (6) Verify that the viability assessment (VA) drift orientation complies with the drift orientation/joint orientation offset criterion, or provide justifications and make recommendations for modifying the VA emplacement drift layout. In addition to providing direct support to the System Description Document (SDD), the release of TBV-361 will provide support to the Repository Subsurface Design Department. The results from this activity may also provide data and information needs to support the MGR Requirements Department, the MGR Safety Assurance Department, and the Performance Assessment Organization

  20. Web Site Optimisation

    OpenAIRE

    Petrželka, Jiří

    2007-01-01

    This BSc Project was performed during a study stay at the Coventry University, UK. The goal of this project is to enhance the accessibility and usability of an existing company presentation located at http://www.hcc.cz, boost the site's traffic and so increase the company's revenues. The project follows these steps to accomplish this: a ) A partial refactoring of the back-end (PHP scripts). b ) Transformation of the website contents according to the recommendations of the World Wide Web conso...

  1. Seismic Hazard Assessment in Site Evaluation for Nuclear Installations: Ground Motion Prediction Equations and Site Response

    International Nuclear Information System (INIS)

    2016-07-01

    The objective of this publication is to provide the state-of-the-art practice and detailed technical elements related to ground motion evaluation by ground motion prediction equations (GMPEs) and site response in the context of seismic hazard assessments as recommended in IAEA Safety Standards Series No. SSG-9, Seismic Hazards in Site Evaluation for Nuclear Installations. The publication includes the basics of GMPEs, ground motion simulation, selection and adjustment of GMPEs, site characterization, and modelling of site response in order to improve seismic hazard assessment. The text aims at delineating the most important aspects of these topics (including current practices, criticalities and open problems) within a coherent framework. In particular, attention has been devoted to filling conceptual gaps. It is written as a reference text for trained users who are responsible for planning preparatory seismic hazard analyses for siting of all nuclear installations and/or providing constraints for anti-seismic design and retrofitting of existing structures

  2. Alternative energy facility siting policies for urban coastal areas: executive summary of findings and policy recommendations

    Energy Technology Data Exchange (ETDEWEB)

    Morell, D; Singer, G

    1980-11-01

    An analysis was made of siting issues in the coastal zone, one of the nation's most critical natural resource areas and one which is often the target for energy development proposals. The analysis addressed the changing perceptions of citizens toward energy development in the coastal zone, emphasizing urban communities where access to the waterfront and revitalization of waterfront property are of interest to the citizen. The findings of this analysis are based on an examination of energy development along New Jersey's urban waterfront and along the Texas-Louisiana Gulf Coast, and on redevelopment efforts in Seattle, San Francisco, Boston, and elsewhere. The case studies demonstrate the significance of local attitudes and regional cooperation in the siting process. In highly urbanized areas, air quality has become a predominant concern among citizen groups and an influential factor in development of alternative energy facility siting strategies, such as consideration of inland siting connected by pipeline to a smaller coastal facility. The study addresses the economic impact of the permitting process on the desirability of energy facility investments, and the possible effects of the location selected for the facility on the permitting process and investment economics. The economic analysis demonstrates the importance of viewing energy facility investments in a broad perspective that includes the positive or negative impacts of various alternative siting patterns on the permitting process. Conclusions drawn from the studies regarding Federal, state, local, and corporate politics; regulatory, permitting, licensing, environmental assessment, and site selection are summarized. (MCW)

  3. Lightning vulnerability of nuclear explosive test systems at the Nevada Test Site

    International Nuclear Information System (INIS)

    Hasbrouck, R.T.

    1985-01-01

    A task force chartered to evaluate the effects of lightning on nuclear explosives at the Nevada Test Site has made several recommendations intended to provide lightning-invulnerable test device systems. When these recommendations have been implemented, the systems will be tested using full-threat-level simulated lightning

  4. DOE organization and management approach in responding to recommendation 94-2 - The implementation plan

    Energy Technology Data Exchange (ETDEWEB)

    Widmayer, D.

    1995-12-31

    In March, the Department of Energy (DOE) submitted the Implementation Plan in response to the Defense Nuclear Facilities Safety Board (DNFSB) Recommendation 94-2, {open_quotes}Conformance with Safety Standards at Department of Energy Low-Level Nuclear Waste and Disposal Sites.{close_quotes} This paper discusses the management organization and interactions established to accomplish the tasks developed to respond to the DNFSB Recommendation. The organization of the tasks into six technical areas and the interfaces and connections between the tasks are briefly described. A summary of how each significant part of the DNFSB Recommendation is being addressed is presented. This paper provides a brief introduction to the remaining presentations in this session.

  5. Non-IID Recommender Systems: A Review and Framework of Recommendation Paradigm Shifting

    Directory of Open Access Journals (Sweden)

    Longbing Cao

    2016-06-01

    Full Text Available While recommendation plays an increasingly critical role in our living, study, work, and entertainment, the recommendations we receive are often for irrelevant, duplicate, or uninteresting products and services. A critical reason for such bad recommendations lies in the intrinsic assumption that recommended users and items are independent and identically distributed (IID in existing theories and systems. Another phenomenon is that, while tremendous efforts have been made to model specific aspects of users or items, the overall user and item characteristics and their non-IIDness have been overlooked. In this paper, the non-IID nature and characteristics of recommendation are discussed, followed by the non-IID theoretical framework in order to build a deep and comprehensive understanding of the intrinsic nature of recommendation problems, from the perspective of both couplings and heterogeneity. This non-IID recommendation research triggers the paradigm shift from IID to non-IID recommendation research and can hopefully deliver informed, relevant, personalized, and actionable recommendations. It creates exciting new directions and fundamental solutions to address various complexities including cold-start, sparse data-based, cross-domain, group-based, and shilling attack-related issues.

  6. Remote sensing to monitor uranium tailing sites

    International Nuclear Information System (INIS)

    1992-02-01

    This report concerns the feasibility of using remotely-sensed data for long-term monitoring of uranium tailings. Decommissioning of uranium mine tailings sites may require long-term monitoring to confirm that no unanticipated release of contaminants occurs. Traditional ground-based monitoring of specific criteria of concern would be a significant expense depending on the nature and frequency of the monitoring. The objective of this study was to evaluate whether available remote-sensing data and techniques were applicable to the long-term monitoring of tailings sites. This objective was met by evaluating to what extent the data and techniques could be used to identify and discriminate information useful for monitoring tailings sites. The cost associated with obtaining and interpreting this information was also evaluated. Satellite and aircraft remote-sensing-based activities were evaluated. A monitoring programme based on annual coverage of Landsat Thematic Mapper data is recommended. Immediately prior to and for several years after decommissioning of the tailings sites, airborne multispectral and thermal infrared surveys combined with field verification data are required in order to establish a baseline for the long-term satellite-based monitoring programme. More frequent airborne surveys may be required if rapidly changing phenomena require monitoring. The use of a geographic information system is recommended for the effective storage and manipulation of data accumulated over a number of years

  7. Raport z badania 2016. Specjalne Strefy Ekonomiczne w Polsce w oczach przedsiębiorców i pracowników samorządów

    OpenAIRE

    Pastusiak, Radosław; Jasiniak, Magdalena; Keller, Jakub; Krzeczewski, Bartłomiej

    2016-01-01

    Niniejszy raport prezentuje wyniki projektu realizowanego w ramach projektu badawczego nr UMO-2013/09/B/HS4/, pt. Efektywność Specjalnych Stref Ekonomicznych, przez zespół Katedry Finansów Korporacji, Wydział Ekonomiczno-Socjologiczny Uniwersytetu Łódzkiego, pod kierownictwem dr hab. Radosława Pastusiaka, prof. nadzw. UŁ. w składzie: dr Magdalena Jasiniak, mgr Jakub Keller, mgr Bartłomiej Krzeczewski. Zasadniczym celem badania było określenie efektywności funkcjonowania Specjalnych Stref Ekon...

  8. Final disposal of spent nuclear fuel - basis for site selection

    International Nuclear Information System (INIS)

    Anttila, P.

    1995-05-01

    International organizations, e.g. IAEA, have published several recommendations and guides for the safe disposal of radioactive waste. There are three major groups of issues affecting the site selection process, i.e. geological, environmental and socioeconomic. The first step of the site selection process is an inventory of potential host rock formations. After that, potential study areas are screened to identify sites for detailed investigations, prior to geological conditions and overall suitability for the safe disposal. This kind of stepwise site selection procedure has been used in Finland and in Sweden. A similar approach has been proposed in Canada, too. In accordance with the amendment to the Nuclear Energy Act, that entered into force in the beginning of 1995, Imatran Voima Oy has to make preparations for the final disposal of spent fuel in the Finnish bedrock. Relating to the possible site selection, the following geological factors, as internationally recommended and used in the Nordic countries, should be taken into account: topography, stability of bedrock, brokenness and fracturing of bedrock, size of bedrock block, rock type, predictability and natural resources. The bedrock of the Loviisa NPP site is a part of the Vyborg rapakivi massif. As a whole the rapakivi granite area forms a potential target area, although other rock types or areas cannot be excluded from possible site selection studies. (25 refs., 7 figs.)

  9. Environmental assessment overview, Deaf Smith County site, Texas

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a location in Deaf Smith County, Texas, as one of nine potentially acceptable sites for mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Deaf Smith County site and eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. The Deaf Smith County site is in the Permian Basin, which is one of five distinct geohydrologic settings considered for the first repository. On the basis of the evaluations reported in this EA, the DOE has found that the Deaf Smith County site is not disqualified under the guidelines. On the basis of these findings, the DOE is nominating the Deaf Smith County site as one of five sites suitable for characterization. 3 figs

  10. Design of Ontology-Based Sharing Mechanism for Web Services Recommendation Learning Environment

    Science.gov (United States)

    Chen, Hong-Ren

    The number of digital learning websites is growing as a result of advances in computer technology and new techniques in web page creation. These sites contain a wide variety of information but may be a source of confusion to learners who fail to find the information they are seeking. This has led to the concept of recommendation services to help learners acquire information and learning resources that suit their requirements. Learning content like this cannot be reused by other digital learning websites. A successful recommendation service that satisfies a certain learner must cooperate with many other digital learning objects so that it can achieve the required relevance. The study proposes using the theory of knowledge construction in ontology to make the sharing and reuse of digital learning resources possible. The learning recommendation system is accompanied by the recommendation of appropriate teaching materials to help learners enhance their learning abilities. A variety of diverse learning components scattered across the Internet can be organized through an ontological process so that learners can use information by storing, sharing, and reusing it.

  11. Context-aware recommender system based on ontology for recommending tourist destinations at Bandung

    Science.gov (United States)

    Rizaldy Hafid Arigi, L.; Abdurahman Baizal, Z. K.; Herdiani, Anisa

    2018-03-01

    Recommender System is software that is able to provide personalized recommendation suits users’ needs. Recommender System has been widely implemented in various domains, including tourism. One approach that can be done for more personalized recommendations is the use of contextual information. This paper proposes a context aware recommender based ontology system in the tourism domain. The system is capable of recommending tourist destinations by using user preferences of the categories of tourism and contextual information such as user locations, weather around tourist destinations and close time of destination. Based on the evaluation, the system has accuracy of of 0.94 (item recommendation precision evaluated by expert) and 0.58 (implicitly from system-end user interaction). Based on the evaluation of user satisfaction, the system provides a satisfaction level of more than 0.7 (scale 0 to 1) for speed factors for providing liked recommendations (PE), informative description of recommendations (INF) and user trust (TR).

  12. DNFSB Recommendation 94-1 Hanford Site Integrated Stabilization Management Plan. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    McCormack, R.L.

    1995-08-01

    This document describes the plans of the Hanford Site for the safe interim storage of fissile materials. Currently, spent nuclear fuels reside in storage basins that have leaked in the past and are projected to leak in the future. Other problems in the basins include; sludge from decomposition, degraded cladding of fuel elements, and construction defects which make the basins seismically unsafe. This management plan describes the time and cost that it will take to implement a safe interim storage plan for the fissile materials.

  13. Environmental assessment overview, Reference repository location, Hanford site, Washington

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a reference repository location at the Hanford Site in Washington as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. The site is in the Columbia Plateau, which is one of five distinct geohydrologic settings considered for the first repository. To determine their suitability, the Hanford site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. On the basis of the evaluations reported in this EA, the DOE has found that the Hanford site is not disqualified under the guidelines. On the basis of these findings, the DOE is nominating the Hanford site as one of five sites suitable for characterization. 3 figs

  14. Site observational work plan for the UMTRA Project Site at Riverton, Wyoming. Revision 3/95

    International Nuclear Information System (INIS)

    1995-03-01

    Ground water compliance for the Uranium Mill Tailings Remedial Action (UMTRA) Project sites, including the Riverton, Wyoming, site, is governed by the Uranium Mill Tailings Radiation Control Act and the US Environmental Protection Agency's Health and Environmental Protection Standards for Uranium and Thorium Mill Tailings. The compliance strategy proposed for this site is natural flushing in conjunction with institutional controls. The essential premise of natural flushing is that ground water movement and natural attenuation processes will reduce the detected contamination to background levels or alternate concentration limits that do not pose a risk to human health or the environment within 100 years. This document contains the following sections. Section 2.0 of this SOWP describes the requirements for meeting standards at UMTRA Project sites. Section 3.0 provides site-specific data and the related conceptual model. Section 4.0 provides the justification for the recommended ground water compliance strategy for the Riverton site. Section 5.0 provides the justification and process for collection and assessment of additional required data. Section 6.0 provides a list of the references cited. The appendixes include data on monitor wells and lithography, ground water, surface water, and sediment quality

  15. Clustering Algorithms in Hybrid Recommender System on MovieLens Data

    Directory of Open Access Journals (Sweden)

    Kuzelewska Urszula

    2014-08-01

    Full Text Available Decisions are taken by humans very often during professional as well as leisure activities. It is particularly evident during surfing the Internet: selecting web sites to explore, choosing needed information in search engine results or deciding which product to buy in an on-line store. Recommender systems are electronic applications, the aim of which is to support humans in this decision making process. They are widely used in many applications: adaptive WWW servers, e-learning, music and video preferences, internet stores etc. In on-line solutions, such as e-shops or libraries, the aim of recommendations is to show customers the products which they are probably interested in. As input data the following are taken: shopping basket archives, ratings of the products or servers log files.

  16. Emergence of scale-free leadership structure in social recommender systems.

    Science.gov (United States)

    Zhou, Tao; Medo, Matúš; Cimini, Giulio; Zhang, Zi-Ke; Zhang, Yi-Cheng

    2011-01-01

    The study of the organization of social networks is important for the understanding of opinion formation, rumor spreading, and the emergence of trends and fashion. This paper reports empirical analysis of networks extracted from four leading sites with social functionality (Delicious, Flickr, Twitter and YouTube) and shows that they all display a scale-free leadership structure. To reproduce this feature, we propose an adaptive network model driven by social recommending. Artificial agent-based simulations of this model highlight a "good get richer" mechanism where users with broad interests and good judgments are likely to become popular leaders for the others. Simulations also indicate that the studied social recommendation mechanism can gradually improve the user experience by adapting to tastes of its users. Finally we outline implications for real online resource-sharing systems.

  17. Area Recommendation Report for the Crystalline Repository Project: Volume 1, Draft

    International Nuclear Information System (INIS)

    1986-01-01

    This Draft Area Recommendation Report for the Crystalline Repository Project identifies portions of crystalline rock bodies as proposed potentially acceptable sites for consideration in the second high-level radioactive waste repository program. The US Department of Energy evaluated available geologic and environmental data for 235 crystalline rock bodies in the North Central, Northeastern, and Southeastern regions to identify preliminary candidate areas. Further evaluation of these preliminary candidate areas resulted in the selection of 12 as proposed potentially acceptable sites. The 12 proposed potentially acceptable sites are located in the States of Georgia (1), Maine (2), Minnesota (3), New Hampshire (1), North Carolina (2), Virginia (2), and Wisconsin (1). The data, analyses, and rationale with which the 12 proposed potentially acceptable sites were selected are presented in this draft report. The analyses presented demonstrate that the evidence available for each proposed potentially acceptable site supports (1) a finding that the site is not disqualified in accordance with the application requirements of Appendix III of the siting guidelines and (2) a decision to proceed with the continued investigation of the site on the basis of the favorable and potentially adverse conditions identified to date. Once this report is finalized, potentially acceptable sites in crystalline rock will be formally identified by the Secretary of Energy, in accordance with the DOE siting guidelines. These potentially acceptable sites will be investigated and evaluated in more detail during the area phase of the siting process. An additional eight areas, which meet the requirements for identification as potentially acceptable sites, will retain their designation as candidate areas

  18. Preliminary site investigation for LL and IL radwaste disposal for Qinshan NPP

    International Nuclear Information System (INIS)

    Huang Yawen; Chen Zhangru

    1993-01-01

    With the purpose of selecting a disposal site for the low- and intermediate-level radwastes arising from Qinshan NPP, site investigations were carried out in several districts of Zhejiang Province. Investigation objectives included the circumstances of geology, hydrogeology, environmental ecology, and social economy. On the basis of collected data, five possible sites were recommended for policy-making reference and further investigation

  19. Assessment of technologies for the remediation of radioactively contaminated Superfund sites

    International Nuclear Information System (INIS)

    1990-01-01

    The report is a screening evaluation of information needs for the development of generic treatability studies for the remediation of Superfund Radiation Sites on the National Priorities List (NPL). It presents a categorization of the 25 radiation sites currently proposed or listed on the NPL, and provides a rating system for evaluating technologies that may be used to remediate these sites. It also identifies gaps in site assessment and technology data and provides information about and recommendations for technology development

  20. Long-term Mechanical Circulatory Support System reliability recommendation by the National Clinical Trial Initiative subcommittee.

    Science.gov (United States)

    Lee, James

    2009-01-01

    The Long-Term Mechanical Circulatory Support (MCS) System Reliability Recommendation was published in the American Society for Artificial Internal Organs (ASAIO) Journal and the Annals of Thoracic Surgery in 1998. At that time, it was stated that the document would be periodically reviewed to assess its timeliness and appropriateness within 5 years. Given the wealth of clinical experience in MCS systems, a new recommendation has been drafted by consensus of a group of representatives from the medical community, academia, industry, and government. The new recommendation describes a reliability test methodology and provides detailed reliability recommendations. In addition, the new recommendation provides additional information and clinical data in appendices that are intended to assist the reliability test engineer in the development of a reliability test that is expected to give improved predictions of clinical reliability compared with past test methods. The appendices are available for download at the ASAIO journal web site at www.asaiojournal.com.

  1. 2005 9th Annual Army Small Business Conference

    Science.gov (United States)

    2005-11-03

    Risk Exposure • Reduces Transition Cost • Alternative for Customer • Buyer/Seller Transition • Novations • Reduces Exit Cost • Stepping Stone Teaming...PRIME FINANCE PROCUREMENT A D M IN ISTR A TIVE T E C H N I C A L DCAA DCMA AMC COMMODITY -AQ Center -Program Mgr -Item Matl Mgr SME -Acct -Legal -HR...concrete and brick walls, and light armored vehicles. Combat Proven in Afghanistan and Iraq “SMAW-D IS AN AWESOME WEAPON!” “MY ONLY REGRET IS THAT WE

  2. MONITORED GEOLOGIC REPOSITORY LIFE CYCLE COST ESTIMATE ASSUMPTIONS DOCUMENT

    International Nuclear Information System (INIS)

    R.E. Sweeney

    2001-01-01

    The purpose of this assumptions document is to provide general scope, strategy, technical basis, schedule and cost assumptions for the Monitored Geologic Repository (MGR) life cycle cost (LCC) estimate and schedule update incorporating information from the Viability Assessment (VA) , License Application Design Selection (LADS), 1999 Update to the Total System Life Cycle Cost (TSLCC) estimate and from other related and updated information. This document is intended to generally follow the assumptions outlined in the previous MGR cost estimates and as further prescribed by DOE guidance

  3. Monitored Geologic Repository Life Cycle Cost Estimate Assumptions Document

    International Nuclear Information System (INIS)

    Sweeney, R.

    2000-01-01

    The purpose of this assumptions document is to provide general scope, strategy, technical basis, schedule and cost assumptions for the Monitored Geologic Repository (MGR) life cycle cost estimate and schedule update incorporating information from the Viability Assessment (VA), License Application Design Selection (LADS), 1999 Update to the Total System Life Cycle Cost (TSLCC) estimate and from other related and updated information. This document is intended to generally follow the assumptions outlined in the previous MGR cost estimates and as further prescribed by DOE guidance

  4. ILK statement on the recommendations by the working group on procedures for the selection of repository sites; ILK-Stellungnahme zu den Empfehlungen des Arbeitskreises Auswahlverfahren Endlagerstandorte Internationale (AkEnd)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2003-11-01

    The Working Group on Procedures for the Selection of Repository Sites (AkEnd) had been appointed by the German Federal Ministry for the Environment (BMU) to develop procedures and criteria for the search for, and selection of, a repository site for all kinds of radioactive waste in deep geologic formations in Germany. ILK in principle welcomes the attempt on the part of AkEnd to develop a systematic procedure. On the other hand, ILK considers the two constraints imposed by BMU inappropriate: AkEnd was not to take into account the two existing sites of Konrad and Gorleben and, instead, work from a so-called white map of Germany. ILK recommends to perform a comprehensive safety analysis of Gorleben and define a selection procedure including the facts about Gorleben and, in addition, to commission the Konrad repository as soon as possible. The one-repository concept established as a precondition by BMU greatly restricts the selection procedure. There are no technical or scientific reasons for such concept. ILK recommends to plan for separate repositories, which would also correspond to international practice. The geoscientific criteria proposed by AkEnd should be examined and revised. With respect to the site selection procedure proposed, ILK feels that procedure is unable to define a targeted approach. Great importance must be attributed to public participation. The final site selection must be made under the responsibility of the government or the parliament. (orig.) [German] Der Arbeitskreis Auswahlverfahren Endlagerstandorte (AkEnd) hat Ende 2002 seine Empfehlungen vorgestellt. Der AkEnd war vom Bundesumweltministerium (BMU) berufen worden, um Verfahren und Kriterien fuer die Suche und die Auswahl eines Endlagerstandortes fuer alle Arten radioaktiver Abfaelle in tiefen geologischen Formationen in Deutschland zu entwickeln. Die ILK begruesst grundsaetzlich den Versuch des AkEnd, ein systematisches Verfahren zu entwickeln. Allerdings haelt die ILK die beiden vom BMU

  5. Health recommender systems: concepts, requirements, technical basics and challenges.

    Science.gov (United States)

    Wiesner, Martin; Pfeifer, Daniel

    2014-03-03

    During the last decades huge amounts of data have been collected in clinical databases representing patients' health states (e.g., as laboratory results, treatment plans, medical reports). Hence, digital information available for patient-oriented decision making has increased drastically but is often scattered across different sites. As as solution, personal health record systems (PHRS) are meant to centralize an individual's health data and to allow access for the owner as well as for authorized health professionals. Yet, expert-oriented language, complex interrelations of medical facts and information overload in general pose major obstacles for patients to understand their own record and to draw adequate conclusions. In this context, recommender systems may supply patients with additional laymen-friendly information helping to better comprehend their health status as represented by their record. However, such systems must be adapted to cope with the specific requirements in the health domain in order to deliver highly relevant information for patients. They are referred to as health recommender systems (HRS). In this article we give an introduction to health recommender systems and explain why they are a useful enhancement to PHR solutions. Basic concepts and scenarios are discussed and a first implementation is presented. In addition, we outline an evaluation approach for such a system, which is supported by medical experts. The construction of a test collection for case-related recommendations is described. Finally, challenges and open issues are discussed.

  6. Health Recommender Systems: Concepts, Requirements, Technical Basics and Challenges

    Directory of Open Access Journals (Sweden)

    Martin Wiesner

    2014-03-01

    Full Text Available During the last decades huge amounts of data have been collected in clinical databases representing patients’ health states (e.g., as laboratory results, treatment plans, medical reports. Hence, digital information available for patient-oriented decision making has increased drastically but is often scattered across different sites. As as solution, personal health record systems (PHRS are meant to centralize an individual’s health data and to allow access for the owner as well as for authorized health professionals. Yet, expert-oriented language, complex interrelations of medical facts and information overload in general pose major obstacles for patients to understand their own record and to draw adequate conclusions. In this context, recommender systems may supply patients with additional laymen-friendly information helping to better comprehend their health status as represented by their record. However, such systems must be adapted to cope with the specific requirements in the health domain in order to deliver highly relevant information for patients. They are referred to as health recommender systems (HRS. In this article we give an introduction to health recommender systems and explain why they are a useful enhancement to PHR solutions. Basic concepts and scenarios are discussed and a first implementation is presented. In addition, we outline an evaluation approach for such a system, which is supported by medical experts. The construction of a test collection for case-related recommendations is described. Finally, challenges and open issues are discussed.

