Cinco translações, 10 edições

OpenAIRE

Ângela Tonietto; Bruno Telles; Charles A. Andrade; Claudemir R. Dias Filho; Juliano A. Gomes

2016-01-01

Após cinco translações em torno da estrela do Sistema Solar e nove edições publicadas, a Revista Brasileira de Criminalística entrega hoje o terceiro número do seu quinto volume, completando assim cinco anos ininterruptos de publicações com sua décima edição.

EDI and the Technical Communicator.

Science.gov (United States)

Eiler, Mary Ann

1994-01-01

Assesses the role of technical communicators in electronic data interchange (EDI). Argues that, as experts in information design, human factors, instructional theory, and professional writing, technical communicators should be advocates of standard documentation protocols and should rethink the traditional concepts of "document" to…

Pro EDI in BizTalk Server 2006 R2 electronic document interchange solutions

CERN Document Server

Beckner, Mark

2008-01-01

As business becomes more dependent on working with partners, suppliers, and other organizations in a streamlined way, Electronic Data Interchange (EDI) is one of the next big waves in connected systems. Microsoft BizTalk Server 2006 R2 offers an efficient, integrated way to deploy EDI solutions, and with the help of this book, readers will see how EDI can be used in their business and how best to get it set up with BizTalk. This book offers insights into the brand-new Biztalk 2006 R2--based EDI functionality, including the far greater flexibility in handling interchange. It gives advice coveri

The new Exponential Directional Iterative (EDI) 3-D Sn scheme for parallel adaptive differencing

International Nuclear Information System (INIS)

Sjoden, G.E.

2005-01-01

The new Exponential Directional Iterative (EDI) discrete ordinates (Sn) scheme for 3-D Cartesian Coordinates is presented. The EDI scheme is a logical extension of the positive, efficient Exponential Directional Weighted (EDW) Sn scheme currently used as the third level of the adaptive spatial differencing algorithm in the PENTRAN parallel discrete ordinates solver. Here, the derivation and advantages of the EDI scheme are presented; EDI uses EDW-rendered exponential coefficients as initial starting values to begin a fixed point iteration of the exponential coefficients. One issue that required evaluation was an iterative cutoff criterion to prevent the application of an unstable fixed point iteration; although this was needed in some cases, it was readily treated with a default to EDW. Iterative refinement of the exponential coefficients in EDI typically converged in fewer than four fixed point iterations. Moreover, EDI yielded more accurate angular fluxes compared to the other schemes tested, particularly in streaming conditions. Overall, it was found that the EDI scheme was up to an order of magnitude more accurate than the EDW scheme on a given mesh interval in streaming cases, and is potentially a good candidate as a fourth-level differencing scheme in the PENTRAN adaptive differencing sequence. The 3-D Cartesian computational cost of EDI was only about 20% more than the EDW scheme, and about 40% more than Diamond Zero (DZ). More evaluation and testing are required to determine suitable upgrade metrics for EDI to be fully integrated into the current adaptive spatial differencing sequence in PENTRAN. (author)

[A German version of the Eating Disorder Inventory EDI-2].

Science.gov (United States)

Thiel, A; Jacobi, C; Horstmann, S; Paul, T; Nutzinger, D O; Schüssler, G

1997-01-01

The paper presents a German version of the second revised edition of the Eating Disorder Inventory EDI-2 (Garner 1991). The EDI-2 is a self-rating inventory (self-report measure) with 91 items and 11 subscales designed for the assessment of attitudinal and behavioural dimensions relevant to anorexia and bulimia nervosa. It consists of the eight original subscales: drive for thinness, bulimia, body dissatisfaction, ineffectiveness, perfectionism, interpersonal distrust, interoception and maturity fears, and the three new subscales: asceticism, impulse regulation and social insecurity. The German EDI-2 was given to 71 patients with anorexia or bulimia nervosa, 30 patients with binge eating disorder, a control group of 186 women and a further control group of 102 men. In comparison to the female control group, patient groups showed significantly elevated means on all subscales. Item analysis revealed sufficient internal consistencies for all subscales except subscale 9 (asceticism) with Cronbachs alpha ranging from 0.58 to 0.90. Twelve of the 91 items showed poor item total scale correlations below 0.40. Factor analysis supported a six-factor-structure. Hence, the reliability and validity of the three new subscales was confirmed only partially. The use of the EDI-2 in therapy research and clinical practice is critically discussed.

Ediţii ale Clasificării Zecimale Dewey

Directory of Open Access Journals (Sweden)

Zenovia Niculescu

2009-01-01

Full Text Available Studiul abordează evoluţia ediţiilor C.Z.D. din perspective actualizării terminologiei, realocărilor şi extinderii structurii principale şi auxiliare a limbajului de indexare Dewey. Analiza comparativă a ediţiilor C.Z.D. reflectă amplificarea şi eficientizarea schemei Dewey din punct de vedere al îmbunătăţirii ofertei informaţionale, prin indici de bază revizuiţi şi dezvoltaţi, precum şi a valorizării notaţiilor auxiliare.

Statistical properties of effective drought index (EDI) for Seoul, Busan, Daegu, Mokpo in South Korea

Science.gov (United States)

Park, Jong-Hyeok; Kim, Ki-Beom; Chang, Heon-Young

2014-08-01

Time series of drought indices has been considered mostly in view of temporal and spatial distributions of a drought index so far. Here we investigate the statistical properties of a daily Effective Drought Index (EDI) itself for Seoul, Busan, Daegu, Mokpo for the period of 100 years from 1913 to 2012. We have found that both in dry and wet seasons the distribution of EDI as a function of EDI follows the Gaussian function. In dry season the shape of the Gaussian function is characteristically broader than that in wet seasons. The total number of drought days during the period we have analyzed is related both to the mean value and more importantly to the standard deviation. We have also found that according to the distribution of the number of occasions where the EDI values of several consecutive days are all less than a threshold, the distribution follows the exponential distribution. The slope of the best fit becomes steeper not only as the critical EDI value becomes more negative but also as the number of consecutive days increases. The slope of the exponential distribution becomes steeper as the number of the city in which EDI is simultaneously less than a critical EDI in a row increases. Finally, we conclude by pointing out implications of our findings.

Electronic Transcripts--EDI in Academic Administration.

Science.gov (United States)

Carson, E. W.

1991-01-01

Newly developed electronic data interchange (EDI) standards for exchanging academic records between colleges and universities are explained. It is argued that implementation of the new standards in college registrar and admissions offices can improve speed, costs, and accuracy and provide a prototype for a variety of campus business applications.…

An arithmetic transference proof of a relative Szemer\\'edi theorem

OpenAIRE

Zhao, Yufei

2013-01-01

Recently Conlon, Fox, and the author gave a new proof of a relative Szemer\\'edi theorem, which was the main novel ingredient in the proof of the celebrated Green-Tao theorem that the primes contain arbitrarily long arithmetic progressions. Roughly speaking, a relative Szemer\\'edi theorem says that if S is a set of integers satisfying certain conditions, and A is a subset of S with positive relative density, then A contains long arithmetic progressions, and our recent results show that S only ...

Magnetic field gradients inferred from multi-point measurements of Cluster FGM and EDI

Science.gov (United States)

Teubenbacher, Robert; Nakamura, Rumi; Giner, Lukas; Plaschke, Ferdinand; Baumjohann, Wolfgang; Magnes, Werner; Eichelberger, Hans; Steller, Manfred; Torbert, Roy

2013-04-01

We use Cluster data from fluxgate magnetometer (FGM) and electron drift instrument (EDI) to determine the magnetic field gradients in the near-Earth magnetotail. Here we use the magnetic field data from FGM measurements as well as the gyro-time data of electrons determined from the time of flight measurements of EDI. The results are compared with the values estimated from empirical magnetic field models for different magnetospheric conditions. We also estimated the spin axis offset of FGM based on comparison between EDI and FGM data and discuss the possible effect in determining the current sheet characteristics.

Determinants of EDI (Electronic Data Interchange) Adoption and Integration in the US and Japanese Automobile Suppliers

OpenAIRE

Sam Kurokawa; Seiji Manabe

2002-01-01

This paper examines determinants of EDI adoption and integration in the US and Japanese automobile suppliers. The paper constructs several hypotheses based on the transaction-cost and resource- dependence approaches, and tests these hypotheses by using data from the automobile suppliers. Our study shows: (1) the resource-dependence approach seemed more effective in explaining EDI adoption, while the transaction-cost approach seemed more effective in explaining EDI integration; (2) the transac...

DOD Electronic Commerce (EC)/Electronic Data Interchange (EDI) in contracting report

Science.gov (United States)

1993-12-01

Use of Electronic Commerce (EC)/Electronic Data Interchange (EDI) to support Department of Defense (DoD) procurement processes has been under consideration for some time. A 1988 Deputy Secretary of Defense memo calls for maximum use of EDI, based on 10 years of DoD EDI investigation and experiments. In 1990, Defense Management Review Decision 941 stated, 'The strategic goal of DoD's current efforts is to provide the department with the capability to initiate, conduct, and maintain its external business related transactions and internal logistics, contracting, and financial activities without requiring the use of hard copy media.' The EC in Contracting PAT membership reflected a broad cross section of Military Services and Defense Agencies working on a full-time basis for 60 days. The diversity of the EC in Contracting PAT ensured that the needs and concerns of all DoD components were addressed during the creation of the report. The resultant plan, therefore, represents a comprehensive approach for implementing EC throughout the DoD.

Measurement Invariance of Early Development Instrument (EDI) Domain Scores across Gender and ESL Status

Science.gov (United States)

Mousavi, Amin; Krishnan, Vijaya

2016-01-01

The Early Development Instrument (EDI) is a widely used teacher rating tool to assess kindergartners' developmental outcomes in Canada and a number of other countries. This paper examines the measurement invariance of EDI domains across ESL status and gender by means of multi-group confirmatory factor analysis. The results suggest evidence of…

JST Thesaurus Headwords and Synonyms: EDI [MeCab user dictionary for science technology term[Archive

Lifescience Database Archive (English)

Full Text Available MeCab user dictionary for science technology term EDI 名詞 一般 * * * * ＥＤＩ【情報交換】 ＥＤＩ イーディーアイ Thesaurus2015 200906091295492920 C EG01 UNKNOWN_1 EDI

Numerical simulation of the electrodeionization (EDI) process accounting for water dissociation

International Nuclear Information System (INIS)

Lu Jun; Wang Yuxin; Zhu Jia

2010-01-01

The electrodeionization process (EDI) is usually operated at overlimiting current density, and is thus characterized by water dissociation and concentration polarization. We attempt to study the useful and harmful effects of water dissociation on the EDI process. A numerical steady state model was established to simulate the process of EDI, accounting for the effects of water dissociation. The differences in concentration polarization of membranes were investigated to study the effects of water dissociation on cation and anion membranes. Protons produced by water dissociation caused the resin to transform into the H-form. The H-form resin, which has high conductivity and high transport number, depletes protons in the interstitial solution. This explains the experimentally detected phenomenon that at high current densities, the pH value of the effluency of the dilute compartment (DC) stops decreasing when current increases. We suggest that the useful role of water dissociation in EDI is due to the H-form resin bringing more salt cations of the interstitial solution into the resin phase, thus producing a high conductivity channel for the electro-migration of the salt cations. This mechanism avoids the decrease in salt ion conductivity brought about by concentration polarization. The disadvantageous effect of concentration polarization on the transportation of salt ions in interstitial solution is thus lessened. An intermediate point between the useful and harmful effects of water dissociation was determined by the dependence of current efficiency and removal rate for both cations and anions as a function of current density.

EdiPy: a resource to simulate the evolution of plant mitochondrial genes under the RNA editing.

Science.gov (United States)

Picardi, Ernesto; Quagliariello, Carla

2006-02-01

EdiPy is an online resource appropriately designed to simulate the evolution of plant mitochondrial genes in a biologically realistic fashion. EdiPy takes into account the presence of sites subjected to RNA editing and provides multiple artificial alignments corresponding to both genomic and cDNA sequences. Each artificial data set can successively be submitted to main and widespread evolutionary and phylogenetic software packages such as PAUP, Phyml, PAML and Phylip. As an online bioinformatic resource, EdiPy is available at the following web page: http://biologia.unical.it/py_script/index.html.

41 CFR 102-118.550 - How does a TSP file an administrative claim using EDI or other electronic means?

Science.gov (United States)

2010-07-01

... administrative claim using EDI or other electronic means? 102-118.550 Section 102-118.550 Public Contracts and... EDI or other electronic means? The medium and precise format of data for an administrative claim filed electronically must be approved in advance by the GSA Audit Division. GSA will use an authenticating EDI...

Does the EDI Equivalently Measure Facets of School Readiness for Aboriginal and Non-Aboriginal Children?

Science.gov (United States)

Muhajarine, Nazeem; Puchala, Chassidy; Janus, Magdalena

2011-01-01

The aim of the current paper was to examine the equivalence of the Early Development Instrument (EDI), a teacher rating measure of school readiness, for Aboriginal and non-Aboriginal children. The current study used an approach, which analyzes the structure and properties of the EDI at the subdomain level. Similar subdomain score distributions…

The EDIE method – towards an approach to collaboration-based persuasive design

DEFF Research Database (Denmark)

Hansen, Sandra Burri Gram

2016-01-01

This paper presents the initial steps towards a collaboration-based method for persuasive design – the EDIE method (Explore, Design, Implement, Evaluate). The method is inspired by Design-Based Research, but developed to combine different design approaches that have dominated the persuasive...... technology field over the past decade. The rhetorical notion of Kairos is considered a key element in the EDIE method, resulting in a distinct focus on participatory design and constructive ethics. The method is explained through a practical example of developing persuasive learning designs in collaboration...

Investigation of the effect of heated ethanol fuel on combustion and emissions of an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

International Nuclear Information System (INIS)

Huang, Yuhan; Hong, Guang

2016-01-01

Highlights: • Effect of EDI heating on the EDI + GPI engine performance was investigated. • CO and HC were significantly reduced and NO was slightly increased by EDI heating. • IMEP and combustion speed were slightly reduced by EDI heating. • EDI heating is effective to address the evaporation and over-cooling issues of EDI + GPI engine. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to utilise ethanol fuel more efficiently and flexibly in spark ignition engines. One issue needs to be addressed in the development of EDI + GPI is the ethanol fuel’s low vapour pressure and large latent heat which slow down the ethanol’s evaporation and result in the mixture unready for combustion by the time of spark ignition and the consequent increase of CO and HC emissions. Heating the ethanol fuel to be directly injected (EDI heating) has been proposed to address this issue. This paper reports the investigation of the effect of EDI heating on the combustion and emissions of a research engine equipped with EDI + GPI. The results showed that EDI heating effectively reduced the CO and HC emissions of the engine due to the increase of evaporation rate and reduced fuel impingement and local over-cooling. The reduction of CO and HC became more significant with the increase of ethanol ratio. When the temperature of the ethanol fuel was increased by 40 °C, the CO and HC were reduced by as much as 43% and 51% respectively in EDI only condition at the original spark timing of 15 CAD BTDC, and 15% and 47% respectively at the minimum spark advance for best torque (MBT) timing of 19 CAD BTDC. On the other hand, the NO emission was slightly increased, but still much smaller than that in GPI only condition due to the strong cooling effect and low combustion temperature of EDI. The IMEP and combustion speed were slightly reduced by EDI heating due to the decrease of injector fuel flow rate and spray collapse of flash-boiling. The

Optomechanical fabrication of EDiFiSE spectrometer

Science.gov (United States)

Arredondo-Vega, Luis; Pérez-Santos, Carlos; Pompa-Carrera, Octavio; Ruiz-Márquez, Armando; Hurtado-Ortega, José; Paez, Gonzalo

2011-09-01

The purpose of this work is to describe some optical and mechanical issues relating to the fabrication of the camera and the collimator of the Equalized and Diffraction-Limited Field Spectrograph Experiment (EDiFiSE), an instrument which forms part of a bigger project of the Instituto de Astrofísica de Canarias (IAC), Spain, and that was designed and manufactured within the facilities of Centro de Investigaciones en Óptica in León, México.

Edição Especial: 6 V-EEGAM

OpenAIRE

João Cândido André da Silva Neto; Thiago Oliveira Neto

2017-01-01

A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

Rancang Bangun Aplikasi Transaksi Elektronik Ritel Pupuk Dengan Metode Electronic Data Interchange (EDI

Directory of Open Access Journals (Sweden)

Nelly Oktavia Adiwijaya

2015-03-01

Full Text Available Fertilizer distribution from distributor to agents, are required to be responsive in addressing the demand for fertilizers. Distributors are also required to be able to manage inventory in the warehouse, to avoid overstocking of fertilizer. Design and implementation of a fertilizer retail electronic commerce applications using electronic data interchange (EDI method is applied in this study. The system is built to help distributors to control the existence of the stock of fertilizer so no excess stock. In addition, the use of EDI can provide information quickly (real-time without having to go directly to the warehouse locations.

Edição Especial: 6 V-EEGAM

Directory of Open Access Journals (Sweden)

João Cândido André da Silva Neto

2017-05-01

Full Text Available A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

Numerical investigation to the dual-fuel spray combustion process in an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

International Nuclear Information System (INIS)

Huang, Yuhan; Hong, Guang; Huang, Ronghua

2015-01-01

Highlights: • A 5D PDF table was used to model the dual-fuel turbulence–chemistry interactions. • The cooling effect of ethanol direct injection (EDI) was examined. • The higher flame speed of ethanol in EDI + GPI increased the thermal efficiency. • The partially premixed combustion in EDI + GPI reduced the combustion temperature. • Ethanol’s low evaporation rate in low temperature led to incomplete combustion. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to make the use of ethanol fuel more effective and efficient in spark ignition engines. Multi-dimensional computational fluid dynamics modelling was conducted on an EDI + GPI engine in both single and dual fuelled conditions. The in-cylinder flow field was solved in the realizable k−ε turbulence model with detailed engine geometry. The temporal and spatial distributions of the liquid and vapour fuels were simulated with the spray breakup and evaporation models. The combustion process was modelled with the partially premixed combustion concept in which both mixture fraction and progress variable were solved. The three-dimensional and five-dimensional presumed Probability Density Function (PDF) look-up tables were used to model the single-fraction-mixture and two-fraction-mixture turbulence–chemistry interactions respectively. The model was verified by comparing the numerical and experimental results of spray pattern and cylinder pressure. The simulation results showed that the combustion process of EDI + GPI dual-fuelled condition was partially premixed combustion because of the low evaporation rate of ethanol spray in low temperature environment before combustion. Compared with GPI only, the higher flame speed of ethanol fuel contributed to the greater pressure rise rate and maximum cylinder pressure in EDI + GPI condition, which consequently resulted in higher power output and thermal efficiency. The lower adiabatic flame temperature of

Improvement of the classification accuracy in discriminating diabetic retinopathy by multifocal electroretinogram analysis

Institute of Scientific and Technical Information of China (English)

无

2007-01-01

The multifocal electroretinogram (mfERG) is a newly developed electrophysiological technique. In this paper, a classification method is proposed for early diagnosis of the diabetic retinopathy using mfERG data. MfERG records were obtained from eyes of healthy individuals and patients with diabetes at different stages. For each mfERG record, 103 local responses were extracted. Amplitude value of each point on all the mfERG local responses was looked as one potential feature to classify the experimental subjects. Feature subsets were selected from the feature space by comparing the inter-intra distance. Based on the selected feature subset, Fisher's linear classifiers were trained. And the final classification decision of the record was made by voting all the classifiers' outputs. Applying the method to classify all experimental subjects, very low error rates were achieved. Some crucial properties of the diabetic retinopathy classification method are also discussed.

Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI: Test report

Energy Technology Data Exchange (ETDEWEB)

NONE

1994-08-15

This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s ``Blue Ribbon`` contractors, located throughout the US. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote. Lessons learned from the test are being fed back to the CALS and EDI standards organizations, and to future implementors of CALS-EDI based acquisition or contracting systems, which require the transfer of technical information, such as engineering data, manufacturing process data, quality test data, and other product or process data, in the form of a CALS or other digital datafile.

Direct Observations of ULF and Whistler-Mode Chorus Modulation of 500eV EDI Electrons by MMS

Science.gov (United States)

Paulson, K. W.; Argall, M. R.; Ahmadi, N.; Torbert, R. B.; Le Contel, O.; Ergun, R.; Khotyaintsev, Y. V.; Strangeway, R. J.; Magnes, W.; Russell, C. T.

2016-12-01

We present here direct observations of chorus-wave modulated field-aligned 500 eV electrons using the Electron Drift Instrument (EDI) on board the Magnetospheric Multiscale mission. These periods of wave activity were additionally observed to be modulated by Pc5-frequency magnetic perturbations, some of which have been identified as drifting mirror-mode structures. The spacecraft encountered these mirror-mode structures just inside of the duskside magnetopause. Using the high sampling rate provided by EDI in burst sampling mode, we are able to observe the individual count fluctuations of field-aligned electrons in this region up to 512 Hz. We use the multiple look directions of EDI to generate both pitch angle and gyrophase plots of the fluctuating counts. Our observations often show unidirectional flow of these modulated electrons along the background field, and in some cases demonstrate gyrophase bunching in the wave region.

Analysis of Dream in Gholamhossein Sa'edi's Short Stories: A Model for Dream Analysis in Literary Works

Science.gov (United States)

Veskari, Hassan; Pouralkhas, Shokrollah; Moharrami, Ramin; Ranjbar, Ebrahim

2017-01-01

Gholam Hussein Sa'edi is one of the greatest Iranian writers of short stories in the present era. Sa'edi's stories are based on the existence of fanciful and dreamlike settings in which he attempts to establish the endings of the stories to be the direct result of the characters' psychological reaction against their dreams. The linguistic and…

Validation of Multilevel Constructs: Validation Methods and Empirical Findings for the EDI

Science.gov (United States)

Forer, Barry; Zumbo, Bruno D.

2011-01-01

The purposes of this paper are to highlight the foundations of multilevel construct validation, describe two methodological approaches and associated analytic techniques, and then apply these approaches and techniques to the multilevel construct validation of a widely-used school readiness measure called the Early Development Instrument (EDI;…

Interhemispheric differences in ionospheric convection: Cluster EDI observations revisited

Science.gov (United States)

Förster, M.; Haaland, S.

2015-07-01

The interaction between the interplanetary magnetic field and the geomagnetic field sets up a large-scale circulation in the magnetosphere. This circulation is also reflected in the magnetically connected ionosphere. In this paper, we present a study of ionospheric convection based on Cluster Electron Drift Instrument (EDI) satellite measurements covering both hemispheres and obtained over a full solar cycle. The results from this study show that average flow patterns and polar cap potentials for a given orientation of the interplanetary magnetic field can be very different in the two hemispheres. In particular during southward directed interplanetary magnetic field conditions, and thus enhanced energy input from the solar wind, the measurements show that the southern polar cap has a higher cross polar cap potential. There are persistent north-south asymmetries, which cannot easily be explained by the influence of external drivers. These persistent asymmetries are primarily a result of the significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemispheres. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace.

Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

Energy Technology Data Exchange (ETDEWEB)

Sigrist, Manuel [Swan Systeme AG, Hinwil (Switzerland)

2017-10-15

The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

International Nuclear Information System (INIS)

Sigrist, Manuel

2017-01-01

The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

Identification of Disciplines and Fields. Edis Task I Report, Work Unit 1.4.

Science.gov (United States)

Howard Research Co., Arlington, VA.

This report presents the identification and definitions of subject oriented engineering and scientific disciplines and fields which are included in the EDIS Subject Categories. The discussion is extended to include the mix of subjects with other orientations, such as Item, Mission-Project, Expertise and Data Bank Categories. Sample queries are…

Assisted editing od SensorML with EDI. A bottom-up scenario towards the definition of sensor profiles.

Science.gov (United States)

Oggioni, Alessandro; Tagliolato, Paolo; Fugazza, Cristiano; Bastianini, Mauro; Pavesi, Fabio; Pepe, Monica; Menegon, Stefano; Basoni, Anna; Carrara, Paola

2015-04-01

Sensor observation systems for environmental data have become increasingly important in the last years. The EGU's Informatics in Oceanography and Ocean Science track stressed the importance of management tools and solutions for marine infrastructures. We think that full interoperability among sensor systems is still an open issue and that the solution to this involves providing appropriate metadata. Several open source applications implement the SWE specification and, particularly, the Sensor Observation Services (SOS) standard. These applications allow for the exchange of data and metadata in XML format between computer systems. However, there is a lack of metadata editing tools supporting end users in this activity. Generally speaking, it is hard for users to provide sensor metadata in the SensorML format without dedicated tools. In particular, such a tool should ease metadata editing by providing, for standard sensors, all the invariant information to be included in sensor metadata, thus allowing the user to concentrate on the metadata items that are related to the specific deployment. RITMARE, the Italian flagship project on marine research, envisages a subproject, SP7, for the set-up of the project's spatial data infrastructure. SP7 developed EDI, a general purpose, template-driven metadata editor that is composed of a backend web service and an HTML5/javascript client. EDI can be customized for managing the creation of generic metadata encoded as XML. Once tailored to a specific metadata format, EDI presents the users a web form with advanced auto completion and validation capabilities. In the case of sensor metadata (SensorML versions 1.0.1 and 2.0), the EDI client is instructed to send an "insert sensor" request to an SOS endpoint in order to save the metadata in an SOS server. In the first phase of project RITMARE, EDI has been used to simplify the creation from scratch of SensorML metadata by the involved researchers and data managers. An interesting by

Research-Based Teacher Education and Professional Development. Achievements and Contributions of EDiTE

Directory of Open Access Journals (Sweden)

Rozalia Małgorzata Ligus

2013-12-01

Full Text Available This article’s aim is to describe some of the sources of the European debate over the third cycle studies in teacher education in Europe. Then it will introduce the international Project EDiTE as one of the collaborative initiatives concerning the European scientific proposal of the teachers’ lifelong learning development. Next, some good practices of promoting the doctoral research based teacher education on national levels will be presented. Finally, in the article, there will be revealed selected findings of the EDiTE team that are focused on the current needs in teacher education that have been pointed by different stakeholders of five European countries represented by the project consortium, while interviewing them in 2013 y. The main goal of this article is to involve the stakeholders in a thought provoking debate for future roles of teachers in Europe, but not through looking for a ‘standardized teacher model’ or to create a ‘European super teacher’, but to see the dilemmas that should be shared while questioning ‘What makes a teacher European?,’ as Michael Schratz underlines, in a diversity of national identities and in the face of challenges of 21st century.

Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI. Summary report. Revision 1

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-01-10

This report provides a summary of the Air Force CALS Test Network (AFCTN) Test Report Transfer of Air Force Technical Procurement Bid Set Data to Small Businesses, Using CALS and EDI (AFCTN Test Report 94-034, UCRL-ID-118619). It represents a synthesis of the results, conclusions, and recommendations, as well as a more concise presentation of the issues and strategies as viewed from AFCTN`s perspective. This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s {open_quote}Blue Ribbon{close_quote} contractors, located throughout the United States. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote.

Calibrating MMS Electron Drift Instrument (EDI) Ambient Electron Flux Measurements and Characterizing 3D Electric Field Signatures of Magnetic Reconnection

Science.gov (United States)

Shuster, J. R.; Torbert, R. B.; Vaith, H.; Argall, M. R.; Li, G.; Chen, L. J.; Ergun, R. E.; Lindqvist, P. A.; Marklund, G. T.; Khotyaintsev, Y. V.; Russell, C. T.; Magnes, W.; Le Contel, O.; Pollock, C. J.; Giles, B. L.

2015-12-01

The electron drift instruments (EDIs) onboard each MMS spacecraft are designed with large geometric factors (~0.01cm2 str) to facilitate detection of weak (~100 nA) electron beams fired and received by the two gun-detector units (GDUs) when EDI is in its "electric field mode" to determine the local electric and magnetic fields. A consequence of the large geometric factor is that "ambient mode" electron flux measurements (500 eV electrons having 0°, 90°, or 180° pitch angle) can vary depending on the orientation of the EDI instrument with respect to the magnetic field, a nonphysical effect that requires a correction. Here, we present determinations of the θ- and ø-dependent correction factors for the eight EDI GDUs, where θ (ø) is the polar (azimuthal) angle between the GDU symmetry axis and the local magnetic field direction, and compare the corrected fluxes with those measured by the fast plasma instrument (FPI). Using these corrected, high time resolution (~1,000 samples per second) ambient electron fluxes, combined with the unprecedentedly high resolution 3D electric field measurements taken by the spin-plane and axial double probes (SDP and ADP), we are equipped to accurately detect electron-scale current layers and electric field waves associated with the non-Maxwellian (anisotropic and agyrotropic) particle distribution functions predicted to exist in the reconnection diffusion region. We compare initial observations of the diffusion region with distributions and wave analysis from PIC simulations of asymmetric reconnection applicable for modeling reconnection at the Earth's magnetopause, where MMS will begin Science Phase 1 as of September 1, 2015.

A novel PSB-EDI system for high ammonia wastewater treatment, biomass production and nitrogen resource recovery: PSB system.

Science.gov (United States)

Wang, Hangyao; Zhou, Qin; Zhang, Guangming; Yan, Guokai; Lu, Haifeng; Sun, Liyan

A novel process coupling photosynthetic bacteria (PSB) with electrodeionization (EDI) treatment was proposed to treat high ammonia wastewater and recover bio-resources and nitrogen. The first stage (PSB treatment) was used to degrade organic pollutants and accumulate biomass, while the second stage (EDI) was for nitrogen removal and recovery. The first stage was the focus in this study. The results showed that using PSB to transform organic pollutants in wastewater into biomass was practical. PSB could acclimatize to wastewater with a chemical oxygen demand (COD) of 2,300 mg/L and an ammonia nitrogen (NH4(+)-N) concentration of 288-4,600 mg/L. The suitable pH was 6.0-9.0, the average COD removal reached 80%, and the biomass increased by an average of 9.16 times. The wastewater COD removal was independent of the NH4(+)-N concentration. Moreover, the PSB functioned effectively when the inoculum size was only 10 mg/L. The PSB-treated wastewater was then further handled in an EDI system. More than 90% of the NH4(+)-N was removed from the wastewater and condensed in the concentrate, which could be used to produce nitrogen fertilizer. In the whole system, the average NH4(+)-N removal was 94%, and the average NH4(+)-N condensing ratio was 10.0.

Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

OpenAIRE

Colombo, L.; Sala, B.; Montesano, G.; Pierrottet, C.; De Cillà, S.; Maltese, P.; Bertelli, M.; Rossetti, L.

2015-01-01

To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Stati...

Mining inter-organizational business process models from EDI messages : a case study from the automotive sector

NARCIS (Netherlands)

Engel, R.; Aalst, van der W.M.P.; Zapletal, M.; Pichler, C.; Werthner, H.; Ralyté, J.; Franch, X.; Brinkkemper, S.; Wrycza, S.

2012-01-01

Traditional standards for Electronic Data Interchange (EDI), such as EDIFACT and ANSI X12, have been employed in Business-to-Business (B2B) e-commerce for decades. Due to their wide industry coverage and long-standing establishment, they will presumably continue to play an important role for some

Inter-Organizational Trust in EDI Adoption: The Case of Ford Motor Company and PBR Limited in Australia.

Science.gov (United States)

Ratnasingam, Pauline

2001-01-01

This study examines behavioral dimensions of trading partner trust in EDI (electronic data interchange) adoption via a qualitative interpretative case study conducted between an automotive manufacturer (Ford Motor Company) in Australia and their first tier supplier, PBR Limited. Findings suggest that trust is important for cooperative long-term…

Variantes textuais no Livro do Desassossego: edição, codificação e interpretação

Directory of Open Access Journals (Sweden)

Diego Giménez

2016-09-01

Full Text Available http://dx.doi.org/10.5007/1807-9288.2016v12n1p54 Em 1988, Ivo Castro, responsável pela edição crítica da obra de Fernando Pessoa para a Imprensa Nacional Casa da Moeda, perguntava, numa comunicação intitulada “Edição Crítica de Pessoa: O Modelo Editorial Adoptado”: “como negar ao leitor o máximo de conhecimento sobre o que está escrito por Pessoa nos manuscritos, quando sabemos que dentro de uma geração, provavelmente, nem o leitor, nem nós, seremos ainda capazes de decifrar a tinta sumida dos papéis?”. Neste artigo mantenho que a codificação das fases de escrita no Livro do Desassossego permite representar o processo de composição textual que é interpretado de maneira diferente pelos especialistas. A especificidade da escrita pessoana presenta uma série de dificuldades que os especialistas enfrentam de forma diferente. Desta forma, a comparação entre o trabalho realizado com a edição crítica e o trabalho realizado com a codificação informática permite pôr em paralelo os problemas e soluções adotados em dois momentos diferenciados dos estudos pessoanos e dos estudos humanísticos em geral.

Inter-instrument calibration using magnetic field data from Flux Gate Magnetometer (FGM) and Electron Drift Instrument (EDI) onboard Cluster

Science.gov (United States)

Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

2013-07-01

We compare the magnetic field data obtained from the Flux-Gate Magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the Electron Drift Instrument (EDI) onboard Cluster to determine the spin axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 nT and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ~ 0.6 nT was observed between July and October 2003. Using multi-point multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

Interinstrument calibration using magnetic field data from the flux-gate magnetometer (FGM) and electron drift instrument (EDI) onboard Cluster

Science.gov (United States)

Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

2014-01-01

We compare the magnetic field data obtained from the flux-gate magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the electron drift instrument (EDI) onboard Cluster to determine the spin-axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ∼ 0.6 nT was observed for Cluster 1 between July and October 2003. Using multipoint multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

Tulevast aastast alustab tööd elektrooniline andmevahetussüsteem EDI : piiriületus muutub kiiremaks / Margo Kokerov

Index Scriptorium Estoniae

Kokerov, Margo, 1978-

2001-01-01

Eesti kaubaveo logistika elektroonilise andmevahetussüsteemi EDI (Electronic Data Interchange) projekti esimese etapina käivitub piiriületuse dokumentatsiooni ja kaubadeklaratsioonide elektroonilise esitamise võimalus. Toivo Jürgenson ja Jaan Pillesaar e-piiriületuse eelistest

Livros do Brasil e a edição de romances brasileiros em Portugal nos anos 1940

Directory of Open Access Journals (Sweden)

Thiago Mio Salla

2017-12-01

Full Text Available Enquanto esforço de historiografia literária e editorial, o presente artigo tem como objetivo lançar luz sobre as edições portuguesas de romances brasileiros realizadas pela editora Livros do Brasil, casa fundada em Lisboa, em 1944, por António de Sousa Pinto. A partir da recuperação de fontes primárias (com destaque para cartas e contratos, examinam-se, sobretudo, as negociações travadas entre Sousa Pinto e José Olympio no que diz respeito à edição, em Portugal, de títulos de dois importantes autores de nossa chamada geração de 1930: José Lins do Rego e Rachel de Queiroz. Mais especificamente, recupera-se o embate travado entre a atitude interventiva do editor luso, que defendia a necessidade de se ajustar o texto das obras de ambos os escritores à variante europeia do idioma, de modo a aproximá-las do leitorado português, e a recusa inicial dos romancistas, que exigiam o respeito estrito aos “brasileirismos” por eles empregados.

«Dos benefícios de Deus»: três edições de um capítulo do tratado medieval português

Directory of Open Access Journals (Sweden)

Rita de Cássia Ribeiro Queiroz

2010-12-01

Full Text Available Resumo: O tratado “Dos benefícios de Deus” integra a obra da literatura medieval portuguesa intitulada Castelo perigoso, a qual é uma adaptação do texto francês escrito por Frère Robert, monge cartuxo, à sua prima Soeur Rose, da Ordem Fontevrault. A versão em língua portuguesa foi realizada no Mosteiro de Alcobaça, provavelmente no século XV, existindo dois códices (ALC 197 e ALC 214, os quais se encontram na Biblioteca Nacional de Portugal. O tratado “Dos benefícios de Deus” é o segundo na ordem dos textos que compõem a obra Castelo perigoso. Propõem-se, neste trabalho, três edições de um capítulo do tratado“Dos benefícios de Deus”, a saber: uma edição conservadora ou semidiplomática; uma edição crítica, executada a partir da collatio entre os códices ALC 197 e ALC 214 e a edição realizada por Augusto Magne na década de 1940; e, por último, uma edição modernizada. Palavras-chave: Crítica textual; edição; português medieval.  Résumé: Le traité “Dos benefícios de Deus” intègre l’oeuvre de la littérature médiévale potugaise Chastel périlleux, qui est une adaptation du texte français écrit par Robert Frère, moine chartreux, à sa cousine Soeur Rose, de l’Ordre Fontevrault. La version en langue portugaise a été réalisée au Monastère d’Alcobaça, probablement au XVe siècle: il y a deux codex (ALC 197 et ALC 214, qui sont à la Bibliothèque Nationale du Portugal. Le traité “Dos benefícios de Deus” est le deuxième dans l’ordre des textes qui constituent l’oeuvre Chastel périlleux. Sont proposées dans le présent travail trois éditions d’un chapitre du traité “Dos benefícios de Deus”, à savoir: une édition conservatrice ou semidiplomatique; une édition critique, faite à partir de la collation des manuscrits entre les codex 197 et 214 et l’édition faite par Augusto Magne en 1940; et, enfin, une édition modernisée. Mots-clés: Critique textuelle

O Encheirídion de Epicteto: Edição Bilíngue

Directory of Open Access Journals (Sweden)

Aldo Lopes Dinucci

2012-02-01

Full Text Available Edição bilíngue do Encheirídion de Epicteto, obra do aluno de Epicteto (55-135 e cidadão romano de origem grega Lúcio Flávio Arriano de Nicomédia (86-160. Tal tradução, produzida por Aldo Dinucci (doutor em filosofia pela PUC-RJ e professor associado do Departamento de Filosofia da UFS e Alfredo Julien (doutor em história pela USP e professor adjunto do Departamento de História da UFS, foi financiada pelo CNPq (edital MCT/CNPq 02/2009 - Ciências Humanas, Sociais e Sociais Aplicadas.

The effects of fundus photography on the multifocal electroretinogram.

Science.gov (United States)

Suresh, Sandip; Tienor, Brian J; Smith, Scott D; Lee, Michael S

2016-02-01

To determine the effect of flash fundus photography (FFP) on the multifocal electroretinogram (mfERG). Ten subjects underwent mfERG testing on three separate dates. Subjects received either mfERG without FFP, mfERG at 5 and 15 min after FFP, or mfERG at 30 and 45 min after FFP on each date. The FFP groups received 10 fundus photographs followed by mfERG testing, first of the right eye then of the left eye 10 min later. Data were averaged and analyzed in six concentric rings at each time point. Average amplitude and implicit times of the N1, P1, and N2 peaks for each concentric ring at each time point after FFP were compared to baseline. Flash fundus photography did not lead to a significant change of amplitude or implicit times of N1, P1, or N2 at 5 min after light exposure. These findings suggest that it is acceptable to perform mfERG testing without delay after performance of FFP.

A gripe suína na Wikipédia em português: análise da dinâmica de edições e qualificação do conteúdo de dois artigos

OpenAIRE

Bernardo Esteves Gonçalves da Costa; Carlos Frederico de Brito d'Andréa

2011-01-01

Este artigo tem como objetivo analisar e comparar a edição colaborativa de dois artigos sobre pandemia de gripe A (H1N1) — ou gripe suína — na Wikipédia em português. Monitoramos as edições feitas nos dois artigos ao longo de um mês após a criação de ambos, em 25 de abril de 2009. Caracterizamos o processo de edição dos textos e a dinâmica de interações entre os editores e, de forma complementar, analisamos seu conteúdo a partir de três critérios: autoridade, verificabilidade e atualidade....

A ansiedade da unidade: uma teoria da edição / L’ansia di unità: Una teoria dell’edizione

Directory of Open Access Journals (Sweden)

Jerónimo Pizarro

2016-12-01

Full Text Available Em 1973 Harold Bloom publicou o livro The Anxiety of Influence: A Theory of Poetry. Uma variação sobre este título poderá ser-nos hoje útil para abordar um outro tipo de ansiedade: o da unidade. Os campos da edição e da interpretação vivem imersos nesse outro tipo de ansiedade. Tanto a interpretação, preocupada com a intenção do autor, da obra ou do leitor, como a edição, angustiada com as intenções finais do autor e o estabelecimento do copy-text, parecem, por vezes, pouco capazes de se libertarem desse ensejo de unidade e de se adaptarem à existência da multiplicidade. Neste artigo, procuro fazer um novo apelo a uma necessária mudança de paradigma, atendendo, em especial, às novas e libertadoras possibilidades potenciadas pela edição electrónica. In 1973 Harold Bloom published his book The Anxiety of Influence: A Theory of Poetry. A variation on this title might be useful for us today to refer to another kind of anxiety: the anxiety of unity. The fields of editing and interpretation lie within this other kind of anxiety. Interpretation, concerned with the author’s, the reader’s or the work’s intention, and editing, worried about the author’s final intentions and the setting up of the copy-text, seem, at times, unable to free themselves from the need to attain unity and adapt to the existence of multiplicity. In this article I intend to make a new appeal on behalf of a change of paradigm, addressing, especially, the new and liberating possibilities of electronic editing

Drought severity in intensive agricultural areas by means of the EDI index

Science.gov (United States)

Procházková, Petra; Chuchma, Filip; Středa, Tomáš

2016-12-01

The aim of this work was the evaluation of drought severity development in the Czech Republic for the period 1971-2015 by the means of the Effective Drought Index (EDI). Annual values of the EDI index were determined using the method of effective precipitation for 14 localities spread throughout the Czech Republic (Central Europe). The seven categories were created according to obtained index values for the drought conditions determination for years during the period 1971-2015 through the percentile method. The annual index values were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Both the years with precipitation unfavourable conditions: 1972, 1973, 1984, 1990, 1991, 1992, 1993 and 2015 and the years with precipitation favourable conditions: 1977, 1987, 1995, 2001, 2002 and 2010 were determined. Precipitation conditions in the growing season from 61st to 180th day of the year were also analysed. This evaluation was conducted during the period 1971-2015 through the ten-day index values which were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Dry growing seasons occurred in 1973, 1974, 1976 and 1993. Wet growing seasons occurred in 1987, 2006 and 2010. Trend analysis of annual index values was performed through the Mann-Kendall test. Highly statistically significant increasing linear trends (P < 0.01) were found for four localities (Uherský Ostroh, Vysoká, Znojmo-Oblekovice and Žatec); statistically significant increasing trends (P < 0.05) were found for three localities (Brno-Chrlice, Lednice and Lípa). Based on the extrapolation of the trend, a slightly higher effective precipitation can be expected during the year in a substantial part of the country. However, these findings do not necessarily mean an optimal supply of agricultural land with water. Precipitation exhibits considerable unevenness of distribution through time. Given the increasing evapotranspiration demands of the environment their

Omnidirectional Internal Fixation by Double Approaches for Treating Rüedi-Allgöwer Type III Pilon Fractures.

Science.gov (United States)

Dai, Chong-Hua; Sun, Jun; Chen, Kun-Quan; Zhang, Hui-Bo

In the present study, we explored the effectiveness and complications of omnidirectional internal fixation using a double approach for treating Rüedi-Allgöwer type III pilon fractures. A retrospective analysis was performed of 19 cases of Rüedi-Allgöwer type III unilateral closed pilon fracture. With preoperative preparation and correct surgical timing, the reduction was performed using anteromedial and posterolateral approaches, and the fracture fragments were fixed by omnidirectional internal fixation. Imaging evaluation was performed using the Burwell-Charnley scoring system. The Johner-Wruhs scoring system was used to assess the functional status of the patients. A comprehensive evaluation of efficacy was performed using a 5-point Likert score. The complications were also recorded and analyzed. All patients were followed up for an average of 16.2 months. The operative incisions of 15 cases healed by primary intent and with delayed healing in 4. All patients had achieved bony union at an average of 16 weeks postoperatively. No deep infection, broken nail or withdrawn nail, exposed plate, or skin flap necrosis occurred. The Burwell-Charnley imaging evaluation showed that 14 patients had anatomic reduction of the articular surface and 5 had acceptable reduction. Using the Johner-Wruhs scoring system, the results were excellent for 8, good for 7, fair for 2, and poor for 2 patients; the combined rate of excellent and good results was 78.9%. The Likert score of efficacy self-reported by the patients was 3 to 4 points for 12 patients, 2 points for 4 patients, and 0 to 1 point for 3 patients. The Likert score of therapeutic efficacy reported by the physicians was 3 to 4 points for 10 patients, 2 points for 5 patients, and 0 to 1 point for 4 patients. Omnidirectional internal fixation using double approaches was an effective method to treat Rüedi-Allgöwer type III pilon fractures with satisfactory reduction and rigid fixation, good joint function recovery, and

Millisecond resolution electron fluxes from the Cluster satellites: Calibrated EDI ambient electron data

Science.gov (United States)

Förster, Matthias; Rashev, Mikhail; Haaland, Stein

2017-04-01

The Electron Drift Instrument (EDI) onboard Cluster can measure 500 eV and 1 keV electron fluxes with high time resolution during passive operation phases in its Ambient Electron (AE) mode. Data from this mode is available in the Cluster Science Archive since October 2004 with a cadence of 16 Hz in the normal mode or 128 Hz for burst mode telemetry intervals. The fluxes are recorded at pitch angles of 0, 90, and 180 degrees. This paper describes the calibration and validation of these measurements. The high resolution AE data allow precise temporal and spatial diagnostics of magnetospheric boundaries and will be used for case studies and statistical studies of low energy electron fluxes in the near-Earth space. We show examples of applications.

Time-Dependent Decline in Multifocal Electroretinogram Requires Faster Recording Procedures in Anesthetized Pigs

DEFF Research Database (Denmark)

Sørensen, Nina Buus; Christiansen, Anders Tolstrup; Kjær, Troels Wesenberg

2017-01-01

between the 3-minute and the prolonged mfERG recordings for conventional amplitudes and the global-flash direct response. The global flash-induced component significantly decreases with prolonged mfERG recordings. CONCLUSIONS: A 3-minute mfERG recording and a single stimulation protocol is sufficient...... injection of tetrodotoxin (TTX) was given and the mfERG was rerecorded as described above. Data were analyzed using mixed models in SAS statistical software. RESULTS: Propofol significantly decreases the conventional and global-flash amplitudes over time. The only significant effect of isoflurane...... is a decrease in the global-flash amplitudes. At 15 minutes after TTX injection several of the mfERG amplitudes are significantly decreased. There is a linear correlation between the conventional P1 and the global-flash DR mfERG-amplitude (R2 = 0.82, slope = 0.72, P

Multifocal electroretinogram in normal emmetropic subjects: Correlation with optical coherence tomography

Directory of Open Access Journals (Sweden)

Rajvardhan Azad

2012-01-01

Full Text Available Aim of the Study: To establish the normative database for multifocal electroretinogram (mfERG parameters in a normal emmetropic population. To correlate the data so obtained with the central macular thickness obtained using the optical coherence tomography (OCT scan. Materials and Methods: mfERG data were obtained from 222 eyes of 111 emmetropic subjects. The amplitude (nv/deg 2 and implicit times (ms of the first-order kernel mfERG responses (N1, P1, and N2 waves were obtained and grouped into five rings (Ring 1: Central 2°, Ring 2: 2-5°, Ring 3: 5-10°, Ring 4: 10-15°, Ring 5: >15°. The central macular thickness (CMT was obtained using the macular thickness scan protocol of the OCT. Results: The mfERG data obtained were used to create a normative database. The amplitudes of the mfERG waves were maximum in the fovea and progressively decreased with increasing eccentricity (P = 0.0001. The latencies of the P1 and N2 waves were longest in the central ring and progressively shortened with eccentricity (P = 0.0001. No statistically significant correlations were observed between central ring 1 parameters and the CMT. Conclusion: This study establishes normative database for mfERG parameters in an emmetropic population. No statistically significant correlation was noted between CMT and mfERG parameters.

Edição Temática “Cidades inteligentes: planejamento e gestão da sustentabilidade”

OpenAIRE

Cláudia Terezinha Kniess

2016-01-01

É com satisfação que apresentamos a edição temática da revista Gestão e Secretariado – Revista GeSec - com foco em “Cidades inteligentes: planejamento e gestão da sustentabilidade”. Os estudos nesta temática respondem a uma forte demanda da sociedade para o enfrentamento dos desafios atuais relacionados à crescente concentração da população nos centros urbanos e à diversidade de problemas técnicos e políticos relacionados a esta dinâmica.   A revista GeSeC é classificada como Qualis B...

Um 13 de maio antecipado: edições temáticas, atualidade e memória no circuito TRIP e TPM

Directory of Open Access Journals (Sweden)

Frederico de Mello Brandão Tavares

2016-05-01

Full Text Available Em abril de 2014, as revistas brasileiras TRIP e TPM publicaram uma edição temática, sob o mesmo título base – “Ser negro/negra no Brasil é f*da”, e estabeleceram um diálogo editorial a partir de um gancho temporal: o dia 13 de maio, quando se comemora a abolição da escravatura no país. Com um mês de antecedência e a partir de coberturas estruturadas por conteúdos específicos, em contato ou não, as publicações anteciparam o acontecimento, previsto, encerrando-o em uma “totalidade” de pautas, acionada por seções e provocadora de um circuito que, antes do “acontecer do acontecimento”, atualizou-o como temática, indicando seus sentidos. Neste contexto, o presente artigo observa relações existentes em acionamentos acontecimentais no jornalismo, mesmo quando estes não partem de uma cobertura factual. Tendo como objeto as edições de TRIP e TPM indicadas, busca-se percorrer a transversalidade originada pela tematização das revistas e compreender as afetações e/ou “determinações” que nela aparecem.

Multifocal electroretinogram and central visual field testing in central areolar choroidal dystrophy.

Science.gov (United States)

Gundogan, Fatih Cakir; Dinç, Umut Asli; Erdem, Uzeyir; Ozge, Gokhan; Sobaci, Gungor

2010-01-01

To study multifocal electroretinogram (mfERG) and its relation to retinal sensitivity assessed by Humphrey visual field (HVF) analysis in central areolar choroidal dystrophy (CACD). Seven eyes of 4 patients with CACD and 15 normal control subjects were examined. mfERG and central 30/2 HVF were tested for each participant. Ring analysis in mfERG was evaluated. HVF results were evaluated in 5 concentric rings in order to compare the results to concentric ring analysis in mfERG. The differences between control subjects and patients were evaluated by Mann-Whitney U test and the correlations were assessed by Spearman test. Mean Snellen acuity was 0.49+/-0.10 in patients. HVF revealed central scotoma in 6 of 7 eyes (85.7%), whereas a paracentral scotoma extending to fixation point was detected in 1 eye. The retinal sensitivities in 5 concentric rings in HVF were significantly lower (p<0.001 for ring 1 to ring 4, and p=0.017 in ring 5) in CACD patients. Similarly, CACD patients had lower P1/N1 amplitudes (p<0.05) and delayed P1/N1 implicit times (p<0.05). In CACD, in the areas of scotoma detected by HVF, mfERG values were depressed. However, both mfERG and HVF abnormalities were found outside the areas of ophthalmoscopically normal retinal areas.

Functional and Structural Findings of Neurodegeneration in Early Stages of Diabetic Retinopathy: Cross-sectional Analyses of Baseline Data of the EUROCONDOR Project.

Science.gov (United States)

Santos, Ana Rita; Ribeiro, Luísa; Bandello, Francesco; Lattanzio, Rosangela; Egan, Catherine; Frydkjaer-Olsen, Ulrik; García-Arumí, José; Gibson, Jonathan; Grauslund, Jakob; Harding, Simon P; Lang, Gabriele E; Massin, Pascale; Midena, Edoardo; Scanlon, Peter; Aldington, Stephen J; Simão, Sílvia; Schwartz, Christian; Ponsati, Berta; Porta, Massimo; Costa, Miguel Ângelo; Hernández, Cristina; Cunha-Vaz, José; Simó, Rafael

2017-09-01

This cross-sectional study evaluated the relationship between 1 ) functional and structural measurements of neurodegeneration in the initial stages of diabetic retinopathy (DR) and 2 ) the presence of neurodegeneration and early microvascular impairment. We analyzed baseline data of 449 patients with type 2 diabetes enrolled in the European Consortium for the Early Treatment of Diabetic Retinopathy (EUROCONDOR) study (NCT01726075). Functional studies by multifocal electroretinography (mfERG) evaluated neurodysfunction, and structural measurements using spectral domain optical coherence tomography (SD-OCT) evaluated neurodegeneration. The mfERG P1 amplitude was more sensitive than the P1 implicit time and was lower in patients with Early Treatment of Diabetic Retinopathy Study (ETDRS) level 20-35 than in patients with ETDRS level <20 ( P = 0.005). In 58% of patients, mfERG abnormalities were present in the absence of visible retinopathy. Correspondence between SD-OCT thinning and mfERG abnormalities was shown in 67% of the eyes with ETDRS <20 and in 83% of the eyes with ETDRS level 20-35. Notably, 32% of patients with ETDRS 20-35 presented no abnormalities in mfERG or SD-OCT. We conclude that there is a link between mfERG and SD-OCT measurements that increases with the presence of microvascular impairment. However, a significant proportion of patients in our particular study population (ETDRS ≤35) had normal ganglion cell-inner plexiform layer thickness and normal mfERG findings. We raise the hypothesis that neurodegeneration may play a role in the pathogenesis of DR in many but not in all patients with type 2 diabetes. © 2017 by the American Diabetes Association.