  7. Web 2.0 Sites for Collaborative Self-Access: The Learning Advisor vs. Google®

    Directory of Open Access Journals (Sweden)

    Craig D. Howard

    2011-09-01

    Full Text Available While Web 2.0 technologies provide motivated, self-access learners with unprecedented opportunities for language learning, Web 2.0 designs are not of universally equal value for learning. This article reports on research carried out at Indiana University Bloomington using an empirical method to select websites for self-access language learning. Two questions related to Web 2.0 recommendations were asked: (1 How do recommended Web 2.0 sites rank in terms of interactivity features? (2 How likely is a learner to find highly interactive sites on their own? A list of 20 sites used for supplemental and self-access activities in language programs at five universities was compiled and provided the initial data set. Purposive sampling criteria revealed 10 sites truly represented Web 2.0 design. To address the first question, a feature analysis was applied (Herring, The international handbook of internet research. Berlin: Springer, 2008. An interactivity framework was developed from previous research to identify Web 2.0 design features, and sites were ranked according to feature quantity. The method used to address the second question was an interconnectivity analysis that measured direct and indirect interconnectivity within Google results. Highly interactive Web 2.0 sites were not prominent in Google search results, nor were they often linked via third party sites. It was determined that, using typical keywords or searching via blogs and recommendation sites, self-access learners were highly unlikely to find the most promising Web 2.0 sites for language learning. A discussion of the role of the learning advisor in guiding Web 2.0 collaborative self-access, as well as some strategic short cuts to quick analysis, conclude the article.

  8. Environmental assessment: Davis Canyon site, Utah

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EA. The Davis Canyon site is in the Paradox Basin, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains one other potentially acceptable site -- the Lavender Canyon site. Although the Lavender Canyon site is suitable for site characterization, the DOE has concluded that the Davis Canyon site is the preferred site in the Paradox Basin. On the basis of the evaluations reported in this EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. Furthermore, the DOE has fond that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Davis Canyon site as one of five sites suitable for characterization. 181 figs., 175 tabs

  9. Environmental assessment: Davis Canyon site, Utah

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high- level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EA. The Davis Canyon site is in the Paradox Basin, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains one other potentially acceptable site -- the Lavender Canyon site. Although the Lavender Canyon site is suitable for site characterization, the DOE has concluded that the Davis Canyon site is the preferred site in the Paradox Basin. On the basis of the evaluations reported in this EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. Furthermore, the DOE has found that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Davis Canyon site as one of the five sites suitable for characterization.

  10. Environmental assessment: Davis Canyon site, Utah

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EA. The Davis Canyon site is in the Paradox Basin, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains one other potentially acceptable site -- the Lavender Canyon site. Although the Lavender Canyon site is suitable for site characterization, the DOE has concluded that the Davis Canyon site is the preferred site in the Paradox Basin. On the basis of the evaluations reported in this EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. Furthermore, the DOE has fond that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Davis Canyon site as one of five sites suitable for characterization. 181 figs., 175 tabs.

  11. Environmental assessment: Davis Canyon site, Utah

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EA. The Davis Canyon site is in the Paradox Basin, which is one of five distinct geohydrologic settings considering for the first repository. This setting contains one other potentially acceptable site -- the Lavender Canyon site. Although the Lavender Canyon site is suitable for site characterization, the DOE has concluded that the Davis Canyon site is the preferred site in the Paradox Basin. On the basis of the evaluations reported in this EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. Furthermore, the DOE has found that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Davis Canyon site as one of five sites suitable for characterization.

  12. Environmental assessment: Davis Canyon site, Utah

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EA. The Davis Canyon site is in the Paradox Basin, which is one of five distinct geohydrologic settings considering for the first repository. This setting contains one other potentially acceptable site -- the Lavender Canyon site. Although the Lavender Canyon site is suitable for site characterization, the DOE has concluded that the Davis Canyon site is the preferred site in the Paradox Basin. On the basis of the evaluations reported in this EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. Furthermore, the DOE has found that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Davis Canyon site as one of five sites suitable for characterization

  13. Environmental assessment: Davis Canyon site, Utah

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high- level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EA. The Davis Canyon site is in the Paradox Basin, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains one other potentially acceptable site -- the Lavender Canyon site. Although the Lavender Canyon site is suitable for site characterization, the DOE has concluded that the Davis Canyon site is the preferred site in the Paradox Basin. On the basis of the evaluations reported in this EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. Furthermore, the DOE has found that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Davis Canyon site as one of the five sites suitable for characterization

  14. Recommendation in evolving online networks

    Science.gov (United States)

    Hu, Xiao; Zeng, An; Shang, Ming-Sheng

    2016-02-01

    Recommender system is an effective tool to find the most relevant information for online users. By analyzing the historical selection records of users, recommender system predicts the most likely future links in the user-item network and accordingly constructs a personalized recommendation list for each user. So far, the recommendation process is mostly investigated in static user-item networks. In this paper, we propose a model which allows us to examine the performance of the state-of-the-art recommendation algorithms in evolving networks. We find that the recommendation accuracy in general decreases with time if the evolution of the online network fully depends on the recommendation. Interestingly, some randomness in users' choice can significantly improve the long-term accuracy of the recommendation algorithm. When a hybrid recommendation algorithm is applied, we find that the optimal parameter gradually shifts towards the diversity-favoring recommendation algorithm, indicating that recommendation diversity is essential to keep a high long-term recommendation accuracy. Finally, we confirm our conclusions by studying the recommendation on networks with the real evolution data.

  15. Site Release Report for C-Well Pipeline, UE-25 Large Rocks Test Site, and 29 GSF Test Pits

    International Nuclear Information System (INIS)

    K.E. Rasmuson

    2002-01-01

    the reclaimed sites. Sixty percent of the reference area means for density, cover, and species richness were compared to the estimated means for the reclaimed sites. Plant density, cover, and species richness at the C-Well Pipeline and UE-25 Large Rocks test site were greater than the success criteria and all key attributes indicated the sites were in acceptable condition. Therefore, these two sites were recommended for release from further monitoring. Of the 29 ground surface facility test pits, 26 met the criterion for density, 21 for cover, and 23 for species richness. When key attributes and conditions of the plant community near each pit were taken into account, 27 of these pits were recommended for release. Success parameters and key attributes at ground surface facility test pits 19 and 20 were inadequate for site release. Transplants of native species were added to these two sites in 2001 to improve density, cover, and species richness

  16. Site Release Reports for C-Well Pipeline, UE-25 Large Rocks Test Site, and 29 GSF Test Pits

    Energy Technology Data Exchange (ETDEWEB)

    K.E. Rasmuson

    2002-04-02

    and aspect were chosen for comparison to the reclaimed sites. Sixty percent of the reference area means for density, cover, and species richness were compared to the estimated means for the reclaimed sites. Plant density, cover, and species richness at the C-Well Pipeline and UE-25 Large Rocks test site were greater than the success criteria and all key attributes indicated the sites were in acceptable condition. Therefore, these two sites were recommended for release from further monitoring. Of the 29 ground surface facility test pits, 26 met the criterion for density, 21 for cover, and 23 for species richness. When key attributes and conditions of the plant community near each pit were taken into account, 27 of these pits were recommended for release. Success parameters and key attributes at ground surface facility test pits 19 and 20 were inadequate for site release. Transplants of native species were added to these two sites in 2001 to improve density, cover, and species richness.

  17. Do highly cited clinicians get more citations when being present at social networking sites?

    Directory of Open Access Journals (Sweden)

    Fatemeh Ramezani-Pakpour-Langeroudi

    2018-01-01

    Conclusion: It seems putting the papers in social networking sites can influence the citation rate. We recommend all scientists to be present at social networking sites to have better chance of visibility and also citation.

  18. 77 FR 39561 - Recommendations from Airman Testing Standards and Training Aviation Rulemaking Committee (ARC)

    Science.gov (United States)

    2012-07-03

    ... site at: http://www.faa.gov/aircraft/draft_docs/arc . Issued in Washington, DC on June 12, 2012. Melvin... Standards and Training Aviation Rulemaking Committee (ARC) AGENCY: Federal Aviation Administration (FAA... report from the ARC, which presents recommendations to enhance the content, process, and methodology for...

  19. Recommendations and Justifications for Modifications for Use Restrictions Established under the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office Federal Facility Agreement and Consent Order, Revision 0

    International Nuclear Information System (INIS)

    Lynn Kidman

    2008-01-01

    This document is part of an effort to re-evaluate all FFACO URs against the current RBCA criteria (referred to in this document as the Industrial Sites [IS] RBCA process) as defined in the Industrial Sites Project Establishment of Final Action Levels (NNSA/NSO, 2006c). Based on this evaluation, the URs were sorted into the following categories: (1) Where sufficient information exists to determine that the current UR is consistent with the RCBA criteria; (2) Where sufficient information exists to determine that the current UR may be removed or downgraded based on RCBA criteria; (3) Where sufficient information does not exist to evaluate the current UR against the RCBA criteria. After reviewing all the existing FFACO URs, the 49 URs addressed in this document have sufficient information to determine that these current URs may be removed or downgraded based on RCBA criteria. This document presents recommendations on modifications to existing URs that will be consistent with the RCBA criteria

  20. Recommended Ventilation Strategies for Energy-Efficient Production Homes

    Energy Technology Data Exchange (ETDEWEB)

    Roberson, J.; Brown, R.; Koomey, J.; Warner, J.; Greenberg, S.

    1998-12-01

    This report evaluates residential ventilation systems for the U.S. Environmental Protection Agency's (EPA's) ENERGY STAR{reg_sign} Homes program and recommends mechanical ventilation strategies for new, low-infiltration, energy-efficient, single-family, ENERGY STAR production (site-built tract) homes in four climates: cold, mixed (cold and hot), hot humid, and hot arid. Our group in the Energy Analysis Department at Lawrence Berkeley National Lab compared residential ventilation strategies in four climates according to three criteria: total annualized costs (the sum of annualized capital cost and annual operating cost), predominant indoor pressure induced by the ventilation system, and distribution of ventilation air within the home. The mechanical ventilation systems modeled deliver 0.35 air changes per hour continuously, regardless of actual infiltration or occupant window-opening behavior. Based on the assumptions and analysis described in this report, we recommend independently ducted multi-port supply ventilation in all climates except cold because this strategy provides the safety and health benefits of positive indoor pressure as well as the ability to dehumidify and filter ventilation air. In cold climates, we recommend that multi-port supply ventilation be balanced by a single-port exhaust ventilation fan, and that builders offer balanced heat-recovery ventilation to buyers as an optional upgrade. For builders who continue to install forced-air integrated supply ventilation, we recommend ensuring ducts are airtight or in conditioned space, installing a control that automatically operates the forced-air fan 15-20 minutes during each hour that the fan does not operate for heating or cooling, and offering ICM forced-air fans to home buyers as an upgrade.

  1. Corrective Action Decision Document/Closure Report for Corrective Action Unit 567: Miscellaneous Soil Sites - Nevada National Security Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick [Navarro-Intera, LLC (N-I), Las Vegas, NV (United States)

    2014-12-01

    This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 567: Miscellaneous Soil Sites, Nevada National Security Site, Nevada. The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation that no further corrective action is needed for CAU 567 based on the implementation of the corrective actions. The corrective actions implemented at CAU 567 were developed based on an evaluation of analytical data from the CAI, the assumed presence of COCs at specific locations, and the detailed and comparative analysis of the CAAs. The CAAs were selected on technical merit focusing on performance, reliability, feasibility, safety, and cost. The implemented corrective actions meet all requirements for the technical components evaluated. The CAAs meet all applicable federal and state regulations for closure of the site. Based on the implementation of these corrective actions, the DOE, National Nuclear Security Administration Nevada Field Office provides the following recommendations: • No further corrective actions are necessary for CAU 567. • The Nevada Division of Environmental Protection issue a Notice of Completion to the DOE, National Nuclear Security Administration Nevada Field Office for closure of CAU 567. • CAU 567 be moved from Appendix III to Appendix IV of the FFACO.

  2. Recommender systems

    OpenAIRE

    Lu L.; Medo M.; Yeung C.H.; Zhang Y.-C.; Zhang Z.-K.; Zhou T.

    2012-01-01

    The ongoing rapid expansion of the Internet greatly increases the necessity of effective recommender systems for filtering the abundant information. Extensive research for recommender systems is conducted by a broad range of communities including social and computer scientists, physicists, and interdisciplinary researchers. Despite substantial theoretical and practical achievements, unification and comparison of different approaches are lacking, which impedes further advances. In this article...

  3. Phosphorus Response and Fertilizer Recommendations for Wheat Grown on Nitisols in the Central Ethiopian Highlands

    NARCIS (Netherlands)

    Agegnehu, Getachew; Nelson, Paul N.; Bird, Michael I.; Beek, van Christy

    2015-01-01

    The provision of farmers with proper and balanced fertilizer recommendations is becoming increasingly important, for reasons of crop productivity, food security, and sustainability. Phosphorus (P) response trials with wheat were conducted on Nitisols at 14 sites in the central Ethiopian highlands

  4. Trust for intelligent recommendation

    CERN Document Server

    Bhuiyan, Touhid

    2013-01-01

    Recommender systems are one of the recent inventions to deal with the ever-growing information overload in relation to the selection of goods and services in a global economy. Collaborative Filtering (CF) is one of the most popular techniques in recommender systems. The CF recommends items to a target user based on the preferences of a set of similar users known as the neighbors, generated from a database made up of the preferences of past users. In the absence of these ratings, trust between the users could be used to choose the neighbor for recommendation making. Better recommendations can b

  5. Development of a laboratory niche Web site.

    Science.gov (United States)

    Dimenstein, Izak B; Dimenstein, Simon I

    2013-10-01

    This technical note presents the development of a methodological laboratory niche Web site. The "Grossing Technology in Surgical Pathology" (www.grossing-technology.com) Web site is used as an example. Although common steps in creation of most Web sites are followed, there are particular requirements for structuring the template's menu on methodological laboratory Web sites. The "nested doll principle," in which one object is placed inside another, most adequately describes the methodological approach to laboratory Web site design. Fragmentation in presenting the Web site's material highlights the discrete parts of the laboratory procedure. An optimally minimal triad of components can be recommended for the creation of a laboratory niche Web site: a main set of media, a blog, and an ancillary component (host, contact, and links). The inclusion of a blog makes the Web site a dynamic forum for professional communication. By forming links and portals, cloud computing opens opportunities for connecting a niche Web site with other Web sites and professional organizations. As an additional source of information exchange, methodological laboratory niche Web sites are destined to parallel both traditional and new forms, such as books, journals, seminars, webinars, and internal educational materials. Copyright © 2013 Elsevier Inc. All rights reserved.

  6. Stranded Fuel, Orphan Sites, Dead Plants: Transportation Planning Considerations After the BRC Report - 13393

    Energy Technology Data Exchange (ETDEWEB)

    Thrower, Alex W. [The Thrower Group LLC, Richmond, VA (United States)

    2013-07-01

    The author explores transportation, packaging and storage questions related to a primary recommendation of the Blue Ribbon Commission on America's Nuclear Future; i.e., that fuel from shutdown plants be removed to consolidated storage as soon as possible to enable final decommissioning and beneficial re-use of those sites. The paper discusses the recommendations of the BRC, the implications and challenges that implementing those recommendations present, and provides recommended solutions for beginning the multi-year planning, coordination, material acquisition, and communications processes that will be needed to move fuel from shutdown plants when a destination site becomes available. Removal of used nuclear fuel from shutdown reactor sites (which are serving no other purpose other than storing SNF and GTCC, at considerable expense) was a central recommendation of the BRC, for a number of reasons. This recommendation was one of the most widely acclaimed that the Commission put forward. However, there are significant challenges (such as availability of fuel canister overpacks, lack of infrastructure, handling constraints and others) that will need to be addressed, apart from the critically important identification of a suitable and workable storage destination site. Resolving these logistical challenges will need to begin even before a destination site is identified, given the long lead-times required for planning and procurement. Based on information available today, it is possible to make informed predictions about what will be needed to modify existing contractual arrangements with utilities, address equipment and infrastructure needs, and begin working with states, tribes and local governments to start initial preparation needs. If DOE, working with industry and other experienced parties, can begin planning and acquisition activities in the near term, overall schedule risk can be reduced and potential cost avoidance achieved. The most immediate benefit will

  7. Stranded Fuel, Orphan Sites, Dead Plants: Transportation Planning Considerations After the BRC Report - 13393

    International Nuclear Information System (INIS)

    Thrower, Alex W.

    2013-01-01

    The author explores transportation, packaging and storage questions related to a primary recommendation of the Blue Ribbon Commission on America's Nuclear Future; i.e., that fuel from shutdown plants be removed to consolidated storage as soon as possible to enable final decommissioning and beneficial re-use of those sites. The paper discusses the recommendations of the BRC, the implications and challenges that implementing those recommendations present, and provides recommended solutions for beginning the multi-year planning, coordination, material acquisition, and communications processes that will be needed to move fuel from shutdown plants when a destination site becomes available. Removal of used nuclear fuel from shutdown reactor sites (which are serving no other purpose other than storing SNF and GTCC, at considerable expense) was a central recommendation of the BRC, for a number of reasons. This recommendation was one of the most widely acclaimed that the Commission put forward. However, there are significant challenges (such as availability of fuel canister overpacks, lack of infrastructure, handling constraints and others) that will need to be addressed, apart from the critically important identification of a suitable and workable storage destination site. Resolving these logistical challenges will need to begin even before a destination site is identified, given the long lead-times required for planning and procurement. Based on information available today, it is possible to make informed predictions about what will be needed to modify existing contractual arrangements with utilities, address equipment and infrastructure needs, and begin working with states, tribes and local governments to start initial preparation needs. If DOE, working with industry and other experienced parties, can begin planning and acquisition activities in the near term, overall schedule risk can be reduced and potential cost avoidance achieved. The most immediate benefit will

  8. A Sentiment-Enhanced Hybrid Recommender System for Movie Recommendation: A Big Data Analytics Framework

    Directory of Open Access Journals (Sweden)

    Yibo Wang

    2018-01-01

    Full Text Available Movie recommendation in mobile environment is critically important for mobile users. It carries out comprehensive aggregation of user’s preferences, reviews, and emotions to help them find suitable movies conveniently. However, it requires both accuracy and timeliness. In this paper, a movie recommendation framework based on a hybrid recommendation model and sentiment analysis on Spark platform is proposed to improve the accuracy and timeliness of mobile movie recommender system. In the proposed approach, we first use a hybrid recommendation method to generate a preliminary recommendation list. Then sentiment analysis is employed to optimize the list. Finally, the hybrid recommender system with sentiment analysis is implemented on Spark platform. The hybrid recommendation model with sentiment analysis outperforms the traditional models in terms of various evaluation criteria. Our proposed method makes it convenient and fast for users to obtain useful movie suggestions.

  9. Criticality codes migration to workstations at the Hanford site

    International Nuclear Information System (INIS)

    Miller, E.M.

    1993-01-01

    Westinghouse Hanford Company, Hanford Site Operations contractor, Richland, Washington, currently runs criticality codes on the Cray X-MP EA/232 computer but has recommended that US Department of Energy DOE-Richland replace the Cray with more economical workstations

  10. Code on the safety of nuclear power plants: Siting

    International Nuclear Information System (INIS)

    1988-01-01

    This Code provides criteria and procedures that are recommended for safety in nuclear power plant siting. It forms part of the Agency's programme for establishing Codes and Safety Guides relating to land based stationary thermal neutron power plants

  11. Reevaluation of air surveillance station siting

    International Nuclear Information System (INIS)

    Abbott, K.; Jannik, T.

    2016-01-01

    DOE Technical Standard HDBK-1216-2015 (DOE 2015) recommends evaluating air-monitoring station placement using the analytical method developed by Waite. The technique utilizes wind rose and population distribution data in order to determine a weighting factor for each directional sector surrounding a nuclear facility. Based on the available resources (number of stations) and a scaling factor, this weighting factor is used to determine the number of stations recommended to be placed in each sector considered. An assessment utilizing this method was performed in 2003 to evaluate the effectiveness of the existing SRS air-monitoring program. The resulting recommended distribution of air-monitoring stations was then compared to that of the existing site perimeter surveillance program. The assessment demonstrated that the distribution of air-monitoring stations at the time generally agreed with the results obtained using the Waite method; however, at the time new stations were established in Barnwell and in Williston in order to meet requirements of DOE guidance document EH-0173T.

  12. Reevaluation of air surveillance station siting

    Energy Technology Data Exchange (ETDEWEB)

    Abbott, K. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jannik, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-07-06

    DOE Technical Standard HDBK-1216-2015 (DOE 2015) recommends evaluating air-monitoring station placement using the analytical method developed by Waite. The technique utilizes wind rose and population distribution data in order to determine a weighting factor for each directional sector surrounding a nuclear facility. Based on the available resources (number of stations) and a scaling factor, this weighting factor is used to determine the number of stations recommended to be placed in each sector considered. An assessment utilizing this method was performed in 2003 to evaluate the effectiveness of the existing SRS air-monitoring program. The resulting recommended distribution of air-monitoring stations was then compared to that of the existing site perimeter surveillance program. The assessment demonstrated that the distribution of air-monitoring stations at the time generally agreed with the results obtained using the Waite method; however, at the time new stations were established in Barnwell and in Williston in order to meet requirements of DOE guidance document EH-0173T.

  13. NCBO Ontology Recommender 2.0: an enhanced approach for biomedical ontology recommendation.

    Science.gov (United States)

    Martínez-Romero, Marcos; Jonquet, Clement; O'Connor, Martin J; Graybeal, John; Pazos, Alejandro; Musen, Mark A

    2017-06-07

    Ontologies and controlled terminologies have become increasingly important in biomedical research. Researchers use ontologies to annotate their data with ontology terms, enabling better data integration and interoperability across disparate datasets. However, the number, variety and complexity of current biomedical ontologies make it cumbersome for researchers to determine which ones to reuse for their specific needs. To overcome this problem, in 2010 the National Center for Biomedical Ontology (NCBO) released the Ontology Recommender, which is a service that receives a biomedical text corpus or a list of keywords and suggests ontologies appropriate for referencing the indicated terms. We developed a new version of the NCBO Ontology Recommender. Called Ontology Recommender 2.0, it uses a novel recommendation approach that evaluates the relevance of an ontology to biomedical text data according to four different criteria: (1) the extent to which the ontology covers the input data; (2) the acceptance of the ontology in the biomedical community; (3) the level of detail of the ontology classes that cover the input data; and (4) the specialization of the ontology to the domain of the input data. Our evaluation shows that the enhanced recommender provides higher quality suggestions than the original approach, providing better coverage of the input data, more detailed information about their concepts, increased specialization for the domain of the input data, and greater acceptance and use in the community. In addition, it provides users with more explanatory information, along with suggestions of not only individual ontologies but also groups of ontologies to use together. It also can be customized to fit the needs of different ontology recommendation scenarios. Ontology Recommender 2.0 suggests relevant ontologies for annotating biomedical text data. It combines the strengths of its predecessor with a range of adjustments and new features that improve its reliability

  14. Recommendations for computer modeling codes to support the UMTRA groundwater restoration project

    Energy Technology Data Exchange (ETDEWEB)

    Tucker, M.D. [Sandia National Labs., Albuquerque, NM (United States); Khan, M.A. [IT Corp., Albuquerque, NM (United States)

    1996-04-01

    The Uranium Mill Tailings Remediation Action (UMTRA) Project is responsible for the assessment and remedial action at the 24 former uranium mill tailings sites located in the US. The surface restoration phase, which includes containment and stabilization of the abandoned uranium mill tailings piles, has a specific termination date and is nearing completion. Therefore, attention has now turned to the groundwater restoration phase, which began in 1991. Regulated constituents in groundwater whose concentrations or activities exceed maximum contaminant levels (MCLs) or background levels at one or more sites include, but are not limited to, uranium, selenium, arsenic, molybdenum, nitrate, gross alpha, radium-226 and radium-228. The purpose of this report is to recommend computer codes that can be used to assist the UMTRA groundwater restoration effort. The report includes a survey of applicable codes in each of the following areas: (1) groundwater flow and contaminant transport modeling codes, (2) hydrogeochemical modeling codes, (3) pump and treat optimization codes, and (4) decision support tools. Following the survey of the applicable codes, specific codes that can best meet the needs of the UMTRA groundwater restoration program in each of the four areas are recommended.

  15. Recommendations for computer modeling codes to support the UMTRA groundwater restoration project

    International Nuclear Information System (INIS)

    Tucker, M.D.; Khan, M.A.