Integrating effective drought index (EDI) and remote sensing derived parameters for agricultural drought assessment and prediction in Bundelkhand region of India

Science.gov (United States)

Padhee, S. K.; Nikam, B. R.; Aggarwal, S. P.; Garg, V.

2014-11-01

Drought is an extreme condition due to moisture deficiency and has adverse effect on society. Agricultural drought occurs when restraining soil moisture produces serious crop stress and affects the crop productivity. The soil moisture regime of rain-fed agriculture and irrigated agriculture behaves differently on both temporal and spatial scale, which means the impact of meteorologically and/or hydrological induced agriculture drought will be different in rain-fed and irrigated areas. However, there is a lack of agricultural drought assessment system in Indian conditions, which considers irrigated and rain-fed agriculture spheres as separate entities. On the other hand recent advancements in the field of earth observation through different satellite based remote sensing have provided researchers a continuous monitoring of soil moisture, land surface temperature and vegetation indices at global scale, which can aid in agricultural drought assessment/monitoring. Keeping this in mind, the present study has been envisaged with the objective to develop agricultural drought assessment and prediction technique by spatially and temporally assimilating effective drought index (EDI) with remote sensing derived parameters. The proposed technique takes in to account the difference in response of rain-fed and irrigated agricultural system towards agricultural drought in the Bundelkhand region (The study area). The key idea was to achieve the goal by utilizing the integrated scenarios from meteorological observations and soil moisture distribution. EDI condition maps were prepared from daily precipitation data recorded by Indian Meteorological Department (IMD), distributed within the study area. With the aid of frequent MODIS products viz. vegetation indices (VIs), and land surface temperature (LST), the coarse resolution soil moisture product from European Space Agency (ESA) were downscaled using linking model based on Triangle method to a finer resolution soil moisture product

Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT.

Science.gov (United States)

Colombo, L; Sala, B; Montesano, G; Pierrottet, C; De Cillà, S; Maltese, P; Bertelli, M; Rossetti, L

2015-01-01

To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT) was 248.21 ± 79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient -0.7248179, p patients (p = 0.2138). Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

糖尿病视网膜1期病变多焦视网膜图变化分析%A Study in the Changes of mfERG in Stage 1 Diabetic Retinopathyn

Institute of Scientific and Technical Information of China (English)

张聪; 刘哲丽; 徐丽; 郭敬斌

2009-01-01

目的 通过检测糖尿病视网膜1期病变患者多焦视网膜电图(multifocal electroretino-gram,mfERG),评价1期糖尿病视网膜病变患者早期视功能的变化.方法 检测正常对照组31只眼,1期糖尿病视网膜病变组46只眼的mtERG在视野30°的测试范围内6个不同离心度的环形区N1、P1波潜伏期、P1波反应密度改变.结果 在视野30°的测试范围内6个不同离心度的环形区,1期糖尿病视网膜病变组(DR组)与正常对照组之间比较N1、P1波潜伏期显著延长;环1、2区DR组与正常对照组之间比较P1波反应密度显著降低.结论 尚未出现肉眼可见眼底改变的1期糖尿病视网膜病变即可出现视功能的异常,mfERG能够定量的检测1期糖尿病视网膜病变的局部视功能变化,为糖尿病视网膜病变的早期诊断提供有效方法.%Objective To investigate the changes of retinal function in stage 1 of diabetic retinopathy detected by multifoeal electroretinogram (mfERG).Methods The responses of mfERG were recorded and analyzed from eyes of 31 normal control subjects and 46 diabetic patients with stage 1 of diabetic retinopathy. Results In eyes of diabetic patients with stage 1 of diabetic retinopathy (DR), the lateneies of N1, P1 were delayed obviously compared to normal control subjects, in the field of about 30 degrees of six rings with different eccentricities; the response densities of the P1 ring1, 2 was significantly decreased in diabetic patients with stagel of diabetic retinopathy compared to normal control subjects.Conclusions The abnormalities of retinal function may occur in stagel of diabetic retinopathy, when there is no abnormality of ocular fundus.As a new objective and quantitative examination for visual function, mfERG may be valuable in early diagnosis of diabetic retinopathy.

Retinal toxicity related to hydroxychloroquine in patients with systemic lupus erythematosus and rheumatoid arthritis.

Science.gov (United States)

Telek, Hande Husniye; Yesilirmak, Nilufer; Sungur, Gulten; Ozdemir, Yaprak; Yesil, Nesibe Karahan; Ornek, Firdevs

2017-12-01

To compare the retinal toxicity due to hydroxychloroquine (HCQ) use in patients with systemic lupus erythematosus (SLE) and rheumatoid arthritis (RA) using multifocal electroretinography (mfERG), fundus autofluorescence (FAF) and optical coherence tomography (OCT). Patients who were using HCQ due to SLE and RA, and healthy subjects evaluated in this study. Central foveal thickness (CFT), inner-outer segment (IS-OS) junction irregularity, retinal nerve fiber layer thickness, mfERG and FAF measurements were performed to evaluate retinal toxicity. Study included 35 eyes of 35 SLE patients, 40 eyes of 40 RA patients and 20 eyes of 20 healthy subjects. In SLE group, retinal abnormality was found in three eyes with mfERG, in one eye with FAF and in four eyes with OCT. In RA group, retinal abnormality was found in 10 eyes with mfERG, in five eyes with FAF and in nine eyes with OCT. A statistically significant difference was found with respect to mfERG between "eyes with abnormal responses and without abnormal responses" and "eyes with abnormal responses and controls" (p < 0.05). A statistically significant difference was found with respect to CFT between "eyes with IS-OS junction irregularities and without IS-OS junction irregularities" and "eyes with/without IS-OS junction irregularities and controls" (p < 0.05). The use of HCQ seems to cause retinal toxicity more often in RA patients compared to SLE patients. For the early detection of retinal changes, OCT and mfERG can be used as screening tools due to their higher sensitivity rates compared to other tests.

The spatial resolution of the porcine multifocal electroretinogram for detection of laser-induced retinal lesions

DEFF Research Database (Denmark)

Kyhn, Maria Voss; Kiilgaard, Jens Folke; Scherfig, Erik

2008-01-01

This study aimed to investigate the spatial resolution of a porcine multifocal electroretinogram (mfERG) protocol by testing its ability to detect laser-induced retinal lesions. Furthermore, we wanted to describe time-dependent changes in implicit time and amplitude of the different mfERG peaks...

(Desmetaforizando significados na pós-edição: um estudo exploratório do esforço despendido por estudantes de tradução

Directory of Open Access Journals (Sweden)

Adriana Silvina Pagano

2014-03-01

Full Text Available Este artigo examina dados de um experimento-piloto e tem por objetivo investigar o esforço despendido por estudantes de tradução em uma tarefa de pós-edição, a partir da análise de pausas e movimentos recursivos registrados durante a produção textual em tempo real para instâncias gramaticalmente metafóricas (cf. HALLIDAY,1998. O estudo contempla o processo e o produto da pós-edição de três alunos de pós-graduação em tradução. Para se proceder à análise, foram observados os registros de uso de teclado e movimentos de cursor mapeados pelo programa Translog 2006 para a produção textual em tempo real. Como resultado, verificou-se um grande esforço para se processar algumas instâncias gramaticalmente metafóricas, sendo que esse esforço não resultou em uma maior adequação dos significados produzidos.

Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

Directory of Open Access Journals (Sweden)

Élen Cátia Tomazela

2011-01-01

Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

Directory of Open Access Journals (Sweden)

Élen Cátia Tomazela

2011-01-01

Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

Plasma convection in the magnetotail lobes: statistical results from Cluster EDI measurements

Directory of Open Access Journals (Sweden)

S. Haaland

2008-08-01

Full Text Available A major part of the plasma in the Earth's magnetotail is populated through transport of plasma from the solar wind via the magnetotail lobes. In this paper, we present a statistical study of plasma convection in the lobes for different directions of the interplanetary magnetic field and for different geomagnetic disturbance levels. The data set used in this study consists of roughly 340 000 one-minute vector measurements of the plasma convection from the Cluster Electron Drift Instrument (EDI obtained during the period February 2001 to June 2007. The results show that both convection magnitude and direction are largely controlled by the interplanetary magnetic field (IMF. For a southward IMF, there is a strong convection towards the central plasma sheet with convection velocities around 10 km s⁻¹. During periods of northward IMF, the lobe convection is almost stagnant. A B_y dominated IMF causes a rotation of the convection patterns in the tail with an oppositely directed dawn-dusk component of the convection for the northern and southern lobe. Our results also show that there is an overall persistent duskward component, which is most likely a result of conductivity gradients in the footpoints of the magnetic field lines in the ionosphere.

What monitor can replace the cathode-ray tube for visual stimulation to elicit multifocal electroretinograms?

Science.gov (United States)

Matsumoto, Celso Soiti; Shinoda, Kei; Matsumoto, Harue; Seki, Keisuke; Nagasaka, Eiichiro; Iwata, Takeshi; Mizota, Atsushi

2014-08-05

To compare a conventional cathode-ray tube (CRT) screen to organic light-emitting diode (OLED) and liquid crystal display (LCD) screens as visual stimulators to elicit multifocal electroretinograms (mfERGs), mfERGs were recorded from seven eyes of seven healthy volunteers (21 ± 2 years). The mfERGs elicited by a conventional CRT screen (S710, Compaq Computer Co.) were compared to those elicited by a studio-grade master OLED monitor (PVM-1741, Sony, Japan) and a conventional LCD (S1721, Flexscan, Eizo Nanao Corp., Japan). The luminance changes of each monitor were measured with a photodiode. CRT, OLED, and LCD screens with a frame frequency of 60 Hz were studied. A hexagonal stimulus array with 61 stimulus elements was created on each monitor. The serial white stimuli of the OLED screen at 60 Hz did not fuse, and that of the LCD screens fused. The amplitudes of P1 and P2 of the first-order kernels of the mfERGs were not significantly different from those elicited by the CRT and OLED screens, and the P1 amplitude of the first-order kernel elicited by the LCD stimuli was significantly smaller than that elicited by the CRT in all the groups of the averaged hexagonal elements. The implicit times were approximately 10 ms longer in almost all components elicited by the LCD screen compared to those elicited by the CRT screen. The mfERGs elicited by monitors other than the CRT should be carefully interpreted, especially those elicited by LCD screens. The OLED had good performance, and we conclude that it can replace the CRT as a stimulator for mfERGs; however, a collection of normative data is recommended. © 2014 ARVO.

Multi-zone modelling of PCCI combustion

NARCIS (Netherlands)

Egüz, U.; Somers, L.M.T.; Leermakers, C.A.J.; Goey, de L.P.H.

2011-01-01

Early Direct Injection Premixed Charge Compression Ignition (EDI PCCI) combustion is a promising concept for the diesel combustion. Although EDI PCCI assures very low soot and NO xemission levels, the injection is uncoupled from combustion, which narrows down the operating conditions. The main

Multifocal ERG wavelet packet decomposition applied to glaucoma diagnosis

Directory of Open Access Journals (Sweden)

Rodríguez-Ascariz José M

2011-05-01

Full Text Available Abstract Background Glaucoma is the second-leading cause of blindness worldwide and early diagnosis is essential to its treatment. Current clinical methods based on multifocal electroretinography (mfERG essentially involve measurement of amplitudes and latencies and assume standard signal morphology. This paper presents a new method based on wavelet packet analysis of global-flash multifocal electroretinogram signals. Methods This study comprised twenty-five patients diagnosed with OAG and twenty-five control subjects. Their mfERG recordings data were used to develop the algorithm method based on wavelet packet analysis. By reconstructing the third wavelet packet contained in the fourth decomposition level (ADAA4 of the mfERG recording, it is possible to obtain a signal from which to extract a marker in the 60-80 ms time interval. Results The marker found comprises oscillatory potentials with a negative-slope basal line in the case of glaucomatous recordings and a positive-slope basal line in the case of normal signals. Application of the optimal threshold calculated in the validation cases showed that the technique proposed achieved a sensitivity of 0.81 and validation specificity of 0.73. Conclusions This new method based on mfERG analysis may be reliable enough to detect functional deficits that are not apparent using current automated perimetry tests. As new stimulation and analysis protocols develop, mfERG has the potential to become a useful tool in early detection of glaucoma-related functional deficits.

The Psychology of Music, editado por Diana Deutsch, 3ª edição: resenha dos capítulos 10 a 13

Directory of Open Access Journals (Sweden)

Ricieri Carlini Zorzal

2016-03-01

Full Text Available O presente texto traz uma resenha de quatro capítulos da terceira edição do livro The Psychology of Music, editado por Diana Deutsch. Nominalmente, são analisados os seguintes capítulos: 10 Performance musical: movimento e coordenação, de autoria de Caroline Palmer; 11 Desenvolvimento musical, de autoria de Laurel Trainor e Erin Hannon; 12 Música e habilidades cognitivas, de autoria de Glenn Schellenberg e Michael Weiss; e 13 As fundações biológicas da música: insights da amusia congênita, de autoria de Isabelle Peretz.

Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

Directory of Open Access Journals (Sweden)

L. Colombo

2015-01-01

Full Text Available To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA, intraocular pressure (IOP, axial length (AL, automated visual field (VF, and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT was 248.21±79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient −0.7248179, p<0.01. No statistically significant correlation was found between SFCT and BCVA, IOP, AL, VF, and RT. SFCT was reduced if compared to healthy subjects (p<0.01. No difference was found when compared to choroidal thickness from nonsyndromic RP patients (p=0.2138. Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

Ocular toxicity and functional vision recovery in a patient treated with hydroxychloroquine.

Science.gov (United States)

Rodríguez-Hurtado, Francisco Jorge; Sáez-Moreno, José Antonio; Rodríguez-Ferrer, José Manuel

2015-01-01

We report the case of a 64-year-old woman with rheumatoid arthritis and Sjögren's syndrome, treated during 48 months with hydroxychloroquine that was removed after an ophthalmological evaluation showed bilateral vision loss associated with paracentral scotoma in the visual field, fundoscopic macular pigmentary changes, and severely impaired central multifocal electrorretinogram (mfERG). Twelve months after treatment withdrawal, visual acuity and central mfERG had surprisingly improved. This is an unusual case of functional recovery after treatment withdrawal. We consider that central mfERG is a more sensitive test than pattern electrorretinogram in the detection of retinal toxicity and functional vision recovery after hydroxychloroquine treatment cessation. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.

High-latitude plasma convection during Northward IMF as derived from in-situ magnetospheric Cluster EDI measurements

Directory of Open Access Journals (Sweden)

M. Förster

2008-09-01

Full Text Available In this study, we investigate statistical, systematic variations of the high-latitude convection cell structure during northward IMF. Using 1-min-averages of Cluster/EDI electron drift observations above the Northern and Southern polar cap areas for six and a half years (February 2001 till July 2007, and mapping the spatially distributed measurements to a common reference plane at ionospheric level in a magnetic latitude/MLT grid, we obtained regular drift patterns according to the various IMF conditions. We focus on the particular conditions during northward IMF, where lobe cells at magnetic latitudes >80° with opposite (sunward convection over the central polar cap are a permanent feature in addition to the main convection cells at lower latitudes. They are due to reconnection processes at the magnetopause boundary poleward of the cusp regions. Mapped EDI data have a particular good coverage within the central part of the polar cap, so that these patterns and their dependence on various solar wind conditions are well verified in a statistical sense. On average, 4-cell convection pattern are shown as regular structures during periods of nearly northward IMF with the tendency of a small shift toward negative clock angles. The positions of these high-latitude convection foci are within 79° to 85° magnetic latitude and 09:00–15:00 MLT. The MLT positions are approximately symmetric ±2 h about 11:30 MLT, i.e. slightly offset from midday toward prenoon hours, while the maximum (minimum potential of the high-latitude cells is at higher magnetic latitudes near their maximum potential difference at ≈−10° to −15° clock angle for the North (South Hemisphere. With increasing clock angle distances from ≈IMFB_z+, a gradual transition occurs from the 4-cell pattern via a 3-cell to the common 2-cell convection pattern, in the course of which one of the medium-scale high-latitude dayside cells diminishes and disappears while the

Multifocal Electroretinography after High Dose Chloroquine Therapy for Malaria

Directory of Open Access Journals (Sweden)

Aline Correa de Carvalho

2013-01-01

Full Text Available Purpose: To investigate changes in multifocal electroretinography (mfERG parameters associated with high dose chloroquine therapy for treatment of malaria in the Amazonia region of Brazil. Methods: Forty-eight subjects who had received chloroquine treatment for single or multiple malaria infections with a cumulative dose ranging from 1,050 to 27,000mg were included. The control group consisted of 37 healthy aged-matched subjects. Data was collected on amplitude and implicit time of the N1, P1 and N2 waves in the central macular hexagon (R1 and in five concentric rings at different retinal eccentricities (R2-R6. Results: No significant difference was observed in any mfERG parameter between chloroquine treated patients and control subjects. A comparison with previous data obtained from patients with rheumatologic disorders in the same region of Brazil who had received larger cumulative doses of chloroquine and had displayed mfERG changes, indicated that retinal toxicity seems to be dependent on cumulative dose. Conclusion: Lack of mfERG changes in the current study suggests that intensive high dose chloroquine therapy for treatment of malaria is not associated with retinal toxicity.

Effect of glial cell line-derived neurotrophic factor on retinal function after experimental branch retinal vein occlusion

DEFF Research Database (Denmark)

Ejstrup, Rasmus; Dornonville de la Cour, Morten; Kyhn, Maria Voss

2012-01-01

The objective of the study was to investigate the effect of glial cell line-derived neurotrophic factor (GDNF) on the multifocal electroretinogram (mfERG) following an induced branch retinal vein occlusion (BRVO) in pigs.......The objective of the study was to investigate the effect of glial cell line-derived neurotrophic factor (GDNF) on the multifocal electroretinogram (mfERG) following an induced branch retinal vein occlusion (BRVO) in pigs....

Functional implications of short-term retinal detachment in porcine eyes

DEFF Research Database (Denmark)

Kyhn, Maria Voss; Kiilgaard, Jens Folke; Lopez, Ana Garcia

2008-01-01

The aim of the study was to determine the type and magnitude of detectable changes in pig multifocal electroretinography (mfERG) induced by the vitreoretinal surgical procedures necessary to gain access to the subretinal space.......The aim of the study was to determine the type and magnitude of detectable changes in pig multifocal electroretinography (mfERG) induced by the vitreoretinal surgical procedures necessary to gain access to the subretinal space....

O, 5 mm: a nova edição brasileira de Problemas da poética de Dostoiévski/0.5 mm: The New Brazilian Edition of Problems of Dostoevsky’s Poetics

Directory of Open Access Journals (Sweden)

Adriana Pucci Penteado de Faria e Silva

2011-11-01

Full Text Available RESUMO: Neste artigo, retomo brevemente a história da recepção de Problemas da poética de Dostoiévski, de Mikhail Bakhtin, no Brasil, estabelecendo alguns paralelos com aspectos da recepção da obra na Itália, na França e nos Estados Unidos, para, então, descrever os acréscimos da nova edição brasileira e analisar, considerando a relevância da obra para os estudos da linguagem, algumas modificações efetuadas pelo tradutor Paulo Bezerra na quarta edição da obra, lançada em 2008. ABSTRACT: In this article I briefly review the history of the Brazilian reception of Mikhail Bakhtin’s Problems of Dostoevsky’s Poetics, establishing a few parallels with aspects of this work’s reception in Italy, France, and the United States in order to describe the additions made to the new Brazilian edition and, considering the relevance of this work to Language Studies, analyze some changes proposed by translator Paulo Bezerra in its

The assessment of macular electrophysiology and macular morphology in patients with vitiligo.

Science.gov (United States)

Aydin, Rukiye; Ozsutcu, Mustafa; Erdur, Sevil Karaman; Dikkaya, Funda; Balevi, Ali; Ozbek, Merve; Senturk, Fevzi

2018-02-01

We aimed to analyze the electrophysiologic function and morphology of macula in vitiligo patients. Seventeen patients with vitiligo and 11 healthy subjects were studied. All participants underwent multifocal electroretinography (mfERG) and spectral domain optical coherence tomography (SD-OCT) evaluations. The mfERG (P1 mfERG responses central and peripheral) and retinal layer segmentation parameters (nine ETDRS subfields) were compared in vitiligo and control groups. The mean P1 response amplitudes were significantly decreased in central and peripheral rings of the fovea in patients with vitiligo compared with controls (p = 0.002 and p = 0.006, respectively). There was a tendency toward a prolonged mean implicit time for both central and peripheral in patients with vitiligo compared to controls, however, with no statistical significance (p = 0.453 and p = 0.05, respectively). There was no statistically significant difference in all retinal layers thickness between two groups. In patients with vitiligo, while photoreceptor segment preserved in SD-OCT, mfERG reduced showing potential decline in central retinal function. This study showed a potential decline in central retinal function in patients with vitiligo even if they have normal fundus appearance and SD-OCT findings.

Multifocal electroretinogram for functional evaluation of retinal injury following ischemia-reperfusion in pigs

DEFF Research Database (Denmark)

Morén, Håkan; Gesslein, Bodil; Andreasson, Sten

2010-01-01

Multifocal electroretinogram (mfERG) has the power to discriminate between localized functional losses and overall retinal changes when evaluating retinal injury. So far, full-field ERG has been the gold standard for examining retinal ischemia and the effects of different neuroprotectants...... in experimental conditions. The aim of the present study was to establish mfERG, with simultaneous fundus monitoring, for analyzing the localized functional response in the retina after ischemia-reperfusion in the porcine eye....

A construção sociológica de uma posição regionalista: Reflexões sobre a edição e recepção de Casa-grande & senzala de Gilberto Freyre

Directory of Open Access Journals (Sweden)

Sorá Gustavo

1998-01-01

Full Text Available Este artigo analisa disputas e momentos de inflexão no processo de autonomização das ciências sociais e das estruturas de produção e circulação de mensagens escritas sobre o Brasil, a partir da análise da edição e recepção de Casa-grande & senzala, de Gilberto Freyre. Entre os sucessivos prefácios do livro, da 1ª à 14ª edições, e a consagração de autores como Florestan Fernandes, desenvolve-se uma prolongada e violenta batalha simbólica para universalizar as formas legítimas (estilos narrativos, projetos institucionais, fórmulas editoriais, invenção e representação de comunidades de leitores para pensar o Brasil. Seguindo este percurso, o artigo mostra como as representações que pesam sobre Freyre e seu livro de estréia, como regionalista, derivam tanto das posições e concepções que Freyre foi assumindo em sua trajetória, quanto das posições que foram se impondo no campo intelectual a partir dos anos 40 em São Paulo, com o objetivo de consolidar a "Sociologia científica e nacional". Somando à interpretação dos discursos os princípios de sua dispersão, como a edição e a institucionalização dos saberes universitários, o artigo busca compreender como livro e autor chegaram a ser o que são hoje em dia à luz de mudanças nos mecanismos de seleção do panteão dos intérpretes do Brasil.

The role of employee participation in generating and commercializing innovations in China

DEFF Research Database (Denmark)

Kesting, Peter; Qin, Zhihua; Song, Jiwen Lynda

2013-01-01

In this paper we are investigating the effect of different forms of employee participation on innovation generation and commercialization in China. To date, the concept of employee-driven innovation (EDI) finds very little recognition in China, in research as well as in management practice....... It seems to fundamentally contradict traditional values in Chinese culture. On the other hand, work realities change rapidly in China. Research suggests that EDI might be particularly relevant for innovations in skilled labour contexts. Based on a survey of 620 medium-sized and large companies in China we...... underpin that EDI is also relevant for China....

Subjective and objective screening tests for hydroxychloroquine toxicity.

Science.gov (United States)

Cukras, Catherine; Huynh, Nancy; Vitale, Susan; Wong, Wai T; Ferris, Fredrick L; Sieving, Paul A

2015-02-01

To compare subjective and objective clinical tests used in the screening for hydroxychloroquine retinal toxicity to multifocal electroretinography (mfERG) reference testing. Prospective, single-center, case control study. Fifty-seven patients with a previous or current history of hydroxychloroquine treatment of more than 5 years' duration. Participants were evaluated with a detailed medical history, dilated ophthalmologic examination, color fundus photography, fundus autofluorescence (FAF) imaging, spectral-domain (SD) optical coherence tomography (OCT), automated visual field testing (10-2 visual field mean deviation [VFMD]), and mfERG testing. We used mfERG test parameters as a gold standard to divide participants into 2 groups: those affected by hydroxychloroquine-induced retinal toxicity and those unaffected. We assessed the association of various imaging and psychophysical variables in the affected versus the unaffected group. Fifty-seven study participants (91.2% female; mean age, 55.7±10.4 years; mean duration of hydroxychloroquine treatment, 15.0±7.5 years) were divided into affected (n = 19) and unaffected (n = 38) groups based on mfERG criteria. Mean age and duration of hydroxychloroquine treatment did not differ statistically between groups. Mean OCT retinal thickness measurements in all 9 macular subfields were significantly lower (<40 μm) in the affected group (P < 0.01 for all comparisons) compared with those in the unaffected group. Mean VFMD was 11 dB lower in the affected group (P < 0.0001). Clinical features indicative of retinal toxicity were scored for the 2 groups and were detected in 68.4% versus 0.0% using color fundus photographs, 73.3% versus 9.1% using FAF images, and 84.2% versus 0.0% on the scoring for the perifoveal loss of the photoreceptor ellipsoid zone on SD-OCT for affected and unaffected participants, respectively. Using a polynomial modeling approach, OCT inner ring retinal thickness measurements and Humphrey 10-2 VFMD were

Estudo comparativo sobre as atividades experimentais em coleções de Física coincidentes recomendados nas edições 2012 e 2015 do PNLD

Directory of Open Access Journals (Sweden)

Wendel Fajardo Reis

2016-09-01

Full Text Available http://dx.doi.org/10.5007/2175-7941.2016v33n2p462   O Ensino Médio pressupõe uma aprendizagem abrangente e significativa dos conteúdos, em que o professor deve valer-se de recursos didáticos disponíveis e adequados à sua prática. Nessa perspectiva, a atividade experimental torna-se um importante instrumento de ensino a ser explorado no estudo da Física, que também pode ser vivenciado pelos alunos por meio do livro didático (LD. Nesta pesquisa, realiza-se uma análise comparativa das atividades experimentais nas coleções de Física coincidentes nas edições de 2012 e 2015 do Programa Nacional do Livro Didático (PNLD. Para isso, aplica-se a classificação proposta por Barros (2009, fundamentada em competências e habilidades dos Parâmetros Curriculares Nacionais para o Ensino Médio (PCNEM (BRASIL, 1999 e nos temas estruturadores de suas orientações educacionais complementares (PCN+ (BRASIL, 2002. Os resultados mostram uma distribuição não uniforme dos experimentos nos temas da Física, em que ainda prevalecem os arranjos relacionados aos movimentos dos corpos. Para as categorias e dimensões de análise, verifica-se que os autores procuram evidenciar as competências e habilidades do PCNEM, entretanto os aspectos históricos sociais continuam pouco contemplados nas duas edições do Programa. Por fim, espera-se que as informações apresentadas nesse trabalho possam contribuir para a prática docente, com foco nas atividades experimentais dos livros didáticos de Física.