    1996-04-01

    The Uranium Mill Tailings Remediation Action (UMTRA) Project is responsible for the assessment and remedial action at the 24 former uranium mill tailings sites located in the US. The surface restoration phase, which includes containment and stabilization of the abandoned uranium mill tailings piles, has a specific termination date and is nearing completion. Therefore, attention has now turned to the groundwater restoration phase, which began in 1991. Regulated constituents in groundwater whose concentrations or activities exceed maximum contaminant levels (MCLs) or background levels at one or more sites include, but are not limited to, uranium, selenium, arsenic, molybdenum, nitrate, gross alpha, radium-226 and radium-228. The purpose of this report is to recommend computer codes that can be used to assist the UMTRA groundwater restoration effort. The report includes a survey of applicable codes in each of the following areas: (1) groundwater flow and contaminant transport modeling codes, (2) hydrogeochemical modeling codes, (3) pump and treat optimization codes, and (4) decision support tools. Following the survey of the applicable codes, specific codes that can best meet the needs of the UMTRA groundwater restoration program in each of the four areas are recommended

  16. Future offshore sites for wind turbines - 2025; Denmark; Fremtidens havmoelleplaceringer - 2025

    Energy Technology Data Exchange (ETDEWEB)

    2007-04-15

    The committee has analysed 23 concrete siting possibilities at 7 main areas. The committee recommends that any extension of ocean wind farms is decided according to cost priorities. The selected sites for establishing offshore wind farms are: Djursland-Anholt in Kattegat, Horns Rev, Jammerbugten and off Ringkoebing in the North Sea, Store Middelgrund in Kattegat, and Kriegers Flak and Roenne Banke in the Baltic Sea. Wind data and power potential are presented for each of the selected sites. (ln)

  17. Formation of Marketing Activity on Organisation and Support of a Corporate Site of Companies That Operate in the Consumer Market

    Directory of Open Access Journals (Sweden)

    Yarym-Agayev Oleksandr M.

    2014-03-01

    Full Text Available The article considers main issues of organisation of Internet marketing at small and medium enterprises of Ukraine, shows a necessity of development and marketing support of the site and provides recommendations on development, implementation and maintenance of corporate sites for marketing and advertising managers. The article considers such directions of operation with the site as analysis of sites of competitors, development of a corporate site, information provision of the site, site indexation and its promotion in search engines, placing site links at information portals, creation of pages in social networks, work at forums, information mailings, operation with site analytics and ensuring feedback with the site visitors. The listed recommendations would allow increase the site image, attract new clients, organise efficient co-operation with specialists on development and promotion of the site and achieve the maximal effect from this source of advertisement and sales.

  18. Air quality measurements for site characterization

    International Nuclear Information System (INIS)

    Carter, M.W.; Conklin, W.C.

    1982-01-01

    Effective and timely site characterization is an important part of selecting a site for low-level waste disposal. Parameters measured can be compared with pertinent regulatory requirements, used for a reference base, helpful in evaluating environmental impacts, utilized in documenting changes in control programs, of value in modeling studies and other data uses, and beneficial in providing relevant sampling and methodology training. This paper will focus on specific air quality measurements which should be an inherent part of the site characterization program. The program is designed to measure, quantify, and identify contributions from site uses (operational procedures), atmospheric fallout, natural radioactivity, and vicinity and regional applications of radionuclides. The recommended air quality measurements program will be described in association with a reference site developd by the US Nuclear Regulatory Commission. Particular attention will be devoted to the type and quality of information which is needed, the scope of sampling and measurements, the frequency of measurements, locations and numbers of sampling stations, the period of time needed for site characterization, and the proper uses of the information once it has been obtained. Adequate characterization of the site will be most important in final site selection and in the operation of the site as to periodically assessing environmental impacts and helping guide any remedial control efforts designed to meet regulatory requirements

  19. SITE-94. Mineralogy of the Aespoe site

    International Nuclear Information System (INIS)

    Andersson, Karin

    1996-12-01

    The water composition has several impacts on the repository. It will influence the behaviour of the engineered materials (e.g. corrosion). It may also determine the possible solubility and speciation of released radionuclides. It also acts as a transport medium for the released elements. The groundwater composition and the potential development of the composition due to the presence of the repository as well as due to external variations is thus an important issue in a safety analysis. The development of the groundwater composition is strongly dependent on reactions with the minerals present in water bearing fractures. Here equilibrium chemistry may be of importance, but also reaction kinetics is important to the long-term behaviour. Within the SITE-94 project, a safety analysis is performed for the conditions at the Aespoe site. The mineralogy of the area has been evaluated from drill cores at various places at the site. In this report a recommendation for selection of mineralogy to be used in geochemical modelling of the repository is given. Calcite and iron containing minerals dominate the fracture filling mineralogy at the Aespoe site. Some typical fracture filling mineralogies may be identified in the fractures: epidote, chlorite, calcite, hematite, some illite/smectite + quartz, fluorite, pyrite and goethite. In addition to these a number of minor minerals are found in the fractures. Uncertainties in the fracture filling data may be due to problems when taking out the drill cores. Drilling water may remove important clay minerals and sealed fractures may be reopened mechanically and treated as water conducting fractures. The problem of determining the variability of the mineralogy along the flow paths also remains. This problem will never be solved when the investigation is performed by drilling investigation holes

  20. Draft environmental assessment: Richton Dome site, Mississippi. Nuclear Waste Policy Act (Section 112)

    International Nuclear Information System (INIS)

    1984-12-01

    In February 1983, the US Department of Energy identified the Richton dome site as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Richton dome site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for Nuclear Waste Repositories. These evaluations are reported in this draft (EA), which is being issued for public review and comment. The DOE findings and determinations that are based on these evaluations are preliminary and subject to public review and comment. A final EA will be prepared after considering the comments received. On the basis of the evaluations reported in this draft EA, the DOE has found that the Richton dome site is not disqualified under the guidelines. The site is in the Gulf Interior Region of the Gulf Coastal Plain. This setting contains two other potentially acceptable sites - the Cypress Creek dome site and the Vacherie dome site. Although these other two sites appear to be suitable for site characterization, the DOE has concluded that the Richton dome site is the preferred site in the Gulf Interior Region. Furthermore, the DOE finds that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is proposing to nominate the Richton dome site as one of five sites suitable for characterization. Having compared the Richton dome site with the other four sites proposed for nomination, the DOE has determined that the Richton dome site is not one of the three preferred sites for recommendation to the President as candidates for characterization

  1. Draft environmental assessment: Davis Canyon site, Utah. Nuclear Waste Policy Act (Section 112)

    International Nuclear Information System (INIS)

    1984-12-01

    In February 1983, the US Department of Energy (DOE) identified the Davis Canyon site in Utah, as one of nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. To determine their suitability, the Davis Canyon site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for Nuclear Waste Repositories. These evaluations are reported in this draft environmental assessment (EA), which is being issued for public review and comment. The DOE findings and determinations that are based on these evaluations are preliminary and subject to public review and comment. A final EA will be prepared after considering the comments received. On the basis of the evaluations reported in this draft EA, the DOE has found that the Davis Canyon site is not disqualified under the guidelines. The site is in the Paradox Basin, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains one other potentially acceptable site - the Lavender Canyon site. Although the Lavender Canyon site appears to be suitable for site characterization, the DOE has concluded that the Davis Canyon site is the preferred site in the Paradox Basin. Furthermore, the DOE finds that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is proposing to nominate the Davis Canyon site as one of five sites suitable for characterization. Having compared the Davis Canyon site with the other four sites proposed for nomination, the DOE has determined that the Davis Canyon site is not one of the three preferred sites for recommendation to the President as candidates for characterization

  2. The Use Of Social Networking Sites For Learning In Institutions Of Higher Learning

    Directory of Open Access Journals (Sweden)

    Mange Gladys Nkatha

    2015-08-01

    Full Text Available Abstract Institutions of higher learning are facing greater challenges to change and subjected to various transformations in the surrounding environment including technology. These challenge and motivate them to explore new ways to improve their teaching approaches. This study sought to investigate the use of social networking site in institutions of higher learning. To this end two objectives were formulated 1 to investigate the current state of the use of social networking sites by the students 2 investigate how social networking sites can be used to promote authentic learning in institutions of higher learning. The study adopted exploratory approach using descriptive survey design where a sample of 10 67 students were picked from Jomo Kenyatta University of Agriculture and Technology JKUAT main campus. The findings indicate the use of social networking sites is a viable option as the students are not only members of social networking sites but also that majority have access to the requisite technological devices. Additionally recommendations for ensuring authentic learning were presented. The researcher recommends the exploration of the leveraging of the existing social networking sites for learning in conjunction with key stakeholders.

  3. Recommender systems and the social web leveraging tagging data for recommender systems

    CERN Document Server

    Gedikli, Fatih

    2013-01-01

    There is an increasing demand for recommender systems due to the information overload users are facing on the Web. The goal of a recommender system is to provide personalized recommendations of products or services to users. With the advent of the Social Web, user-generated content has enriched the social dimension of the Web. As user-provided content data also tells us something about the user, one can learn the user's individual preferences from the Social Web. This opens up completely new opportunities and challenges for recommender systems research. Fatih Gedikli deals with the question of

  4. Hanford waste-form release and sediment interaction: A status report with rationale and recommendations for additional studies

    International Nuclear Information System (INIS)

    Serne, R.J.; Wood, M.I.

    1990-05-01

    This report documents the currently available geochemical data base for release and retardation for actual Hanford Site materials (wastes and/or sediments). The report also recommends specific laboratory tests and presents the rationale for the recommendations. The purpose of this document is threefold: to summarize currently available information, to provide a strategy for generating additional data, and to provide recommendations on specific data collection methods and tests matrices. This report outlines a data collection approach that relies on feedback from performance analyses to ascertain when adequate data have been collected. The data collection scheme emphasizes laboratory testing based on empiricism. 196 refs., 4 figs., 36 tabs

  5. Natural phenomena analyses, Hanford Site, Washington

    International Nuclear Information System (INIS)

    Tallman, A.M.

    1989-01-01

    Probabilistic seismic hazard studies completed for the Washington Public Power Supply System's Nuclear Plant 2 and for the US Department of Energy's N Reactor sites, both on the Hanford Site, suggested that the Lawrence Livermore National Laboratory seismic exposure estimates were lower than appropriate, especially for sites near potential seismic sources. A probabilistic seismic hazard assessment was completed for those areas that contain process and/or waste management facilities. the lower bound magnitude of 5.0 is used in the hazard analysis and the characteristics of small-magnitude earthquakes relatively common to the Hanford Site are addressed. The recommended ground motion for high-hazard facilities is somewhat higher than the Lawrence Livermore National Laboratory model and the ground motion from small-magnitude earthquakes is addressed separately from the moderate- to large-magnitude earthquake ground motion. The severe wind and tornado hazards determined for the Hanford Siste are in agreement with work completed independently using 43 years of site data. The low-probability, high-hazard, design-basis flood at the Hanford Site is dominated by dam failure on the Columbia River. Further evaluation of the mechanisms and probabilities of such flooding is in progress. The Hanford Site is downwind from several active Cascade volcanoes. Geologic and historical data are used to estimate the ashfall hazard

  6. Recommender systems in knowledge-mining

    Science.gov (United States)

    Volna, Eva

    2017-07-01

    The subject of the paper is to analyse the possibilities of application of recommender systems in the field of data mining. The work focuses on three basic types of recommender systems (collaborative, content-based and hybrid). The goal of the article is to evaluate which of these three concepts of recommender systems provides forecast with the lowest error rate in the domain of recommending movies. This target is fulfilled by the practical part of the work - at first, the own recommender system was designed and created, capable of obtaining movies recommendation from the database based on the user's preferences. Next, we verified experimentally which recommender system produces more accurate results.

  7. Radon in an underground excavation site in Helsinki

    International Nuclear Information System (INIS)

    Venelampi, E.

    2004-01-01

    The paper reports on radon measurements and actions taken in a large underground excavation site in Helsinki, where a coal store was excavated underneath an existing power plant. The measurements were carried out by taking grab samples using Lucas type scintillation cells. Large variations in radon concentrations were observed during the three-year study. The reasons for variations are discussed and recommendations are given for radon monitoring procedures in underground excavation sites. The importance of ventilation to reduce the radon level is stressed. (P.A.)

  8. Radioligands for PET studies of central benzodiazepine receptors and PK (peripheral benzodiazepine) binding sites -current status

    International Nuclear Information System (INIS)

    Pike, V.W.; Osman, S.; Shah, F.; Turton, D.R.; Waters, S.L.; Crouzel, C.; Nutt, D.J.

    1993-01-01

    The status of the radiochemical development and biological evaluation of radioligands for PET studies of central benzodiazepine (BZ) receptors and the so-called peripheral benzodiazepine binding sites, here discriminated and referred to as PK binding sites, is reviewed against current pharmacological knowledge, indicating those agents with present value and those with future potential. Practical recommendations are given for the preparation of two useful radioligands for PET studies, [N-methyl- 11 C]flumazenil for central BZ receptors, and [N-methyl- 11 C]PK 11195 for PK binding sites. Quality assurance and plasma metabolite analysis are also reviewed for these radioligands and practical recommendations are given on methodology for their performance. (Author)

  9. Semantically Enhanced Recommender Systems

    Science.gov (United States)

    Ruiz-Montiel, Manuela; Aldana-Montes, José F.

    Recommender Systems have become a significant area in the context of web personalization, given the large amount of available data. Ontologies can be widely taken advantage of in recommender systems, since they provide a means of classifying and discovering of new information about the items to recommend, about user profiles and even about their context. We have developed a semantically enhanced recommender system based on this kind of ontologies. In this paper we present a description of the proposed system.

  10. Towards Information Enrichment through Recommendation Sharing

    Science.gov (United States)

    Weng, Li-Tung; Xu, Yue; Li, Yuefeng; Nayak, Richi

    Nowadays most existing recommender systems operate in a single organisational basis, i.e. a recommender system recommends items to customers of one organisation based on the organisation's datasets only. Very often the datasets of a single organisation do not have sufficient resources to be used to generate quality recommendations. Therefore, it would be beneficial if recommender systems of different organisations with similar nature can cooperate together to share their resources and recommendations. In this chapter, we present an Ecommerce-oriented Distributed Recommender System (EDRS) that consists of multiple recommender systems from different organisations. By sharing resources and recommendations with each other, these recommenders in the distributed recommendation system can provide better recommendation service to their users. As for most of the distributed systems, peer selection is often an important aspect. This chapter also presents a recommender selection technique for the proposed EDRS, and it selects and profiles recommenders based on their stability, average performance and selection frequency. Based on our experiments, it is shown that recommenders' recommendation quality can be effectively improved by adopting the proposed EDRS and the associated peer selection technique.

  11. Use of compensation and incentives in siting low-level radioactive waste disposal facilities

    International Nuclear Information System (INIS)

    Smith, T.P.; Jaffe, M.

    1984-09-01

    In discussing the use of compensation and incentives in siting low-level radioactive waste disposal facilities, chapters are devoted to: compensation and incentives in disposal facility siting (definitions and effects of compensation and incentives and siting decisions involving the use of compensation and incentives); the impacts of regional and state low-level radioactive waste facilities; the legal framework of compensation; and recommendations regarding the use of compensation

  12. Enhancement of on-site emergency diesel generator reliability

    International Nuclear Information System (INIS)

    Boner, G.L.; Hanners, H.W.

    1979-01-01

    The University of Dayton Research Institute has concluded a program designed to provide NRC/DOR with technical assistance in evaluating the factors leading to improved reliability of on-site emergency diesel generator (DG) units. The program consisted of a comprehensive review of DG maintenance and operating experience and a comparative evaluation of the DG manufacturer's recommendations. This information, will enable the NRC to improve the basis on which it makes regulatory decisions. The primary goal of the program is to better identify the main problem areas which decrease the reliability of the DG units and make recommendations. The report has attained the program objectives by identifying and discussing the more significant problems and presenting the recommended corrective actions. The identified problems have been categorized into three groups as a function of their significance

  13. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act

    International Nuclear Information System (INIS)

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended by the Secretary of Energy and approved by the President for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared by the US Department of Energy (DOE) in accordance with the requirements of the Nulcear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of the site characterization plan are oulined, and compliance with applicable regulations is discussed

  14. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended by the Secretary of Energy and approved by the President for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared by the US Department of Energy (DOE) in accordance with the requirements of the Nulcear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of the site characterization plan are oulined, and compliance with applicable regulations is discussed.

  15. Membrane-Associated Effects of Glucocorticoid on BACE1 Upregulation and Aβ Generation: Involvement of Lipid Raft-Mediated CREB Activation.

    Science.gov (United States)

    Choi, Gee Euhn; Lee, Sei-Jung; Lee, Hyun Jik; Ko, So Hee; Chae, Chang Woo; Han, Ho Jae

    2017-08-30

    Glucocorticoid has been widely accepted to induce Alzheimer's disease, but the nongenomic effect of glucocorticoid on amyloid β (Aβ) generation has yet to be studied. Here, we investigated the effect of the nongenomic pathway induced by glucocorticoid on amyloid precursor protein processing enzymes as well as Aβ production using male ICR mice and human neuroblastoma SK-N-MC cells. Mice groups exposed to restraint stress or intracerebroventricular injection of Aβ showed impaired cognition, decreased intracellular glucocorticoid receptor (GR) level, but elevated level of membrane GR (mGR). In this respect, we identified the mGR-dependent pathway evoked by glucocorticoid using impermeable cortisol conjugated to BSA (cortisol-BSA) on SK-N-MC cells. Cortisol-BSA augmented the expression of β-site amyloid precursor protein cleaving enzyme 1 (BACE1), the level of C-terminal fragment β of amyloid precursor protein (C99) and Aβ production, which were maintained even after blocking intracellular GR. We also found that cortisol-BSA enhanced the interaction between mGR and Gαs, which colocalized in the lipid raft. The subsequently activated CREB by cortisol-BSA bound to the CRE site of the BACE1 promoter increasing its expression, which was downregulated by inhibiting CBP. Consistently, blocking CBP attenuated cognitive impairment and Aβ production induced by corticosterone treatment or intracerebroventricular injection of Aβ more efficiently than inhibiting intracellular GR in mice. In conclusion, glucocorticoid couples mGR with Gαs and triggers cAMP-PKA-CREB axis dependent on the lipid raft to stimulate BACE1 upregulation and Aβ generation. SIGNIFICANCE STATEMENT Patients with Alzheimer's disease (AD) have been growing sharply and stress is considered as the major environment factor of AD. Glucocorticoid is the primarily responsive factor to stress and is widely known to induce AD. However, most AD patients usually have impaired genomic pathway of glucocorticoid

  16. Site suitability to tourist use or management programs South Marsa Alam, Red Sea, Egypt

    Directory of Open Access Journals (Sweden)

    AMRO ABD-ELHAMID ABD-ELGAWAD

    2011-01-01

    Full Text Available Ammar MSA, Hassanein M, Madkour HA, Abd-Elgawad AE. 2011. Site suitability to tourist use or management programs South Marsa Alam, Red Sea, Egypt. Nusantara Bioscience 3: 36-43. Twenty sites in the southern Egyptian Red Sea (Marsa Alam-Ras Banas sector were surveyed principally for sensitivity significance throughout the periode 2002-2003. Sensitivity of the study area was derived from internationally known criteria, the key words of each criterion and a brief description of its use was described. The present study assigned for the first time a numerical total environmental significance score that gives a full sensitivity significance evaluation for any site to decide to select either for tourist use or management purposes. However, the results of the study still have the availability to arrange sites with respect to one criterion or only two or many of the used criteria whichever needed. Sites selected for protection are categorized as belonging to the following protected area categories: sites 7, 10 (category vi, site 18 (category ib, site 5 (category iv, sites 16, 17 (category ii. Sites selected for tourist uses are suggested to be classified into 2 categories: first category sites (sites 1, 3, 8, 11, 13, 15 which are recommended as tourist use sites with management of the sensitive resources beside non consumptive recreational activities like swimming, diving, boating, surfing, wind-surfing, jet skiing, bird watching, snorkelling, etc.; second category sites (sites 2, 4, 6, 9, 12, 14, 19, 20 which are recommended as tourist use sites with both non consumptive and managed consumptive recreational activities like fishing.

  17. Preliminary Site Characterization Report, Rulsion Site, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-08-01

    This report is a summary of environmental information gathered during a review of the documents pertaining to Project Rulison and interviews with personnel who worked on the project. Project Rulison was part of Operation Plowshare (a program designed to explore peaceful uses for nuclear devices). The project consisted of detonating a 43-kiloton nuclear device on September 10, 1969, in western Colorado to stimulate natural gas production. Following the detonation, a reentry well was drilled and several gas production tests were conducted. The reentry well was shut-in after the last gas production test and was held in standby condition until the general cleanup was undertaken in 1972. A final cleanup was conducted after the emplacement and testing wells were plugged in 1976. However, some surface radiologic contamination resulted from decontamination of the drilling equipment and fallout from the gas flaring during drilling operations. With the exception of the drilling effluent pond, all surface contamination at the Rulison Site was removed during the cleanup operations. All mudpits and other excavations were backfilled, and both upper and lower drilling pads were leveled and dressed. This report provides information regarding known or suspected areas of contamination, previous cleanup activities, analytical results, a review of the regulatory status, the site`s physical environment, and future recommendations for Project Ruhson. Based on this research, several potential areas of contamination have been identified. These include the drilling effluent pond and mudpits used during drilling operations. In addition, contamination could migrate in the gas horizon.

  18. Application of NUSS siting guidelines for nuclear power plants in India

    International Nuclear Information System (INIS)

    Soman, S.D.; Sarma, T.P.

    1985-01-01

    The nuclear power profile in India envisages generation of 10,000 MW(e) by the year 2000. In the selection of sites for this purpose, safety considerations based on the NUSS siting code were developed, keeping in mind the conditions existing in the country. The paper reviews the similarity of approach between NUSS documents on siting and guidelines being adopted in India, given different site characteristics such as population distribution, seismicity, flooding and external man-induced events. However, in a few aspects, difficulties were experienced in adopting NUSS requirements in toto. This was primarily because of differences in the national systems, lack of instrumentally recorded data, and an inadequate scientific investigational base in fields such as seismology and hydrology. This paper discusses two such examples and how the difficulties have been overcome in arriving at guidelines which would be in the same spirit as the siting recommendations of the NUSS programme. The first example relates to identification of capable fault and the second concerns the flooding arising out of failure of upstream dams. In addition, the inadequacy and inappropriateness of some of the models given in the NUSS siting guides are also discussed. The paper also considers the current status of accident evaluation of PHWR (235 MW(e)) units being built in the country. In the light of this evaluation, the siting criteria and the emergency measures planned at the sites are reviewed for their compatibility. The emergency measures planned take full cognizance of the ICRP recommendations related to the protection of population in the event of a major reactor accident. (author)

  19. Recommender Systems in Commercial Use

    OpenAIRE

    Aldrich, Susan E.

    2011-01-01

    Commercial recommender systems are deployed by marketing teams to increase revenue and/or personalize user experience. Marketers evaluate recommender systems not on its algorithms but on how well the vendor‘s expertise and interfaces will support achieving business goals. Driven by a business model that pays based on recommendation success, vendors guide clients through continuous optimization of recommendations. While recommender technology is mature, the solutions and market are still young...

  20. Alberta's transmission development policy : review and recommendations

    International Nuclear Information System (INIS)

    Stubbings, R.V.

    2004-01-01

    Alberta's Department of Energy (ADOE) released a policy paper in November 2003 regarding power transmission development for the province. The transmission development policy (TDP) is intended to promote economic growth in Alberta while ensuring consumers with reliable, reasonably priced electricity. This presentation reviewed the main features of the policy and then focused on the allocation of costs to generation customers. The author argued that the proposed changes would result in a sub-optimal development of generation and higher total electricity bills for consumers. He argued that the policy will spare generation customers of any obligation to pay wire-related costs other than local interconnection costs. This would weaken a long-standing ADOE policy which requires generators to pay costs that depend on their location on the transmission system. With the new proposal, generators would not be responsible for ancillary service costs even when they provide direct benefits, and they would pay for system losses on a zonal basis. The author recommended that location charges should be large enough to influence the siting decisions of generators. He also recommended that generators should pay their fare share of transmission use-of-system charges, including ancillary services that provide benefits to generators in the form of a stable, reliable transmission system. 2 tabs., 2 figs

  1. Macroencapsulated and elemental lead mixed waste sites report

    International Nuclear Information System (INIS)

    Kalia, A.; Jacobson, R.