Retinal Vascular Fractals Correlate With Early Neurodegeneration in Patients With Type 2 Diabetes Mellitus

DEFF Research Database (Denmark)

Frydkjaer-Olsen, Ulrik; Soegaard Hansen, Rasmus; Pedersen, Knud

2015-01-01

. In a randomly selected eye of each patient, Fd was calculated using SIVA-Fractal, a specialized semiautomatic software. Retinal neurodegeneration was evaluated by Topcon 3D OCT-2000 spectral-domain optical coherence tomography (OCT) and by a RETI-scan multifocal ERG (mf-ERG) system in rings one to six. Level...... were 10 (42.7%), 20 (35.0%), and 35 (22.3%), respectively. Fd correlated inversely with mf-ERG implicit time of ring one (r = -0.25, P = 0.01) and present diabetic neuropathy (P = 0.02), and positively with OCT ganglion cell layer (GCL) thickness (r = 0.20, P = 0.04). In a multivariable linear...... regression model, Fd was associated with mf-ERG implicit time of ring one (coefficient -0.0021/ms, P = 0.040) and the presence of diabetic neuropathy (coefficient -0.0209 for neuropathy present versus absent, P = 0.041). Conclusions: In patients with T2DM and no or minimal DR, independent correlations were...

JAMSTEC E-library of Deep-sea Images (J-EDI) Realizes a Virtual Journey to the Earth's Unexplored Deep Ocean

Science.gov (United States)

Sasaki, T.; Azuma, S.; Matsuda, S.; Nagayama, A.; Ogido, M.; Saito, H.; Hanafusa, Y.

2016-12-01

The Japan Agency for Marine-Earth Science and Technology (JAMSTEC) archives a large amount of deep-sea research videos and photos obtained by JAMSTEC's research submersibles and vehicles with cameras. The web site "JAMSTEC E-library of Deep-sea Images : J-EDI" (http://www.godac.jamstec.go.jp/jedi/e/) has made videos and photos available to the public via the Internet since 2011. Users can search for target videos and photos by keywords, easy-to-understand icons, and dive information at J-EDI because operating staffs classify videos and photos as to contents, e.g. living organism and geological environment, and add comments to them.Dive survey data including videos and photos are not only valiant academically but also helpful for education and outreach activities. With the aim of the improvement of visibility for broader communities, we added new functions of 3-dimensional display synchronized various dive survey data with videos in this year.New Functions Users can search for dive survey data by 3D maps with plotted dive points using the WebGL virtual map engine "Cesium". By selecting a dive point, users can watch deep-sea videos and photos and associated environmental data, e.g. water temperature, salinity, rock and biological sample photos, obtained by the dive survey. Users can browse a dive track visualized in 3D virtual spaces using the WebGL JavaScript library. By synchronizing this virtual dive track with videos, users can watch deep-sea videos recorded at a point on a dive track. Users can play an animation which a submersible-shaped polygon automatically traces a 3D virtual dive track and displays of dive survey data are synchronized with tracing a dive track. Users can directly refer to additional information of other JAMSTEC data sites such as marine biodiversity database, marine biological sample database, rock sample database, and cruise and dive information database, on each page which a 3D virtual dive track is displayed. A 3D visualization of a dive

Functional and Structural Findings of Neurodegeneration in Early Stages of Diabetic Retinopathy. Cross-sectional Analyses of Baseline Data of the EUROCONDOR project

DEFF Research Database (Denmark)

Santos, Ana Rita; Ribeiro, Luisa; Bandello, Francesco

2017-01-01

Cross-sectional study evaluating the relationship between: a) functional and structural measurements of neurodegeneration in initial stages of diabetic retinopathy (DR); and b) presence of neurodegeneration and early microvascular impairment. We analyzed baseline data of patients with type 2...... diabetes (n=449) enrolled in the EUROCONDOR study (NCT01726075). Functional studies by multifocal ERG (mfERG) evaluated neurodysfunction and structural measurements using spectral domain optical-coherence tomography (SD-OCT) evaluated neurodegeneration. The mfERG P1 amplitude was more sensitive than the P1...

The effect of subretinal viscoelastics on the porcine retinal function

DEFF Research Database (Denmark)

Sørensen, Nina Fischer; Ejstrup, Rasmus; Svahn, Thøger Frøsig

2012-01-01

pharmaceutical therapy is needed, and can only be tested in a suitable animal model. The porcine model is promising and the mfERG is well validated in this model. RD was induced in 18 pigs by vitrectomy and healon injection of various concentrations. Preoperatively and 6 weeks postoperatively eight animals were...... examined by mfERG. The major component P1 was analyzed statistically. Indirect ophthalmoscopy and bilateral color fundus photography (FP) were performed. Selected animals underwent high-resolution optical coherence tomography (OCT). Examination by ophthalmoscopy and FP showed that the RDs remained detached...

O objecto dúctil: a emergência de uma sociologia histórica da edição The ductile object: emergency a historical sociology of publishing

Directory of Open Access Journals (Sweden)

Nuno Medeiros

2010-12-01

Full Text Available Localizada, desde o início das diligências explicativas para a apreender, numa matriz temática e disciplinar em que se multiplicam os cruzamentos, a edição de livros foi sendo construída como objeto para cuja captura e definição convergiu e converge sinuosamente um feixe de tradições e perspectivas, tanto na sociologia como na história. Este artigo procura estabelecer um percurso sistematizado que se possa constituir para o leitor interessado como baliza de entendimento de um campo de pesquisa teórica e empírica em construção, que aqui se denomina "sociologia histórica da edição". Projeto necessariamente parcelar, o propósito apresentado concretiza-se seletivamente, tentando proceder a uma exploração do tema a partir especificamente de duas tradições, a francesa e a anglo-saxônica, com enfoque particular na produção do último meio século.Since the first attempts to apprehend and explain the phenomenon, book publishing has been apprehended within a disciplinary and thematic context formed by a constellation of traditions and approaches in both sociology and history with multiple interconnections. This article looks to provide a systematic framework for the reader interested in gaining an understanding of one particular field of theoretical and empirical research, what I call here a historical sociology of publishing. A necessarily incomplete project, the approach is purposefully selective, examining the theme through the exploration of two specific traditions, French and Anglo-Saxon, with a particular focus on the last half century.

[Case-control study on effects of external fixation combined with limited internal fixation for the treatment of Pilon fractures of Rüedi-Allgower type III].

Science.gov (United States)

Duan, Da-Peng; You, Wu-Lin; Ji, Le; Zhang, Yong-Tao; Dang, Xiao-Qian; Wang, Kun-Zheng

2014-01-01

To analyze the effects of three surgical operations in the treatment of Pilon fracture of Rüedi-Allgower type III, and put forward the best therapeutic method. The clinical data of 33 patients with Pilon fracture who received surgical operations (plaster immobilization group, 10 cases; distal tibia anatomical plate group, 11 cases; external fixation with limited internal fixation group, 12 cases) from October 2009 to January 2012 were analyzed. There were 5 males and 5 females, ranging in age from 24 to 61 years in the plaster immobilization group. There were 7 males and 4 females, ranging in age from 21 to 64 years in the distal tibia anatomical plate group. There were 7 males and 5 females, ranging in age from 23 to 67 years in the external fixation with limited internal fixation group. The Ankle X-ray of Pilon fracture after operation, ankle score, early and late complications were collected. Bourne system was used to evaluate ankle joint function. After 8 months to 3 years follow-up, it was found that three kinds of treatment had significant differences in the outcomes and complications (P external fixation with limited internal fixation group got the best results. The number of anatomic reduction cases in the external fixation with limited internal fixation group (7 cases) and the distal tibia anatomical plate group (8 cases) was more than the plaster immobilization group (2 cases). According to the ankle score, 8 patients got an excellent result, 3 good and 1 poor in the limited internal fixation group ,which was better than those of distal tibia anatomical plate group (5 excellent, 4 good and 2 poor) and the plaster immobilization group (3 excellent, 4 good and 3 poor). The number of early and late complications in the external fixation with limited internal fixation group was more than those in the plaster immobilization group and the distal tibia anatomical plate group (Pexternal fixation with limited internal fixation in the treatment of Pilon fracture

Um estudo das edições de Ou isto ou aquilo, de Cecília Meireles A study of Cecília Meirelles' Ou isto ou aquilo editions

Directory of Open Access Journals (Sweden)

Norma Sandra de Almeida Ferreira

2009-08-01

Full Text Available Localizar em sua materialidade a obra Ou isto ou aquilo, de Cecília Meireles, em suas edições - 1964; 1969; 1977; 1987; 1990; 2002 -; cotejá-las para compreender as formas pelas quais os textos são apresentados aos seus leitores, em diferentes tempos; e indagar como e por que essas formas são pensadas e concretizadas são desafios deste artigo. Esta pesquisa de cunho exploratório, à luz, principalmente, dos estudos da História Cultural, privilegia, no exame das diferentes edições, as partes externas que envolvem os poemas (o texto propriamente dito e suas ilustrações. Identifica e discute a produção de sentidos e valores ligados à educação do leitor, ao reconhecimento de uma escritora consagrada pela tradição literária, à singularidade da linguagem, à importância de uma prática prazerosa da leitura.This article brings the challenges of locating Cecília Meireles' book Ou isto ou aquilo (Either this or that in its materialness, with considerations on its 1964, 1969, 1977, 1987, 1990 and 2002 editions, as well as comparing these editions in order to understand the forms in which texts are presented to their readers at different times, and questioning how and why these forms are conceived and put into practice. In the light of studies on cultural history, in the analysis of the different editions, this exploratory research prioritizes the external parts that involve poems (the texts themselves and their illustrations. It provides identification and a discussion on the production of senses and values related to readers' education, the recognition of a writer who is consecrated by literary tradition, the uniqueness of the language used, and the importance of pleasant reading practice.

The structure and function of the macula in patients with advanced retinitis pigmentosa.

Science.gov (United States)

Vámos, Rita; Tátrai, Erika; Németh, János; Holder, Graham E; DeBuc, Delia Cabrera; Somfai, Gábor Márk

2011-10-28

To assess the structure and function of the macula in advanced retinitis pigmentosa (RP). Twenty-nine eyes of 22 patients with RP were compared against 17 control eyes. Time-domain optical coherence tomography (OCT) data were processed using OCTRIMA (optical coherence tomography retinal image analysis) as a means of quantifying commercial OCT system images. The thickness of the retinal nerve fiber layer (RNFL), ganglion cell layer and inner plexiform layer complex (GCL+IPL), inner nuclear layer and outer plexiform layer complex (INL+OPL), and the outer nuclear layer (ONL) were measured. Multifocal electroretinography (mfERG) was performed; two groups were formed based on the mfERG findings. Fourteen eyes had no detectable central retinal function (NCRF) on mfERG; detectable but abnormal retinal function (DRF) was present in the mfERG of the other 15 eyes. The thickness of the ONL in the central macular region was significantly less in the NCRF eyes compared with that in both DRF eyes and controls. The ONL was significantly thinner in the pericentral region in both patient groups compared with that in controls, whereas the thickness of the GCL+IPL and INL+OPL was significantly decreased only in the NCRF eyes. The RNFL in the peripheral region was significantly thicker, whereas the thickness of the GCL+IPL and ONL was significantly thinner in both patient groups compared with that in controls. The results are consistent with degeneration of the outer retina preceding inner retinal changes in RP. OCT image segmentation enables objective evaluation of retinal structural changes in RP, with potential use in the planning of therapeutic interventions and conceivably as an outcome measure.

The Structure and Function of the Macula in Patients with Advanced Retinitis Pigmentosa

Science.gov (United States)

Vámos, Rita; Tátrai, Erika; Németh, János; Holder, Graham E.; DeBuc, Delia Cabrera

2011-01-01

Purpose. To assess the structure and function of the macula in advanced retinitis pigmentosa (RP). Methods. Twenty-nine eyes of 22 patients with RP were compared against 17 control eyes. Time-domain optical coherence tomography (OCT) data were processed using OCTRIMA (optical coherence tomography retinal image analysis) as a means of quantifying commercial OCT system images. The thickness of the retinal nerve fiber layer (RNFL), ganglion cell layer and inner plexiform layer complex (GCL+IPL), inner nuclear layer and outer plexiform layer complex (INL+OPL), and the outer nuclear layer (ONL) were measured. Multifocal electroretinography (mfERG) was performed; two groups were formed based on the mfERG findings. Fourteen eyes had no detectable central retinal function (NCRF) on mfERG; detectable but abnormal retinal function (DRF) was present in the mfERG of the other 15 eyes. Results. The thickness of the ONL in the central macular region was significantly less in the NCRF eyes compared with that in both DRF eyes and controls. The ONL was significantly thinner in the pericentral region in both patient groups compared with that in controls, whereas the thickness of the GCL+IPL and INL+OPL was significantly decreased only in the NCRF eyes. The RNFL in the peripheral region was significantly thicker, whereas the thickness of the GCL+IPL and ONL was significantly thinner in both patient groups compared with that in controls. Conclusions. The results are consistent with degeneration of the outer retina preceding inner retinal changes in RP. OCT image segmentation enables objective evaluation of retinal structural changes in RP, with potential use in the planning of therapeutic interventions and conceivably as an outcome measure. PMID:21948552

Macular function and morphology in acute retinal pigment epithelitis.

Science.gov (United States)

Gundogan, Fatih C; Diner, Oktay; Tas, Ahmet; Ilhan, Abdullah; Yolcu, Umit

2014-12-01

A 20-year-old man applied with vision loss in the left eye. Right eye examination was unremarkable. Best-corrected visual acuity (BCVA) in the left eye was 20/200. Fundus examination revealed a few yellow spots within a round-shaped macular lesion. Autofluorescence imaging showed hyperautofluorescence in the lesion. Central amplitudes in multifocal electroretinogram (mfERG) were depressed. The patient reported a rhinopharyngitis 7-10 days before the visual loss. The patient was diagnosed as acute retinal pigment epithelitis. BCVA improved gradually up to 20/20 in 4 weeks. mfERG amplitudes returned to normal. A slight pigmentary distortion was the only residual fundus finding.

"Economia e sociedade": a herança de Max Weber à luz da edição de sua Obra completa (MWG "Economy and society": Max Weber's legacy following the publication of his Complete works (MWG

Directory of Open Access Journals (Sweden)

M. Rainer Lepsius

2012-01-01

Full Text Available O artigo relata o entendimento atual do conjunto de textos conhecido como Economia e sociedade, procurando esclarecer em que consistia originalmente; como foi organizado nas edições anteriores por Marianne Weber e Johannes Winckelmann; como foi tratado no âmbito da nova edição da MWG. Para tanto, procura indicar como Max Weber situava os diversos textos, as diversas versões e fases de concepção e composição desses escritos. A partir daí, sistematiza os principais aspectos dos textos evidenciados na MWG, assim como os principais campos de discussão que se abrem para a pesquisa, em especial a sociologia econômica.The article reviews the current understanding of the set of texts known as Economy and Society, looking to identify the original content, how these texts were edited in previous editions by Marianne Weber and Johannes Winckelmann, and how they have been dealt with in the new edition of the MWG. These aims in mind, the text looks to show how Max Weber himself situated the various texts, including the different versions and phases of conception and composition of the writings. The article then summarizes the main aspects of the works, as evinced in the MWG, as well as the principal fields of discussion opened up for research, especially in economic sociology.

Impacto da tecnologia de informação no Supply Chain Management: um estudo multicaso sobre a adoção de EDI entre varejo e indústria agroalimentar The impact of information technology on the Supply Chain Management: a multicase study in EDI adoption between the agrifood industry and retailers

Directory of Open Access Journals (Sweden)

Andrea Lago da Silva

1999-12-01

Full Text Available As tecnologias de informação têm alterado as formas de coordenação entre os diferentes elos da cadeia de suprimentos. A coordenação pode ser entendida como a habilidade de transmitir informação, estímulos e controles ao longo das etapas seqüenciais que integram o conjunto de atividades necessárias para atender o mercado (FARINA & ZYLBERSZTAJN, 1994. O conjunto destas etapas é o que tem sido chamado de Supply Chain ou Cadeia de Suprimentos. Neste artigo, discute-se alguns casos de adoção de uma tecnologia de informação, o EDI (troca eletrônica de dados como ferramenta de coordenação entre varejistas e indústrias agroalimentares. Conclui-se que o processo de adoção é relativamente recente para que se possa mensurar resultados quantitativos e qualitativos significativos, mas já se observa alterações na freqüência de desabastecimento, em estoques melhor dimensionados e vendas maiores em decorrência da maior disponibilidade de mercadorias. Sinalizam-se também mudanças qualitativas, como alteração na função do vendedor tradicional, maior interação entre as áreas técnicas, com um aprendizado comum das novas formas de usar a tecnologia e o importante papel da confiança nos relacionamentos interorganizações.Information technology has changed the patterns of coordination among the different linkages of supply-chains. Coordination can be understood as the ability to transfer information, incentives and controls throughout the sequential stages which integrate the set of activities indispensable to serve the market (FARINA & ZYLBERSZTAJN, 1994. The sum of these stages is currently known as Supply-Chains. This paper discusses cases of adopting a specific information technology, EDI (Electronic Data Interchange, as an integration tool between the food industry and retailers. It was found that the adoption process is too recent to measure significative quantitative results, but it is possible to observe changes in the

O Brasil através dos Para-brisas: O Turismo na Primeira Edição da Revista Quatro Rodas

Directory of Open Access Journals (Sweden)

Maria Henriqueta S. Garcia Gimenes-Minasse

2014-07-01

Full Text Available É grande a importância dos guias turísticos na construção da imagem de destinos turísticos, pois auxiliam a organização de viagens, selecionando o que merece ser visto e visitado. No Brasil, um dos mais respeitados pelos turistas domésticos é o Guia Quatro Rodas, publicado anualmente pela Editora Abril, desde setembro de 1965. Contudo, já em 1960 a revista Quatro Rodas, criada nesse ano, e da qual o Guia nasceu, já vinha desempenhando o papel de informar e orientar o leitor sobre passeios e roteiros que poderiam ser feitos de automóvel. Este artigo tem o objetivo de analisar o conteúdo relacionado ao Turismo da primeira edição da Revista Quatro Rodas. Os principais resultados encontrados evidenciam a transformação social do Brasil com o advento de uma matriz econômica pautada na indústria do automóvel e com a incorporação das viagens de lazer como uma forma de descoberta desse ‘novo’ país.  Brazil through the Windshield: Tourism in the First Edition of Quatro Rodas Magazine - Tour guides are very important in building the image of touristic attractions, as they help with travel arrangements and selection of attractions to be seen and visited. In Brazil Guia Quatro Rodas is one of the guides most respected by domestic tourists. It is annually published by Editora Abril, since September 1965. Nevertheless, since 1960 the newly formed Quatro Rodas magazine, and from which the Guia Quatro Rodas was borne, was already playing the role of informing and guiding its readers in relation to tours that could be made by car. The scope of this article is to analyze the first edition of Quatro Rodas magazine with respect to its tourism-related content. The main results show the social transformation of Brazil with the advent of an economic matrix based on the automotive industry and the incorporation of leisure travel as a way to discover the ‘new’ country.

Characterization of macular structure and function in two Swedish families with genetically identified autosomal dominant retinitis pigmentosa

Science.gov (United States)

Abdulridha-Aboud, Wissam; Kjellström, Ulrika; Andréasson, Sten

2016-01-01

Purpose To study the phenotype in two families with genetically identified autosomal dominant retinitis pigmentosa (adRP) focusing on macular structure and function. Methods Clinical data were collected at the Department of Ophthalmology, Lund University, Sweden, for affected and unaffected family members from two pedigrees with adRP. Examinations included optical coherence tomography (OCT), full-field electroretinography (ffERG), and multifocal electroretinography (mfERG). Molecular genetic screening was performed for known mutations associated with adRP. Results The mode of inheritance was autosomal dominant in both families. The members of the family with a mutation in the PRPF31 (p.IVS6+1G>T) gene had clinical features characteristic of RP, with severely reduced retinal rod and cone function. The degree of deterioration correlated well with increasing age. The mfERG showed only centrally preserved macular function that correlated well with retinal thinning on OCT. The family with a mutation in the RHO (p.R135W) gene had an extreme intrafamilial variability of the phenotype, with more severe disease in the younger generations. OCT showed pathology, but the degree of morphological changes was not correlated with age or with the mfERG results. The mother, with a de novo mutation in the RHO (p.R135W) gene, had a normal ffERG, and her retinal degeneration was detected merely with the reduced mfERG. Conclusions These two families demonstrate the extreme inter- and intrafamilial variability in the clinical phenotype of adRP. This is the first Swedish report of the clinical phenotype associated with a mutation in the PRPF31 (p.IVS6+1G>T) gene. Our results indicate that methods for assessment of the central retinal structure and function may improve the detection and characterization of the RP phenotype. PMID:27212874

Assessment of hydroxychloroquine maculopathy after cessation of treatment: an optical coherence tomography and multifocal electroretinography study.

Science.gov (United States)

Moschos, Marilita M; Nitoda, Eirini; Chatziralli, Irini P; Gatzioufas, Zisis; Koutsandrea, Chryssanthi; Kitsos, George

2015-01-01

This study was conducted to evaluate the macular status of patients treated with hydroxychloroquine before and after cessation of treatment. Forty-two patients with systemic lupus erythematosus underwent ocular examination based on visual acuity evaluation, optical coherence tomography retinal thickness measurements, and multifocal electroretinography (mfERG) records at first visit. The tests were repeated 6 months after treatment withdrawal and compared to the findings at their first visit. Mean visual acuity (measured in log minimum angle of resolution) of both eyes was statistically increased after hydroxychloroquine discontinuation (difference in means: 0.06 [Phydroxychloroquine improves along with the amplitudes of the mfERG responses 6 months after discontinuation of the drug, but no difference in retinal thickness is identified.

Linezolid induced retinopathy.

Science.gov (United States)

Park, Dae Hyun; Park, Tae Kwann; Ohn, Young-Hoon; Park, Jong Sook; Chang, Jee Ho

2015-12-01

While optic neuropathy is a well-known cause of visual disturbances in linezolid-treated patients, the possibility of linezolid-related retinopathy has not been investigated. Here, we report a case of retinopathy demonstrated by multifocal electroretinogram (mfERG) in a linezolid-treated patient. A 61-year-old man with extensively drug-resistant pulmonary tuberculosis treated with linezolid for 5 months presented with painless loss of vision in both eyes. The patient's best corrected visual acuity was 20/50 in the right eye and 20/100 in the left eye. Fundus examination revealed mild disc edema, and color vision was defective in both eyes. Humphrey visual field tests showed a superotemporal field defect in the right eye and central and pericentral field defect in the left eye. Optical coherence tomography (OCT) revealed only mild optic disc swelling. In mfERG, central amplitudes were depressed in both eyes. Four months after the cessation of linezolid, visual acuity was restored to 20/20 right eye and 20/25 left eye. The color vision and visual field had improved. The OCT and mfEFG findings improved as well. Although the clinical features were similar to linezolid-induced optic neuropathy, the mfERG findings suggest the possibility of a retinopathy through cone dysfunction.

Radial optic neurotomy for ischaemic central vein occlusion

Science.gov (United States)

Martínez-Jardón, C S; Meza-de Regil, A; Dalma-Weiszhausz, J; Leizaola-Fernández, C; Morales-Cantón, V; Guerrero-Naranjo, J L; Quiroz-Mercado, H

2005-01-01

Background/aims: Ischaemic central retinal vein occlusion (CRVO) accounts for 20–50% of all CRVO. No treatment has been proved to be effective. The efficacy of radial optic neurotomy (RON) was evaluated in eyes with ischaemic CRVO. Methods: 10 patients with ischaemic CRVO underwent RON. After pars plana vitrectomy, a microvitreoretinal blade was used to incise the scleral ring, cribriform plate, and adjacent sclera at the nasal edge of the optic disc. Best corrected visual acuity (BCVA), intraocular pressure (IOP), fluorescein angiography (FA), multifocal electroretinography (mfERG), and optical coherence tomography (OCT) were measured preoperatively and at 1, 3, and 6 months postoperatively. Results: No visual improvement was noted in the eyes that underwent RON. FA and mfERG showed no increase in retinal perfusion or retinal function postoperatively. Mean macular central thickness changed from 841 (SD 170) μm preoperatively to 162 (SD 34) μm at the sixth postoperative month. One patient had retinal central artery perforation intraoperatively. One patient developed neovascular glaucoma. Conclusion: RON in ischaemic CRVO did not improve visual function (by mfERG) or visual acuity although macular thickness did improve. This technique may be associated with potential risks. Randomised studies are needed to corroborate these results. PMID:15834084

Carta do editor de edições especiais da Encontros Bibli 10.5007/1518-2924.2011v16nesp1piv

Directory of Open Access Journals (Sweden)

Francisco das Chagas de Souza

2011-06-01

Full Text Available Dos horizontes arquivísticos e de seu sentido É significativo observar que a discussão sobre Arquivologia e sobre as práticas profissionais arquivisticas tem avançado muito nos últimos anos no Brasil, e as razões são claramente apontadas pelos organizadores desta edição especial de Encontros Bibli em seu texto editorial. Contendo sete artigos, esta edição temática traz o título Horizontes Arquivísticos.Para dar vida a este número, foi desenvolvido um trabalho de quase dois anos, liderado pelo pesquisador José Maria Jardim e colaboração de Renata Silva Borges. Aqui estão reunidos nove autores e seis avaliadores, todos vinculados a instituições de ensino e de pesquisa ligadas ao Serviço Público Federal, com sede nas cidades de Brasilia, Rio de Janeiro, Niteroi e Florianópolis: UNB, UNIRIO, UFF, UFRJ, UFSC, Arquivo Nacional e FIOCRUZ.Neste momento da história brasileira ─ em que se anunciam políticas governamentais em prol da cidadania, em que se diz da disposição de resgate da verdade sobre os fatos políticos acontecidos na gestão do estado brasileiro dos anos de 1964 a 1989 ─ os arquivos e seus profissionais passam a divisar um relevante protagonismo. Pode-se dizer que, de certa maneira, deu-se um movimento de preparação deste protagonismo e que, simultaneamente, essa preparação alicerçou a percepção de segmentos importantes do setor público para oferecer essa perspectiva para a sociedade nacional.Nesse sentido, tem peso relevante a instalação de novos cursos de bacharelado na área, totalizando, em 2011, o número de 14 universidades que os oferecem: UNIRIO, UFF, UFSM, UFES, UNB, UEL, UFBA ,UNESP/MARÍLIA, UFRGS, UEPB, UFAM, FURG, UFMG, UFSC. Uma nota marcante é que todas essas Instituições de Ensino Superior têm vínculos governamentais, sendo onze federais e três estaduais. Esse movimento não se faz por outro caminho senão o da pesquisa histórica e social. Em áreas como a História, Educa

Technical feasibility of the electrode ionization process for the makeup water treatment system of the thermal cycle of the CAREM-25 nuclear power plant

International Nuclear Information System (INIS)

Ramilo, Lucia B.; Chocron, Mauricio

2003-01-01

In thermal cycles of PWRs nuclear power plants with once-through steam generators as the CAREM-25, makeup water of very high purity is required to minimizing the induction of corrosion phenomena, fundamentally in the steam generators and other thermal cycle components. The makeup water treatment systems include several stages, of which the demineralization is the purification stage. The required makeup water purity is obtained in this stage. Historically, ultrapure water systems were based completely on ion exchange technology. Now, the electrode ionization process (EDI) has replaced the ion exchange technology used traditionally in the demineralization stage. Continuous demineralization in an EDI stack consists of three coupled processes: ion exchange, continuous ion removal by transport through the ion exchange resin and membranes into the concentrate stream, continuous regeneration by hydrogen and hydroxyl ions derived from the water splitting reaction and driven by the applied direct current. EDI process allows to obtain ultrapure water, with practically no use of chemical reagents and with technologies of continuous process. The objective of this work is the analysis of the electrode ionization process (EDI) for its implementation in the makeup water treatment system of the thermal cycle of the CAREM-25 nuclear power plant. The obtained results allow to assure the technical feasibility of implementation of the electrode ionization process, EDI, in the makeup water treatment system of the thermal cycle of this Argentinean nuclear power plant. (author)

77 FR 57090 - Agency Information Collection Activities: Proposed Collection; Comment Request

Science.gov (United States)

2012-09-17

...: Medicare Electronic Data Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment... Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are... efficient uniform means by which Medicare captures information necessary to drive Medicare EDI security and...

The Antagonistic Interaction of Cones in Human Eyes—a Pilot Study

Directory of Open Access Journals (Sweden)

Jenny Chun-Yee Lung

2011-05-01

Full Text Available Multifocal electroretinogram (mfERG by Sutter (1992 provides a measuring tool of the retinal responses at different locations. Traditional mfERG stimulus at each base period is a pseudorandom m-sequence focal flash. By interleaving seven dark frames between the focal flashes, a slow-sequence stimulus can be formed to trigger retinal responses which are originated predominantly from the bipolar cells and inner retinal cells. In this study, the antagonistic interaction of cones in human eye was investigated by this slow-flash mfERG (sfmfERG under different colour stimuli (white and blue colour conditions. The N1, P1 and photopic negative response (PhNR of the sfmfERG were used to investigate the effect on the local retinal responses. It was found that the blue stimulus could trigger greater amplitudes of the N1, P1 and PhNR than the white stimulus did. In terms of the implicit time, the white stimulus would trigger P1 and PhNR with longer implicit time than the blue stimulus. White stimulus provides a broader spectrum signal than blue stimulus. The changes of cone responses from a broad to narrow spectrum stimulation may illustrate a decrease in the involvement of retinal antagonism and thus leads to an increase in amplitude and a decrease in implicit time.

Damage to the macula associated with LED-derived blue laser exposure: A case report.

Science.gov (United States)

Liang, Lingling; Cui, Zhihua; Lu, Chengwei; Hao, Qian; Zheng, Yajuan

2017-04-24

Light emitting diodes laser is emerging as an important source of light replacing conventional lights. It is widely used for illumination in the bar where young people love to go. But not everyone knows about the light damage to the eye especially to the macula. In this article, we report the case of a macular damage induced by LED-derived blue laser in a bar, studied with optical coherence tomography (OCT) to evaluate the retinal lesion and multifocal electroretinography (mfERG) to evaluate functional damage. Four days after the photo injury to the right eye, the visual acuity was 0.5. Funduscopy revealed a round red lesion in the macula of the right eye. Fluorescein angiography (FA) revealed no leakage. OCT revealed a deficiency in the center of the fovea. MfERG revealed a reduction of the peak value in the right eye compared to the left eye. One month later, although the vision was 1.0 in the right eye, OCT revealed a hyporeflectivity of the ellipsoid zone. MfERG still showed a reduction of the peak value in the right eye compared to the left eye. We believe that general knowledge about laser injuries to the eye should be realized widely. We also think in cases of macular laser damage, the recovery of vision can not demonstrate the recovery of the function of photoreceptors.

Interhemispheric differences and solar cycle effects of the high-latitude ionospheric convection patterns deduced from Cluster EDI observations

Science.gov (United States)

Förster, Matthias; Haaland, Stein

2015-04-01

Here, we present a study of ionospheric convection at high latitudes that is based on satellite measurements of the Electron Drift Instrument (EDI) on-board the Cluster satellites, which were obtained over a full solar cycle (2001-2013). The mapped drift measurements are covering both hemispheres and a variety of different solar wind and interplanetary magnetic field (IMF) conditions. The large amount of data allows us to perform more detailed statistical studies. We show that flow patterns and polar cap potentials can differ between the two hemispheres on statistical average for a given IMF orientation. In particular, during southward directed IMF conditions, and thus enhanced energy input from the solar wind, we find that the southern polar cap has a higher cross polar cap potential. We also find persistent north-south asymmetries which cannot be explained by external drivers alone. Much of these asymmetries can probably be explained by significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemisphere. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace. The average convection is higher during periods with high solar activity. Although local ionospheric conditions may play a role, we mainly attribute this to higher geomagnetic activity due to enhanced solar wind - magnetosphere interactions.

48 CFR 552.216-72 - Placement of Orders.

Science.gov (United States)

2010-10-01

...] (b) Orders may be placed through Electronic Data Interchange (EDI) or mailed in paper form. EDI... Data Interchange (EDI) format. (c) If the Contractor agrees, General Services Administration's Federal Acquisition Service (FAS) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer...

75 FR 41093 - General Services Administration Acquisition Regulation; Rewrite of GSAR Part 516, Types of Contracts

Science.gov (United States)

2010-07-15

...) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer EDI is not possible, FAS will use an alternative EDI method allowing the Contractor to receive orders by facsimile transmission. Subject to the Contractor's agreement, other agencies may place orders by EDI. * * * * * (g) The...

Demand and withdraw behaviors in couples with a history of infidelity.

Science.gov (United States)

Balderrama-Durbin, Christina M; Allen, Elizabeth S; Rhoades, Galena K

2012-02-01

Although relationship distress and dissolution are common consequences of sexual involvement outside a committed relationship, there is little empirical information regarding communication behaviors of couples who have experienced extradyadic involvement (EDI). This study examined male and female demand and withdraw behaviors in videotaped conflict discussions among 170 married or seriously dating couples categorized into 3 groups: those without a history of sexual EDI, those with a history of sexual EDI that was known to the other partner, and those with a history of "unknown" (undisclosed or undiscovered) sexual EDI. Both men and women in a relationship where there was at least one unknown EDI demonstrated the highest levels of demand behaviors. Furthermore, demand behaviors were higher for participating partners (those engaging in an outside sexual relationship) in relationships with an unknown EDI compared with participating partners in relationships with a known EDI. Conversely, demand behaviors were higher among nonparticipating partners in relationships with known EDI, compared to with nonparticipating partners in relationships with unknown EDI. Withdraw behaviors demonstrated a less pronounced and less consistent pattern of elevation by EDI group, and role within EDI, compared with demand behaviors. Clinical and relational implications for these findings are discussed.

Functional implications of short-term retinal detachment in porcine eyes

DEFF Research Database (Denmark)

Kyhn, Maria Voss; Kiilgaard, Jens Folke; Lopez, Ana Garcia

2008-01-01

The aim of the study was to determine the type and magnitude of detectable changes in pig multifocal electroretinography (mfERG) induced by the vitreoretinal surgical procedures necessary to gain access to the subretinal space....

Digital TV: the aparattus and the representation of real on image edition in news casting TV Digital: o aparelho e a representação do real na edição de imagens no telejornalismo

Directory of Open Access Journals (Sweden)

Fernanda Aiex Boni

2011-08-01

Full Text Available This study investigates some changes on image edition due to the transfer of Analogic to Digital Television in Brazil. Beginning with Vilém Flusser’s Media Theory and its concept of “apparatus”, it develops a theoretical analysis of the new relationship between journalists and digital editing instruments, taking into account the concept of hyperreality proposed by Jean Baudrillard. Retrieving the philosophical discourse of “real” throughout History and also the positivist concepts, base of the journalistic activity, it discusses how digital image manipulation and the construction of graphic universes meddle with the new representation of real presented by television news casting. From interviews with Rede Globo editors in São Paulo, Rio de Janeiro and Curitiba (cities where digital television has already been implemented, it analyses how this new technology can hinder the main commitment of journalism, which is reporting facts as faithfully as possible. The discussion proposes an engagement of professionals and society regarding digital images in the search of greater critical conscience towards digital images in news casting, with an ethic view of the use of manipulation resources and scene construction on news editing. Este trabalho investiga algumas mudanças na edição de imagens com a passagem da TV Analógica para a Digital no Brasil. A partir da teoria da mídia de Vilém Flusser e seu conceito de “aparelho” desenvolve-se uma análise teórica da nova relação entre os jornalistas e os equipamentos digitais de edição, levando-se em conta o conceito de hiper-realidade, proposto por Jean Baudrillard. Retomando o percurso filosófico do real ao longo da história e ainda os conceitos positivistas, que embasam a atividade jornalística, discute-se de que maneira a manipulação das imagens digitais e a construção deuniversos gráficos interferem na nova representação do real apresentada pelo telejornalismo. Com base em

7-Hexagon Multifocal Electroretinography for an Objective Functional Assessment of the Macula in 14 Seconds.

Science.gov (United States)

Schönbach, Etienne M; Chaikitmongkol, Voraporn; Annam, Rachel; McDonnell, Emma C; Wolfson, Yulia; Fletcher, Emily; Scholl, Hendrik P N

2017-01-01

We present the multifocal electroretinogram (mfERG) with a 7-hexagon array as an objective test of macular function that can be recorded in 14 s. We provide normal values and investigate its reproducibility and validity. Healthy participants underwent mfERG testing according to International Society for Clinical Electrophysiology of Vision (ISCEV) standards using the Espion Profile/D310 multifocal ERG system (Diagnosys, LLC, Lowell, MA, USA). One standard recording of a 61-hexagon array and 2 repeated recordings of a custom 7-hexagon array were obtained. A total of 13 subjects (mean age 46.9 years) were included. The median response densities were 12.5 nV/deg2 in the center and 5.2 nV/deg2 in the periphery. Intereye correlations were strong in both the center (ρCenter = 0.821; p < 0.0001) and the periphery (ρPeriphery = 0.862; p < 0.0001). Intraeye correlations were even stronger: ρCenter = 0.904 with p < 0.0001 and ρPeriphery = 0.955 with p < 0.0001. Bland-Altman plots demonstrated an acceptable retest mean difference in both the center and periphery, and narrow limits of agreement. We found strong correlations of the center (ρCenter = 0.826; p < 0.0001) and periphery (ρPeriphery = 0.848; p < 0.0001), with recordings obtained by the 61-hexagon method. The 7-hexagon mfERG provides reproducible results in agreement with results obtained according to the ISCEV standard. © 2017 S. Karger AG, Basel.

Morphology and function of the retina in children and young adults with Stargardt dystrophy

Directory of Open Access Journals (Sweden)

Martina Jarc Vidmar

2012-06-01

Conclusions: In young patients with Stargardt dystrophy central retinal atrophy was shown by OCT and AF. The shift of fixation to the PRL was seen in all the patients. MfERG showed central cone dysfunction in all the patients.

78 FR 12322 - Agency Information Collection Activities: OMB Review; Comment Request

Science.gov (United States)

2013-02-22

... Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment Form; Use: The purpose of this... identification of Medicare providers/suppliers and authorization of requested Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are completed by Medicare providers...

Examining the extreme 2017 spring drought event in South Korea using a suite of drought indices (SPI, SC-PDSI, SPEI, EDI)

Science.gov (United States)

Nam, W. H.; Hayes, M. J.; Svoboda, M. D.; Fuchs, B.; Tadesse, T.; Wilhite, D. A.; Hong, E. M.; Kim, T.

2017-12-01

South Korea has experienced extreme droughts in 1994-1995, 2000-2001, 2012, 2015, and 2016-2017. The 2017 spring drought (with especially low winter precipitation recorded in winter 2016) affected a large portion of central and western South Korea, and was one of the most severe droughts in the region since the 2000-2001 drought. The spring drought of 2017 was characterized by exceptionally low precipitation with total precipitation from January to June being 50% lower than the mean normal precipitation record (1981-2010) over most of western South Korea. It was the climatologically driest spring over the 1961-2016 record period. Effective drought monitoring and management depends on which drought indices are selected because each drought index has different drought criteria or levels of drought severity, associated with drought responses. In this study, for the quantitative analysis of the spring 2017 drought event in South Korea, four widely-used drought indices, including the Standardized Precipitation Index (SPI), the Standardized Precipitation Evapotranspiration Index (SPEI), the Self-Calibrated Palmer Drought Severity Index (SC-PDSI), and the Effective Drought Index (EDI) are compared with observed drought damaged areas in the context of agricultural drought impacts. The South Korean government (Ministry of Agriculture, Food and Rural Affairs (MAFRA) and Korea Rural Community Corporation (KRC)) has been operating a government-level drought monitoring system since 2016. Results from this study can be used to improve the drought monitoring applications, as well as drought planning and preparedness in South Korea.

The effect of high- to low-altitude adaptation on the multifocal electroretinogram

DEFF Research Database (Denmark)

Kofoed, Peter Kristian; Sander, Birgit; Zubieta-Calleja, Gustavo

2009-01-01

PURPOSE: To examine variations in retinal electrophysiology assessed by multifocal electroretinogram (mfERG) during acclimatization of native highlanders to normobaric normoxia at sea level. METHODS: Eight healthy residents of the greater La Paz area in Bolivia (3600 m above sea level) were...

75 FR 64737 - Automated Commercial Environment (ACE): Announcement of a National Customs Automation Program...

Science.gov (United States)

2010-10-20

... interchange (EDI) for submitting advance ocean and rail data and intends to amend the regulations as [email protected] . Please describe in the body of the e-mail any past EDI history with CBP. Written... (EDI). For ocean and rail carriers, the CBP-approved EDI is the Automated Manifest System (AMS). Ocean...

Detecting Fraudulent Erasures at an Aggregate Level

Science.gov (United States)

Sinharay, Sandip

2018-01-01

Wollack, Cohen, and Eckerly suggested the "erasure detection index" (EDI) to detect fraudulent erasures for individual examinees. Wollack and Eckerly extended the EDI to detect fraudulent erasures at the group level. The EDI at the group level was found to be slightly conservative. This article suggests two modifications of the EDI for…

Toxicity profiles of subretinal indocyanine green, Brilliant Blue G, and triamcinolone acetonide: a comparative study

DEFF Research Database (Denmark)

Ejstrup, Rasmus; Dornonville de la Cour, Morten; Heegaard, Steffen

2012-01-01

BACKGROUND: This study introduces a novel porcine model to examine the histopathological and electrophysiological consequences of retinotoxicity exerted by dyes commonly used for internal limiting membrane (ILM) staining. METHODS: Indocyanine green (ICG) 0.5 mg/ml, Brilliant Blue G (BBG) 0.25 mg....../ml and triamcinolone acetonide (TA) 13 mg/ml was injected subretinally in 12 vitrectomized pig eyes. At 6 weeks, retinas were examined by multifocal electroretinography (mfERG), ophthalmoscopy, fluorescein angiograpy, histopathology, and apoptosis assay. RESULTS: mfERG responses were significantly lower in ICG......-injected eyes than in healthy fellow eyes (p¿=¿0.039). The ratio between injected eyes and healthy fellow eyes was lower in the ICG group than in the BBG (p¿=¿0.009) and TA group (p¿=¿0.025). No difference between BBG and TA existed. All retinas were reattached, and fluorescein angiographies showed a window...

77 FR 70708 - VA Acquisition Regulation: Electronic Submission of Payment Requests

Science.gov (United States)

2012-11-27

... electronic data interchange (EDI) formats; or (3) another electronic form as prescribed by the contract....fsc.va.gov/einvoice.asp .); or, (b) A system that conforms to the X12 electronic data interchange (EDI... Institute (ANSI). The X12 EDI Web site ( http://www.x12.org ) includes additional information on EDI 810 and...

Test-retest variability of multifocal electroretinography in normal volunteers and short-term variability in hydroxychloroquine users

Directory of Open Access Journals (Sweden)

Browning DJ

2014-08-01

Full Text Available David J Browning,1 Chong Lee2 1Charlotte Eye, Ear, Nose and Throat Associates, 2University of North Carolina – Charlotte, Charlotte, NC, USA Purpose: To determine measurement variability of N1P1 amplitudes and the R1/R2 ratio in normal subjects and hydroxychloroquine users without retinopathy. Design: Retrospective, observational study. Subjects: Normal subjects (n=21 and 44 patients taking hydroxychloroquine (n=44 without retinopathy. Methods: Multifocal electroretinography (mfERG was performed twice in one session in the 21 normal subjects and twice within 1 year in the hydroxychloroquine users, during which time no clinical change in macular status occurred. Main outcome measures: N1P1 amplitudes of rings R1–R5, the R1/R2 ratio, and coefficients of repeatability (COR for these measurements. Results: Values for N1P1 amplitudes in hydroxychloroquine users were reduced compared with normal subjects by the known effect of age, but R1/R2 was not affected by age. The COR for R1–R5 ranged from 43% to 52% for normal subjects and from 43% to 59% for hydroxychloroquine users; for R1/R2 the COR was 29% in normal subjects and 45% in hydroxychloroquine users. Conclusion: mfERG measurements show high test-retest variability, limiting the ability of a single mfERG test to influence a decision to stop hydroxychloroquine; corroborative evidence with a different ancillary test is recommended in a suspicious case. Keywords: multifocal electroretinography, hydroxychloroquine, test-retest variability 

Facilitating the analysis of the multifocal electroretinogram using the free software environment R.

Science.gov (United States)

Bergholz, Richard; Rossel, Mirjam; Dutescu, Ralf M; Vöge, Klaas P; Salchow, Daniel J

2018-01-01

The large amount of data rendered by the multifocal electroretinogram (mfERG) can be analyzed and visualized in various ways. The evaluation and comparison of more than one examination is time-consuming and prone to create errors. Using the free software environment R we developed a solution to average the data of multiple examinations and to allow a comparison of different patient groups. Data of single mfERG recordings as exported in .csv format from a RETIport 21 system (version 7/03, Roland Consult) or manually compiled .csv files are the basis for the calculations. The R software extracts response densities and implicit times of N1 and P1 for the sum response, each ring eccentricity, and each single hexagon. Averages can be calculated for as many subjects as needed. The mentioned parameters can then be compared to another group of patients or healthy subjects. Application of the software is illustrated by comparing 11 patients with chloroquine maculopathy to a control group of 7 healthy subjects. The software scripts display response density and implicit time 3D plots of each examination as well as of the group averages. Differences of the group averages are presented as 3D and grayscale 2D plots. Both groups are compared using the t-test with Bonferroni correction. The group comparison is furthermore illustrated by the average waveforms and by boxplots of each eccentricity. This software solution on the basis of the programming language R facilitates the clinical and scientific use of the mfERG and aids in interpretation and analysis.

Principal components′ analysis of multifocal electroretinogram in retinitis pigmentosa

Directory of Open Access Journals (Sweden)

Aniruddha Maiti

2011-01-01

Full Text Available Aims : To determine waveforms of multifocal electroretinogram (mfERG in patients with retinitis pigmentosa (RP contributing significantly to the overall retinal response by using principal components′ analysis. Settings and Design: Prospective, non-randomized, single-visit, observational, case-control study from a single tertiary ophthalmic center. Materials and Methods: Patients with various forms of RP underwent mfERG testing for a period of one year. The first-order kernel responses of RP cases were compared with concurrently recruited healthy controls. Statistical Analysis Used: Parametric data was analyzed using the unpaired t test for differences between the implicit time and amplitudes of cases and controls. Principal components′ analysis was done for each implicit time and amplitude in cases with RP using the Varimax rotation method. Results: From March 2006 to March 2007, 24 cases with typical RP (56%, 47 eyes were included in the final analysis. Their mean age was 33.7 years (19-69 ± 15.5 years. Comparison of latencies and amplitudes among RP cases with log MAR acuity ≤ 0.18 and those > 0.18, revealed significant difference in the implicit time (P1 in Ring 2 only (P=0.028. Two components (predominently from Ring 1 and 2 each contributing 66.8% and 88.8% of the total variance in the data for latencies and amplitudes respectively, were seen. Conclusions : The first two rings of the mfERG contributed to the variance of waveforms in RP, irrespective of the visual acuity and poor visual field results.

Prolonged multifocal electroretinographic implicit times in the ocular ischemic syndrome

DEFF Research Database (Denmark)

Kofoed, Peter Kristian; Munch, Inger Christine; Sander, Birgit

2010-01-01

.4 +/- 1.7 mm Hg, respectively. Summed mfERG implicit times (N1, P1, N2) were prolonged in eyes with OIS, by 7.6%, 6.2%, and 7.5%, respectively, compared with fellow eyes (P macula, whereas the assessment of responses from...

Employee-Driven Innovation: A Brave New World in the Build Environment’s Project Organisations

DEFF Research Database (Denmark)

Sørensen, Henrik; Wandahl, Søren

2013-01-01

-driven innovation (EDI) could be such a methodology to implicate the spoken and tacit knowledge of the employees that would strengthen the innovative capabilities of the project organisations. To investigate the theoretical field around EDI a literature study was conducted. The overall objective was to develop...... a theoretical framework based on the field of EDI and related methodologies. This research resulted in two main findings. First; identification of the overall themes of the EDI field of research. Second; definition of an overall framework of methodologies to conduct EDI in project organisations. Furthermore...

[Follow-up on MEWDS by fundus perimetry and multifocal ERG with the SLO].

Science.gov (United States)

Bültmann, S; Martin, M; Rohrschneider, K

2002-09-01

Most conventional techniques for examination such as perimetry or ERG may not be sensitive enough to detect functional alterations due to MEWDS precisely. We report on a follow-up performed by fundus perimetry and the new technique of multifocal ERG using the scanning laser ophthalmoscope. A 24-year-old female patient (VA 0.2/0.8) was followed up for 7 weeks with these techniques as well as Octopus perimetry, fluorescence angiography, Ganzfeld ERG and biomicroscopy. Multifocal ERG stimulation (mfERG, Retiscan) was performed with the SLO. Visual acuity improved from 0.2 to 0.8 and the central relative scotoma disappeared while a relevant increase of P1-wave amplitudes in mfERG could be observed. Combining objective measurements from the fundus controlled SLO-mfERG and results from fundus perimetry enable good correlation of morphology and results, even for minor alterations of the macula only accessible by few established clinical examinations.

Employee-driven innovation in large project organisations

DEFF Research Database (Denmark)

Sørensen, Henrik; Wandahl, Søren; Christensen, Randi Muff

2014-01-01

(EDI). The case was a group of employees in a large governmental client organisation. The EDI framework was based on a theoretical approach to conduct EDI, derived from a previous literature study. The case study was conducted as an exploratory case study with outset in a gaming approach...... that challenged the participants with discussions on obstacles and solutions for EDI. The game approach was undertaken to facilitate discussions on specific EDI topics carefully selected to stimulate both group and plenum discussions. The themes of the theoretical framework were challenged through...... the participants’ discussions and perceptions of the applicability in the organisation. The findings were discussed in relation to the theoretical approach and findings from a comparable case study. It identified overall methods that had the higher robustness and applicability to incorporate in a practical EDI...

A queda da bancada e as mudanças na cena de apresentação dos telejornais: em busca da identidade e aproximação com o telespectador – uma análise do MGTV Primeira Edição

OpenAIRE

Pereira, Renata Venise Vargas

2013-01-01

Este trabalho teve como proposta investigar como as alterações na cena de apresentação do telejornal, que incluem a retirada da bancada como o principal elemento cênico e a circulação e posicionamento do apresentador no estúdio, constituem tentativas de aproximação com o telespectador, estabelecer vínculos de pertencimento e relações identitárias com seu público. Na pesquisa empírica avaliou-se as alterações adotadas pelo MGTV 1ª Edição, veiculado pela TV Integração de Juiz de Fora, emissora ...

Comparison of peripapillary choroidal thickness measurements via spectral domain optical coherence tomography with and without enhanced depth imaging.