    1996-09-01

    The purpose of this study was to compile a list of the Macroencapsulated (MACRO) and Elemental Lead (EL) Mixed Wastes sites that will be treated and require disposal at the Nevada Test Site within the next five to ten years. The five sites selected were: Hanford Site, Richland, Washington; Idaho National Engineering Laboratory (INEL), Idaho Falls, Idaho; Oak Ridge National Laboratory (ORNL), Oak Ridge, Tennessee; Rocky Flats Environmental Technology (RF), Golden, Colorado; and Savannah River (SRS), Charleston, South Carolina. A summary of total lead mixed waste forms at the five selected DOE sites is described in Table E-1. This table provides a summary of total waste and grand total of the current inventory and five-year projected generation of lead mixed waste for each site. This report provides conclusions and recommendations for further investigations. The major conclusions are: (1) the quantity of lead mixed current inventory waste is 500.1 m 3 located at the INEL, and (2) the five sites contain several other waste types contaminated with mercury, organics, heavy metal solids, and mixed sludges

  2. Geospatial Optimization of Siting Large-Scale Solar Projects

    Energy Technology Data Exchange (ETDEWEB)

    Macknick, Jordan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Quinby, Ted [National Renewable Energy Lab. (NREL), Golden, CO (United States); Caulfield, Emmet [Stanford Univ., CA (United States); Gerritsen, Margot [Stanford Univ., CA (United States); Diffendorfer, Jay [U.S. Geological Survey, Boulder, CO (United States); Haines, Seth [U.S. Geological Survey, Boulder, CO (United States)

    2014-03-01

    Recent policy and economic conditions have encouraged a renewed interest in developing large-scale solar projects in the U.S. Southwest. However, siting large-scale solar projects is complex. In addition to the quality of the solar resource, solar developers must take into consideration many environmental, social, and economic factors when evaluating a potential site. This report describes a proof-of-concept, Web-based Geographical Information Systems (GIS) tool that evaluates multiple user-defined criteria in an optimization algorithm to inform discussions and decisions regarding the locations of utility-scale solar projects. Existing siting recommendations for large-scale solar projects from governmental and non-governmental organizations are not consistent with each other, are often not transparent in methods, and do not take into consideration the differing priorities of stakeholders. The siting assistance GIS tool we have developed improves upon the existing siting guidelines by being user-driven, transparent, interactive, capable of incorporating multiple criteria, and flexible. This work provides the foundation for a dynamic siting assistance tool that can greatly facilitate siting decisions among multiple stakeholders.

  3. Analysis of ILRS Site Ties

    Science.gov (United States)

    Husson, V. S.; Long, J. L.; Pearlman, M.

    2001-12-01

    By the end of 2000, 94% of ILRS stations had completed station and site information forms (i.e. site logs). These forms contain six types of information. These six categories include site identifiers, contact information, approximate coordinates, system configuration history, system ranging capabilities, and local survey ties. The ILRS Central Bureau, in conjunction with the ILRS Networks and Engineering Working Group, has developed procedures to quality control site log contents. Part of this verification entails data integrity checks of local site ties and is the primary focus of this paper. Local survey ties are critical to the combination of space geodetic network coordinate solutions (i.e. GPS, SLR, VLBI, DORIS) of the International Terrestrial Reference Frame (ITRF). Approximately 90% of active SLR sites are collocated with at least one other space geodetic technique. The process used to verify these SLR ties, at collocated sites, is identical to the approach used in ITRF2000. Local vectors (X, Y, Z) from each ILRS site log are differenced from its corresponding ITRF2000 position vectors (i.e. no transformations). These X, Y, and Z deltas are converted into North, East, and Up. Any deltas, in any component, larger than 5 millimeter is flagged for investigation. In the absence of ITRF2000 SLR positions, CSR positions were used. To further enhance this comparison and to fill gaps in information, local ties contained in site logs from the other space geodetic services (i.e. IGS, IVS, IDS) were used in addition to ITRF2000 ties. Case studies of two collocated sites (McDonald/Ft. Davis and Hartebeeshtoek) will be explored in-depth. Recommendations on how local site surveys should be conducted and how this information should be managed will also be presented.

  4. One to One Recommendation System in Apparel On-Line Shopping

    Science.gov (United States)

    Sekozawa, Teruji; Mitsuhashi, Hiroyuki; Ozawa, Yukio

    We propose an apparel online shopping site that the fashion adviser exists on the internet. The fashion adviser, who has detailed knowledge about the fashion in real shop, selects and coordinates the clothes of the customer's preference. However, the customer, who didn't have detailed knowledge about the fashion, was not able to choose the clothes suitable for the customer's preference from among the candidate of a large amount of clothes on a conventional apparel shopping site. Then, we compose the system that analyzes the customer's preference by the AHP technique, makes to the cluster by the correlation of clothes, and analyzes the market basket. As a result, this system can coordinate the clothes appropriate for the favor of an individual customer. Moreover, this system can propose the recommendation of other clothes based on past sales data.

  5. Recommendations following the meetings of September 18--19, 1989 held in DeSoto, Texas

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1989-10-11

    This report summarizes recommendations made by the Underground Technology Advisory Panel (UTAP) to the Superconducting Super Collider (SSC) Laboratory, subsequent to meetings held on September 18 and 19, 1989. The panel was convened at the request of Mr. Robert Crawley. Deputy Manager of the Conventional Construction Division for the SSC. A list of UTAP members and meeting agenda are appended to this report. The meeting was held at the Holiday Inn, DeSoto, TX, during which time presentations were made by members of the SSC Laboratory staff on the Texas site geology, site exploration, ring placement, experimental halls, and main beam tunnels and shafts. Information conveyed at the meetings is in the public domain, and has been collected and filed as part of the SSC Laboratory Notes which are available through the SSC Laboratory. Recommendations pertaining to the geotechnical program, presentation of geotechnical information, startup tunnel, groundwater and subsidence monitoring, location of the ring, tunnel and special tunnel areas, and experimental halls are summarized under the headings which follow.

  6. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 6

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed.

  7. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 7

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-01-01

    The Yucca Mountain site in Neavada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended and approved for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining hte geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare and environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed.

  8. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 7

    International Nuclear Information System (INIS)

    1988-01-01

    The Yucca Mountain site in Neavada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended and approved for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining hte geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare and environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed

  9. Quality assurance during site construction of nuclear power plants

    International Nuclear Information System (INIS)

    1981-01-01

    This Safety Guide provides requirements and recommendations related to the establishment and implementation of a quality assurance programme for the site construction activities at nuclear power plants. These include activities such as fabricating, erecting, installing, handling, storing, cleaning, flushing, inspecting, testing, modifying, repairing, and maintaining

  10. Recommended criteria for the evaluation of on-site nuclear power plant emergency exercises

    International Nuclear Information System (INIS)

    Lafortune, J.F.

    1997-01-01

    A review of existing Canadian and International emergency exercise evaluation criteria and approaches has been conducted. Based on the results of the review, criteria are proposed for the evaluation of on-site emergency exercises for Canadian nuclear power stations. The proposed criteria are performance-based. They are comprehensive, yet remain adaptable to all stations and accident scenarios. They are primarily aimed at radiological emergency exercises, but are entirely applicable to fire or other conventional exercises. This report also addresses evaluation preparation and methodology. (author). 21 refs., 6 tabs

  11. Case study of siting technology for underground nuclear power plant

    International Nuclear Information System (INIS)

    Hibino, Satoshi; Komada, Hiroya; Honsho, Shizumitsu; Fujiwara, Yoshikazu; Motojima, Mutsumi; Nakagawa, Kameichiro; Nosaki, Takashi

    1991-01-01

    Underground siting method is one of new feasible siting methods for nuclear power plants. This report presents the results on case studies on underground siting. Two sites of a steeply inclined and plateau like configurations were selected. 'Tunnel type cavern; all underground siting' method was applied for the steeply inclined configuration, and 'shaft type semi-cavern; partial underground siting' method was applied for the plateau like configuration. The following designs were carried out for these two sites as case studies; (1) conceptual designs, (2) geological surveys and rock mechanics tests, (3) stability analysis during cavern excavations, (4) seismic stability analysis of caverns during earthquake, (5) reinforcement designs for caverns, (6) drainage designs. The case studies showed that these two cases were fully feasible, and comparison between two cases revealed that the 'shaft type semi-cavern; partial underground siting' method was more suitable for Japanese islands. As a first step of underground siting, therefore, the authors recommend to construct a nuclear power plant by this method. (author)

  12. Archaeological reconnaissance of a proposed site for the Waste Isolation Plant (WIPP)

    International Nuclear Information System (INIS)

    Nielsen, J.

    1976-01-01

    An archaeological reconnaissance was carried out on Sections 20, 21, 28, and 29 of T 22 S, R 31 E, Eddy County, NM, the core area of a site proposed for disposal of radioactive waste in bedded salt (the Waste Isolation Pilot Plant). This site is located in the Los Medanos area east of Carlsbad, NM. Results of the survey are presented in sections on survey techniques, geology, terrain, floristics, cultural resources, theoretical considerations, site description, and recommendations

  13. Environmental assessment: Reference repository location, Hanford site, Washington

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a reference repository location at the Hanford Site in Washington as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. The site is in the Columbia Plateau, which is one of five distinct geohydrologic settings considered for the first repository. To determine their suitability, the Hanford Site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. On the basis of the evaluations reported in this EA, the DOE has found that the Hanford site is not disqualified under the guidelines. The DOE has also found that it is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Hanford site as one of five sites suitable for characterization.

  14. Environmental assessment: Reference repository location, Hanford site, Washington

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a reference repository location at the Hanford Site in Washington as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. The site is in the Columbia Plateau, which is one of five distinct geohydrologic settings considered for the first repository. To determine their suitability, the Hanford site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. On the basis of the evaluations reported in this EA, the DOE has found that the Hanford site is not disqualified under the guidelines. The DOE has also found that is is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Hanford site as one of five sites available for characterization.

  15. Environmental assessment: Reference repository location, Hanford site, Washington

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a reference repository location at the Hanford Site in Washington as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. The site is in the Columbia Plateau, which is one of five distinct geohydrologic settings considered for the first repository. To determine their suitability, the Hanford Site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. On the basis of the evaluations reported in this EA, the DOE has found that the Hanford site is not disqualified under the guidelines. The DOE has also found that it is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Hanford site as one of five sites suitable for characterization

  16. Environmental assessment: Reference repository location, Hanford site, Washington

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified a reference repository location at the Hanford Site in Washington as one of the nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. The site is in the Columbia Plateau, which is one of five distinct geohydrologic settings considered for the first repository. To determine their suitability, the Hanford site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for the Nuclear Waste Repositories. These evaluations were reported in draft environmental assessments (EAs), which were issued for public review and comment. After considering the comments received on the draft EAs, the DOE prepared the final EAs. On the basis of the evaluations reported in this EA, the DOE has found that the Hanford site is not disqualified under the guidelines. The DOE has also found that is is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is nominating the Hanford site as one of five sites available for characterization

  17. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Brisbane Baylands Brownfield Site in Brisbane, California. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Salasovich, J.; Geiger, J.; Healey, V.; Mosey, G.

    2013-04-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Brisbane Baylands site in Brisbane, California, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.

  18. Intelligent Knowledge Recommendation Methods for R&D Knowledge Portals

    Institute of Scientific and Technical Information of China (English)

    KIM Jongwoo; LEE Hongjoo; PARK Sungjoo

    2004-01-01

    The personalization in knowledge portals and knowledge management systems is mainly performed based on users' explicitly specified categories and keywords. The explicit specification approach requires users' participation to start personalization services, and has limitation to adapt changes of users' preference. This paper suggests two implicit personalization approaches: automatic user category assignment method and automatic keyword profile generation method. The performances of the implicit personalization approaches are compared with traditional personalization approach using an Internet news site experiment. The result of the experiment shows that the suggested personalization approaches provide sufficient recommendation effectiveness with lessening users'unwanted involvement in personalization process.

  19. Probabilistic Seismic Hazard Assessment Method for Nonlinear Soil Sites based on the Hazard Spectrum of Bedrock Sites

    International Nuclear Information System (INIS)

    Hahm, Dae Gi; Seo, Jeong Moon; Choi, In Kil

    2011-01-01

    For the probabilistic safety assessment of the nuclear power plants (NPP) under seismic events, the rational probabilistic seismic hazard estimation should be performed. Generally, the probabilistic seismic hazard of NPP site is represented by the uniform hazard spectrum (UHS) for the specific annual frequency. In most case, since that the attenuation equations were defined for the bedrock sites, the standard attenuation laws cannot be applied to the general soft soil sites. Hence, for the probabilistic estimation of the seismic hazard of soft soil sites, a methodology of probabilistic seismic hazard analysis (PSHA) coupled with nonlinear dynamic analyses of the soil column are required. Two methods are commonly used for the site response analysis considering the nonlinearity of sites. The one is the deterministic method and another is the probabilistic method. In the analysis of site response, there exist many uncertainty factors such as the variation of the magnitude and frequency contents of input ground motion, and material properties of soil deposits. Hence, nowadays, it is recommended that the adoption of the probabilistic method for the PSHA of soft soil deposits considering such uncertainty factors. In this study, we estimated the amplification factor of the surface of the soft soil deposits with considering the uncertainties of the input ground motions and the soil material properties. Then, we proposed the probabilistic methodology to evaluate the UHS of the soft soil site by multiplying the amplification factor to that of the bedrock site. The proposed method was applied to four typical target sites of KNGR and APR1400 NPP site categories

  20. A Flexible Electronic Commerce Recommendation System

    Science.gov (United States)

    Gong, Songjie

    Recommendation systems have become very popular in E-commerce websites. Many of the largest commerce websites are already using recommender technologies to help their customers find products to purchase. An electronic commerce recommendation system learns from a customer and recommends products that the customer will find most valuable from among the available products. But most recommendation methods are hard-wired into the system and they support only fixed recommendations. This paper presented a framework of flexible electronic commerce recommendation system. The framework is composed by user model interface, recommendation engine, recommendation strategy model, recommendation technology group, user interest model and database interface. In the recommender strategy model, the method can be collaborative filtering, content-based filtering, mining associate rules method, knowledge-based filtering method or the mixed method. The system mapped the implementation and demand through strategy model, and the whole system would be design as standard parts to adapt to the change of the recommendation strategy.

  1. Corrective Action Investigation Plan for Corrective Action Unit 137: Waste Disposal Sites, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    Wickline, Alfred

    2005-01-01

    This Corrective Action Investigation Plan (CAIP) contains project-specific information including facility descriptions, environmental sample collection objectives, and criteria for conducting site investigation activities at Corrective Action Unit (CAU) 137: Waste Disposal Sites. This CAIP has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S. Department of Defense. Corrective Action Unit 137 contains sites that are located in Areas 1, 3, 7, 9, and 12 of the Nevada Test Site (NTS), which is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 137 is comprised of the eight corrective action sites (CASs) shown on Figure 1-1 and listed below: (1) CAS 01-08-01, Waste Disposal Site; (2) CAS 03-23-01, Waste Disposal Site; (3) CAS 03-23-07, Radioactive Waste Disposal Site; (4) CAS 03-99-15, Waste Disposal Site; (5) CAS 07-23-02, Radioactive Waste Disposal Site; (6) CAS 09-23-07, Radioactive Waste Disposal Site; (7) CAS 12-08-01, Waste Disposal Site; and (8) CAS 12-23-07, Waste Disposal Site. The Corrective Action Investigation (CAI) will include field inspections, radiological surveys, geophysical surveys, sampling of environmental media, analysis of samples, and assessment of investigation results, where appropriate. Data will be obtained to support corrective action alternative evaluations and waste management decisions. The CASs in CAU 137 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting corrective action

  2. SUBSURFACE EMPLACEMENT TRANSPORTATION SYSTEM

    International Nuclear Information System (INIS)

    Wilson, T.; Novotny, R.

    1999-01-01

    The objective of this analysis is to identify issues and criteria that apply to the design of the Subsurface Emplacement Transportation System (SET). The SET consists of the track used by the waste package handling equipment, the conductors and related equipment used to supply electrical power to that equipment, and the instrumentation and controls used to monitor and operate those track and power supply systems. Major considerations of this analysis include: (1) Operational life of the SET; (2) Geometric constraints on the track layout; (3) Operating loads on the track; (4) Environmentally induced loads on the track; (5) Power supply (electrification) requirements; and (6) Instrumentation and control requirements. This analysis will provide the basis for development of the system description document (SDD) for the SET. This analysis also defines the interfaces that need to be considered in the design of the SET. These interfaces include, but are not limited to, the following: (1) Waste handling building; (2) Monitored Geologic Repository (MGR) surface site layout; (3) Waste Emplacement System (WES); (4) Waste Retrieval System (WRS); (5) Ground Control System (GCS); (6) Ex-Container System (XCS); (7) Subsurface Electrical Distribution System (SED); (8) MGR Operations Monitoring and Control System (OMC); (9) Subsurface Facility System (SFS); (10) Subsurface Fire Protection System (SFR); (11) Performance Confirmation Emplacement Drift Monitoring System (PCM); and (12) Backfill Emplacement System (BES)

  3. Hydrosphere monitoring at nuclear power plant sites

    International Nuclear Information System (INIS)

    Belousova, A.P.; Zakharova, T.V.; Shvets, V.M.

    1993-01-01

    The paper deals with problems related to protection of the environment in areas occupied by nuclear power plants (NPP). NPP construction and operation result in destruction of ecological, geochemical and geological equilibria in and around NPP sites. This process requires monitoring. Recommendations of the International Agency for Atomic Energy (IAAE) suggest monitoring to commence 2-3 years prior to the start of NPP construction. The paper describes the extent of hydrosphere monitoring and guidelines along which monitoring is to be organized. The authors recommend a certain approach toward the planning observation networks and provide description of forecasting subsystem that consist of a data bank, a continuously operating model (COM) and a forecast unit

  4. Recommended methods for monitoring change in bird populations by counting and capture of migrants

    Science.gov (United States)

    David J. T. Hussell; C. John Ralph

    2005-01-01

    Counts and banding captures of spring or fall migrants can generate useful information on the status and trends of the source populations. To do so, the counts and captures must be taken and recorded in a standardized and consistent manner. We present recommendations for field methods for counting and capturing migrants at intensively operated sites, such as bird...

  5. A Sentiment-Enhanced Hybrid Recommender System for Movie Recommendation: A Big Data Analytics Framework

    OpenAIRE

    Wang, Yibo; Wang, Mingming; Xu, Wei

    2018-01-01

    Movie recommendation in mobile environment is critically important for mobile users. It carries out comprehensive aggregation of user’s preferences, reviews, and emotions to help them find suitable movies conveniently. However, it requires both accuracy and timeliness. In this paper, a movie recommendation framework based on a hybrid recommendation model and sentiment analysis on Spark platform is proposed to improve the accuracy and timeliness of mobile movie recommender system. In the propo...

  6. Dose assessments in nuclear power plant siting

    International Nuclear Information System (INIS)

    1988-03-01

    This document is mainly intended to provide information on dose estimations and assessments for the purpose of nuclear power plant (NPP) siting. It is not aimed at giving radiation protection guidance, criteria or procedures to be applied during the process of NPP siting nor even to provide recommendations on this subject matter. The document may however be of help for implementing some of the Nuclear Safety Standards (NUSS) documents on siting. The document was prepared before April 26, 1986, when a severe accident at the Unit 4 of Chernobyl NPP in the USSR had occurred. It should be emphasized that this document does not bridge the gap which exists in the NUSS programme as far as radiation protection guidance for the specific case of siting of NPP is concerned. The Agency will continue to work on this subject with the aim to prepare a safety series document on radiation protection requirements for NPP siting. This document could serve as a working document for this purpose. Refs, figs and tabs

  7. Realities of proximity facility siting

    International Nuclear Information System (INIS)

    DeMott, D.L.

    1981-01-01

    Numerous commercial nuclear power plant sites have 2 to 3 reactors located together, and a group of Facilities with capabilities for fuel fabrication, a nuclear reactor, a storage area for spent fuel, and a maintenance area for contaminated equipment and radioactive waste storage are being designed and constructed in the US. The proximity of these facilities to each other provides that the ordinary flow of materials remain within a limited area. Interactions between the various facilities include shared resources such as communication, fire protection, security, medical services, transportation, water, electrical, personnel, emergency planning, transport of hazardous material between facilities, and common safety and radiological requirements between facilities. This paper will explore the advantages and disadvantages of multiple facilities at one site. Problem areas are identified, and recommendations for planning and coordination are discussed

  8. Hanford Site National Evnironmental Policy Act (NEPA) characterization

    Energy Technology Data Exchange (ETDEWEB)

    Cushing, C.E. (ed.)

    1991-12-01

    This fourth revision of the Hanford Site National Environmental Policy (NEPA) Characterization presents current environmental data regarding the Hanford Site and its immediate environs. This information is intended for use in preparing Site-related NEPA documentation. In Chapter 4.0 are presented summations of up-to-date information about climate and meteorology, geology and hydrology, ecology, history and archaeology, socioeconomics, land use, and noise levels. Chapter 5.0 describes models, including their principal assumptions, that are to be used in simulating realized or potential impacts from nuclear materials at the Hanford Site. Included are models of radionuclides transport in groundwater and atmospheric pathways, and of radiation dose to populations via all known pathways from known initial conditions. Chapter 6.0 provides the preparer with the federal and state regulations, DOE orders and permits, and environmental standards directly applicable for environmental impact statements for the Hanford Site, following the structure Chapter 4.0. NO conclusions or recommendations are given in this report.

  9. A User-centered Model for Web Site Design

    Science.gov (United States)

    Kinzie, Mable B.; Cohn, Wendy F.; Julian, Marti F.; Knaus, William A.

    2002-01-01

    As the Internet continues to grow as a delivery medium for health information, the design of effective Web sites becomes increasingly important. In this paper, the authors provide an overview of one effective model for Web site design, a user-centered process that includes techniques for needs assessment, goal/task analysis, user interface design, and rapid prototyping. They detail how this approach was employed to design a family health history Web site, Health Heritage . This Web site helps patients record and maintain their family health histories in a secure, confidential manner. It also supports primary care physicians through analysis of health histories, identification of potential risks, and provision of health care recommendations. Visual examples of the design process are provided to show how the use of this model resulted in an easy-to-use Web site that is likely to meet user needs. The model is effective across diverse content arenas and is appropriate for applications in varied media. PMID:12087113

  10. Some interactive factors affecting trench-cover integrity on low-level waste sites

    International Nuclear Information System (INIS)

    Hakonson, T.E.; Lane, L.J.; Steger, J.G.; DePoorter, G.L.

    1982-01-01

    This paper describes important mechanisms by which radionuclide can be transported from low-level waste disposal sites into biological pathways, discuss interactions of abiotic and biotic processes, and recommends environmental characteristics that should be measured to design sites that minimize this transport. Past experience at shallow land burial sites for low-level radioactive wastes suggest that occurrences of waste exposure and radionuclide transport are often related to inadequate trench cover designs. Meeting performance standards at low-level waste sites can only be achieved by recognizing that physical, chemical, and biological processes operating on and in a trench cover profile are highly interactive. Failure to do so can lead to improper design criteria and subsequent remedial action procedures that can adversely affect site stability. Based upon field experiments and computer modeling, recommendations are made on site characteristics that require measurement in order to design systems that reduce surface runoff and erosion, manage soil moisture and biota in the cover profile to maximize evapotranspiration and minimize percolation, and place bounds on the intrusion potential of plants and animals into the waste material. Major unresolved problems include developing probabilistic approaches that include climatic variability, improved knowledge of soil-water-plant-erosion relationships, development of practical vegetation establishment and maintenance procedures, prediction and quantification of site potential and plant succession, and understanding the interaction of processes occurring on and in the cover profile with deeper subsurface processes

  11. Corrective Action Decision Document/Closure Report for Corrective Action Unit 370: T-4 Atmospheric Test Site, Nevada Test Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Patrick Matthews

    2009-05-01

    This Corrective Action Decision Document/Closure Report has been prepared for Corrective Action Unit (CAU) 370, T-4 Atmospheric Test Site, located in Area 4 at the Nevada Test Site, Nevada, in accordance with the Federal Facility Agreement and Consent Order (FFACO). Corrective Action Unit 370 is comprised of Corrective Action Site (CAS) 04-23-01, Atmospheric Test Site T-4. The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation that no further corrective action is needed for CAU 370 due to the implementation of the corrective action of closure in place with administrative controls. To achieve this, corrective action investigation (CAI) activities were performed from June 25, 2008, through April 2, 2009, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 370: T-4 Atmospheric Test Site and Record of Technical Change No. 1.