Science.gov (United States)

Ayyildiz, Onder; Kucukevcilioglu, Murat; Ozge, Gokhan; Koylu, Mehmet Talay; Ozgonul, Cem; Gokce, Gokcen; Mumcuoglu, Tarkan; Durukan, Ali Hakan; Mutlu, Fatih Mehmet

2016-05-01

To compare peripapillary choroidal thickness (PP-CT) measurements using a spectral domain optical coherence tomography (SD-OCT) device with and without enhanced depth imaging (EDI). Sixty healthy subjects aged from 18 to 40 years were included in this study. PP-CTs were measured in the right eyes by manual segmentation via SD-OCT both with and without EDI. The intraclass correlation coefficient (ICC) for each technique and comparison of PP-CT measurements between two techniques were evaluated. The correlation between retinal nerve fiber layer (RNFL) thickness and PP-CT was also explored on images of SD-OCT without EDI. The PP-CT measurements of 55 subjects were evaluated. The ICC was 0.999 (95% CI: 0.998-1.0, p  0.05). Additionally, there was no correlation between RNFL thickness and PP-CT (r = -0.109; p = 0.335). The PP-CT measurements via SD-OCT without EDI were consistent with the measurements via SD-OCT with EDI. Ophthalmologists who do not have access to EDI technology can use images of SD-OCT without EDI to measure the peripapillary choroid for research purposes. However, thicker peripapillary choroids cannot be measured using this technique and require further modifications or newer technologies, such as SD-OCT with EDI.

Electronic data interchange in the Canadian natural gas industry

International Nuclear Information System (INIS)

Sheinfield, J.

1995-01-01

The concept of electronic data interchange (EDI) in the gas industry was discussed. EDI as a champion of costumer service and as a powerful management tool was defined, and the process of electronic information transfer was explained. EDI was then placed in the context of the business process, and its benefits in providing efficient service and product improvement were enumerated. North American Gas EDI standards, and industry initiatives were explored in detail

Edição e tradução, entre a cultura e a política: Argentina e Brasil na Feira do Livro de Frankfurt

Directory of Open Access Journals (Sweden)

José de Souza Muniz Jr.

Full Text Available Resumo Este artigo analisa a participação da Argentina e do Brasil como países convidados de honra (em 2010 e 2013, respectivamente na Feira do Livro de Frankfurt. Remetemos tais presenças à história recente da feira e ao seu papel na estrutura dos fluxos e circuitos de edição e tradução em nível mundial, estrutura esta regulada pelas relações desiguais entre distintos países e mercados linguísticos. Analisamos as negociações entre entidades do poder público e da política setorial que deram origem a tais participações; as ênfases temáticas escolhidas para compor os estandes; e as características socioprofissionais dos autores de cada delegação. A conclusão é que tais casos permitem observar relações específicas entre intelectuais e Estado em cada contexto, na medida em que fazem emergir não apenas as tensões entre cultura e economia, mas também os modos específicos como cada país “traduz” questões locais para um âmbito de trocas simbólicas transnacionais.

Repeated subretinal surgery and removal of subretinal decalin is well tolerated

DEFF Research Database (Denmark)

Sørensen, Nina Buus; Klemp, Kristian; Kjær, Troels Wesenberg

2017-01-01

flexible tube. Two weeks after removal, a control mfERG was recorded, the pigs were enucleated and sacrificed and eyes were examined histologically. All statistics were carried out with a paired t-test in SAS Enterprise Guide 7.1® (SAS Institute Inc., Cary, NC, USA). RESULTS: There was no significant...

Electronic Data Interchange: from its Birth to its New Role in Logistics Information Systems

OpenAIRE

Janssens, Gerrit K.

2011-01-01

The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model...

The photographic edition as a visual narrative construction A edição fotográfica como construção de uma narrativa visual

Directory of Open Access Journals (Sweden)

Fernanda Jansen Mira Catanho

2007-01-01

Full Text Available This article, based on the concept of intellectual montage, developed by russian movie director Sergei Eisenstein, works in the premises that the photographic edition may be responsible for the construction of a visual narrative. Thus, it adopts a photographic essay composed of 26 pictures and sends it to three specialists for edition. The results are three different narratives. With this, it becomes evident that the photographic message may undergo a creative rearrange and compose distinctive enunciation discourses. At the end, the work shows that the differences between the discourses elaborated by the editors are captured by the receiver of the photographic message. Este artigo, baseado no conceito de montagem intelectual, desenvolvido pelo cineasta russo Sergei Eisenstein, trabalha com a premissa de que a edição fotográfica pode ser responsável pela construção de uma narrativa visual. Para tanto, adota um ensaio fotográfico composto por 26 fotografias e o passa para três especialistas editá-lo. O resultado são três narrativas diferentes. Com isso, torna-se evidente que a mensagem fotográfica pode passar por uma re-elaboração criativa e formar discursos enunciativos distintos. Ao final, o trabalho mostra que as diferenças entre os discursos elaborados pelos editores são apreendidos pelo receptor da mensagem fotográfica.

48 CFR 552.232-25 - Prompt Payment.

Science.gov (United States)

2010-10-01

... electronic data interchange (EDI) purchase orders (transaction set 850). (ii) The Contractor must generate and submit to the Government valid EDI invoices (transaction set 810) or submit invoices through the... of the Contractor, EFT payments through the Automated Clearing House (ACH) system. (iv) The EDI...

77 FR 20835 - National Customs Automation Program (NCAP) Test Concerning Automated Commercial Environment (ACE...

Science.gov (United States)

2012-04-06

... Interchange (EDI). This notice also describes test particulars including commencement date, eligibility... Electronic Data Interchange (EDI) as part of the Document Image System (DIS) test. DIS is currently a stand... with supporting information via EDI in an Extensible Markup Language (XML) format, in lieu of...

77 FR 34846 - Inspection, Repair, and Maintenance; Driver-Vehicle Inspection Report for Intermodal Equipment

Science.gov (United States)

2012-06-12

... report EDI Electronic data interchange FHWA Federal Highway Administration FMCSRs Federal Motor Carrier...-copy paperwork to unassisted electronic data interchange (EDI) transmissions. IANA added that the... system, or EDI and transmittals of files in various formats. IANA noted that its program offers IEPs and...

Electronic data intercharge: from its birth to its new role in logistics information systems

OpenAIRE

JANSSENS, Gerrit

2011-01-01

The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model changes, to...

76 FR 42721 - Automated Commercial Environment (ACE): Announcement of a New Start Date for the National Customs...

Science.gov (United States)

2011-07-19

... the e-mail any past electronic data interchange (EDI) history with CBP. Written comments concerning... be transmitted in advance of arrival through a CBP-approved electronic data interchange (EDI).The..., 2008).\\1\\ Currently, the Automated Commercial System (ACS) is the CBP-approved EDI through which this...

76 FR 51324 - Hazardous Materials: Incorporating Rail Special Permits Into the Hazardous Materials Regulations

Science.gov (United States)

2011-08-18

... through use of electronic data interchange (EDI). The IVOHMA states ``differences in hazard communication... and on the possible effects EDI may have on distributing hazardous materials shipping paper... consider the use of EDI in other modes of transport in a future rulemaking. Petition No. P-1567 PHMSA...

77 FR 19030 - Automated Commercial Environment Required for the Transmission of Advance Ocean and Rail Cargo...

Science.gov (United States)

2012-03-29

... electronic data interchange (EDI) system. CBP recently completed the testing of the Automated Commercial..., after a six month transition period, ACE will be the only CBP-approved EDI for submitting required...-approved EDI for transmitting to CBP required advance information for ocean and rail cargo. FOR FURTHER...

77 FR 37961 - Hazardous Materials: Incorporating Rail Special Permits Into the Hazardous Materials Regulations

Science.gov (United States)

2012-06-25

...'' are added to Sec. 171.8. Requirements for electronic shipping papers, electronic data interchange (EDI... electronic shipping paper information transmitted by EDI for the development of shipping papers used to... shipping papers by carriers. Most of the commenters support amending the HMR to permit EDI transmission of...

Design management of electronic data interchange systems

NARCIS (Netherlands)

Heck, van H.W.G.M.

1993-01-01

This study deals with the management of the design process of Electronic Data Interchange (EDI) systems. Its objectives are (1) to investigate the design process of EDI systems from a practical and theoretical perspective; (2) to develop a model to describe factors relevant to EDI

75 FR 40729 - Residues of Quaternary Ammonium Compounds, N-Alkyl (C12-14

Science.gov (United States)

2010-07-14

... the Daily Dietary Dose (DDD) and the Estimated Daily Intake (EDI) using modified Food and Drug... survey days. The Estimated Daily Intake (EDI) calculations presented in this assessment for treated... is 0.0103 lbs a.i per gallon of treatment solution. EDI values were calculated using an approach...

78 FR 52958 - Announcement of Test Concerning Manifesting and Entry of Residue Found in Instruments of...

Science.gov (United States)

2013-08-27

... Commercial Environment (ACE) will be the only CBP-approved electronic data interchange (EDI) system for... submitted electronically via EDI process at the master or simple bill level. (2) Qualifiers for IIT with... Regular Bill should be submitted electronically via EDI process. (b) Qualifiers for IIT with Residue (TBD...

77 FR 50613 - Didecyl Dimethyl Ammonium Carbonate and Didecyl Dimethyl Ammonium Bicarbonate; Exemption From the...

Science.gov (United States)

2012-08-22

...) and the Estimated Daily Intake (EDI) using modified Food and Drug Administration (FDA) methodologies for utensils and the Indirect Dietary Residential Exposure Model (IDREAM) for countertops. The EDI... for DDACB for bottling/packing of food is 0.0033 lbs a.i. per gallon of treatment solution. EDI values...

48 CFR 552.216-73 - Ordering Information.

Science.gov (United States)

2010-10-01

... transmission or □ computer-to-computer Electronic Data Interchange (EDI). (b) An offeror electing to receive computer-to-computer EDI is requested to indicate below the name, address, and telephone number of the representative to be contacted regarding establishment of an EDI interface. (c) An offeror electing to receive...

Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul

OpenAIRE

Piccinin,Marcos Rogério Mistro; Cunha,Juliana Ferrari; Almeida,Herbert Paulo de; Bach,Cleiton Cassio; Dossa,Andréa Cristina Grubits Gonçalves de Oliveira; Silva,Reinaldo Ferreira da; Pessoa,Valdir Filgueiras

2007-01-01

OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

77 FR 10621 - Changes to the In-Bond Process

Science.gov (United States)

2012-02-22

... submit in-bond applications electronically using a CBP-approved electronic data interchange (EDI) system... electronically submit the in-bond application to CBP via a CBP-approved EDI system. \\6\\ Due to the unique... as the CBP-approved EDI system for submitting the in-bond application and other information that is...

Extradyadic Involvement, Narcissism, and Callousness in College Students

Science.gov (United States)

Crass, Suzanne L.; Terranova, Andrew M.

2018-01-01

The relationship between narcissism, callousness, and extradyadic involvement (EDI), has been understudied. It was anticipated that callousness and narcissism would be associated with increased likelihood of engaging in an EDI and less distress about having engaged in the EDI. Participants (268 college students; 75% female; mean age of 20 years…

77 FR 65006 - Air Cargo Advance Screening (ACAS) Pilot Program

Science.gov (United States)

2012-10-24

... electronic cargo information by way of a CBP-approved electronic data interchange (EDI) system before the... electronically receive certain information regarding that cargo through a CBP-approved EDI system no later than... the above information regarding that cargo through a CBP-approved EDI system no later than the time of...

78 FR 35115 - Listing of Color Additives Exempt From Certification; Mica-Based Pearlescent Pigments

Science.gov (United States)

2013-06-12

... (EDI) of the additive from all sources for both the mean and high- intake consumer to an acceptable daily intake (ADI) level established by toxicological data. The EDI is determined by projections based... the issuance of Sec. 73.350 we calculated a cumulative EDI (CEDI) for the use of mica-based...

76 FR 54470 - Proposed Data Collections Submitted for Public Comment and Recommendations

Science.gov (United States)

2011-09-01

..., patient name, patient ID number, and cost. Pharmacies utilize Electronic Data Interchange (EDI) processing at the point-of-sale to transmit claims to the World Trade Center Health Program (WTC-HP). The EDI... the point-of-sale. The EDI transmission occurs in real-time as the prescription transaction is made...

Determination of Arsenic Species in Ophiocordyceps sinensis from Major Habitats in China by HPLC-ICP-MS and the Edible Hazard Assessment.

Science.gov (United States)

Guo, Lian-Xian; Zhang, Gui-Wei; Wang, Jia-Ting; Zhong, Yue-Ping; Huang, Zhi-Gang

2018-04-26

This study sought to determine the concentration and distribution of arsenic (As) species in Ophiocordyceps sinensis ( O. sinensis ), and to assess its edible hazard for long term consumption. The total arsenic concentrations, measured through inductively coupled plasma mass spectrometry (ICP-MS), ranged from 4.00 mg/kg to 5.25 mg/kg. As determined by HPLC-ICP-MS, the most concerning arsenic species—AsB, MMA V , DMA V , As V , and As Ш —were either not detected (MMA V and DMA V ) or were detected as minor As species (AsB: 1.4⁻2.9%; As V : 1.3⁻3.2%, and As Ш : 4.1⁻6.0%). The major components were a cluster of unknown organic As (uAs) compounds with As Ш , which accounted for 91.7⁻94.0% of the As content. Based on the H₂O₂ test and the chromatography behavior, it can be inferred that, the uAs might not be toxic organic As. Estimated daily intake ( EDI) , hazard quotient ( HQ ), and cancer risk ( CR ) caused by the total As content; the sum of inorganic As (iAs) and uAs, namely i+uAs; and iAs exposure from long term O. sinensis consumption were calculated and evaluated through equations from the US Environmental Protection Agency and the uncertainties were analyzed by Monte-Carlo Simulation (MCS). EDI total As and EDI i+uAs are approximately ten times more than EDI iAs ; HQ total As and HQ i+u As > 1 while HQ i As 1 × 10 −4 while CR iAs iAs is very low.

78 FR 49117 - Listing of Color Additives Exempt From Certification; Spirulina Extract

Science.gov (United States)

2013-08-13

.... We compare an individual's estimated daily intake (EDI) of the additive from all food sources to an acceptable intake level established by toxicological data. The EDI is determined by projections based on the... from all food sources of the additive. We commonly use the EDI for the 90th percentile consumer of a...

Enhanced-Depth Imaging Optical Coherence Tomography of the Human Choroid In Vivo Compared With Histology After Enucleation

DEFF Research Database (Denmark)

Li, Xiao Qiang; Heegaard, Steffen; Kiilgaard, Jens Folke

2016-01-01

PURPOSE: This study compared in vivo enhanced-depth imaging optical coherence tomography (EDI-OCT) with ex vivo histology of the choroid in human eyes. METHODS: Three eyes in three patients with advanced iris melanoma without posterior segment involvement underwent EDI-OCT less than 24 hours prior...... to enucleation and, in one eye, immediately after enucleation. Following fixation in 4% buffered formaldehyde and paraffin embedding, serial sections of the whole eye were cut horizontally, mounted, stained with hematoxylin-eosin and digitized. Alignment between histology and EDI-OCT was made on landmarks...... and subfoveal choroid thickness reduced to 56%, 45%, and 56%, respectively, of its in vivo thickness on EDI-OCT. CONCLUSIONS: There were no identifiable discrepancies in choroidal structural patterns between clinical EDI-OCT and histologic sections except that after enucleation and histologic fixation choroidal...

EDI Performance Statistics

Data.gov (United States)

U.S. Department of Health & Human Services — This section contains statistical information and reports related to the percentage of electronic transactions being sent to Medicare contractors in the formats...

Energy upcycle in anaerobic treatment: Ammonium, methane, and carbon dioxide reformation through a hybrid electrodeionization–solid oxide fuel cell system

International Nuclear Information System (INIS)

Xu, Linji; Dong, Feifei; Zhuang, Huichuan; He, Wei; Ni, Meng; Feng, Shien-Ping; Lee, Po-Heng

2017-01-01

Highlights: • EDI-SOFC integrated with AD is introduced for energy extraction from C and N pollutants. • NH_4"+ dissociation to NH_3 and H_2 in EDI avoids C deposition in SOFC. • EDI exhibits nutrient and heavy metal recovery. • SOFCs display its adaptability with NH_3, H_2, and biogas. • Energy balance ratio boosts from 1.11 to 1.75 by EDI-SOFC in a HK landfill plant. - Abstract: To create possibilities for a more sustainable wastewater management, a novel system consisting of electrodeionization (EDI) and solid oxide fuel cells (SOFCs) is proposed in this study. This system is integrated with anaerobic digestion/landfills to capture energy from carbonaceous and nitrogenous pollutants. Both EDI and SOFCs showed good performances. EDI removed 95% and 76% ammonium-nitrogen (NH_4"+-N) from diluted (0.025 M) to concentrated (0.5 M) synthetic ammonium wastewaters, respectively, accompanied by hydrogen production. SOFCs converted the recovered fuels, biogas mixtures of methane and carbon dioxide, to electricity. Under the optimal conditions of EDI (3.0 V applied voltage and 7.5 mm internal electrode distance (IED), and SOFCs (750 °C operating temperature), the system achieved 60% higher net energy output as compared to conventional systems. The estimated energy benefit of this proposed system showed that the net energy balance ratio is enhanced from 1.11 (existing system) to 1.75 (this study) for a local Hong Kong active landfill facility with 10.0 g L"−"1 chemical oxygen demand (COD) and 0.21 M NH_4"+-N. Additionally, an average of 80% inorganic ions (heavy metals and nutrient elements) can be removed from the raw landfill leachate by EDI cell. The results are successful demonstrations of the upgrades of anaerobic processes for energy extraction from wastewater streams.

Improving the Procurement of Information Technology Commodities

Science.gov (United States)

1994-04-12

and 0 the federal government. Apply Electronic Data Interchange (EDI) to order processing at AVC. Implementing EDI at AVC and throughout the Air Force...ordering process by approximately 2 weeks. 4. Centralize the Central Order Processing Offices. By consolidating AVC and SSCs order processing responsibilities...Im plem entation ..................................................................................... 21 5. ORDER PROCESSING WITH EDI

Alberta Learning: Early Development Instrument Pilot Project Evaluation.

Science.gov (United States)

Meaney, Wanda; Harris-Lorenze, Elayne

The Early Development Instrument (EDI) was designed by McMaster University to measure the outcomes of childrens early years as they influence their readiness to learn at school. The EDI was piloted in several Canadian cities in recent years through two national initiatives. Building on these initiatives, Alberta Learning piloted the EDI as a…

75 FR 37827 - Notice of Regulatory Waiver Requests Granted for the First Quarter of Calendar Year 2010

Science.gov (United States)

2010-06-30

... Development Initiative Special Purpose (EDI-SP) grant in the amount of $745,575 for the Poverty Point restoration project in Delhi, LA. The State of Louisiana will use the EDI-SP funds to build a new visitor... site. Subsequent to the January 23, 2004 appropriation for the EDI-SP grant, but prior to the...

Fatores técnicos intervenientes na realização do exame de eletrorretinograma multifocal (ERGmf Technical factors that influence multifocal electroretinogram (mfERG recording

Directory of Open Access Journals (Sweden)

Maria Kiyoko Oyamada

2007-08-01

adequada da amplitude e do tempo implícito dos picos N1 e P1, fundamentais para a corroboração diagnóstica de lesões ou afecções retinianas.PURPOSE: To describe the main intervening factors observed during the acquisition and analysis of multifocal electroretinogram (mfERG, that could affect the recorded signal, the obtained responses and their analysis. METHODS: The error factors observed during the acquisition of 100 sequential multifocal electroretinogram tests, in the period of May to July, 2005 were analyzed. The examinations of multifocal electroretinogram were carried out in agreement with international guideline recommendations, taking into account the established parameters of equipment, with 61 elements, and visual angle of 30º. All patients had been submitted to complete ophthalmologic examination, excluding those with inadequate transparency of ways, flat corneas and those incapable to visualize a central fixation target. RESULTS: The intervening factors, that could cause artifacts and errors in the interpretation of the obtained results, observed and corrected during the acquisition of multifocal electroretinogram were: eccentric or poor fixation, eye movements, orbicular contraction, cervical muscle contraction, inadequate transparency of the corneal electrode, electrode displacement, lens support decentralization, inadequate viewing distance in patients with high refractive errors, eye height inadequacy in relation to the center of the screen, electrical noise in 60 HZ frequency and electromagnetic field and high impedances. Excessive use of filters in wave processing for noise and artifact removal can interfere with the analysis of the obtained results. CONCLUSION: Simple observational cares during signal acquisition are of significant importance to ensure accuracy of the topographical electroretinogram information, good waveform morphology and low noise level register. Through their ready correction, the correct and adjusted analysis of the

The occurrence, exposure and risk assessment of perfluoroalkyl acids in food from mainland, China.

Science.gov (United States)

Wang, Xinxuan; Zhang, Ruobing; Zhang, Hong; Wang, Yanping

2017-11-01

To study the contamination of perfluoroalkyl acids (PFAAs) in Chinese food and the risk of dietary exposure for the Chinese population, the data of 17 PFAAs covering 38 cities throughout China in 15 groups of foods were collected for meta-analysis from published and available research literature. Using food consumption and body weight parameters, estimated dietary intakes (EDIs) were calculated for evaluation using the Scenario-Based Risk Assessment (SceBRA) modelling. Among food groups, the highest ΣPFAAs concentrations and EDI contributions were both found in poultry (363 ng/g), fish and shrimp (313 ng/g), dark vegetables (309 ng/g), fruits (116 ng/g) and pork (25 ng/g). The EDI of adults in the high-exposure scenario was about twice that of the intermediate-exposure scenario, while the EDI of children was about twice that of adults' EDI in the intermediate-exposure scenario. In addition, the PFOS EDI for children under high exposure approached its tolerable daily intake (TDI). Therefore high dietary exposure to PFAAs is giving rise to an increased health risk, especially for children.

76 FR 71389 - Agency Forms Submitted for OMB Review, Request for Comments

Science.gov (United States)

2011-11-17

... Interchange (EDI) version of the Form Letter ID-4K notice, or an Internet equivalent ID-4K, which is... electronically via EDI or ERS. Completion is voluntary. Once the RRB determines to pay a claim post-payment Form...-4E paper notice and the EDI and Internet equivalent versions are transmitted on a daily basis...

76 FR 55719 - Proposed Collection; Comment Request

Science.gov (United States)

2011-09-08

...-4K paper notice, an Electronic Data Interchange (EDI) version of the Form Letter ID-4K notice, or an... completed ID-4K back to the RRB, or electronically via EDI or ERS. Completion is voluntary. No changes are...-4E paper notice and the EDI and Internet equivalent versions are transmitted on a daily basis...

Preparing organisations for employee-driven open innovation

Directory of Open Access Journals (Sweden)

Amundsen, O.

2014-07-01

Full Text Available The present study addresses the need to prepare organisations, small or large, for open innovation approaches, including the development of capacity to exploit the potential benefits of such principles through Employee-Driven Innovation (EDI. Based on interviews in 20 Norwegian enterprises, we propose that EDI is an under-explored opportunity in many organisations, and that the systematic introduction of EDI practices increases organisations' ability to exploit open innovation principles and favourably impacts the capacity for innovation. Specifically, EDI results in a more general interest in improvement among employees, increased engagement in innovation processes, and reduced opposition to change.

Very slow neutrons

International Nuclear Information System (INIS)

Frank, A.

1983-01-01

The history is briefly presented of the research so far of very slow neutrons and their basic properties are explained. The methods are described of obtaining very slow neutrons and the problems of their preservation are discussed. The existence of very slow neutrons makes it possible to perform experiments which may deepen the knowledge of the fundamental properties of neutrons. Their wavelength approximates that of visible radiation. The possibilities and use are discussed of neutron optical systems (neutron microscope) which could be an effective instrument for the study of the detailed arrangement, especially of organic substances. (B.S.)

Shallow surface etching of organic and inorganic compounds by electrospray droplet impact

International Nuclear Information System (INIS)

Hiraoka, Kenzo; Sakai, Yuji; Iijima, Yoshitoki; Asakawa, Daiki; Mori, Kunihiko

2009-01-01

The electrospray droplet impact (EDI) was applied to bradykinin, polyethylene terephthalate (PET), SiO 2 /Si, and indium phosphide (InP). It was found that bradykinin deposited on the stainless steel substrate was ionized/desorbed without the accumulation of radiation products. The film thickness desorbed by a single collisional event was found to be less than 10 monolayers. In the EDI mass spectra for PET, several fragment ions were observed but the XPS spectra did not change with prolonged cluster irradiation. The etching rate for SiO 2 by EDI was measured to be ∼0.2 nm/min. The surface roughness of InP etched by EDI was found to be one order of magnitude smaller than that etched by 3 keV Ar + for about the same etching depths. EDI is capable of shallow surface etching with little damage left on the etched surface.

Exposure assessment of synthetic colours approved in Korea.

Science.gov (United States)

Ha, M-S; Ha, S-D; Choi, S-H; Bae, D-H

2013-01-01

The dietary intakes of nine synthetic food colours--amaranth, erythrosine, Allura Red, Ponceau 4R, tartrazine, Sunset Yellow FCF, Fast Green FCF, Brilliant Blue FCF and indigo carmine--permitted in Korea were estimated based on food consumption data for consumers and their concentrations in processed foods. The estimated daily intakes (EDIs) by Korean consumers were compared with the acceptable daily intakes (ADIs) of the colours. Among 704 foods sampled, 471 contained synthetic colours. The most highly consumed synthetic colours were Allura Red and tartrazine; the highest EDI/ADI ratios were found for amaranth, erythrosine and Allura Red. The EDIs of infants and children were higher than those of adults. The main food categories containing colours were beverages and liquor for adults, and beverages, chocolate and ice cream for infants and children. For average Korean consumers, the EDIs were not greater than 2.5% of their corresponding ADIs, although the EDI of a conservative consumer in the upper 95th percentile reached 37% of the ADI.

Comparison Study of Water Demineralization System for the OPR 1000 and AP 1000 Nuclear Power Plant

International Nuclear Information System (INIS)

Dedy Priambodo; Siti Alimah; Erlan Dewita

2009-01-01

OPR 1000 adopts demineralization method based on ion exchanger resin and AP 1000 adopt the method that based on Reverse Osmosis (RO)-Electrodeionization (EDI). The Ion exchange process is a reversible chemical reaction of a solution and an insoluble solid. Ion exchanger use resin as polluter ions capture and will be regenerated after its saturated. RO is method using pressure to force a solution through a membrane, retaining the solute on one side and allowing the pure solvent to pass to the other side. Whereas, EDI is a combination of ion exchange and electrodialysis. The ions is taken by ion exchange resin, and then it is discharged utilizing electric potential difference. Due to water splitting phenomena in EDI, make resin will never be saturated, so the RO-EDI process is water demineralization system that use little chemical, more simple installation, capable to maintain demineralization water product quality and environmental friendly. Thereby, The RO-EDI water demineralization system is more advance then ion exchange technology. (author)

Assessment of Korean consumer exposure to sodium saccharin, aspartame and stevioside.