  12. Toward Privacy-Preserving Personalized Recommendation Services

    Directory of Open Access Journals (Sweden)

    Cong Wang

    2018-02-01

    Full Text Available Recommendation systems are crucially important for the delivery of personalized services to users. With personalized recommendation services, users can enjoy a variety of targeted recommendations such as movies, books, ads, restaurants, and more. In addition, personalized recommendation services have become extremely effective revenue drivers for online business. Despite the great benefits, deploying personalized recommendation services typically requires the collection of users’ personal data for processing and analytics, which undesirably makes users susceptible to serious privacy violation issues. Therefore, it is of paramount importance to develop practical privacy-preserving techniques to maintain the intelligence of personalized recommendation services while respecting user privacy. In this paper, we provide a comprehensive survey of the literature related to personalized recommendation services with privacy protection. We present the general architecture of personalized recommendation systems, the privacy issues therein, and existing works that focus on privacy-preserving personalized recommendation services. We classify the existing works according to their underlying techniques for personalized recommendation and privacy protection, and thoroughly discuss and compare their merits and demerits, especially in terms of privacy and recommendation accuracy. We also identity some future research directions. Keywords: Privacy protection, Personalized recommendation services, Targeted delivery, Collaborative filtering, Machine learning

  13. Proposed Site-Specific Response Spectra for Surabaya-Madura Bridge

    Directory of Open Access Journals (Sweden)

    Dyah Kusumastuti

    2008-01-01

    Full Text Available This paper presents a site-specific seismic hazard study to determine the recommended seismic design criteria for Suramadu Bridge. The study is performed using probabilistic seismic hazard approach to determine maximum acceleration and response spectra at bedrock and followed by local site effect analysis to determine maximum acceleration and response spectra at ground surface. The probabilistic seismic hazard analysis (PSHA is carried out using 3-dimension (3-D seismic source models (fault source model. Two hazard levels are analysed to represent 150 and 3,300 years return period of ground motion around site location. The local site effect analysis is performed using 1-dimension (1-D shear wave propagation theory to obtain peak ground acceleration and response spectra at ground surface. Finally, the site-specific surface response spectra with 5 percent damping are developed based on the mean plus one standard deviation concept from the result of local site effect analysis.

  14. Public involvement in the siting of contentious facilities; Lessons from the radioactive waste repository siting programmes in Canada and the United States, with special reference to the Swedish repository siting process

    International Nuclear Information System (INIS)

    Richardson, P.J.

    1997-08-01

    This report describes the conclusion of a two-part programme, begun in 1994 with the overall aim of assisting in the development of an acceptable public participation strategy for use in Sweden for the siting of contentious facilities, with particular reference to the ongoing siting programme for a deep repository for spent nuclear fuel. The first part of the work programme, a global review of siting practice, was reported as SSI Rapport 94-15, in November 1994. This recommended further detailed studies of at least two individual programmes, which have now been carried out in Canada and the United States, and are reported on here. They involved face to face meetings with many of the main stake holders in the two programmes and enabled valuable insight to be gained into the potential problems associated with increased public participation, as well as identifying good practice where it exists. The lessons learned have then been applied to the evolving repository siting process in Sweden. 35 refs

  15. Public involvement in the siting of contentious facilities; Lessons from the radioactive waste repository siting programmes in Canada and the United States, with special reference to the Swedish repository siting process

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, P J [Geosciences for Development and the Environment (United Kingdom)

    1997-08-01

    This report describes the conclusion of a two-part programme, begun in 1994 with the overall aim of assisting in the development of an acceptable public participation strategy for use in Sweden for the siting of contentious facilities, with particular reference to the ongoing siting programme for a deep repository for spent nuclear fuel. The first part of the work programme, a global review of siting practice, was reported as SSI Rapport 94-15, in November 1994. This recommended further detailed studies of at least two individual programmes, which have now been carried out in Canada and the United States, and are reported on here. They involved face to face meetings with many of the main stake holders in the two programmes and enabled valuable insight to be gained into the potential problems associated with increased public participation, as well as identifying good practice where it exists. The lessons learned have then been applied to the evolving repository siting process in Sweden. 35 refs.

  16. Readability of Online Patient Education Materials From the AAOS Web Site

    Science.gov (United States)

    Badarudeen, Sameer; Unes Kunju, Shebna

    2008-01-01

    One of the goals of the American Academy of Orthopaedic Surgeons (AAOS) is to disseminate patient education materials that suit the readability skills of the patient population. According to standard guidelines from healthcare organizations, the readability of patient education materials should be no higher than the sixth-grade level. We hypothesized the readability level of patient education materials available on the AAOS Web site would be higher than the recommended grade level, regardless when the material was available online. Readability scores of all articles from the AAOS Internet-based patient information Web site, “Your Orthopaedic Connection,” were determined using the Flesch-Kincaid grade formula. The mean Flesch-Kincaid grade level of the 426 unique articles was 10.43. Only 10 (2%) of the articles had the recommended readability level of sixth grade or lower. The readability of the articles did not change with time. Our findings suggest the majority of the patient education materials available on the AAOS Web site had readability scores that may be too difficult for comprehension by a substantial portion of the patient population. PMID:18324452

  17. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Price Landfill Site in Pleasantville, New Jersey. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Salasovich, J.; Geiger, J.; Mosey, G.; Healey, V.

    2013-05-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Price Landfill site in Pleasantville, New Jersey, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site. This study did not assess environmental conditions at the site.

  18. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Tower Road Site in Aurora, Colorado. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Van Geet, O.; Mosey, G.

    2013-03-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Tower Road site in Aurora, Colorado, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site. This study did not assess environmental conditions at the site.

  19. Closure Report for Corrective Action Unit 356: Mud Pits and Disposal Sites, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2002-01-01

    This Closure Report (CR) has been prepared for Corrective Action Unit (CAU) 356, Mud Pits and Disposal Sites, in accordance with the Federal Facility Agreement and Consent Order. This CAU is located in Areas 3 and 20 of the Nevada Test Site (NTS) approximately 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 356 consists of seven Corrective Action Sites (CASs): 03-04-01, Area 3 Change House Septic System; 03-09-01, Mud Pit Spill Over; 03-09-03, Mud Pit; 03-09-04, Mud Pit; 03-09-05, Mud Pit; 20-16-01, Landfill; and 20-22-21, Drums. This CR identifies and rationalizes the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Operations Office's (NNSA/NV's) recommendation that no further corrective action and closure in place is deemed necessary for CAU 356. This recommendation is based on the results of field investigation/closure activities conducted November 20, 2001, through January 3, 2002, and March 11 to 14, 2002. These activities were conducted in accordance with the Streamlined Approach for Environmental Restoration Plan (SAFER) for CAU 356. For CASs 03-09-01, 03-09-03, 20-16-01, and 22-20-21, analytes detected in soil during the corrective action investigation were evaluated against Preliminary Action Levels (PALs) and it was determined that no Contaminants of Concern (COCs) were present. Therefore, no further action is necessary for the soil at these CASs. For CASs 03-04-01, 03-09-04, and 03-09-05, analytes detected in soil during the corrective action investigation were evaluated against PALs and identifies total petroleum hydrocarbons (TPHs) and radionuclides (i.e., americium-241 and/or plutonium 239/240) as COCs. The nature, extent, and concentration of the TPH and radionuclide COCs were bounded by sampling and shown to be relatively immobile. Therefore, closure in place is recommended for these CASs in CAU 356. Further, use restrictions are not required at this CAU beyond the NTS use restrictions identified in

  20. Seismic site-response characterization of high-velocity sites using advanced geophysical techniques: application to the NAGRA-Net

    Science.gov (United States)

    Poggi, V.; Burjanek, J.; Michel, C.; Fäh, D.

    2017-08-01

    The Swiss Seismological Service (SED) has recently finalised the installation of ten new seismological broadband stations in northern Switzerland. The project was led in cooperation with the National Cooperative for the Disposal of Radioactive Waste (Nagra) and Swissnuclear to monitor micro seismicity at potential locations of nuclear-waste repositories. To further improve the quality and usability of the seismic recordings, an extensive characterization of the sites surrounding the installation area was performed following a standardised investigation protocol. State-of-the-art geophysical techniques have been used, including advanced active and passive seismic methods. The results of all analyses converged to the definition of a set of best-representative 1-D velocity profiles for each site, which are the input for the computation of engineering soil proxies (traveltime averaged velocity and quarter-wavelength parameters) and numerical amplification models. Computed site response is then validated through comparison with empirical site amplification, which is currently available for any station connected to the Swiss seismic networks. With the goal of a high-sensitivity network, most of the NAGRA stations have been installed on stiff-soil sites of rather high seismic velocity. Seismic characterization of such sites has always been considered challenging, due to lack of relevant velocity contrast and the large wavelengths required to investigate the frequency range of engineering interest. We describe how ambient vibration techniques can successfully be applied in these particular conditions, providing practical recommendations for best practice in seismic site characterization of high-velocity sites.

  1. Quarterly report on Defense Nuclear Facilities Safety Board Recommendation 90-7 for the period ending December 31, 1991

    International Nuclear Information System (INIS)

    Cash, R.J.; Dukelow, G.T.; Atwood, J.M.

    1992-01-01

    This quarterly report provides a status of the activities underway at the Hanford Site on the ferrocyanide safety issues as requested by the Defense Nuclear Facilities Safety Board (DNFSB) in their Recommendation 90-7 (FR 1990). In March 1991, an DNFSB Implementation Plan (Cash 1991a) was prepared and sent to the DNFSB responding to the six parts of Recommendation 90-7. All of the activities in the DNFSB Implementation Plan are underway and the status of each is described

  2. Process for determining the remediation category of hazardous substance sites

    International Nuclear Information System (INIS)

    Sieben, A.K.

    1994-01-01

    An evaluation process has been developed that aids in selecting the appropriate remediation category of hazardous substance sites. Three general remediation categories have been established: No further Action: Potential Early Action: and Defer for RI/FS or Transition/Decontamination and Decommissioning. This evaluation method is a preliminary screening process only and will not identify the most appropriate remediation alternative for each site. The remedy selection process can proceed only after a remediation category is determined for each site. All sites are evaluated at a preliminary screening level to determine the general remediation category. After the first screen, a secondary evaluation is performed on both the PEA sites and the DEFER sites. For PEAs, this secondary evaluation will incorporate additional specific factors, such as a screening level risk assessment. For the DEFER sites feasibility factors will be used to distinguish between the sites which should undergo a normal RI/FS and the sites which will be recommended to be remediated in association with D ampersand D of buildings. Ultimately, all of the sites will be placed into one of four remediation categories

  3. RARD: The Related-Article Recommendation Dataset

    OpenAIRE

    Beel, Joeran; Carevic, Zeljko; Schaible, Johann; Neusch, Gabor

    2017-01-01

    Recommender-system datasets are used for recommender-system evaluations, training machine-learning algorithms, and exploring user behavior. While there are many datasets for recommender systems in the domains of movies, books, and music, there are rather few datasets from research-paper recommender systems. In this paper, we introduce RARD, the Related-Article Recommendation Dataset, from the digital library Sowiport and the recommendation-as-a-service provider Mr. DLib. The dataset contains ...

  4. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 4

    International Nuclear Information System (INIS)

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended and approved by the President for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site; to describe the conceptual designs for the repository and the waste package; and to present the plans for obtaining the geologic information necessary to demonstate the suitability of the site for a repository, to desin the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next; it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed

  5. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 4

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended and approved by the President for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site; to describe the conceptual designs for the repository and the waste package; and to present the plans for obtaining the geologic information necessary to demonstate the suitability of the site for a repository, to desin the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next; it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed.

  6. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in acordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and eveloping a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing prinicples, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed. 880 refs., 130 figs., 25 tabs.

  7. The pre-operational monitoring - how useful are recommendations of international organizations and various national programs

    International Nuclear Information System (INIS)

    Mihailovic, M.

    1980-01-01

    National legislation and the preoperational monitoring program around Nuclear Power Plant Krsko are described. The usefulness of international recommendations and various national preoperational monitoring programs is examined. Modifications are described which were introduced with the aim of identifying the site specific critical exposure pathways. The role of qualified and experienced experts is discussed. (H.K.)

  8. Environmental assessment overview, Yucca Mountain site, Nevada Research and Development Area, Nevada

    International Nuclear Information System (INIS)

    1986-05-01

    In February 1983, the US Department of Energy (DOE) identified the Yucca Mountain site in Nevada as one of nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. The site is in the Great Basin, which is one of five distinct geohydrologic settings considered for the first repository. To determine their suitability, the Yucca Mountain site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendations of Sites for the Nuclear Waste Repositories. On the basis of the evaluations reported in this EA, the DOE has found that the Yucca Mountain site is not disqualified under the guidelines. On the basis of these findings, the DOE is nominating the Yucca Mountain site as one of five sites suitable for characterization. 3 figs

  9. Evaluation of two surveillance methods for surgical site infection

    Directory of Open Access Journals (Sweden)

    M. Haji Abdolbaghi

    2006-08-01

    Full Text Available Background: Surgical wound infection surveillance is an important facet of hospital infection control processes. There are several surveillance methods for surgical site infections. The objective of this study is to evaluate the accuracy of two different surgical site infection surveillance methods. Methods: In this prospective cross sectional study 3020 undergoing surgey in general surgical wards of Imam Khomeini hospital were included. Surveillance methods consisted of review of medical records for postoperative fever and review of nursing daily note for prescription of antibiotics postoperatively and during patient’s discharge. Review of patient’s history and daily records and interview with patient’s surgeon and the head-nurse of the ward considered as a gold standard for surveillance. Results: The postoperative antibiotic consumption especially when considering its duration is a proper method for surgical wound infection surveillance. Accomplishments of a prospective study with postdischarge follow up until 30 days after surgery is recommended. Conclusion: The result of this study showed that postoperative antibiotic surveillance method specially with consideration of the antibiotic usage duration is a proper method for surgical site infection surveillance in general surgery wards. Accomplishments of a prospective study with post discharge follow up until 30 days after surgery is recommended.

  10. Siting Study for the Remote-Handled Low-Level Waste Disposal Project

    Energy Technology Data Exchange (ETDEWEB)

    Lisa Harvego; Joan Connolly; Lance Peterson; Brennon Orr; Bob Starr

    2010-10-01

    The U.S. Department of Energy has identified a mission need for continued disposal capacity for remote-handled low-level waste (LLW) generated at the Idaho National Laboratory (INL). An alternatives analysis that was conducted to evaluate strategies to achieve this mission need identified two broad options for disposal of INL generated remote-handled LLW: (1) offsite disposal and (2) onsite disposal. The purpose of this study is to identify candidate sites or locations within INL boundaries for the alternative of an onsite remote handled LLW disposal facility and recommend the highest-ranked locations for consideration in the National Environmental Policy Act process. The study implements an evaluation based on consideration of five key elements: (1) regulations, (2) key assumptions, (3) conceptual design, (4) facility performance, and (5) previous INL siting study criteria, and uses a five-step process to identify, screen, evaluate, score, and rank 34 separate sites located across INL. The result of the evaluation is identification of two recommended alternative locations for siting an onsite remote-handled LLW disposal facility. The two alternative locations that best meet the evaluation criteria are (1) near the Advanced Test Reactor Complex and (2) west of the Idaho Comprehensive Environmental Response, Compensation, and Liability Act Disposal Facility.

  11. Corrective Action Plan for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Restoration

    2007-07-01

    Corrective Action Unit (CAU) 139, Waste Disposal Sites, is listed in the Federal Facility Agreement and Consent Order (FFACO) of 1996 (FFACO, 1996). CAU 139 consists of seven Corrective Action Sites (CASs) located in Areas 3, 4, 6, and 9 of the Nevada Test Site (NTS), which is located approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1). CAU 139 consists of the following CASs: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Details of the site history and site characterization results for CAU 139 are provided in the approved Corrective Action Investigation Plan (CAIP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006) and in the approved Corrective Action Decision Document (CADD) (NNSA/NSO, 2007). The purpose of this Corrective Action Plan (CAP) is to present the detailed scope of work required to implement the recommended corrective actions as specified in Section 4.0 of the approved CADD (NNSA/NSO, 2007). The approved closure activities for CAU 139 include removal of soil and debris contaminated with plutonium (Pu)-239, excavation of geophysical anomalies, removal of surface debris, construction of an engineered soil cover, and implementation of use restrictions (URs). Table 1 presents a summary of CAS-specific closure activities and contaminants of concern (COCs). Specific details of the corrective actions to be performed at each CAS are presented in Section 2.0 of this report.

  12. Corrective Action Plan for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    NSTec Environmental Restoration

    2007-01-01

    Corrective Action Unit (CAU) 139, Waste Disposal Sites, is listed in the Federal Facility Agreement and Consent Order (FFACO) of 1996 (FFACO, 1996). CAU 139 consists of seven Corrective Action Sites (CASs) located in Areas 3, 4, 6, and 9 of the Nevada Test Site (NTS), which is located approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1). CAU 139 consists of the following CASs: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Details of the site history and site characterization results for CAU 139 are provided in the approved Corrective Action Investigation Plan (CAIP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006) and in the approved Corrective Action Decision Document (CADD) (NNSA/NSO, 2007). The purpose of this Corrective Action Plan (CAP) is to present the detailed scope of work required to implement the recommended corrective actions as specified in Section 4.0 of the approved CADD (NNSA/NSO, 2007). The approved closure activities for CAU 139 include removal of soil and debris contaminated with plutonium (Pu)-239, excavation of geophysical anomalies, removal of surface debris, construction of an engineered soil cover, and implementation of use restrictions (URs). Table 1 presents a summary of CAS-specific closure activities and contaminants of concern (COCs). Specific details of the corrective actions to be performed at each CAS are presented in Section 2.0 of this report

  13. New ICRP recommendations and radiation safety of an NPP

    International Nuclear Information System (INIS)

    Janzekovic, H.

    2007-01-01

    In March 2007 the fundamental radiation protection recommendations used world-widely in nuclear facilities were approved by the ICRP. Implementation of radiation safety standards in an NPP is a challenging issue related to all NPP phases from planning a site and its design to its decommissioning also because if neglected it could be very difficult if not impossible to implement improvement of radiation safety later during operation or decommissioning without a substantial cost. The standards are changing with a period of 15 years which is small regarding a prolonged lifetime of many NPPs and also foreseen lifetime of new NPPs, i.e. 60 years. The new recommendations are actually an upgrading of the ICRP 60. Among other changes new sets of wR and wT are given, as well as an update of around 50 different values related to doses. Two new concepts are also tackled i.e. terrorist attacks and protection of the environment. The influence of the new recommendations on the radiation safety of NPPs can be analysed by a selection of four renewed or new concepts: types of exposure situation, dose constraints, source-related approach and safety and security. Their implementation could lead to upgrading the radiation safety of future or existing NPPs as well as of decommissioning processes. Some of the concepts were already extensively and successfully used by designers of modifications or of new NPPs, as well as by operators. (author)

  14. Volcanic Hazard Assessments for Nuclear Installations: Methods and Examples in Site Evaluation

    International Nuclear Information System (INIS)

    2016-07-01

    To provide guidance on the protection of nuclear installations against the effects of volcanoes, the IAEA published in 2012 IAEA Safety Standards Series No. SSG-21, Volcanic Hazards in Site Evaluation for Nuclear Installations. SSG-21 addresses hazards relating to volcanic phenomena, and provides recommendations and general guidance for evaluation of these hazards. Unlike seismic hazard assessments, models for volcanic hazard assessment have not undergone decades of review, evaluation and testing for suitability in evaluating hazards at proposed nuclear installations. Currently in volcanology, scientific developments and detailed methodologies to model volcanic phenomena are evolving rapidly.This publication provides information on detailed methodologies and examples in the application of volcanic hazard assessment to site evaluation for nuclear installations, thereby addressing the recommendations in SSG-21. Although SSG-21 develops a logical framework for conducting a volcanic hazard assessment, this publication demonstrates the practicability of evaluating the recommendations in SSG-21 through a systematic volcanic hazard assessment and examples from Member States. The results of this hazard assessment can be used to derive the appropriate design bases and operational considerations for specific nuclear installations

  15. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Kerr McGee Site in Columbus, Mississippi. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Simon, J.; Mosey, G.

    2013-01-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Kerr McGee site in Columbus, Mississippi, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.

  16. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Crazy Horse Landfill Site in Salinas, California. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Stoltenberg, B.; Konz, C.; Mosey, G.

    2013-03-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Crazy Horse Landfill site in Salinas, California, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) was contacted to provide technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, operation and maintenance requirements, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.

  17. Receiving recommendations and providing feedback : the user-experience of a recommender system

    NARCIS (Netherlands)

    Knijnenburg, B.P.; Willemsen, M.C.; Hirtbach, S.; Buccafurri, F.; Semeraro, G.

    2010-01-01

    This paper systematically evaluates the user experience of a recommender system. Using both behavioral data and subjective measures of user experience, we demonstrate that choice satisfaction and system effectiveness increase when a system provides personalized recommendations (compared to the same

  18. 75 FR 7591 - Guidance on Recommended Interim Preliminary Remediation Goals for Dioxin in Soil at CERCLA and...

    Science.gov (United States)

    2010-02-22

    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-SFUND-2009-0907; FRL-9114-6] RIN 2050-ZA05 Guidance on Recommended Interim Preliminary Remediation Goals for Dioxin in Soil at CERCLA and RCRA Sites; Extension of... Interim Preliminary Remediation Goals for Dioxin in Soil at Comprehensive Environmental Response...

  19. Site specific study for possible ongoing salt dome movement

    International Nuclear Information System (INIS)

    Thoms, R.L.; Manning, T.A.; Paille, L.K.; Gehle, R.M.

    1977-01-01

    U.S. Gulf Coast salt domes, among other geologic structures, currently are being considered for storage of commercial radioactive wastes. A major concern with dome storage of long lived radioactive wastes lies with the possible tectonic movement of the host dome. Any ongoing movement of a salt dome can be monitored with a site specific complementary system of field instrumentation and finite element modelling. Field instrumentation and accompanying finite element analyses for a study dome in northwest Louisiana are described. Site specific data and early experience associated with tiltmeters over the dome are presented. Also, recommendations are made for modifications and extensions of the field instrumentation and finite element modelling appropriate to the specific site under study

  20. Recommendation systems in software engineering

    CERN Document Server

    Robillard, Martin P; Walker, Robert J; Zimmermann, Thomas

    2014-01-01

    With the growth of public and private data stores and the emergence of off-the-shelf data-mining technology, recommendation systems have emerged that specifically address the unique challenges of navigating and interpreting software engineering data.This book collects, structures and formalizes knowledge on recommendation systems in software engineering. It adopts a pragmatic approach with an explicit focus on system design, implementation, and evaluation. The book is divided into three parts: "Part I - Techniques" introduces basics for building recommenders in software engineering, including techniques for collecting and processing software engineering data, but also for presenting recommendations to users as part of their workflow.?"Part II - Evaluation" summarizes methods and experimental designs for evaluating recommendations in software engineering.?"Part III - Applications" describes needs, issues and solution concepts involved in entire recommendation systems for specific software engineering tasks, fo...

  1. Methodology to evaluate the site standard seismic motion for a nuclear facility

    International Nuclear Information System (INIS)

    Soares, W.A.

    1983-03-01

    An overall view of the subjects involved in the determination of the site standard seismic motion to a nuclear facility is presented. The main topics discussed are: basic priciples of seismic instrumentation; dynamic and spectral concepts; design earthquakes definitions; fundamentals of seismology; empirical curves developed from prior seismic data; avalable methodologies and recommended procedures to evaluate the site standard seismic motion. (E.G.) [pt

  2. American National Standard: for facilities and medical care for on-site nuclear-power-plant radiological emergencies

    International Nuclear Information System (INIS)

    Anon.

    1979-01-01

    This standard provides guidance for first aid during an emergency and for initial medical care of those persons on-site who are overexposed to penetrating radiation (irradiated). It also provides guidance for medical care of persons contaminated with radioactive material or radionuclides who may also be irradiated or injured as a result of an accident at a nuclear power plant. It provides recommendations for facilities, supplies, equipment, and the extent of care both on-site where first aid and initial care may be provided and off-site at a local hospital where further medical and surgical care may be provided. This initial care continues until either the patient is released or admitted, or referred to another, possibly distant, medical center for definitive care. Recommendations are also provided for the transportation of patients and the training of personnel. Recommendations for specialized care are considered to be beyond the scope of this standard on emergency medical care; however, since emergency and specialized care are related, a brief discussion of specialized care is provided in the Appendix

  3. Surfing the web during pandemic flu: availability of World Health Organization recommendations on prevention.

    Science.gov (United States)

    Gesualdo, Francesco; Romano, Mariateresa; Pandolfi, Elisabetta; Rizzo, Caterina; Ravà, Lucilla; Lucente, Daniela; Tozzi, Alberto E

    2010-09-20

    People often search for information on influenza A(H1N1)v prevention on the web. The extent to which information found on the Internet is consistent with recommendations issued by the World Health Organization is unknown. We conducted a search for "swine flu" accessing 3 of the most popular search engines through different proxy servers located in 4 English-speaking countries (Australia, Canada, UK, USA). We explored each site resulting from the searches, up to 4 clicks starting from the search engine page, analyzing availability of World Health Organization recommendations for swine flu prevention. Information on hand cleaning was reported on 79% of the 147 websites analyzed; staying home when sick was reported on 77.5% of the websites; disposing tissues after sneezing on 75.5% of the websites. Availability of other recommendations was lower. The probability of finding preventative recommendations consistent with World Health Organization varied by country, type of website, and search engine. Despite media coverage on H1N1 influenza, relevant information for prevention is not easily found on the web. Strategies to improve information delivery to the general public through this channel should be improved.

  4. Corrective Action Decision Document/Closure Report for Corrective Action Unit 545: Dumps, Waste Disposal Sites, and Buried Radioactive Materials Nevada Test Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Alfred Wickline

    2008-04-01

    This Corrective Action Decision Document (CADD)/Closure Report (CR) has been prepared for Corrective Action Unit (CAU) 545, Dumps, Waste Disposal Sites, and Buried Radioactive Materials, in Areas 2, 3, 9, and 20 of the Nevada Test Site, Nevada, in accordance with the Federal Facility Agreement and Consent Order that was agreed to by the State of Nevada; U.S. Department of Energy (DOE), Environmental Management; U.S. Department of Defense; and DOE, Legacy Management (1996, as amended February 2008). Corrective Action Unit 545 is comprised of the following eight Corrective Action Sites (CASs): • 02-09-01, Mud Disposal Area • 03-08-03, Mud Disposal Site • 03-17-01, Waste Consolidation Site 3B • 03-23-02, Waste Disposal Site • 03-23-05, Europium Disposal Site • 03-99-14, Radioactive Material Disposal Area • 09-23-02, U-9y Drilling Mud Disposal Crater • 20-19-01, Waste Disposal Site While all eight CASs are addressed in this CADD/CR, sufficient information was available for the following three CASs; therefore, a field investigation was not conducted at these sites: • For CAS 03-08-03, though the potential for subsidence of the craters was judged to be extremely unlikely, the data quality objective (DQO) meeting participants agreed that sufficient information existed about disposal and releases at the site and that a corrective action of close in place with a use restriction is recommended. Sampling in the craters was not considered necessary. • For CAS 03-23-02, there were no potential releases of hazardous or radioactive contaminants identified. Therefore, the Corrective Action Investigation Plan for CAU 545 concluded that: “Sufficient information exists to conclude that this CAS does not exist as originally identified. Therefore, there is no environmental concern associated with CAS 03-23-02.” This CAS is closed with no further action. • For CAS 03-23-05, existing information about the two buried sources and lead pig was considered to be

  5. Web Accessibility in Romania: The Conformance of Municipal Web Sites to Web Content Accessibility Guidelines

    OpenAIRE

    Costin PRIBEANU; Ruxandra-Dora MARINESCU; Paul FOGARASSY-NESZLY; Maria GHEORGHE-MOISII

    2012-01-01

    The accessibility of public administration web sites is a key quality attribute for the successful implementation of the Information Society. The purpose of this paper is to present a second review of municipal web sites in Romania that is based on automated accessibility checking. A number of 60 web sites were evaluated against WCAG 2.0 recommendations. The analysis of results reveals a relatively low web accessibility of municipal web sites and highlights several aspects. Firstly, a slight ...

  6. End of mission report on seismic safety review mission for Belene NPP site

    International Nuclear Information System (INIS)

    Gurpinar, A.; Mohammadioun, B.; Schneider, H.; Serva, L.

    1995-01-01

    Upon the invitation of the Bulgarian government through the Committee for the Peaceful Uses of Atomic Energy and within the framework of the implementation of the Technical Cooperation project BUL/9/012 related to site and seismic of NPPs, a mission visited Sofia 3 - 7 July 1995. The mission constituted a follow-up of the interim review of subjects related to tectonic stability and seismic hazard characterization of the site which was performed in September 1993. The main objective of the mission was the final review of the subjects already reviewed in September 1993 as well as issues related to geotechnical engineering and foundation safety. The main terms of reference of the present mission was to verify the implementation of the recommendations of the Site Safety Review Mission of June 1990. This document gives findings on geology-tectonics, seismology and foundation safety. In the end conclusions and recommendations of the mission are presented

  7. A flexible monitoring infrastructure for the simulation requests

    International Nuclear Information System (INIS)

    Spinoso, V; Missiato, M

    2014-01-01

    Running and monitoring simulations usually involves several different aspects of the entire workflow: the configuration of the job, the site issues, the software deployment at the site, the file catalogue, the transfers of the simulated data. In addition, the final product of the simulation is often the result of several sequential steps. This project tries a different approach to monitoring the simulation requests. All the necessary data are collected from the central services which lead the submission of the requests and the data management, and stored by a backend into a NoSQL-based data cache; those data can be queried through a Web Service interface, which returns JSON responses, and allows users, sites, physics groups to easily create their own web frontend, aggregating only the needed information. As an example, it will be shown how it is possible to monitor the CMS services (ReqMgr, DAS/DBS, PhEDEx) using a central backend and multiple customized cross-language frontends.

  8. A Flexible Monitoring Infrastructure for the Simulation Requests

    Science.gov (United States)

    Spinoso, V.; Missiato, M.

    2014-06-01

    Running and monitoring simulations usually involves several different aspects of the entire workflow: the configuration of the job, the site issues, the software deployment at the site, the file catalogue, the transfers of the simulated data. In addition, the final product of the simulation is often the result of several sequential steps. This project tries a different approach to monitoring the simulation requests. All the necessary data are collected from the central services which lead the submission of the requests and the data management, and stored by a backend into a NoSQL-based data cache; those data can be queried through a Web Service interface, which returns JSON responses, and allows users, sites, physics groups to easily create their own web frontend, aggregating only the needed information. As an example, it will be shown how it is possible to monitor the CMS services (ReqMgr, DAS/DBS, PhEDEx) using a central backend and multiple customized cross-language frontends.

  9. Toward a national policy for managing low-level radioactive waste: key issues and recommendations

    International Nuclear Information System (INIS)

    Duerksen, C.J.; Mantell, M.; Thompson, G.P.

    1981-06-01

    The Conservation Foundation, a not-for-profit research and public education organization, asked individuals with diverse backgrounds and viewpoints to come together under Foundation leadership as a Dialogue Group on Low-Level Radioactive Waste Management. The group, including persons who represent waste generators, concerned citizens, state regulators, and environmentalists, met over an 18-month period to discuss issues crucial to the development of a national policy on low-level wastes. The Dialogue Group agreed that three principles, if accepted broadly, would form the basis of a sound national policy for managing low-level radioactive wastes: with proper implementation, technology exists to manage low-level waste safely; generators and their customers should pay disposal costs; and greater public involvement at all stages can improve the disposal system. These principles acted as polestars for the group as it worked toward a series of policy recommendations in four main areas: (1) cleaning up closed commercial sites; (2) remodeling a system for defining and classifying low-level radioactive waste; (3) siting new low-level waste disposal facilities; and (4) decommissioning, long-term care, and liability. This report presents an extensive discussion of these recommendations covering qualifications, limitations, and alternatives

  10. Post-precipitation bias in band-tailed pigeon surveys conducted at mineral sites

    Science.gov (United States)

    Overton, C.T.; Schmitz, R.A.; Casazza, Michael L.

    2005-01-01

    Many animal surveys to estimate populations or index trends include protocol prohibiting counts during rain but fail to address effects of rainfall preceding the count. Prior research on Pacific Coast band-tailed pigeons (Patagioenas fasciata monilis) documented declines in use of mineral sites during rainfall. We hypothesized that prior precipitation was associated with a short-term increase in use of mineral sites following rain. We conducted weekly counts of band-tailed pigeons at 19 Pacific Northwest mineral sites in 2001 and 20 sites in 2002. Results from regression analysis indicated higher counts ???2 days after rain (11.31??5.00% [x????SE]) compared to ???3 days. Individual index counts conducted ???2 days after rain were biased high, resulting in reduced ability to accurately estimate population trends. Models of band-tailed pigeon visitation rates throughout the summer showed increased mineral-site counts during both June and August migration periods, relative to the July breeding period. Our research supported previous studies recommending that mineral-site counts used to index the band-tailed pigeon population be conducted during July. We further recommend conducting counts >3 days after rain to avoid weather-related bias in index estimation. The design of other population sampling strategies that rely on annual counts should consider the influence of aberrant weather not only coincident with but also preceding surveys if weather patterns are thought to influence behavior or detection probability of target species.

  11. Closure Strategy Nevada Test Site Area 5 Radioactive Waste Management Site

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Management

    2007-03-01

    This paper presents an overview of the strategy for closure of part of the Area 5 Radioactive Waste Management Site (RWMS) at the Nevada Test Site (NTS), which is about 65 miles northwest of Las Vegas, Nevada (Figure 1). The Area 5 RWMS is in the northern part of Frenchman Flat, approximately 14 miles north of Mercury. The Area 5 RWMS encompasses 732 acres subdivided into quadrants, and is bounded by a 1,000-foot (ft)-wide buffer zone. The northwest and southwest quadrants have not been developed. The northeast and southeast quadrants have been used for disposal of unclassified low-level radioactive waste (LLW) and indefinite storage of classified materials. This paper focuses on closure of the 38 waste disposal and classified material storage units within the southeast quadrant of the Area 5 RWMS, called the ''92-Acre Area''. The U.S Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office (NNSA/NSO) is currently planning to close the 92-Acre Area by 2011. Closure planning for this site must take into account the regulatory requirements for a diversity of waste streams, disposal and storage configurations, disposal history, and site conditions. For ease of discussion, the 92-Acre Area has been subdivided into six closure units defined by waste type, location, and similarity in regulatory requirements. Each of the closure units contains one or more waste disposal units; waste disposal units are also called waste disposal cells. The paper provides a brief background of the Area 5 RWMS, identifies key closure issues for the 92-Acre Area, recommends actions to address the issues, and provides the National Security Technologies, LLC (NSTec), schedule for closure.

  12. Summary (and) recommendations

    International Nuclear Information System (INIS)

    1992-01-01

    This report looks at the Health and Safety record at the Atomic Weapons Establishment at Aldermaston. The last outside report was by Pochin in 1978 which recommended that staffing for health physicists and maintenance staff should be increased and that some buildings where solid and liquid radioactive wastes were processed should be replaced. A new facility to process contaminated heavy equipment was also recommended. This report finds that none of the recommendations have been fully implemented. It also lists accidents, fires and worker contamination. It is concluded that some of the problems are that nuclear weapons production is inherently unsafe and cannot be made safe, that the secrecy surrounding the establishments' safety record is not good for improving it and finally the report calls for production at Aldermaston to be halted. (UK)

  13. Recommending Multidimensional Queries

    Science.gov (United States)

    Giacometti, Arnaud; Marcel, Patrick; Negre, Elsa

    Interactive analysis of datacube, in which a user navigates a cube by launching a sequence of queries is often tedious since the user may have no idea of what the forthcoming query should be in his current analysis. To better support this process we propose in this paper to apply a Collaborative Work approach that leverages former explorations of the cube to recommend OLAP queries. The system that we have developed adapts Approximate String Matching, a technique popular in Information Retrieval, to match the current analysis with the former explorations and help suggesting a query to the user. Our approach has been implemented with the open source Mondrian OLAP server to recommend MDX queries and we have carried out some preliminary experiments that show its efficiency for generating effective query recommendations.

  14. Draft environmental assessment: Deaf Smith County site, Texas. Nuclear Waste Policy Act (Section 112)

    International Nuclear Information System (INIS)

    1984-12-01

    In February 1983, the US Department of Energy identified a location in Deaf Smith County, Texas, as one of nine potentially acceptable sites for a mined geologic repository for spent nuclear fuel and high-level radioactive waste. The potentially acceptable site was subsequently narrowed to an area of 9 square miles. To determine their suitability, the Deaf Smith site and the eight other potentially acceptable sites have been evaluated in accordance with the DOE's General Guidelines for the Recommendation of Sites for Nuclear Waste Repositories. These evaluations are reported in this draft environmental assessment, which is being issued for public review and comment. The DOE findings and determinations that are based on these evaluations are preliminary and subject to public review and comment. A final EA will be prepared after considering the comments received. On the basis of the evaluations reported in this draft EA, the DOE has found that the Deaf Smith site is not disqualified under the guidelines. The site is in the Permian Basin, which is one of five distinct geohydrologic settings considered for the first repository. This setting contains one other potentially acceptable site - the Swisher site. Although the Swisher site appears to be suitable for site characterization, DOE has concluded that the Deaf Smith site is the preferred site. The DOE finds that the site is suitable for site characterization because the evidence does not support a conclusion that the site will not be able to meet each of the qualifying conditions specified in the guidelines. On the basis of these findings, the DOE is proposing to nominate the Deaf Smith site as one of five sites suitable for characterization. Having compared the Deaf Smith site with the other four sites proposed for nomination, the DOE has determined that the Deaf Smith site is one of the three preferred sites for recommendation to the President as candidates for characterization

  15. Avoiding congestion in recommender systems

    International Nuclear Information System (INIS)

    Ren, Xiaolong; Lü, Linyuan; Liu, Runran; Zhang, Jianlin

    2014-01-01

    Recommender systems use the historical activities and personal profiles of users to uncover their preferences and recommend objects. Most of the previous methods are based on objects’ (and/or users’) similarity rather than on their difference. Such approaches are subject to a high risk of increasingly exposing users to a narrowing band of popular objects. As a result, a few objects may be recommended to an enormous number of users, resulting in the problem of recommendation congestion, which is to be avoided, especially when the recommended objects are limited resources. In order to quantitatively measure a recommendation algorithm's ability to avoid congestion, we proposed a new metric inspired by the Gini index, which is used to measure the inequality of the individual wealth distribution in an economy. Besides this, a new recommendation method called directed weighted conduction (DWC) was developed by considering the heat conduction process on a user–object bipartite network with different thermal conductivities. Experimental results obtained for three benchmark data sets showed that the DWC algorithm can effectively avoid system congestion, and greatly improve the novelty and diversity, while retaining relatively high accuracy, in comparison with the state-of-the-art methods. (paper)

  16. Recommendation Sets and Choice Queries

    DEFF Research Database (Denmark)

    Viappiani, Paolo Renato; Boutilier, Craig

    2011-01-01

    Utility elicitation is an important component of many applications, such as decision support systems and recommender systems. Such systems query users about their preferences and offer recommendations based on the system's belief about the user's utility function. We analyze the connection between...... the problem of generating optimal recommendation sets and the problem of generating optimal choice queries, considering both Bayesian and regret-based elicitation. Our results show that, somewhat surprisingly, under very general circumstances, the optimal recommendation set coincides with the optimal query....

  17. Bedrock Kd data and uncertainty assessment for application in SR-Site geosphere transport calculations

    International Nuclear Information System (INIS)

    Crawford, James

    2010-12-01

    The safety assessment SR-Site is undertaken to assess the safety of a potential geologic repository for spent nuclear fuel at the Forsmark and Laxemar sites. The present report is one of several reports that form the data input to SR-Site and contains a compilation of recommended K d data (i.e. linear partitioning coefficients) for safety assessment modelling of geosphere radionuclide transport. The data are derived for rock types and groundwater compositions distinctive of the site investigation areas at Forsmark and Laxemar. Data have been derived for all elements and redox states considered of importance for far-field dose estimates as described in /SKB 2010d/. The K d data are given in the form of lognormal distributions characterised by a mean (μ) and standard deviation (σ). Upper and lower limits for the uncertainty range of the recommended data are defined by the 2.5% and 97.5% percentiles of the empirical data sets. The best estimate K d value for use in deterministic calculations is given as the median of the K d distribution

  18. A heterogeneous graph-based recommendation simulator

    Energy Technology Data Exchange (ETDEWEB)

    Yeonchan, Ahn [Seoul National University; Sungchan, Park [Seoul National University; Lee, Matt Sangkeun [ORNL; Sang-goo, Lee [Seoul National University

    2013-01-01

    Heterogeneous graph-based recommendation frameworks have flexibility in that they can incorporate various recommendation algorithms and various kinds of information to produce better results. In this demonstration, we present a heterogeneous graph-based recommendation simulator which enables participants to experience the flexibility of a heterogeneous graph-based recommendation method. With our system, participants can simulate various recommendation semantics by expressing the semantics via meaningful paths like User Movie User Movie. The simulator then returns the recommendation results on the fly based on the user-customized semantics using a fast Monte Carlo algorithm.

  19. 1990 recommendations of ICRP

    International Nuclear Information System (INIS)

    Clarke, R.H.

    1991-01-01

    The Main Commission of ICRP finalised its new recommendations during its November 1990 meeting. The recommendations will appear in the Annals of the ICRP in 1991 as Publication 60. This paper represents a personal summary of these recommendations. It covers the basic biological risk estimates and the conceptual framework of the system of radiological protection, the definition of radiation detriment and its use both in the definition of radiation quantities and in the establishment of the dose limits adopted by the Main Commissions. (author)

  20. Introduction on health recommender systems.

    Science.gov (United States)

    Sanchez-Bocanegra, C L; Sanchez-Laguna, F; Sevillano, J L

    2015-01-01

    People are looking for appropriate health information which they are concerned about. The Internet is a great resource of this kind of information, but we have to be careful if we don't want to get harmful info. Health recommender systems are becoming a new wave for apt health information as systems suggest the best data according to the patients' needs.The main goals of health recommender systems are to retrieve trusted health information from the Internet, to analyse which is suitable for the user profile and select the best that can be recommended, to adapt their selection methods according to the knowledge domain and to learn from the best recommendations.A brief definition of recommender systems will be given and an explanation of how are they incorporated in the health sector. A description of the main elementary recommender methods as well as their most important problems will also be made. And, to finish, the state of the art will be described.

  1. Hanford Site National Environmental Policy Act (NEPA) Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Rohay, A.C.; Fosmire, C.J.; Neitzel, D.A.; Hoitink, D.J.; Harvey, D.W.; Antonio, E.J.; Wright, M.K.; Thorne, P.D.; Hendrickson, P.L.; Fowler, R.A.; Goodwin, S.M.; Poston, T.M.

    1999-09-28

    This document describes the US Department of Energy's (DOE) Hanford Site environment. It is updated each year and is intended to provide a consistent description of the Hanford Site environment for the many NEPA documents being prepared by DOE contractors. No conclusions or recommendations are provided. This year's report is the eleventh revision of the original document published in 1988 and is (until replaced by the 12th revision) the only version that is relevant for use in the preparation of Hanford NEPA; SEPA and CERCLA documents. The two chapters included in this document (Chapters 4 and 6) are numbered to correspond to the chapters where such information is presented in environmental impact statements (EISs) and other Site-related NEPA or CERCLA documentation. Chapter 4.0 (Affected Environment) describes Hanford Site climate and meteorology, geology, hydrology, ecology, cultural, archaeological and historical resources, socioeconomic; occupational safety, and noise. Sources for extensive tabular data related to these topics are provided in the chapter. Most subjects are divided into a general description of the characteristics of the Hanford Site, followed by site-specific information, where available, of the 100,200,300, and other Areas. This division allows the reader to go directly to those sections of particular interest. When specific information on each of these separate areas is not complete or available, the general Hanford Site description should be used. Chapter 6.0 (Statutory and Regulatory Requirements) is essentially a definitive NEPA Chapter 6.0, which describes applicable federal and state laws and regulations, DOE directives and permits, and environmental standards directly applicable to the NEPA documents on the Hanford Site. People preparing environmental assessments and EISs should also be cognizant of the document entitled ''Recommendations for the Preparation of Environmental Assessments and Environmental Impact

  2. Dicty_cDB: SHL207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GYSLNNNFYISETPFSLASTTHIDKTFISTNKE AIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSY KFNDTIKINPFEIKTFRFISN*klkiklinky...DTIKINPFEIKTFRFISN*klkiklinkyknkf Translated Amino Acid sequence (All Frames) Frame A: ---*hklgfrki*scrt*mgr...ASTTHIDKTFISTNKE AIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSY KFN

  3. Web vulnerability study of online pharmacy sites.

    Science.gov (United States)

    Kuzma, Joanne

    2011-01-01

    Consumers are increasingly using online pharmacies, but these sites may not provide an adequate level of security with the consumers' personal data. There is a gap in this research addressing the problems of security vulnerabilities in this industry. The objective is to identify the level of web application security vulnerabilities in online pharmacies and the common types of flaws, thus expanding on prior studies. Technical, managerial and legal recommendations on how to mitigate security issues are presented. The proposed four-step method first consists of choosing an online testing tool. The next steps involve choosing a list of 60 online pharmacy sites to test, and then running the software analysis to compile a list of flaws. Finally, an in-depth analysis is performed on the types of web application vulnerabilities. The majority of sites had serious vulnerabilities, with the majority of flaws being cross-site scripting or old versions of software that have not been updated. A method is proposed for the securing of web pharmacy sites, using a multi-phased approach of technical and managerial techniques together with a thorough understanding of national legal requirements for securing systems.

  4. Preventing surgical site infections: a surgeon's perspective.

    OpenAIRE

    Nichols, R. L.

    2001-01-01

    Wound site infections are a major source of postoperative illness, accounting for approximately a quarter of all nosocomial infections. National studies have defined the patients at highest risk for infection in general and in many specific operative procedures. Advances in risk assessment comparison may involve use of the standardized infection ratio, procedure-specific risk factor collection, and logistic regression models. Adherence to recommendations in the 1999 Centers for Disease Contro...

  5. Management of radio-contaminated sites. Analysis of various public policies

    International Nuclear Information System (INIS)

    Massuelle, M.H.; Brenot, J.; Hubert, P.

    1999-01-01

    This paper deals with the management of sites that were contaminated by radioactive substances in the past because of industrial practices, such as the mining, milling and processing of uranium ores, the radium luminizing industry, and thorium processing. Contaminations due to nuclear weapons testing, nuclear accidents and on-going practices are not considered. The management refers to the protection of the near populations and of people who are using the site now or who might use it in the future. International organizations have issued recommendations which apply to these contaminated sites. The concepts called for to manage these de facto situations are intervention, optimization and intervention levels. Few countries have yet elaborated regulations or guidelines concerning the treatment and the use of contaminated sites. The United States has one regulation in preparation that will be generally applicable whereas most countries follow the recommendations of their national radiation protection board on a case by case basis. This paper aims at comparing public policies in several countries by developing first, how policies are defined, and second, how they are implemented in practice. The present survey suffers from the limitation of such an approach. The main limitation lies in the fact that remediation cannot be summarized by a series of prescriptions that can be found in regulatory documents. Rather it is a series of practical decisions that must be investigated, and of recommendations that may not have an official statute and cannot be traced easily. Nevertheless, this work allowed us to put forward some important points. The main one is that flexible approaches are usually adopted. Even when quantitative levels (intervention levels, non intervention levels) are put forward, they can be interpreted in different ways, depending on the approach followed for assessment and on the exact concepts. Should one consider that contaminated sites can be a building in an

  6. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Sky Park Landfill Site in Eau Claire, Wisconsin. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Simon, J.; Mosey, G.

    2013-01-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Sky Park Landfill site in Eau Claire, Wisconsin, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.

  7. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Former Fort Ord Army Base Site in Marina, California. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Stoltenberg, B.; Konz, C.; Mosey, G.

    2013-05-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Former Fort Ord Army Base (FOAB) site in Marina, California, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.