Science.gov (United States)

Ha, Mi-Sun; Ha, Sang-Do; Choi, Sung-Hee; Bae, Dong-Ho

2013-01-01

The dietary intakes of sodium saccharin, aspartame and stevioside were estimated on the basis of food consumption data of the Korean consumer and the concentration of sweeteners in processed foods. Results were compared with the acceptable daily intake (ADI) of sweeteners. Among the 28 food categories for which the application of sodium saccharin, aspartame and stevioside is permitted in Korea, they were detected in 5, 12 and 13 categories, respectively. The estimated daily intake (EDI) of sodium saccharin and aspartame were high in infants and children, whereas the EDI of stevioside was high in adolescents and adults. The most highly consumed sweetener was aspartame, and the highest EDI/ADI ratio was found for sodium saccharin. The main food categories contributing to sweetener consumption were beverages, including alcoholic beverages. For most Korean consumers, the EDIs were no greater than 20% of their corresponding ADI; however, the EDI of sodium saccharin for conservative consumers aged 1-2 years reached 60% of their ADI.

Phases of Violent Extremism: Targeting the Evolution of Al-Shabaab

Science.gov (United States)

2015-12-01

Edi Rama, prime minister of Albania suggests, “The threat from the radicalization of ideologies and particularly from violent jihadist extremism will...Killed Al-Shabab Leader,” BBC News Africa, Accessed October 10, 2015, http://www.bbc.com/news/world-africa-29034409. 219 Edi Rama, To Defeat Extremism...Balasubramaniyan. “Organizational and Structural Evolution- Lessons from Al-Qaeda.” Indian Defense Review, November 21, 2013. Rama, Edi . To Defeat

Evidence for the electromagnetic decay instability driven by two plasmon decay

International Nuclear Information System (INIS)

Baker, K.L.; Afeyan, B.B.; Estabrook, K.G.; Drake, R.P.

1997-01-01

This paper examines the electromagnetic decay instability (EDI) and its role in laser-produced plasmas. The electromagnetic decay instability provides another channel through which parametric instabilities involving Langmuir waves can saturate. In the case where EDI is pumped by the Langmuir waves associated with two plasmon decay, EDI is shown to present an explanation for ω o /2 emission from laser-produced plasmas which is consistent with experimental observations

Removal of enzymatic and fermentation inhibitory compounds from biomass slurries for enhanced biorefinery process efficiencies.

Science.gov (United States)

Gurram, Raghu N; Datta, Saurav; Lin, Yupo J; Snyder, Seth W; Menkhaus, Todd J

2011-09-01

Within the biorefinery paradigm, many non-monomeric sugar compounds have been shown to be inhibitory to enzymes and microbial organisms that are used for hydrolysis and fermentation. Here, two novel separation technologies, polyelectrolyte polymer adsorption and resin-wafer electrodeionization (RW-EDI), have been evaluated to detoxify a dilute acid pretreated biomass slurry. Results showed that detoxification of a dilute acid pretreated ponderosa pine slurry by sequential polyelectrolyte and RW-EDI treatments was very promising, with significant removal of acetic acid, 5-hydroxymethyl furfural, and furfural (up to 77%, 60%, and 74% removed, respectively) along with >97% removal of sulfuric acid. Removal of these compounds increased the cellulose conversion to 94% and elevated the hydrolysis rate to 0.69 g glucose/L/h. When using Saccharomyces cerevisiae D(5)A for fermentation of detoxified slurry, the process achieved 99% of the maximum theoretical ethanol yield and an ethanol production rate nearly five-times faster than untreated slurry. Copyright © 2011 Elsevier Ltd. All rights reserved.

75 FR 76426 - Privacy Act of 1974; System of Records

Science.gov (United States)

2010-12-08

... name, middle initial); unique identifiers including Electronic Data Interchange Person Identifier (EDI... (EDI PI), other unique identifier (not Social Security Number), Federal Agency Smart Credential Number...

78 FR 23778 - Notice of Proposed Information Collection: Comment Request: Congressional Earmark Grants

Science.gov (United States)

2013-04-22

... categories: Economic Development Initiative--Special Project (EDI--SP) grantees and Neighborhood Initiative... generally fall into two categories: Economic Development Initiative--Special Project (EDI--SP) grantees and...

Esta tenzon fezeron Pero da Ponte e Afonso Anes do Coton. Edição e estudo do debate B969/V556

Directory of Open Access Journals (Sweden)

Déborah González Martínez

2013-07-01

Full Text Available Pero da Ponte e Afonso Eanes do Coton são dois destacados autores de cantigas transmitidas nos cancioneiros galego-portugueses: o Cancioneiro da Ajuda, o Cancioneiro da Biblioteca Nacional (Cód. 10991 e o Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. A estreita relação entre estes dois trovadores confirma-se pelas menções a ambos no interior de vários textos de natureza satírica e pela interação em duas cantigas dialogadas. O presente trabalho consiste numa nova edição crítica da tenção entre Afonso Eanes do Coton e Pero da Ponte (Pero da Pont’, e[n] un vosso cantar, B969 / V556, oferecendo novas respostas a velhas dificuldades ecdóticas. O texto vai acompanhado de anotação e estudo, pois o diálogo desenvolve vários temas de especial interesse para os estudos trovadorescos: a classe social e a atividade profissional dos interlocutores.Pero da Ponte and Afonso Eanes do Coton are two renowned authors of cantigas contained in the galician-portuguese songbooks: the Cancioneiro da Ajuda, the Cancioneiro da Biblioteca Nacional (Cód. 10991 and the Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. The close relationship between these troubadours is confirmed by some references in satirical texts and, mainly, by the dialogued song Pero da Pont’, e[n] un vosso cantar (B969 / V556. This work offers a new critical edition of this tenção with notes and literary study. The dialogue develops several topics of interest for the studies about troubadours: social class and professional activity of the interlocutors.  

Embodied Design Ideation

DEFF Research Database (Denmark)

Wilde, Danielle; Vallgårda, Anna; Tomico, Oscar

Embodied design ideation (EDI) practices work with relationships between body, material and context to enliven design and research potential. Methods are often idiosyncratic and – due to their physical nature – not easily transferred. As independent researchers, and as collaborators, we have been...... engaging with this problematic for some time. At CHI2017 we will present a framework that enables designers to understand, describe and contextualise EDI practices in ways that can be understood by peers, as well as those new to embodied ideation. Our framework affords discussion of embodied design actions...... individual approaches to EDI, developed over many years of research practice and (3) an inspirational catalogue demonstrating the diversity of ideas that EDI methods can foster....

76 FR 40457 - Administrative Simplification: Adoption of Operating Rules for Eligibility for a Health Plan and...

Science.gov (United States)

2011-07-08

... information. Electronic Data interchange (EDI) enables providers and payers to process financial and... hardware and software to exchange EDI data. Each trading partner, including providers, separately provides...

In vitro digestion and DGT techniques for estimating cadmium and lead bioavailability in contaminated soils: Influence of gastric juice pH

International Nuclear Information System (INIS)

Pelfrene, Aurelie; Waterlot, Christophe; Douay, Francis

2011-01-01

A sensitivity analysis was conducted on an in vitro gastrointestinal digestion test (i) to investigate the influence of a low variation of gastric juice pH on the bioaccessibility of Cd and Pb in smelter-contaminated soils (F B , using the unified bioaccessibility method UBM) and fractions of metals that may be transported across the intestinal epithelium (F A , using the diffusive gradient in thin film technique), and (ii) to provide a better understanding of the significance of pH in health risk assessment through ingestion of soil by children. The risk of metal exposure to children (hazard quotient, HQ) was determined for conditions that represent a worst-case scenario (i.e., ingestion rate of 200 mg day -1 ) using three separate calculations of metal daily intake: estimated daily intake (EDI), bioaccessible EDI (EDI-F B ), and oral bioavailable EDI (EDI-F A ). The increasing pH from 1.2 to 1.7 resulted in: (i) no significant variation in Cd-F B in the gastric phase but a decrease in the gastrointestinal phase; (ii) a decrease in soluble Pb in the gastric phase and a significant variation in Pb-F B in the gastrointestinal phase; (iii) a significant decrease in Cd-F A and no variation in Pb-F A ; (iv) no change in EDI-F B and EDI-F A HQs for Cd; (v) a significant decrease in EDI-F B HQs and no significant variation in EDI-F A HQ for Pb. In the analytical conditions, these results show that risk to children decreases when the bioavailability of Pb in soils is taken into account and that the studied pH values do not affect the EDI-F A HQs. The present results provide evidence that the inclusion of bioavailability analysis during health risk assessment could provide a more realistic estimate of Cd and Pb exposure, and opens a wide field of practical research on this topic (e.g., in contaminated site management). - Highlights: → Sensitivity analysis on an in vitro gastrointestinal digestion test. → Influence of gastric juice pH on metal bioaccessibility

In vitro digestion and DGT techniques for estimating cadmium and lead bioavailability in contaminated soils: Influence of gastric juice pH

Energy Technology Data Exchange (ETDEWEB)

Pelfrene, Aurelie, E-mail: aurelie.pelfrene@isa-lille.fr [Universite Lille Nord de France, Lille (France); Groupe ISA, Equipe Sols et Environnement, Laboratoire Genie Civil et geo-Environnement (LGCgE) Lille Nord de France (EA 4515), 48 boulevard Vauban, 59046 Lille cedex (France); Waterlot, Christophe; Douay, Francis [Universite Lille Nord de France, Lille (France); Groupe ISA, Equipe Sols et Environnement, Laboratoire Genie Civil et geo-Environnement (LGCgE) Lille Nord de France (EA 4515), 48 boulevard Vauban, 59046 Lille cedex (France)

2011-11-01

A sensitivity analysis was conducted on an in vitro gastrointestinal digestion test (i) to investigate the influence of a low variation of gastric juice pH on the bioaccessibility of Cd and Pb in smelter-contaminated soils (F{sub B}, using the unified bioaccessibility method UBM) and fractions of metals that may be transported across the intestinal epithelium (F{sub A}, using the diffusive gradient in thin film technique), and (ii) to provide a better understanding of the significance of pH in health risk assessment through ingestion of soil by children. The risk of metal exposure to children (hazard quotient, HQ) was determined for conditions that represent a worst-case scenario (i.e., ingestion rate of 200 mg day{sup -1}) using three separate calculations of metal daily intake: estimated daily intake (EDI), bioaccessible EDI (EDI-F{sub B}), and oral bioavailable EDI (EDI-F{sub A}). The increasing pH from 1.2 to 1.7 resulted in: (i) no significant variation in Cd-F{sub B} in the gastric phase but a decrease in the gastrointestinal phase; (ii) a decrease in soluble Pb in the gastric phase and a significant variation in Pb-F{sub B} in the gastrointestinal phase; (iii) a significant decrease in Cd-F{sub A} and no variation in Pb-F{sub A}; (iv) no change in EDI-F{sub B} and EDI-F{sub A} HQs for Cd; (v) a significant decrease in EDI-F{sub B} HQs and no significant variation in EDI-F{sub A} HQ for Pb. In the analytical conditions, these results show that risk to children decreases when the bioavailability of Pb in soils is taken into account and that the studied pH values do not affect the EDI-F{sub A} HQs. The present results provide evidence that the inclusion of bioavailability analysis during health risk assessment could provide a more realistic estimate of Cd and Pb exposure, and opens a wide field of practical research on this topic (e.g., in contaminated site management). - Highlights: {yields} Sensitivity analysis on an in vitro gastrointestinal digestion test

76 FR 37136 - Post-Summary Corrections to Entry Summaries Filed in ACE Pursuant to the ESAR IV Test

Science.gov (United States)

2011-06-24

... accelerated liquidation request indicator. C. Electronic Data Interface (EDI) Capability Trade participants.../ace_edi_messages/catair_main/abi_catair . Operational documentation addressing PSC may be found in the...

77 FR 1555 - Administrative Simplification: Adoption of Standards for Health Care Electronic Funds Transfers...

Science.gov (United States)

2012-01-10

... interim final rule with comment period. For further information about electronic data interchange (EDI... the accounts payable/receivable system and electronic data interchange (EDI) systems, and the business...

Highly-sensitive aptasensor based on fluorescence resonance energy transfer between l-cysteine capped ZnS quantum dots and graphene oxide sheets for the determination of edifenphos fungicide.

Science.gov (United States)

Arvand, Majid; Mirroshandel, Aazam A

2017-10-15

With the advantages of excellent optical properties and biocompatibility, single-strand DNA-functionalized quantum dots have been widely applied in biosensing and bioimaging. A new aptasensor with easy operation, high sensitivity, and high selectivity was developed by immobilizing the aptamer on water soluble l-cysteine capped ZnS quantum dots (QDs). Graphene oxide (GO) sheets are mixed with the aptamer-QDs. Consequently, the aptamer-conjugated QDs bind to the GO sheets to form a GO/aptamer-QDs ensemble. This aptasensor enables the energy transfer based on a fluorescence resonance energy transfer (FRET) from the QDs to the GO sheets, quenching the fluorescence of QDs. The GO/aptamer-QDs ensemble assay acts as a "turn-on'' fluorescent sensor for edifenphos (EDI) detection. When GO was replaced by EDI, the fluorescence of QDs was restored and its intensity was proportional to the EDI concentration. This GO-based aptasensor under the optimum conditions exhibited excellent analytical performance for EDI determination, ranging from 5×10 -4 to 6×10 -3 mg L -1 with the detection limit of 1.3×10 -4 mgL -1 . Furthermore, the designed aptasensor exhibited excellent selectivity toward EDI compared to other pesticides and herbicides with similar structures such as diazinon, heptachlor, endrin, dieldrin, butachlor and chlordane. Good reproducibility and precision (RSD =3.9%, n =10) of the assay indicates the high potential of the aptasensor for quantitative trace analysis of EDI. Moreover, the results demonstrate the applicability of the aptasensor for monitoring EDI fungicide in spiked real samples. Copyright © 2017 Elsevier B.V. All rights reserved.

76 FR 23628 - Agency Information Collection Activities: Submission for the Office of Management and Budget (OMB...

Science.gov (United States)

2011-04-27

... Form 628, ``Financial EDI Authorization;'' NUREG/BR-0254, Payment Methods; and NRC Form 629... applicable: NRC Form 628, ``Financial EDI Authorization'' and NRC Form 629, ``Authorization for Payment by...

75 FR 12777 - Notice of Regulatory Waiver Requests Granted for the Fourth Quarter of Calendar Year 2009

Science.gov (United States)

2010-03-17

... Development Initiative Special Project (EDI-SP) funds to implement the Pagedale Community Development... are currently vacant. Subsequent to the March 11, 2009 appropriation containing the EDI-SP, but prior...

76 FR 72210 - Notice of Proposed Information Collection: Comment Request Congressional Earmark Grants

Science.gov (United States)

2011-11-22

...-Special Project (EDI-SP) and Neighborhood Initiative (NI) grants. DATES: Comments Due Date: January 23... generally fall into two categories: Economic Development Initiative-Special Project (EDI-SP) grantees and...

Self Assembly and Pyroelectric Poling for Organics

Science.gov (United States)

2015-07-06

These “static” charges are the origin of electric field ( Edi ) creation inside the dielectric medium. If the loss of pyroelectric charges is...negligibly small, it would yield Edi = γΔT/[ε0(εdi + εcrLdi/Lcr)] (1) where ε0, εcr, and εdi are the dielectric permittivities of free space, the pyroelectric...field ( Edi ) in the dielectric thin film, and the small open arrows at the thin layer of dielectrics represent the direction of electric fields. The

75 FR 80854 - Agency Information Collection Activities: Proposed Collection; Comment Request

Science.gov (United States)

2010-12-23

..., ``Financial EDI Authorization''; NUREG/BR-0254, Payment Methods; and NRC Form 629, ``Authorization for Payment... licensing fees, and inspection fees to the NRC. The NRC Form 628, ``Financial EDI Authorization,'' provides...

Very true operators on MTL-algebras

Directory of Open Access Journals (Sweden)

Wang Jun Tao

2016-01-01

Full Text Available The main goal of this paper is to investigate very true MTL-algebras and prove the completeness of the very true MTL-logic. In this paper, the concept of very true operators on MTL-algebras is introduced and some related properties are investigated. Also, conditions for an MTL-algebra to be an MV-algebra and a Gödel algebra are given via this operator. Moreover, very true filters on very true MTL-algebras are studied. In particular, subdirectly irreducible very true MTL-algebras are characterized and an analogous of representation theorem for very true MTL-algebras is proved. Then, the left and right stabilizers of very true MTL-algebras are introduced and some related properties are given. As applications of stabilizer of very true MTL-algebras, we produce a basis for a topology on very true MTL-algebras and show that the generated topology by this basis is Baire, connected, locally connected and separable. Finally, the corresponding logic very true MTL-logic is constructed and the soundness and completeness of this logic are proved based on very true MTL-algebras.

Cost-effectiveness of using small vertebrates as indicators of disturbance.

Science.gov (United States)

Peck, Mika Robert; Maddock, Simon T; Morales, Jorge Noe; Oñate, Hugolino; Mafla-Endara, Paola; Peñafiel, Vanessa Aguirre; Torres-Carvajal, Omar; Pozo-Rivera, Wilmer E; Cueva-Arroyo, Xavier A; Tolhurst, Bryony A

2014-10-01

In species-rich tropical forests, effective biodiversity management demands measures of progress, yet budgetary limitations typically constrain capacity of decision makers to assess response of biological communities to habitat change. One approach is to identify ecological-disturbance indicator species (EDIS) whose monitoring is also monetarily cost-effective. These species can be identified by determining individual species' responses to disturbance across a gradient; however, such responses may be confounded by factors other than disturbance. For example, in mountain environments the effects of anthropogenic habitat alteration are commonly confounded by elevation. EDIS have been identified with the indicator value (IndVal) metric, but there are weaknesses in the application of this approach in complex montane systems. We surveyed birds, small mammals, bats, and leaf-litter lizards in differentially disturbed cloud forest of the Ecuadorian Andes. We then incorporated elevation in generalized linear (mixed) models (GL(M)M) to screen for EDIS in the data set. Finally, we used rarefaction of species accumulation data to compare relative monetary costs of identifying and monitoring EDIS at equal sampling effort, based on species richness. Our GL(M)M generated greater numbers of EDIS but fewer characteristic species relative to IndVal. In absolute terms birds were the most cost-effective of the 4 taxa surveyed. We found one low-cost bird EDIS. In terms of the number of indicators generated as a proportion of species richness, EDIS of small mammals were the most cost-effective. Our approach has the potential to be a useful tool for facilitating more sustainable management of Andean forest systems. © 2014 Society for Conservation Biology.

Grabbing the Air Force by the Tail: Applying Strategic Cost Analytics to Understand and Manage Indirect Cost Behavior

Science.gov (United States)

2015-09-17

sector   age Technology Impact  that  significant  technology  adoption  (RFID,  ERP,   EDI ,  etc)  has  on  supply  chain... EDI  capabilities   Complexity Impact  of  a  wide  product/service  line  on  the  supply  chain,  cost  of  serving...can incorporate measurements of the number of EDI transactions in the purchasing function, the age of the technology in the production process, the

75 FR 7520 - Certain Refrigerators and Components Thereof; Notice of the Commission's Final Determination of...

Science.gov (United States)

2010-02-19

... for this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc... infringe claim 8 of the `130 patent. The Commission also affirms the ALJ's finding that the accused French...

75 FR 60782 - Notice of Regulatory Waiver Requests Granted for the Second Quarter of Calendar Year 2010

Science.gov (United States)

2010-10-01

... Town of Jean Lafitte, LA received an Economic Development Initiative Special Purpose (EDI-SP) grant in... the December 8, 2004 appropriation for the EDI-SP grant, but prior to the completion of a Federal...

75 FR 37455 - Mortgage Insurance Termination; Application for Premium Refund or Distributive Share Payment

Science.gov (United States)

2010-06-29

... EDI and is used to directly pay eligible homeowners. This condition occurs when the form passes the... information is submitted via the Internet or EDI and is used to directly pay eligible homeowners. This...

77 FR 72788 - Reduction of Use of Social Security Numbers in the Department of Defense

Science.gov (United States)

2012-12-06

... recommended replacing the SSN with the DoD Electronic Data Interchange Personal Identifier (EDI- PI... Number, the common name for the EDI-PI, is identified by both policies as the primary alternative for the...

77 FR 48007 - Administrative Simplification: Adoption of Operating Rules for Health Care Electronic Funds...

Science.gov (United States)

2012-08-10

... electronic data interchange (EDI). Through the use of electronic funds transfers (EFT) for health care claim... care transactions results in higher use of EDI by health care providers.\\8\\ We expect usage of EFT and...

Employee-Driven Innovation (EDI)

DEFF Research Database (Denmark)

Kesting, Peter; Ulhøi, John Parm

  The responsibility to be innovative and think of useful ideas and the privilege of making decisions in processes of innovation are typically restricted to specifically assigned R&D functions and/or upper echelon managers. Given the importance of innovation to most organizations, it may seem...

Mapping key antecedents of employee-driven innovations

DEFF Research Database (Denmark)

Smith, Pernille; Ulhøi, John Parm; Kesting, Peter

2012-01-01

Research on employee-driven innovation (EDI) is still in its infancy, and as yet there is no independent body of literature on the topic. The aim of this paper is to review existing insights into the key antecedents of EDI in other research contexts. In particular, we focus on: leader support......, autonomy, collaboration, and organisational norms of exploration. The main contribution of this paper is to discuss how these key antecedents apply to the specific case of EDI and to identify an agenda for new research....

Quality and safety implications of emergency department information systems.

Science.gov (United States)

Farley, Heather L; Baumlin, Kevin M; Hamedani, Azita G; Cheung, Dickson S; Edwards, Michael R; Fuller, Drew C; Genes, Nicholas; Griffey, Richard T; Kelly, John J; McClay, James C; Nielson, Jeff; Phelan, Michael P; Shapiro, Jason S; Stone-Griffith, Suzanne; Pines, Jesse M

2013-10-01

The Health Information Technology for Economic and Clinical Health Act of 2009 and the Centers for Medicare & Medicaid Services "meaningful use" incentive programs, in tandem with the boundless additional requirements for detailed reporting of quality metrics, have galvanized hospital efforts to implement hospital-based electronic health records. As such, emergency department information systems (EDISs) are an important and unique component of most hospitals' electronic health records. System functionality varies greatly and affects physician decisionmaking, clinician workflow, communication, and, ultimately, the overall quality of care and patient safety. This article is a joint effort by members of the Quality Improvement and Patient Safety Section and the Informatics Section of the American College of Emergency Physicians. The aim of this effort is to examine the benefits and potential threats to quality and patient safety that could result from the choice of a particular EDIS, its implementation and optimization, and the hospital's or physician group's approach to continuous improvement of the EDIS. Specifically, we explored the following areas of potential EDIS safety concerns: communication failure, wrong order-wrong patient errors, poor data display, and alert fatigue. Case studies are presented that illustrate the potential harm that could befall patients from an inferior EDIS product or suboptimal execution of such a product in the clinical environment. The authors have developed 7 recommendations to improve patient safety with respect to the deployment of EDISs. These include ensuring that emergency providers actively participate in selection of the EDIS product, in the design of processes related to EDIS implementation and optimization, and in the monitoring of the system's ongoing success or failure. Our recommendations apply to emergency departments using any type of EDIS: custom-developed systems, best-of-breed vendor systems, or enterprise systems

Evaluation of Potential Biological Threats in Ukraine

International Nuclear Information System (INIS)

Pozdnyakova, L.; Slavina, N.; Pozdnyakov, S.

2007-01-01

Dilating of biological threats spectrum, EDI diffusion opportunities and routes, unpredictability of outbreaks connected with connatural, technogenic, terrorist factors determines constant monitoring and readiness for operative BPA indication and identification. Scientific analytical approach of existing and probable regional bio-threats evaluation is necessary for adequate readiness system creation and maintenance of medical counteraction tactics to probable biological threats. Basing on the international experience, we carry out analysis of a situation present in Ukraine and routes for the decisions. The basic directions are: - Evaluation of a reality for EDI penetration from abroad and presence of conditions for their further diffusion inside the country. - Revealing of presence and definition of connatural EDI foci biocenoses features and BPAs. - Appropriate level of biological safety and physical protection of bio-laboratories and pathogens collections maintenance. - Gene/molecular and phenotypical definition of EDI circulating strains. - Creation of the circulating EDI gene/ phenotypic characteristics regional data bank. - Ranging of EDI actual for area. - Introduction of GPT, mathematical modeling and forecasting for tactics development in case of technogenic accidents and connatural outbreaks. - Methodical basis and equipment improvement for BPA system indication for well-timed identification of natural, or modified agent. - Education and training The international cooperation in maintenance of biosafety and bioprotection within the framework of scientific programs, grants, exchange of experience, introduction of international standards and rules are among basic factors in the decision for creating system national biosafety for countries not included in EU and the NATO. (author)

75 FR 62522 - Combined Notice of Filings No. 3

Science.gov (United States)

2010-10-12

... filing per 154.203: NAESB EDI Form Filing to be effective 11/1/ 2010. Filed Date: 09/30/2010. Accession....9 EDI Form to be effective 11/1/2010. Filed Date: 09/30/2010. Accession Number: 20100930-5348...

Intervention Framework to Support Employee-Driven Innovation Between R&D and Manufacturing Department

DEFF Research Database (Denmark)

Jensen, Christian Schou; Jensen, Anna Rose Vagn; Broberg, Ole

2016-01-01

This paper is exploring the area of employee-driven innovation (EDI) and describes how we in ourresearch project have developed and tested a framework for initiating employee participation between R&D and manufacturing department. EDI refers to the generation and implementation of significant new...... [Kesting andUlhøi 2010]. It is argued that companies should not restrict themselves to relying exclusively on R&D employees, but also recognize that manufacturing employees possess abilities for innovation [Høyrup2010]. Several other theories, such as high-involvement innovation share the conviction...... et al. 2013]. • It can generate a flow of additional information and tacit knowledge from employees to point out opportunities that management cannot [Kesting and Ulhøi 2010].With a long list of known benefits from EDI, one might wonder why it is not implemented everywhere? The list of EDI obstacles...