  8. Urgent recommendation. Interim report

    Energy Technology Data Exchange (ETDEWEB)

    Nakano, Masayuki [International Affairs and Safeguards Division, Atomic Energy Bureau, Science and Technology Agency, Tokyo (Japan)

    2000-12-01

    The Investigation Committee for Critical Accident at Uranium Processing Plant was founded immediately after the accident to investigate the cause of the accident and to establish measures to prevent the similar accident. On September 30, 1999 around 10:35, the Japan's first criticality accident occurred at JCO Co. Ltd. Uranium processing plant (auxiliary conversion plant) located at Tokai-mura Ibaraki-ken. The criticality continued on and off for approximately 20 hours after the first instantaneous criticality. The accident led the recommendation of tentative evacuation and sheltering indoors for residents living in the neighborhood. The serious exposure to neutrons happened to three workers. The dominant effect is dose due to neutrons and gamma rays from the precipitation tank. When the accident took place, three workers dissolved sequentially about 2.4 kg uranium powder with 18.8 % enrichment in the 10-litter bucket with nitric acid. The procedure of homogenization of uranium nitrate was supposed to be controlled using the shape-limited narrow storage column. Actually, however, the thick and large precipitation tank was used. As a result, about 16.6 kg of uranium was fed into the tank, which presumably caused criticality. The first notification by JCO was delayed and the following communication was not smooth. This led to the delay of correct understanding of the situation and made the initial proper response difficult, then followed by insufficient communication between the nation, prefecture, and local authority. Urgent recommendations were made on the following items; (1) Safety measures to be taken at the accident site, (2) health cares for residents and others, (3) Comprehensive safety securing at nuclear operators such as Establishment of the effective audit system, Safety education for employees and Qualification and licensing system, Safety related documents, etc. (4) Reconstruction of the government's safety regulations such as How safety

  9. Urgent recommendation. Interim report

    International Nuclear Information System (INIS)

    Nakano, Masayuki

    2000-01-01

    The Investigation Committee for Critical Accident at Uranium Processing Plant was founded immediately after the accident to investigate the cause of the accident and to establish measures to prevent the similar accident. On September 30, 1999 around 10:35, the Japan's first criticality accident occurred at JCO Co. Ltd. Uranium processing plant (auxiliary conversion plant) located at Tokai-mura Ibaraki-ken. The criticality continued on and off for approximately 20 hours after the first instantaneous criticality. The accident led the recommendation of tentative evacuation and sheltering indoors for residents living in the neighborhood. The serious exposure to neutrons happened to three workers. The dominant effect is dose due to neutrons and gamma rays from the precipitation tank. When the accident took place, three workers dissolved sequentially about 2.4 kg uranium powder with 18.8 % enrichment in the 10-litter bucket with nitric acid. The procedure of homogenization of uranium nitrate was supposed to be controlled using the shape-limited narrow storage column. Actually, however, the thick and large precipitation tank was used. As a result, about 16.6 kg of uranium was fed into the tank, which presumably caused criticality. The first notification by JCO was delayed and the following communication was not smooth. This led to the delay of correct understanding of the situation and made the initial proper response difficult, then followed by insufficient communication between the nation, prefecture, and local authority. Urgent recommendations were made on the following items; (1) Safety measures to be taken at the accident site, (2) health cares for residents and others, (3) Comprehensive safety securing at nuclear operators such as Establishment of the effective audit system, Safety education for employees and Qualification and licensing system, Safety related documents, etc. (4) Reconstruction of the government's safety regulations such as How safety regulation

  10. Monitored Retrievable Storage facility site screening and evaluation report

    International Nuclear Information System (INIS)

    1985-05-01

    The Nuclear Waste Policy Act of 1982 directs the Department of Energy to ''complete a detailed study of the need for and feasibility of, and to submit to the Congress a proposal for, the construction of one or more monitored retrievable storage facilities for high level radioactive waste and spent nuclear fuel.'' The Act directs that the proposal includes site specific designs. Further, the proposal is to include, ''for the first such facility, at least three alternative sites and at least five alternative combinations of such proposed sites and facility designs hor-ellipsis'' as well as a recommendation of ''the combination among the alternatives that the Secretary deems preferable.'' An MRS Site Screening Task Force has been formed to help identify and evaluate potential MRS facility sites within a preferred region and with the application of a siting process and criteria developed by the DOE. The activities of the Task Force presented in this report, all site evaluations (sections 13 through 16) where the rationale for the site evaluations are presented, along with each evaluation and findings of the Task Force. This is Volume 3 of a three volume document. References are also included in this volume

  11. Monitored retrievable storage facility site screening and evaluation report

    International Nuclear Information System (INIS)

    1985-05-01

    The Nuclear Waste Policy Act of 1982 directs the Department of Energy to ''complete a detailed study of the need for and feasibility of, and to submit to the Congress a proposal for, the construction of one or more monitored retrievable storage facilities for high level radioactive waste and spent nuclear fuel.'' The Act directs that the proposal includes site specific designs. Further, the proposal is to include, ''for the first such facility, at least three alternative sites and at least five alternative combinations of such proposed sites and facility designs hor-ellipsis'' as well as a recommendation of ''the combination among the alternatives that the Secretary deems preferable.'' An MRS Site Screening Task Force has been formed to help identify and evaluate potential MRS facility sites within a preferred region and with the application of a siting process and criteria developed by the DOE. The activities of the Task Force presented in this report include: site evaluations (sections 10 through 12) where the rationale for the site evaluations are presented, along with each evaluation and findings of the Task Force. This in Volume 2 of a three volume document

  12. Monitored retrievable storage facility site screening and evaluation report

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1985-05-01

    The Nuclear Waste Policy Act of 1982 directs the Department of Energy to complete a detailed study of the need for and feasibility of, and to submit to the Congress a proposal for, the construction of one or more monitored retrievable storage facilities for high level radioactive waste and spent nuclear fuel.'' The Act directs that the proposal includes site specific designs. Further, the proposal is to include, for the first such facility, at least three alternative sites and at least five alternative combinations of such proposed sites and facility designs{hor ellipsis}'' as well as a recommendation of the combination among the alternatives that the Secretary deems preferable.'' An MRS Site Screening Task Force has been formed to help identify and evaluate potential MRS facility sites within a preferred region and with the application of a siting process and criteria developed by the DOE. The activities of the Task Force presented in this report include: site evaluations (sections 10 through 12) where the rationale for the site evaluations are presented, along with each evaluation and findings of the Task Force. This in Volume 2 of a three volume document.

  13. Recommended system of application and development

    Science.gov (United States)

    Wang, Wei

    2018-04-01

    A recommender system is a project that helps users identify their wishes and needs. The recommender system has been successfully applied to many e-commerce environments, such as news, film, music, books and other areas of recommendation. This paper mainly discusses the application of recommendation technology in software engineering, data and knowledge engineering, configurable projects and persuasion technology, and summarizes the development trend of recommendation technology in the future.

  14. OARSI Clinical Trials Recommendations

    DEFF Research Database (Denmark)

    McAlindon, T. E.; Driban, J. B.; Henrotin, Y.

    2015-01-01

    The goal of this document is to update the original OARSI recommendations specifically for the design, conduct, and reporting of clinical trials that target symptom or structure modification among individuals with knee osteoarthritis (OA). To develop recommendations for the design, conduct...

  15. Research on Long Tail Recommendation Algorithm

    Science.gov (United States)

    Hu, Xuezhi; Zhang, Chuang; Wu, Ming; Zeng, Yang

    2017-10-01

    Most recommendation systems in the major electronic commerce platforms are influenced by the long tail effect more or less. There are sufficient researches of how to assess recommendation effect while no criteria to evaluate long tail recommendation rate. In this study, we first discussed the existing problems of recommending long tail products through specific experiments. Then we proposed a long tail evaluation criteria and compared the performance in long tail recommendation between different models.

  16. A Retrospective Management Perspective on Nearly 20 Years of the Savannah River Site Citizen Advisory Board - 13078

    International Nuclear Information System (INIS)

    Belencan, Helen L.; Guevara, Karen C.; Spears, Terrel J.

    2013-01-01

    The Department of Energy, Office of Environmental Management (DOE EM) program has invested in site specific advisory boards since 1994. These boards have served as a portal to the communities surrounding the DOE sites, provided a key avenue for public involvement, and have actively engaged in providing input and feedback that has informed clean up and priority decisions made by EM. Although the EM program has made considerable progress in completing its mission, work will continue for decades, including work at the Savannah River Site (SRS). It is reasonable to assume the advisory boards will continue in their role providing input and feedback to EM. The SRS Citizen Advisory Board (CAB) formed in 1994 and has issued 298 recommendations through September 2012. Although the effectiveness of the board is not measured by the number of recommendations issued, the recommendations themselves serve to illustrate the areas in which the CAB is particularly interested, and offer insight to the overall effectiveness of the CAB as a means for public participation in the EM decision making process. (authors)

  17. Recommendations for the determination of migration parameters by field experiments (tracer tests)

    International Nuclear Information System (INIS)

    Adam, C.

    1989-01-01

    The hydrogeologic review and assessment of candidate sites for nuclear power plants includes expertises on the potential subsurface migration of radionuclides in the event of accident conditions. To this end, knowledge of representative migration parameters is required. Detailed recommendations are given for determining such parameters by tracer field tests, for using standardized terminology in their practical conduct as well as for interpreting the data obtained. Also, mention has been made of recent work reported by other authors on this topic. 31 refs. (author)

  18. Savannah River Site Ingestion Pathway Methodology Manual for Airborne Radioactive Releases

    Energy Technology Data Exchange (ETDEWEB)

    Vincent, A.W. III

    2001-01-03

    This manual documents a recommended methodology for determining the ingestion pathway consequences of hypothetical accidental airborne radiological releases from facilities at the Savannah River Site. Both particulate and tritiated radioactive contaminants are addressed. Other approaches should be applied for evaluation of routine releases.

  19. The siting record: An account of the programs of federal agencies and events that have led to the selection of a potential site for a geologic respository for high-level radioactive waste

    Energy Technology Data Exchange (ETDEWEB)

    Lomenick, T.F.

    1996-03-01

    This record of siting a geologic repository for high-level radioactive wastes (HLW) and spent fuel describes the many investigations that culminated on December 22, 1987 in the designation of Yucca Mountain (YM), as the site to undergo detailed geologic characterization. It recounts the important issues and events that have been instrumental in shaping the course of siting over the last three and one half decades. In this long task, which was initiated in 1954, more than 60 regions, areas, or sites involving nine different rock types have been investigated. This effort became sharply focused in 1983 with the identification of nine potentially suitable sites for the first repository. From these nine sites, five were subsequently nominated by the U.S. Department of Energy (DOE) as suitable for characterization and then, in 1986, as required by the Nuclear Waste Policy Act of 1982 (NWPA), three of these five were recommended to the President as candidates for site characterization. President Reagan approved the recommendation on May 28, 1986. DOE was preparing site characterization plans for the three candidate sites, namely Deaf Smith County, Texas; Hanford Site, Washington; and YM. As a consequence of the 1987 Amendment to the NWPA, only the latter was authorized to undergo detailed characterization. A final Site Characterization Plan for Yucca Mountain was published in 1988. Prior to 1954, there was no program for the siting of disposal facilities for high-level waste (HLW). In the 1940s and 1950s, the volume of waste, which was small and which resulted entirely from military weapons and research programs, was stored as a liquid in large steel tanks buried at geographically remote government installations principally in Washington and Tennessee.

  20. The siting record: An account of the programs of federal agencies and events that have led to the selection of a potential site for a geologic respository for high-level radioactive waste

    International Nuclear Information System (INIS)

    Lomenick, T.F.

    1996-03-01

    This record of siting a geologic repository for high-level radioactive wastes (HLW) and spent fuel describes the many investigations that culminated on December 22, 1987 in the designation of Yucca Mountain (YM), as the site to undergo detailed geologic characterization. It recounts the important issues and events that have been instrumental in shaping the course of siting over the last three and one half decades. In this long task, which was initiated in 1954, more than 60 regions, areas, or sites involving nine different rock types have been investigated. This effort became sharply focused in 1983 with the identification of nine potentially suitable sites for the first repository. From these nine sites, five were subsequently nominated by the U.S. Department of Energy (DOE) as suitable for characterization and then, in 1986, as required by the Nuclear Waste Policy Act of 1982 (NWPA), three of these five were recommended to the President as candidates for site characterization. President Reagan approved the recommendation on May 28, 1986. DOE was preparing site characterization plans for the three candidate sites, namely Deaf Smith County, Texas; Hanford Site, Washington; and YM. As a consequence of the 1987 Amendment to the NWPA, only the latter was authorized to undergo detailed characterization. A final Site Characterization Plan for Yucca Mountain was published in 1988. Prior to 1954, there was no program for the siting of disposal facilities for high-level waste (HLW). In the 1940s and 1950s, the volume of waste, which was small and which resulted entirely from military weapons and research programs, was stored as a liquid in large steel tanks buried at geographically remote government installations principally in Washington and Tennessee

  1. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 2

    International Nuclear Information System (INIS)

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site; to describe the conceptual designs for the repository and the waste package and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. Chapter 3 summarizes present knowledge of the regional and site hydrologic systems. The purpose of the information presented is to (1) describe the hydrology based on available literature and preliminary site-exploration activities that have been or are being performed and (2) provide information to be used to develop the hydrologic aspects of the planned site characterization program. Chapter 4 contains geochemical information about the Yucca Mountain site. The chapter references plan for continued collection of geochemical data as a part of the site characterization program. Chapter 4 describes and evaluates data on the existing climate and site meterology, and outlines the suggested procedures to be used in developing and validating methods to predict future climatic variation. 534 refs., 100 figs., 72 tabs

  2. Site characterization plan: Yucca Mountain site, Nevada research and development area, Nevada: Consultation draft, Nuclear Waste Policy Act: Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-01-01

    The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site; to describe the conceptual designs for the repository and the waste package and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. Chapter 3 summarizes present knowledge of the regional and site hydrologic systems. The purpose of the information presented is to (1) describe the hydrology based on available literature and preliminary site-exploration activities that have been or are being performed and (2) provide information to be used to develop the hydrologic aspects of the planned site characterization program. Chapter 4 contains geochemical information about the Yucca Mountain site. The chapter references plan for continued collection of geochemical data as a part of the site characterization program. Chapter 4 describes and evaluates data on the existing climate and site meterology, and outlines the suggested procedures to be used in developing and validating methods to predict future climatic variation. 534 refs., 100 figs., 72 tabs.

  3. Defining and Supporting Narrative-driven Recommendation

    DEFF Research Database (Denmark)

    Bogers, Toine; Koolen, Marijn

    2017-01-01

    Research into recommendation algorithms has made great strides in recent years. However, these algorithms are typically applied in relatively straightforward scenarios: given information about a user's past preferences, what will they like in the future? Recommendation is often more complex......: evaluating recommended items never takes place in a vacuum, and it is often a single step in the user's more complex background task. In this paper, we define a specific type of recommendation scenario called narrative-driven recommendation, where the recommendation process is driven by both a log...... of the user's past transactions as well as a narrative description of their current interest(s). Through an analysis of a set of real-world recommendation narratives from the LibraryThing forums, we demonstrate the uniqueness and richness of this scenario and highlight common patterns and properties...

  4. Prescription drug brand Web sites: Guidance where none exists

    Directory of Open Access Journals (Sweden)

    Lewis Glinert, Ph.D

    2010-01-01

    Full Text Available This paper applies insights from linguistics and discourse analysis to prescription drug brand Web sites, with special reference to the 100 top-selling drugs. Such sites give the outward appearance of being a place to go for straightforward information about a specific brand. In reality, they present a confused mix of brand information, health information and hype, muddled organization, and poor indication of authority, creating an imbalance between benefit and risk content. In so doing, they breach the letter and spirit of the regulations governing direct-to-consumer advertising, which the FDA has by default applied to such Web sites but which were not designed for this special type of discourse. The many communicative difficulties proven to be caused by Web sites in general, in particular for the elderly and less literate, also pose ethical problems. A rethinking of the verbal and visual design of these drug sites is needed -- and new regulatory guidance, for which this paper offers recommendations. At stake is not just the quality of health information at brand drug sites but also their credibility.

  5. Hybrid context aware recommender systems

    Science.gov (United States)

    Jain, Rajshree; Tyagi, Jaya; Singh, Sandeep Kumar; Alam, Taj

    2017-10-01

    Recommender systems and context awareness is currently a vital field of research. Most hybrid recommendation systems implement content based and collaborative filtering techniques whereas this work combines context and collaborative filtering. The paper presents a hybrid context aware recommender system for books and movies that gives recommendations based on the user context as well as user or item similarity. It also addresses the issue of dimensionality reduction using weighted pre filtering based on dynamically entered user context and preference of context. This unique step helps to reduce the size of dataset for collaborative filtering. Bias subtracted collaborative filtering is used so as to consider the relative rating of a particular user and not the absolute values. Cosine similarity is used as a metric to determine the similarity between users or items. The unknown ratings are calculated and evaluated using MSE (Mean Squared Error) in test and train datasets. The overall process of recommendation has helped to personalize recommendations and give more accurate results with reduced complexity in collaborative filtering.

  6. Relationship between peripheral insertion site and catheter-related phlebitis in adult hospitalized patients: a systematic review.

    Science.gov (United States)

    Comparcini, Dania; Simonetti, Valentina; Blot, Stijn; Tomietto, Marco; Cicolini, Giancarlo

    2017-01-01

    To explore the relationship between the anatomical site of peripheral venous catheterization and risk of catheter-related phlebitis. Peripheral venous catheterization is frequently associated with phlebitis. Recent guidelines, recommend the use of an upper-extremity site for catheter insertion but no univocal consensus exists on the anatomical site with lower risk of phlebitis. Systematic review. We searched Medline (PubMed) and CINAHL (EBSCOhost) databases until the end of January 2017. We also reviewed the reference lists of retrieved articles and gray literature was excluded. Searches were limited to articles published in English with no restriction imposed to date of publication. The primary outcome was the incidence of phlebitis associated with anatomical site of peripheral catheterization. We included randomized controlled trials and observational studies on adult patients who required a peripheral catheter for the administration of medi- cation, intermittent or continuous fluid infusion. Antecubital fossa veins are associated with lower phlebitis rates, while hands veins are the most risky sites to develop phlebitis. There is no consensus regarding vein in forearm. Choosing the right anatomical site to insert a peripheral venous catheter is important to decrease phlebitis rate. Further studies should compare indwelling time in different anatomical sites with phlebitis rate. A more standardized approach in defining and assessing phlebitis among studies is recommended.

  7. Recommender Systems for Learning

    CERN Document Server

    Manouselis, Nikos; Verbert, Katrien; Duval, Erik

    2013-01-01

    Technology enhanced learning (TEL) aims to design, develop and test sociotechnical innovations that will support and enhance learning practices of both individuals and organisations. It is therefore an application domain that generally covers technologies that support all forms of teaching and learning activities. Since information retrieval (in terms of searching for relevant learning resources to support teachers or learners) is a pivotal activity in TEL, the deployment of recommender systems has attracted increased interest. This brief attempts to provide an introduction to recommender systems for TEL settings, as well as to highlight their particularities compared to recommender systems for other application domains.

  8. International recommendations

    International Nuclear Information System (INIS)

    Lindell, Bo

    1986-01-01

    Full text: This short presentation will indicate the general radiation protection background to protective measures against foodstuffs contaminated with radioactive substances. A number of international organizations are involved in various aspects of radiation protection, for example, the International Atomic Energy Agency (IAEA), the United Nations Food and Agriculture Organization (FAO), the United Nations Environment Programme (UNEP), and the World Health Organization (WHO). Two international organizations, however, provide the basic background. These are the International Commission on Radiological Protection (ICRP) and the United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR). UNSCEAR provides the scientific information on radiation levels and effects. It consists of 21 member countries, with truly international coverage. It issues reports to the UN General Assembly, including comprehensive scientific annexes. Its latest comprehensive report was issued in 1982, the next is expected to be published in 1988. That report will include an assessment of the radiological consequences of the Chernobyl accident. The ICRP is a non-governmental organization. It has issued recommendations on radiation protection since 1928. The postulated biological basis for radiation protection recommendations involves two types of biological effects. The so-called non-stochastic effects, mainly due to cell death, appear only when the radiation doses exceed a certain threshold value. These effects, therefore, can only appear after high accidental exposures. After the Chernobyl accident, they only affected about 200 individuals involved in fire extinction and rescue work at the damaged nuclear power plant. Stochastic effects, with some simplification, may be seen as the result of initial changes in the genetic code of some surviving cells. If these cells are germ cells, this may lead to hereditary harm. If they are somatic cells, the result could be cancer

  9. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Standard Chlorine of Delaware Superfund Site in Delaware City, Delaware. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Salasovich, J.; Geiger, J.; Mosey, G.; Healey, V.

    2013-06-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Standard Chlorine of Delaware site in Delaware City, Delaware, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.

  10. Feasibility Study of Economics and Performance of Solar Photovoltaics at the Former Bethlehem Steel Plant Brownfield Site in Lackawanna, New York. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Salasovich, J.; Geiger, J.; Mosey, G.; Healey, V.

    2013-04-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Former Bethlehem Steel Plant site in Lackawanna, New York, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.

  11. Monitored retrievable storage facility site screening and evaluation report

    International Nuclear Information System (INIS)

    1985-05-01

    The Nuclear Waste Policy Act of 1982 directs the Department of Energy to ''complete a detailed study of the need for and feasibility of, and to submit to the Congress a proposal for, the construction of one or more monitored retrievable storage facilities for high level radioactive waste and spent nuclear fuel.'' The Act directs that the proposal includes site specific designs. Further, the proposal is to include, ''for the first such facility, at least three alternative sites and at least five alternative combinations of such proposed site and facility designs...'' as well as a recommendation of ''the combination among the alternatives that the Secretary deems preferable.'' An MRS Site Screening Task Force has been formed to help identify and evaluated potential MRS facility sites within a preferred region and with the application of a siting process and criteria developed by the DOE. The activities of the task force presented in this report includes: site screening (Sections 3, 4, and 5), the MRS facilities which are to be sited are described; the criteria, process and outcome of the screening process is presented; and descriptions of the candidate MRS facility sites are given, and site evaluations (Sections 6 through 9) where the rational for the site evaluations are presented, along with each evaluation and findings of the Task Force

  12. Monitored retrievable storage facility site screening and evaluation report

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1985-05-01

    The Nuclear Waste Policy Act of 1982 directs the Department of Energy to complete a detailed study of the need for and feasibility of, and to submit to the Congress a proposal for, the construction of one or more monitored retrievable storage facilities for high level radioactive waste and spent nuclear fuel.'' The Act directs that the proposal includes site specific designs. Further, the proposal is to include, for the first such facility, at least three alternative sites and at least five alternative combinations of such proposed site and facility designs...'' as well as a recommendation of the combination among the alternatives that the Secretary deems preferable.'' An MRS Site Screening Task Force has been formed to help identify and evaluated potential MRS facility sites within a preferred region and with the application of a siting process and criteria developed by the DOE. The activities of the task force presented in this report includes: site screening (Sections 3, 4, and 5), the MRS facilities which are to be sited are described; the criteria, process and outcome of the screening process is presented; and descriptions of the candidate MRS facility sites are given, and site evaluations (Sections 6 through 9) where the rational for the site evaluations are presented, along with each evaluation and findings of the Task Force.

  13. The Role of Individual-Media Relationship and Consumer Personal Factors on Spanish Teenagers' Mobile Social Networking Sites Usage

    OpenAIRE

    Carla Ruiz-Mafé; Silvia Sanz-Blas; José Martí-Parreño

    2014-01-01

    Social Networking Sites (SNS) are gaining momentum as powerful tools of marketing communications. Mobile phones are becoming one of the most popular devices for accessing Social Networking Sites. In Spain, 44% of Social Networking Sites users access these sites on a daily basis while 79% of them access these sites on a weekly basis. Furthermore, it is notable that over 70% of Social Networking Sites users talk about and recommend commercial brands. This justifies the interest of the study of ...

  14. Current Practices in Global/International Advanced Pharmacy Practice Experiences: Home/Host Country or Site/Institution Considerations.

    Science.gov (United States)

    Alsharif, Naser Z; Dakkuri, Adnan; Abrons, Jeanine P; Williams, Dennis; Ombengi, David N; Zheng, HaiAn; Al-Dahir, Sara; Tofade, Toyin; Gim, Suzanna; O'Connell, Mary Beth; Ratka, Anna; Dornblaser, Emily

    2016-04-25

    International outreach by schools and colleges of pharmacy is increasing. In this paper, we provide current practice guidelines to establish and maintain successful global/international advanced pharmacy practice experiences (G/I APPEs) with specific recommendations for home/host country and host site/institution. The paper is based on a literature review (2000-2014) in databases and Internet searches with specific keywords or terms. Educational documents such as syllabi and memoranda of understanding (MoUs) from pharmacy programs were also examined. In addition, a preliminary draft was developed and the findings and recommendations were reviewed in a 90-minute roundtable discussion at the 2014 American Association of Colleges of Pharmacy Annual Meeting. Recommendations for the host country include travel considerations (eg, passport, visa, air travel), safety, housing, transportation, travel alerts and warnings, health issues, and financial considerations. For the home country, considerations for establishment of G/I APPE site (eg, vetting process, MoU, site expectations) are described. The paper is a resource for development of new G/I APPEs and provides guidance for continuous quality improvement of partnerships focusing on G/I pharmacy education.

  15. Hybrid pine for tough sites

    International Nuclear Information System (INIS)

    Davidson, W.H.

    1994-01-01

    A test planting of 30 first- and second-generation pitch x loblolly pine (pinus rigida x P. taeda) hybrids was established on a West Virginia minesoil in 1985. The site was considered orphaned because earlier attempts at revegetation were unsuccessful. The soil was acid (pH 4.6), lacking in nutrients, and compacted. Vegetation present at the time of planting consisted of a sparse cover of tall fescue (Festuca arundinacea) and poverty grass (Danthonia spicata) and a few sourwood (Oxydendrum arboreum) and mountain laurel (Kalmia latifolia) seedlings. In the planting trial, 30 different hybrids were set out in 4 tree linear plots replicated 5 times. The seedlings had been grown in containers for 1 yr before outplanting. Evaluations made after 6 growing seasons showed overall plantation survival was 93%; six hybrids and one open-pollinated cross survived 100%. Individual tree heights ranged from 50 to 425 cm with a plantation average of 235 cm (7.7 ft). Eleven of the hybrids had average heights that exceeded the plantation average. Another test planting of tree and shrub species on this site has very poor survival. Therefore, pitch x loblolly hybrid pine can be recommended for reclaiming this and similar sites

  16. Surfing the web during pandemic flu: availability of World Health Organization recommendations on prevention

    Directory of Open Access Journals (Sweden)

    Ravà Lucilla

    2010-09-01

    Full Text Available Abstract Background People often search for information on influenza A(H1N1v prevention on the web. The extent to which information found on the Internet is consistent with recommendations issued by the World Health Organization is unknown. Methods We conducted a search for "swine flu" accessing 3 of the most popular search engines through different proxy servers located in 4 English-speaking countries (Australia, Canada, UK, USA. We explored each site resulting from the searches, up to 4 clicks starting from the search engine page, analyzing availability of World Health Organization recommendations for swine flu prevention. Results Information on hand cleaning was reported on 79% of the 147 websites analyzed; staying home when sick was reported on 77.5% of the websites; disposing tissues after sneezing on 75.5% of the websites. Availability of other recommendations was lower. The probability of finding preventative recommendations consistent with World Health Organization varied by country, type of website, and search engine. Conclusions Despite media coverage on H1N1 influenza, relevant information for prevention is not easily found on the web. Strategies to improve information delivery to the general public through this channel should be improved.

  17. Framework for DOE mixed low-level waste disposal: Site fact sheets

    Energy Technology Data Exchange (ETDEWEB)

    Gruebel, M.M.; Waters, R.D.; Hospelhorn, M.B.; Chu, M.S.Y. [eds.

    1994-11-01

    The Department of Energy (DOE) is required to prepare and submit Site Treatment Plans (STPS) pursuant to the Federal Facility Compliance Act (FFCAct). Although the FFCAct does not require that disposal be addressed in the STPS, the DOE and the States recognize that treatment of mixed low-level waste will result in residues that will require disposal in either low-level waste or mixed low-level waste disposal facilities. As a result, the DOE is working with the States to define and develop a process for evaluating disposal-site suitability in concert with the FFCAct and development of the STPS. Forty-nine potential disposal sites were screened; preliminary screening criteria reduced the number of sites for consideration to twenty-six. The DOE then prepared fact sheets for the remaining sites. These fact sheets provided additional site-specific information for understanding the strengths and weaknesses of the twenty-six sites as potential disposal sites. The information also provided the basis for discussion among affected States and the DOE in recommending sites for more detailed evaluation.

  18. Development and validation of the Single Item Trait Empathy Scale (SITES).

    Science.gov (United States)

    Konrath, Sara; Meier, Brian P; Bushman, Brad J

    2018-04-01

    Empathy involves feeling compassion for others and imagining how they feel. In this article, we develop and validate the Single Item Trait Empathy Scale (SITES), which contains only one item that takes seconds to complete. In seven studies (N=5,724), the SITES was found to be both reliable and valid. It correlated in expected ways with a wide variety of intrapersonal outcomes. For example, it is negatively correlated with narcissism, depression, anxiety, and alexithymia. In contrast, it is positively correlated with other measures of empathy, self-esteem, subjective well-being, and agreeableness. The SITES also correlates with a wide variety of interpersonal outcomes, especially compassion for others and helping others. The SITES is recommended in situations when time or question quantity is constrained.

  19. Hanford Site National Environmental Policy Act (NEPA) characterization. Revision 8

    Energy Technology Data Exchange (ETDEWEB)

    Neitzel, D.A. [ed.; Bjornstad, B.N.; Fosmire, C.J.; Fowler, R.A. [and others

    1996-08-01

    This eighth revision of the Hanford Site National Environmental Policy Act (NEPA) Characterization presents current environmental data regarding the Hanford Site and its immediate environs. This information is intended for use in preparing Chapters 4 and 6 in Hanford Site-related NEPA documents. Chapter 4 (Affected Environment) includes information on climate and meteorology, geology, hydrology, ecology, historical, archaeological and cultural resources, socioeconomics, and noise. Chapter 6 (Statutory and Regulatory Requirements) provides the preparer with the federal and state regulations, DOE directives and permits, and environmental standards directly applicable to the NEPA documents on the Hanford Site. The following sections were updated in this revision: climate and meteorology; ecology (threatened and endangered species section only); historical; archaeological and cultural resources; and all of chapter 6. No conclusions or recommendations are given in this report. Rather, it is a compilation of information on the Hanford Site environment that can be used directly by Site contractors. This information can also be used by any interested individual seeking baseline data on the hanford Site and its past activities by which to evaluate projected activities and their impacts.

  20. Hanford Site National Environmental Policy Act (NEPA) characterization. Revision 8

    International Nuclear Information System (INIS)

    Neitzel, D.A.; Bjornstad, B.N.; Fosmire, C.J.; Fowler, R.A.

    1996-08-01

    This eighth revision of the Hanford Site National Environmental Policy Act (NEPA) Characterization presents current environmental data regarding the Hanford Site and its immediate environs. This information is intended for use in preparing Chapters 4 and 6 in Hanford Site-related NEPA documents. Chapter 4 (Affected Environment) includes information on climate and meteorology, geology, hydrology, ecology, historical, archaeological and cultural resources, socioeconomics, and noise. Chapter 6 (Statutory and Regulatory Requirements) provides the preparer with the federal and state regulations, DOE directives and permits, and environmental standards directly applicable to the NEPA documents on the Hanford Site. The following sections were updated in this revision: climate and meteorology; ecology (threatened and endangered species section only); historical; archaeological and cultural resources; and all of chapter 6. No conclusions or recommendations are given in this report. Rather, it is a compilation of information on the Hanford Site environment that can be used directly by Site contractors. This information can also be used by any interested individual seeking baseline data on the hanford Site and its past activities by which to evaluate projected activities and their impacts

  1. Successful characterization of radioactive waste at the Savannah River Site

    International Nuclear Information System (INIS)

    Hughes, M.B.; Miles, G.M.

    1995-01-01

    Characterization of the low-level radioactive waste generated by forty five independent operating facilities at The Savannah River Site (SRS) experienced a slow start. However, the site effectively accelerated waste characterization based on findings of an independent assessment that recommended several changes to the existing process. The new approach included the development of a generic waste characterization protocol and methodology and the formulation of a technical board to approve waste characterization. As a result, consistent, detailed characterization of waste streams from SRS facilities was achieved in six months

  2. The C.L.E.A.N. program: Regulating legacy sites

    International Nuclear Information System (INIS)

    Stenson, R.E.; Clement, C.H.

    2002-01-01

    With the coming into force of the Canadian Nuclear Safety and Control Act (NSCA) on May 31, 2000 many sites, that were not subject to licensing under the previous Atomic Energy Control Act (AECA), now required regulatory review and possibly a licence to possess nuclear substances. To ensure consistency in approach, completeness in coverage, and compliance with internal procedures, the Contaminated Lands Evaluation and Assessment Network (CLEAN) program was developed. Over 200 contaminated lands sites required evaluation. Some of the issues and the interim recommendations to the Commission are discussed. (author)

  3. Clinical practice recommendations for depression.

    Science.gov (United States)

    Malhi, G S; Adams, D; Porter, R; Wignall, A; Lampe, L; O'Connor, N; Paton, M; Newton, L A; Walter, G; Taylor, A; Berk, M; Mulder, R T

    2009-01-01

    To provide clinically relevant evidence-based recommendations for the management of depression in adults that are informative, easy to assimilate and facilitate clinical decision making. A comprehensive literature review of over 500 articles was undertaken using electronic database search engines (e.g. MEDLINE, PsychINFO and Cochrane reviews). In addition articles, book chapters and other literature known to the authors were reviewed. The findings were then formulated into a set of recommendations that were developed by a multidisciplinary team of clinicians who routinely deal with mood disorders. The recommendations then underwent consultative review by a broader advisory panel that included experts in the field, clinical staff and patient representatives. The clinical practice recommendations for depression (Depression CPR) summarize evidence-based treatments and provide a synopsis of recommendations relating to each phase of the illness. They are designed for clinical use and have therefore been presented succinctly in an innovative and engaging manner that is clear and informative. These up-to-date recommendations provide an evidence-based framework that incorporates clinical wisdom and consideration of individual factors in the management of depression. Further, the novel style and practical approach should promote uptake and implementation.

  4. Unit evaluation at Yucca Mountain, Nevada Test Site: summary report and recommendation

    International Nuclear Information System (INIS)

    Johnstone, J.K.; Peters, R.R.; Gnirk, P.F.

    1984-06-01

    Of the four potential repository units, identified at Yucca Mountain, two potential units the welded, devitrified portions of the Bullfrog and Tram Members of the Crater Flat Tuff are below the water table. The welded, devitrified Topopah Spring Member of the Paintbrush Tuff and the nonwelded, zeolitized Tuffaceous Beds of Calico Hills are above the water table. The results of a study of the four potential repository units are to provide a technical basis for selecting a single target repository unit for future test and evaluation. The unit evaluation studies compared the units rather than provided and absolute assessment. The four ranking evaluation criteria used were: radionuclide isolation time; allowable repository gross thermal loading; excavation stability; and relative economics. Considered the most important of the criteria as well as the most difficult, radionuclide isolation times were estimated using the limited existing data. The allowable repository gross thermal loadings determined from near-field calculations, were nearly the same for all four units. The gross thermal loading supported other criteria by providing the heat source for succeeding thermally related evaluation studies. A large number of studies evaluated excavation stability, including near-field mechanical and thermomechanical finite element code calculations studies. A large number of studies evaluated excavation stability, including near-field mechanical and thermomechanical finite element code calculations, rock matrix property evaluation, and rock mass classification. Relative economics, a minor criterion, did not play an explicit role in the final ranking. Based on all of the analyses, the final recommendation was that the Topopah Springs be selected as the target unit, followed, in order, by the Calico Hills, Bullfrog, and Tram

  5. Corrective Action Decision Document/Closure Report for Corrective Action Unit 105: Area 2 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick

    2013-09-01

    This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 105: Area 2 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada. CAU 105 comprises the following five corrective action sites (CASs): -02-23-04 Atmospheric Test Site - Whitney Closure In Place -02-23-05 Atmospheric Test Site T-2A Closure In Place -02-23-06 Atmospheric Test Site T-2B Clean Closure -02-23-08 Atmospheric Test Site T-2 Closure In Place -02-23-09 Atmospheric Test Site - Turk Closure In Place The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation that no further corrective action is needed for CAU 105 based on the implementation of the corrective actions. Corrective action investigation (CAI) activities were performed from October 22, 2012, through May 23, 2013, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 105: Area 2 Yucca Flat Atmospheric Test Sites; and in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices.

  6. Corrective Action Decision Document/Closure Report for Corrective Action Unit 570: Area 9 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick [Navarro-Intera, LLC (N-I), Las Vegas, NV (United States)

    2013-11-01

    This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 570: Area 9 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada. This complies with the requirements of the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the State of Nevada; U.S. Department of Energy (DOE), Environmental Management; U.S. Department of Defense; and DOE, Legacy Management. The purpose of the CADD/CR is to provide justification and documentation supporting the recommendation that no further corrective action is needed.

  7. Corrective Action Decision Document for Corrective Action Unit 536: Area 3 Release Site, Nevada Test Site, Nevada, Revision 0 with Errata

    Energy Technology Data Exchange (ETDEWEB)

    Boehlecke, Robert

    2004-11-01

    This Corrective Action Decision Document (CADD) has been prepared for Corrective Action Unit (CAU) 536: Area 3 Release Site, Nevada Test Site (NTS), Nevada, in accordance with the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S Department of Defense (FFACO, 1996). The NTS is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 536 is comprised of a single Corrective Action Site (CAS), 03-44-02, Steam Jenny Discharge, and is located in Area 3 of the NTS (Figure 1-2). The CAU was investigated in accordance with the Corrective Action Investigation Plan (CAIP) and Record of Technical Change (ROTC) No. 1 (NNSA/NV, 2003). The CADD provides or references the specific information necessary to support the recommended corrective action alternative selected to complete closure of the site. The CAU 536, Area 3 Release Site, includes the Steam Jenny Discharge (CAS 03-44-02) that was historically used for steam cleaning equipment in the Area 3 Camp. Concerns at this CAS include contaminants commonly associated with steam cleaning operations and Area 3 Camp activities that include total petroleum hydrocarbons (TPH), unspecified solvents, radionuclides, metals, and polychlorinated biphenyls (PCBs). The CAIP for Corrective Action Unit 536: Area 3 Release Site, Nevada Test Site, Nevada (NNSA/NV, 2003), provides additional information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for the CAS within CAU 536. The evaluation of corrective action alternatives is based on process knowledge and the results of the investigative activities conducted in accordance with the CAIP (NNSA/NV, 2003) that was approved prior to the start of the

  8. Feasibility Study of Economics and Performance of Geothermal Power Generation at the Lakeview Uranium Mill Site in Lakeview, Oregon. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

    Energy Technology Data Exchange (ETDEWEB)

    Hillesheim, M.; Mosey, G.

    2013-11-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Lakeview Uranium Mill site in Lakeview, Oregon, for a feasibility study of renewable energy production. The EPA contracted with the National Renewable Energy Laboratory (NREL) to provide technical assistance for the project. The purpose of this report is to describe an assessment of the site for possible development of a geothermal power generation facility and to estimate the cost, performance, and site impacts for the facility. In addition, the report recommends development pathways that could assist in the implementation of a geothermal power system at the site.

  9. Extra environmental impact assessment and recommendable measures for their minimization in arranging sanitary inspection room site

    International Nuclear Information System (INIS)

    Rud'ko, V.M.; Batij, V.G.; Kuz'menko, V.A.; Paskevich, S.A.

    2003-01-01

    Environmental impact assessments during the works for preparation of sanitary inspection room site are presented. A range of measures to minimize environmental impact from the works to be implemented,is offered. Impacts on such environmental components as soil,air and aqueous medium,are considered

  10. Site characterization information needs for a high-level waste geologic repository

    International Nuclear Information System (INIS)

    Gupta, D.C.; Nataraja, M.S.; Justus, P.S.

    1987-01-01

    At each of the three candidate sites recommended for site characterization for High-Level Waste Geologic Repository development, the DOE has proposed to conduct both surface-based testing and in situ exploration and testing at the depths that wastes would be emplaced. The basic information needs and consequently the planned surface-based and in situ testing program will be governed to a large extent by the amount of credit taken for individual components of the geologic repository in meeting the performance objectives and siting criteria. Therefore, identified information to be acquired from site characterization activities should be commensurate with DOE's assigned performance goals for the repository system components on a site-specific basis. Because of the uncertainties that are likely to be associated with initial assignment of performance goals, the information needs should be both reasonably and conservatively identified

  11. Hybrid recommendation methods in complex networks.

    Science.gov (United States)

    Fiasconaro, A; Tumminello, M; Nicosia, V; Latora, V; Mantegna, R N

    2015-07-01

    We propose two recommendation methods, based on the appropriate normalization of already existing similarity measures, and on the convex combination of the recommendation scores derived from similarity between users and between objects. We validate the proposed measures on three data sets, and we compare the performance of our methods to other recommendation systems recently proposed in the literature. We show that the proposed similarity measures allow us to attain an improvement of performances of up to 20% with respect to existing nonparametric methods, and that the accuracy of a recommendation can vary widely from one specific bipartite network to another, which suggests that a careful choice of the most suitable method is highly relevant for an effective recommendation on a given system. Finally, we study how an increasing presence of random links in the network affects the recommendation scores, finding that one of the two recommendation algorithms introduced here can systematically outperform the others in noisy data sets.

  12. Internet Presentation of Departments of Pediatric Surgery in Germany and Their Compliance with Recommended Criteria for Promoting Services and Offering Professional Information for Patients.

    Science.gov (United States)

    Farhat, Naim; Zoeller, Christoph; Petersen, Claus; Ure, Benno

    2016-08-01

    Introduction The presentation of health institutions in the internet is highly variable concerning marketing features and medical information. We aimed to investigate the structure and the kind of information provided on the Web sites of all departments of pediatric surgery in Germany. Furthermore, we aimed to identify the degree to which these Web sites comply with internet marketing recommendations for generating business. Method The Web sites of all pediatric surgery units referred to as departments on the official Web site of the German Society of Pediatric Surgery (GSPS) were assessed. The search engine Google was used by entering the terms "pediatric surgery" and the name of the city. Besides general data eight content characteristics focusing on ranking, accessibility, use of social media, multilingual sites, navigation options, selected images, contact details, and medical information were evaluated according to published recommendations. Results A total of 85 departments of pediatric surgery were included. On Google search results 44 (52%) ranked number one and 34 (40%) of the department's homepages were accessible directly through the homepage link of the GSPS. A link to own digital and/or social media was offered on 11 (13%) homepages. Nine sites were multilingual. The most common navigation bar item was clinical services on 74 (87%) homepages. Overall, 76 (89%) departments presented their doctors and 17 (20%) presented other staff members with images of doctors on 53 (62%) and contact data access from the homepage on 68 (80%) Web sites. On 25 (29%) Web sites information on the medical conditions treated were presented, on 17 (20%) details of treating concepts, and on 4 (5%) numbers of patients with specific conditions treated in the own department per year. Conclusion We conclude that numerous of the investigated online presentations do not comply with recommended criteria for offering professional information for patients and for promoting

  13. Assessment of Westinghouse Hanford Company methods for estimating radionuclide release from ground disposal of waste water at the N Reactor sites

    International Nuclear Information System (INIS)

    1988-09-01

    This report summarizes the results of an independent assessment by Golder Associates, Inc. of the methods used by Westinghouse Hanford Company (Westinghouse Hanford) and its predecessors to estimate the annual offsite release of radionuclides from ground disposal of cooling and other process waters from the N Reactor at the Hanford Site. This assessment was performed by evaluating the present and past disposal practices and radionuclide migration data within the context of the hydrology, geology, and physical layout of the N Reactor disposal site. The conclusions and recommendations are based upon the available data and simple analytical calculations. Recommendations are provided for conducting more refined analyses and for continued field data collection in support of estimating annual offsite releases. Recommendations are also provided for simple operational and structural measures that should reduce the quantities of radionuclides leaving the site. 5 refs., 9 figs., 1 tab

  14. Intact and Degraded Component Criticality Calculations of N Reactor Spent Nuclear Fuel

    International Nuclear Information System (INIS)

    L. Angers

    2001-01-01

    The objective of this calculation is to perform intact and degraded mode criticality evaluations of the Department of Energy's (DOE) N Reactor Spent Nuclear Fuel codisposed in a 2-Defense High-Level Waste (2-DHLW)/2-Multi-Canister Overpack (MCO) Waste Package (WP) and emplaced in a monitored geologic repository (MGR) (see Attachment I). The scope of this calculation is limited to the determination of the effective neutron multiplication factor (k eff ) for both intact and degraded mode internal configurations of the codisposal waste package. This calculation will support the analysis that will be performed to demonstrate the technical viability for disposing of U-metal (N Reactor) spent nuclear fuel in the potential MGR

  15. Monitored Retrievable Storage facility site screening and evaluation report

    Energy Technology Data Exchange (ETDEWEB)

    none,

    1985-05-01

    The Nuclear Waste Policy Act of 1982 directs the Department of Energy to complete a detailed study of the need for and feasibility of, and to submit to the Congress a proposal for, the construction of one or more monitored retrievable storage facilities for high level radioactive waste and spent nuclear fuel.'' The Act directs that the proposal includes site specific designs. Further, the proposal is to include, for the first such facility, at least three alternative sites and at least five alternative combinations of such proposed sites and facility designs {hor ellipsis}'' as well as a recommendation of the combination among the alternatives that the Secretary deems preferable.'' An MRS Site Screening Task Force has been formed to help identify and evaluate potential MRS facility sites within a preferred region and with the application of a siting process and criteria developed by the DOE. The activities of the Task Force presented in this report, all site evaluations (sections 13 through 16) where the rationale for the site evaluations are presented, along with each evaluation and findings of the Task Force. This is Volume 3 of a three volume document. References are also included in this volume.

  16. AMF 1 Site Science

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Mark Alan [Rutgers Univ., New Brunswick, NJ (United States)

    2016-08-18

    This report documents progress on DOE Grant# DE-FG02-08ER64531 funded by the Department of Energy’s Atmospheric Systems Research (ASR) program covering the period between its inception in 2008 and its conclusion in 2014. The Atmospheric Radiation Measurement (ARM) Program’s Mobile Facility #1 (AMF#1) is a collection of state-of-the art atmospheric sensing systems including remote and in situ instrumentation designed to characterize the atmospheric column above and in the immediate vicinity of the deployment location. The grant discussed in this report funded the activities of the AMF#1 Site Scientist Team. Broad responsibilities of this team included examining new deployment sites and recommending instrument deployment configurations; data quality control during the early stages of deployments and for certain instruments through the course of the deployment; scientific outreach in the host country or location (particularly international deployments); scientific research oriented toward basic questions about cloud physics and radiation transfer in the deployment region; and training of Ph.D. students to conduct future research relevant to the Atmospheric Systems Research (ASR) program.

  17. USGEO DMWG Cloud Computing Recommendations

    Science.gov (United States)

    de la Beaujardiere, J.; McInerney, M.; Frame, M. T.; Summers, C.

    2017-12-01

    The US Group on Earth Observations (USGEO) Data Management Working Group (DMWG) has been developing Cloud Computing Recommendations for Earth Observations. This inter-agency report is currently in draft form; DMWG hopes to have released the report as a public Request for Information (RFI) by the time of AGU. The recommendations are geared toward organizations that have already decided to use the Cloud for some of their activities (i.e., the focus is not on "why you should use the Cloud," but rather "If you plan to use the Cloud, consider these suggestions.") The report comprises Introductory Material, including Definitions, Potential Cloud Benefits, and Potential Cloud Disadvantages, followed by Recommendations in several areas: Assessing When to Use the Cloud, Transferring Data to the Cloud, Data and Metadata Contents, Developing Applications in the Cloud, Cost Minimization, Security Considerations, Monitoring and Metrics, Agency Support, and Earth Observations-specific recommendations. This talk will summarize the recommendations and invite comment on the RFI.

  18. Recommendation System for Adaptive Learning.

    Science.gov (United States)

    Chen, Yunxiao; Li, Xiaoou; Liu, Jingchen; Ying, Zhiliang

    2018-01-01

    An adaptive learning system aims at providing instruction tailored to the current status of a learner, differing from the traditional classroom experience. The latest advances in technology make adaptive learning possible, which has the potential to provide students with high-quality learning benefit at a low cost. A key component of an adaptive learning system is a recommendation system, which recommends the next material (video lectures, practices, and so on, on different skills) to the learner, based on the psychometric assessment results and possibly other individual characteristics. An important question then follows: How should recommendations be made? To answer this question, a mathematical framework is proposed that characterizes the recommendation process as a Markov decision problem, for which decisions are made based on the current knowledge of the learner and that of the learning materials. In particular, two plain vanilla systems are introduced, for which the optimal recommendation at each stage can be obtained analytically.

  19. Fusing Recommendations for Social Bookmarking Websites

    DEFF Research Database (Denmark)

    Bogers, Toine; van den Bosch, Antal

    2011-01-01

    Social bookmarking websites are rapidly growing in popularity. Recommender systems, a promising remedy to the information overload accompanying the explosive growth in content, are designed to identify which unseen content might be of interest to a particular user, based on his or her past...... that use tag overlap and metadata provide better results for social bookmarking data sets than the transaction patterns that are used traditionally in recommender systems research. In addition, we investigate how to fuse different recommendation approaches to further improve recommendation accuracy. We...... preferences. Most previous work in recommendation for social bookmarking suffers from a lack of comparisons between the different available approaches. In this article, we address this issue by comparing and evaluating eight recommendation approaches on four data sets from two domains. We find that approaches...

  20. WIPP site and vicinity geological field trip

    International Nuclear Information System (INIS)

    Chaturvedi, L.

    1980-10-01

    The Environmental Evaluation Group (EEG) is conducting an assessment of the radiological health risks to people from the Waste Isolation Pilot Plant (WIPP). As a part of this work, EEG is making an effort to improve the understanding of those geological issues concerning the WIPP site which may affect the radiological consequences of the proposed repository. One of the important geological issues to be resolved is the timing and the nature of the dissolution processes which may have affected the WIPP site. EEG organized a two-day conference of geological scientists, titled Geotechnical Considerations for Radiological Hazard Assessment of WIPP on January 17-18, 1980. During this conference, it was realized that a field trip to the site would further clarify the different views on the geological processes active at the site. The field trip of June 16-18, 1980 was organized for this purpose. This report provides a summary of the field trip activities along with the participants post field trip comments. Important field stops are briefly described, followed by a more detailed discussion of critical geological issues. The report concludes with EEG's summary and recommendations to the US Department of Energy for further information needed to more adequately resolve concerns for the geologic and hydrologic integrity of the site