A nova edição de Why Suyá Sing, de Anthony Seeger, e alguns estudos recentes sobre música indígena nas terras baixas da América do Sul

Directory of Open Access Journals (Sweden)

Luís Fernando Hering Coelho

2007-04-01

Full Text Available Lançado originalmente em 1987, Why Suya Sing? ganhou uma nova edição norte-americana em 2004. Apesar de constituir um marco teórico e etnográfico importante nos campos da etnologia indígena e da antropologia da música, o livro ainda não conta com uma tradução para o português. Neste ensaio, oferece-se uma leitura da obra, buscando resumir alguns de seus pontos principais, junto a uma contextualização geral sumária dos estudos sobre povos Gê, e uma nota breve sobre alguns desenvolvimentos recentes nas pesquisas sobre música indígena nas terras baixas da América do Sul.Originally published in 1987, Why Suyá Sing? acquired a new US edition in 2004. Despite constituting a theoretical and ethnographic landmark in the fields of indigenous ethnology and anthropology of music, Seeger’s book has yet to be translated into Portuguese. This essay offers a reading of the work, looking to resume some of its key points, along with a brief overall contextualization of the studies on Gê peoples, and a short note on some of the recent developments in the research on indigenous music in the South American lowlands.

Clinical outcomes of double staining and additional ILM peeling during ERM surgery.

Science.gov (United States)

Oh, Ha Na; Lee, Joo Eun; Kim, Hyun Woong; Yun, Il Han

2013-08-01

To assess the clinical outcomes in idiopathic epiretinal membrane (ERM) patients after vitrectomy and ERM removal with or without additional indocyanine green (ICG)-assisted internal limiting membrane (ILM) peeling. The medical records of 43 patients with an idiopathic ERM that underwent vitrectomy and ERM removal between July 2007 and April 2010 were reviewed. The patients were divided into two groups: triamcinolone-assisted simple ERM peeling only (group A, n = 23) and triamcinolone-assisted ERM peeling followed by ICG staining and peeling of the remaining internal ILM (group B, n = 20). No difference was found between the two groups in terms of visual acuity, macular thickness, P1 amplitude or implicit time on multifocal-electroretinogram (mfERG) at six and 12 months postoperatively. In group B, ICG staining after ERM peeling demonstrated that the ILM had been removed together with the ERM in 12 eyes (60%), and all 12 eyes showed punctate retinal hemorrhages during ERM peeling. There was no recurrence of an ERM in either group. Additional procedures involving ICG staining and ILM peeling during ERM surgery do not appear to have an additive effect on the clinical outcomes in terms of visual acuity, retinal function based on mfERG, or recurrence rate.

78 FR 76655 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

Science.gov (United States)

2013-12-18

... Trade Commission (USITC): http://edis.usitc.gov . \\3\\ Electronic Document Information System (EDIS... INTERNATIONAL TRADE COMMISSION Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest AGENCY: U.S. International Trade Commission. ACTION: Notice. SUMMARY: Notice...

HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

Directory of Open Access Journals (Sweden)

Kall Lyws Barroso Sales

2015-06-01

Full Text Available Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

Microwave preparation of Li-zeolite directly from alumatrane and silatrane

International Nuclear Information System (INIS)

Sathupunya, Mathavee; Gulari, Erdogan; Wongkasemjit, Sujitra

2004-01-01

Li-zeolites were successfully synthesized in a one-step sol-gel process and microwave technique using silatrane and alumatrane as precursors and lithium hydroxide as the hydrolytic agent. Many types of Li-zeolites were obtained by controlling synthesis parameters. Perfect crystalline zeolite, EDI type zeolite, was obtained at 90 deg. C after heating for 60 min while ABW type zeolite was produced after heating for 300 min at 110 deg. C. With increasing temperature, a higher packing density product was generated. Changing Si/Al loading ratio highly influenced the morphology of the synthesized product. With increasing Al loading, more irregular morphology products were obtained. Changing Li 2 O/SiO 2 ratio, led to changes in the unit cell structure and crystal morphology. Lowering the Li 2 O/SiO 2 ratio to one produced FAU type zeolite at 110 deg. C for 240 min. The thermal stability of EDI and ABW were very low while that of FAU was higher which might come from the effect of low ring strain construction of FAU

78 FR 16707 - Certain Electronic Devices Having Placeshifting or Display Replication Functionality and Products...

Science.gov (United States)

2013-03-18

... INTERNATIONAL TRADE COMMISSION [Docket No. 2943] Certain Electronic Devices Having Placeshifting... International Trade Commission (USITC): http://edis.usitc.gov . \\3\\ Electronic Document Information System (EDIS...; Solicitation of Comments Relating to the Public Interest AGENCY: U.S. International Trade Commission. ACTION...

78 FR 56737 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

Science.gov (United States)

2013-09-13

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review an... on the Commission's electronic docket (EDIS) at http://edis.usitc.gov . Hearing-impaired persons are...

78 FR 49764 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

Science.gov (United States)

2013-08-15

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review n... for this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc...

78 FR 72712 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

Science.gov (United States)

2013-12-03

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review an... this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc.gov...

The Environmental Data Initiative: A broad-use data repository for environmental and ecological data that strives to balance data quality and ease of submission

Science.gov (United States)

Servilla, M. S.; Brunt, J.; Costa, D.; Gries, C.; Grossman-Clarke, S.; Hanson, P. C.; O'Brien, M.; Smith, C.; Vanderbilt, K.; Waide, R.

2017-12-01

In the world of data repositories, there seems to be a never ending struggle between the generation of high-quality data documentation and the ease of archiving a data product in a repository - the higher the documentation standards, the greater effort required by the scientist, and the less likely the data will be archived. The Environmental Data Initiative (EDI) attempts to balance the rigor of data documentation to the amount of effort required by a scientist to upload and archive data. As an outgrowth of the LTER Network Information System, the EDI is funded by the US NSF Division of Environmental Biology, to support the LTER, LTREB, OBFS, and MSB programs, in addition to providing an open data archive for environmental scientists without a viable archive. EDI uses the PASTA repository software, developed originally by the LTER. PASTA is metadata driven and documents data with the Ecological Metadata Language (EML), a high-fidelity standard that can describe all types of data in great detail. PASTA incorporates a series of data quality tests to ensure that data are correctly documented with EML in a process that is termed "metadata and data congruence", and incongruent data packages are forbidden in the repository. EDI reduces the burden of data documentation on scientists in two ways: first, EDI provides hands-on assistance in data documentation best practices using R and being developed in Python, for generating EML. These tools obscure the details of EML generation and syntax by providing a more natural and contextual setting for describing data. Second, EDI works closely with community information managers in defining rules used in PASTA quality tests. Rules deemed too strict can be turned off completely or just issue a warning, while the community learns to best handle the situation and improve their documentation practices. Rules can also be added or refined over time to improve overall quality of archived data. The outcome of quality tests are stored as

Process mining for electronic data interchange

NARCIS (Netherlands)

Engel, R.; Krathu, W.; Zapletal, M.; Pichler, C.; Aalst, van der W.M.P.; Werthner, H.; Huemer, C.; Setzer, T.

2011-01-01

Choreography modeling and service integration received a lot of attention in the last decade. However, most real-world implementations of inter-organizational systems are still realized by traditional Electronic Data Interchange (EDI) standards. In traditional EDI standards, the notion of process or

32 CFR Appendix C to Part 57 - Procedures for the Provision of Related Services by the Military Medical Departments to DoDDS...

Science.gov (United States)

2010-07-01

... EDIS shall ensure that a qualified medical authority conducts or verifies a medical evaluation for use... to the questions posed in the original referral. The written report shall include: (i) Demographic... initial parental permission, EDIS must: (i) Obtain parental permission for the additional activities. (ii...

Multi-Sensor Image Fusion for Target Recognition in the Environment of Network Decision Support Systems

Science.gov (United States)

2015-12-01

Classification Problem Adapted from E. Alpaydin, “Introduction to Machine Learning,” Thrird Edi . MIT Press, 2014. Table 7. Performance Measures for...Binary Classification Problem Adapted from E. Alpaydin, “Introduction to Machine Learning,” Thrird Edi . MIT Press, 2014. ROC curves give us a

Carta Editorial

Directory of Open Access Journals (Sweden)

Pedro Vitor Lemos Cravo

2016-06-01

Full Text Available A primeira edição de 2016 da revista Fronteiras: Journal of Social, Technological and Environmental Science, está no ar com a notícia que a partir desse volume todos os artigos contarão com os registros no DOI (Digital Object Identifier. O Doi é uma ferramenta que associa os artigos existentes nas plataformas digitais a um endereço eletrônico. As edições de 2105 já foram incluídas e até o final deste mês as demais edições receberão o registro DOI.

Growth pattern and final height of very preterm vs. very low birth weight infants

NARCIS (Netherlands)

Hollanders, J.J.; Pal, S.M. van der; Dommelen, P. van; Rotteveel, J.; Finken, M.J.J.

2017-01-01

BackgroundBoth very preterm (VP; i.e., gestational age <32 weeks) and very low birth weight (VLBW; i.e., birth weight <1,500 g) are used as inclusion criteria by studies on preterm birth. We aimed to quantify the impact of these entities on postnatal growth until final height.MethodsSubjects born VP

Very heavy dark Skyrmions

International Nuclear Information System (INIS)

Dick, Rainer

2017-01-01

A dark sector with a solitonic component provides a means to circumvent the problem of generically low annihilation cross sections of very heavy dark matter particles. At the same time, enhanced annihilation cross sections are necessary for indirect detection of very heavy dark matter components beyond 100 TeV. Non-thermally produced dark matter in this mass range could therefore contribute to the cosmic γ-ray and neutrino flux above 100 TeV, and massive Skyrmions provide an interesting framework for the discussion of these scenarios. Therefore a Higgs portal and a neutrino portal for very heavy Skyrmion dark matter are discussed. The Higgs portal model demonstrates a dark mediator bottleneck, where limitations on particle annihilation cross sections will prevent a signal from the potentially large soliton annihilation cross sections. This problem can be avoided in models where the dark mediator decays. This is illustrated by the neutrino portal for Skyrmion dark matter. (orig.)

Very heavy dark Skyrmions

Energy Technology Data Exchange (ETDEWEB)

Dick, Rainer [University of Saskatchewan, Department of Physics and Engineering Physics, Saskatoon, SK (Canada)

2017-12-15

A dark sector with a solitonic component provides a means to circumvent the problem of generically low annihilation cross sections of very heavy dark matter particles. At the same time, enhanced annihilation cross sections are necessary for indirect detection of very heavy dark matter components beyond 100 TeV. Non-thermally produced dark matter in this mass range could therefore contribute to the cosmic γ-ray and neutrino flux above 100 TeV, and massive Skyrmions provide an interesting framework for the discussion of these scenarios. Therefore a Higgs portal and a neutrino portal for very heavy Skyrmion dark matter are discussed. The Higgs portal model demonstrates a dark mediator bottleneck, where limitations on particle annihilation cross sections will prevent a signal from the potentially large soliton annihilation cross sections. This problem can be avoided in models where the dark mediator decays. This is illustrated by the neutrino portal for Skyrmion dark matter. (orig.)

Repeated subretinal surgery and removal of subretinal decalin is well tolerated - evidence from a porcine model.

Science.gov (United States)

Sørensen, Nina Buus; Klemp, Kristian; Kjær, Troels Wesenberg; Heegaard, Steffen; la Cour, Morten; Kiilgaard, Jens Folke

2017-09-01

Subretinal perfluorocarbon liquid (PFCL) is a serious complication that can occur after retinal detachment repair. It is possible to remove the PFCL surgically, but retinal damage related to the procedure is unknown. Also, increasing interest in subretinal treatment makes it relevant to examine the functional and morphological consequences of repeated subretinal manipulation. We hypothesized that PFCL in a porcine model can be injected in the subretinal space and removed with minimal effect on retinal structure and function. The left eyes of ten healthy three-month-old female domestic pigs were included. Multifocal electroretinograms (mfERG) were recorded before surgery. Following vitrectomy, a PFCL bleb (decalin) was injected subretinally using a 41G cannula. After 14 days the decalin was removed through a 41G cannula in combination with a 2 ml syringe and an intermediate flexible tube. Two weeks after removal, a control mfERG was recorded, the pigs were enucleated and sacrificed and eyes were examined histologically. All statistics were carried out with a paired t-test in SAS Enterprise Guide 7.1® (SAS Institute Inc., Cary, NC, USA). There was no significant difference in mfERG amplitude ratio (left/right eye) between baseline and recordings two weeks after removal of decalin (P1 (M = 0.26, SD = 0.80, p = 0.39), second order kernel (M = -0.18, SD = 0.86, p = 0.57), Direct Response (M = 0.39, SD = 0.61, p = 0.12) or Induced Component (M = -0.03, SD = 0.40, p = 0.80)). Histologically, the photoreceptor outer segments were minimally affected. Otherwise the retina was normal 14 days after removal of decalin. In four pigs the subretinal decalin displaced inferiorly and was no longer accessible for removal. Subretinal decalin can be removed within 14 days without lasting retinal damage. Decalin is a heavy liquid where the risk of displacement is high. Future studies using PFCLs to control duration of an experimental retinal separation

Neighborhood Poverty Impacts Children's Physical Health and Well-Being over Time: Evidence from the Early Development Instrument

Science.gov (United States)

Cushon, Jennifer A.; Vu, Lan T. H.; Janzen, Bonnie L.; Muhajarine, Nazeem

2011-01-01

Research Findings: The purpose of this study was to investigate how neighborhoods and neighborhood socioeconomic disadvantage impact school readiness over time. School readiness was measured using the Early Development Instrument (EDI) for 3 populations of kindergartners in 2001, 2003, and 2005 in Saskatoon, Saskatchewan, Canada. EDI results…

Psychometric Properties of the Dutch Version of the Eating Disorder Inventory–3

Directory of Open Access Journals (Sweden)

Vicky Lehmann

2013-10-01

Full Text Available The psychometric properties of the Dutch version of the Eating Disorder Inventory–3 (EDI-3 were tested in eating disordered patients (N = 514 using confirmatory factor analyses, variance decomposition, reliabilities, and receiver operating characteristic (ROC curve analyses. Factorial validity results supported the 12 subscales, but model fit was impaired by correlated item errors, misallocated items, and redundant subscales. At the composite level, the Bulimia subscale was identified as a largely specific source of information that did not contribute much to its overarching composite. Reliabilities for subscales and composites ranged from .6 to .9. ROC curve analysis indicated good to excellent discriminative ability of the EDI-3 identifying clinical subjects against a reference group. In conclusion, further revisions of the EDI-3 might target the item allocation and (over-differentiation of subscales and composites to further clarify its structure. For the clinical practice, we advise the careful use of the EDI-3, although it might serve as a good screening tool.

Meta-analysis of neurobehavioral outcomes in very preterm and/or very low birth weight children

NARCIS (Netherlands)

C.S.H. Aarnoudse-Moens (Cornelieke); N. Weisglas-Kuperus (Nynke); J.B. van Goudoever (Hans); J. Oosterlaan (Jaap)

2009-01-01

textabstractOBJECTIVE: Sequelae of academic underachievement, behavioral problems, and poor executive function (EF) have been extensively reported for very preterm (≤33 weeks' gestation) and/or very low birth weight (VLBW) (≤1500 g) children. Great variability in the published results, however,

77 FR 58101 - Proposed Collection; Comment Request

Science.gov (United States)

2012-09-19

... from members of the public is to make these submissions available for public viewing on the Internet at... Educational and Developmental Intervention Services (EDIS) clinics. The system's remote function allows EDIS... clearance, which allows them access to basic functions of SNPMIS (i.e., data querying, viewing, and printing...

An Empirical Study of Logistics Organization, Electronic Linkage, and Performance

Science.gov (United States)

1993-01-01

Anvari, M., "Electronic Data Interchange and Inventories," International Journal of Production Economics , 26, 1-3 (1992), 135-143. Baker, R. H., EDI: What...Electronic Data Interchange -- A Study of Norwegian Freight Forwarders Using EDI," International Journal of Production Economics , 24 (1991), 91-101. Henry, G

Are You Experienced The Case for Acquisition Professional Qualification Standards

Science.gov (United States)

2015-10-01

1, DAU 236), featuring a cover story on micro machines used in defense systems. The winners for Defense AT&L were managing edi - tor/senior editor of...Gonzalez, copy edi - tor and circulation manager; and Noelia Gamboa, editorial support. Defense AT&L’s sister DAU publication, the Defense Acquisition

Very high-luminosity infrared galaxies - are they very young?

International Nuclear Information System (INIS)

Burbidge, G.

1986-01-01

It is proposed that most of the very high-luminosity IRAS galaxies, those which emit greater than or equal to 10 to the 12th solar luminosities nearly all in the far infrared out to 100 microns, are very young systems with ages less than or equal to 10 to the 9th years. The luminosity comes largely from stars with masses near 100 solar masses which evolve rapidly, ejecting much of their mass as elements heavier than hydrogen. The gas ejected condenses into dust in circumstellar shells. The prototype star in the Galaxy which shows all of these attributes is Eta Car. It is shown that total masses of order 10 to the 7th-10 to the 8th solar masses condensed into such stars can produce the observed luminosities, and that 10-100 generations of such stars will produce enough dust (about 10 to the 8th solar masses) to explain the observed infrared luminosities. If this hypothesis is correct the composition of gas and dust may well be highly anomalous, and there should be no old stars with ages about 10 to the 10th years present. Initial star formation is probably triggered by interactions with close companion galaxies. 40 references

Validation of the Korean Version of the Eating Disorder Inventory-2: Psychometric Properties and Cross-Cultural Comparison

Science.gov (United States)

Lee, Jung-Hyun; Shin, Mi-Yeon; Jo, Hye-Hyeon; Jung, Young-Chul; Kim, Joon-Ki

2012-01-01

Purpose The purpose of the present study was to examine the validity and reliability of the Korean version of the Eating Disorder Inventory-2 (EDI-2) in Korean patients with eating disorders and healthy controls, and to investigate cultural differences of EDI-2 between a Korean group and a North American standardization sample. Materials and Methods The Korean version of the EDI-2 was prepared after comprehensive clinical assessment of Korean patients with eating disorders (n=327) as well as female undergraduates (n=176). Results were compared between eating disorder subgroups (anorexia nervosa, bulimia nervosa and eating disorders not otherwise specified) and those of a North American standardization sample and healthy controls. Results The results showed that the Korean EDI-2 had adequate internal consistency (0.77-0.93) and discriminated well between patients with eating disorders and healthy controls on all subscales. Significant differences in EDI-2 subscale scores between the eating disorder groups and the healthy control group were observed; however, there was no discernible difference among the eating disorder subgroups. When compared with a North American standardization sample, the Korean control group showed significantly higher scores for drive for thinness and asceticism. When patient groups were compared, the Korean group showed significantly lower scores for perfectionism. Conclusion As expected, the results accurately reflected psychometric properties of the Korean version of EDI-2 for eating disorder patients in Korea. These findings also suggest that common characteristics for the eating disorder exist as a whole rather than with significant difference between each subgroup. In addition, significant differences between the Korean and the North American groups for both patients and controls also demonstrated specific cultural differences. PMID:23074108

Validation of the Korean version of the Eating Disorder Inventory-2: psychometric properties and cross-cultural comparison.

Science.gov (United States)

Lee, Jung-Hyun; Shin, Mi-Yeon; Jo, Hye-Hyeon; Jung, Young-Chul; Kim, Joon-Ki; Kim, Kyung Ran

2012-11-01

The purpose of the present study was to examine the validity and reliability of the Korean version of the Eating Disorder Inventory-2 (EDI-2) in Korean patients with eating disorders and healthy controls, and to investigate cultural differences of EDI-2 between a Korean group and a North American standardization sample. The Korean version of the EDI-2 was prepared after comprehensive clinical assessment of Korean patients with eating disorders (n=327) as well as female undergraduates (n=176). Results were compared between eating disorder subgroups (anorexia nervosa, bulimia nervosa and eating disorders not otherwise specified) and those of a North American standardization sample and healthy controls. The results showed that the Korean EDI-2 had adequate internal consistency (0.77-0.93) and discriminated well between patients with eating disorders and healthy controls on all subscales. Significant differences in EDI-2 subscale scores between the eating disorder groups and the healthy control group were observed; however, there was no discernible difference among the eating disorder subgroups. When compared with a North American standardization sample, the Korean control group showed significantly higher scores for drive for thinness and asceticism. When patient groups were compared, the Korean group showed significantly lower scores for perfectionism. As expected, the results accurately reflected psychometric properties of the Korean version of EDI-2 for eating disorder patients in Korea. These findings also suggest that common characteristics for the eating disorder exist as a whole rather than with significant difference between each subgroup. In addition, significant differences between the Korean and the North American groups for both patients and controls also demonstrated specific cultural differences.

Grappling with Change: The South African Electricity Supply Industry

Energy Technology Data Exchange (ETDEWEB)

Galen, P. S.

1998-11-01

This paper reviews the debate over the future structure of the South African electricity supply industry (ESI) with focus on the electricity distribution industry (EDI) segment. The importance of both new and old institutions in the ESI in facilitating change is discussed. The perspective is that of an outside observer who spent nearly 2 years following events in the South African ESI. The ESI situation reviewed here is very complex and connected to a myriad of other economic, financial, cultural, social, and political issues.

Grappling with Change: The South African Electricity Supply Industry

International Nuclear Information System (INIS)

Galen, Paul S.

1998-01-01

This paper reviews the debate over the future structure of the South African electricity supply industry (ESI) with focus on the electricity distribution industry (EDI) segment. The importance of both new and old institutions in the ESI in facilitating change is discussed. The perspective is that of an outside observer who spent nearly 2 years following events in the South African ESI. The ESI situation reviewed here is very complex and connected to a myriad of other economic, financial, cultural, social, and political issues

A functional approach to cerebral visual impairments in very preterm/very-low-birth-weight children

NARCIS (Netherlands)

Geldof, C.J.A.; van Wassenaer-Leemhuis, A.G.; Dik, M.; Kok, J.H.; Oosterlaan, J.

2015-01-01

Background:Cerebral visual impairment (CVI) is a major cause of visual impairment, with very preterm birth/very low birth weight (VP/VLBW) being a major risk factor. There is no generally accepted definition of CVI. This study aims to investigate the usefulness of an empirically-based functional

A functional approach to cerebral visual impairments in very preterm/very-low-birth-weight children

NARCIS (Netherlands)

Geldof, Christiaan J. A.; van Wassenaer-Leemhuis, Aleid G.; Dik, Marjolein; Kok, Joke H.; Oosterlaan, Jaap

2015-01-01

Cerebral visual impairment (CVI) is a major cause of visual impairment, with very preterm birth/very low birth weight (VP/VLBW) being a major risk factor. There is no generally accepted definition of CVI. This study aims to investigate the usefulness of an empirically-based functional definition of

Editorial

OpenAIRE

André Luis Calado Araújo

2007-01-01

O CEFET-RN apresenta a segunda edição da Holos de 2008. A revista se consolida com multidisciplinar com 8 artigos. Com esta edição completamos cinco anos no formato online e a décima quarta edição, mostrando que o periódico se consolida como alternativa à publicação de trabalhos científicos. O primeiro artigo intitulado “O façonismo no espaço urbano de Americana-SP”, discute o espaço urbano, a diversidade cultural e sua dinamicidade. O objetivo deste trabalho foi fazer uma análise da ativ...

76 FR 31632 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

Science.gov (United States)

2011-06-01

... docket (EDIS) at http://edis.usitc.gov , and will be available for inspection during official business... Co. Ltd. of Shenzhen, China; Cellairis Franchise, Inc. of Alpharetta, GA; Cellet Products of Santa Fe... be filed no later than by close of business, five business days after the date of publication of this...

'I can't accept that feeling': Relationships between interoceptive awareness, mindfulness and eating disorder symptoms in females with, and at-risk of an eating disorder.

Science.gov (United States)

Lattimore, Paul; Mead, Bethan R; Irwin, Leanne; Grice, Lorna; Carson, Ruth; Malinowski, Peter

2017-01-01

Mindfulness based therapies (MBTs) for eating disorders show potential benefit for outcomes yet evidence is scarce regarding the mechanisms by which they influence remission from symptoms. One way that mindfulness approaches create positive outcomes is through enhancement of emotion regulation skills. Maladaptive emotion regulation is a key psychological feature of all eating disorders. The aim of the current study was to identify facets of emotion regulation involved in the relationship between mindfulness and maladaptive eating behaviours. In three cross-sectional studies, clinical (n=39) and non-clinical (n=137 and 119) female participants completed: 1) the Eating Disorder Inventory (EDI) eating specific scales (drive-for-thinness and bulimia) and the EDI psychological symptom scales (emotion dysregulation and interoceptive deficits); and 2) mindfulness, impulsivity, and emotion regulation questionnaires. In all samples mindfulness was significantly and inversely associated with EDI eating and psychological symptom scales, and impulsivity. In non-clinical samples interoceptive deficits mediated the relationship between mindfulness and EDI eating specific scales. Non-acceptance of emotional experience, a facet of interoceptive awareness, mediated the relationship between mindfulness and eating specific EDI scores. Further investigations could verify relationships identified so that mindfulness based approaches can be optimised to enhance emotion regulation skills in sufferers, and those at-risk, of eating disorders. Crown Copyright © 2016. Published by Elsevier Ireland Ltd. All rights reserved.

A Comparative Study of the Story Events in Literary and Cinematic Narrative: A Comparison between the Story of Ashghalduni (Dustbin and the Adapted Movie, Dayere-ye Mina (The Cycle

Directory of Open Access Journals (Sweden)

Z. Hayati

2016-07-01

Full Text Available The present article tries to study the story Ašghālduni (Dustbin by Gholāmhossein Sā’edi and the adapted movie Dāyere-ye Minā (The Cycle by Dāryuš Mehrjuyi with a view to new adaptation theories. Of course, these theories have not yet been consistent and well-established; but its literature is going to evolve, especially its essentials are discussed in the study method of narratology. As an example, this proposition is discussed in theoretical subjects of adaptation that even in the loyal adapted movies, in which the structure of the literary story and the sequence of events in the movie are preserved, some of the semantic functions change because of story entry into the cinematic discourse along with the needs of medium of cinema. For example, the figurative aspect of Sā’edi's story in its adapted movie has been influenced by the scheme and sometimes realism dominates symbolism. Mehrjuyi has organized the events in the discourse of classic cinema in order to encourage the reader to persist the events during a certain time period. The way of timing a movie in terms of a three-screen structure encourages the spectator to follow the events and causes the "scheme" to dominate the "idea". Since the dominance of either scheme or idea creates different themes, it can be said that the very structural change leads somewhat to semantic change. Similarly, the change of Sā’edi's open ending narrative to a close one prevents the audience to participate in re-making the fictional fate of Ali; the sort that exists in a literary text.

E × B electron drift instability in Hall thrusters: Particle-in-cell simulations vs. theory

Science.gov (United States)

Boeuf, J. P.; Garrigues, L.

2018-06-01

The E × B Electron Drift Instability (E × B EDI), also called Electron Cyclotron Drift Instability, has been observed in recent particle simulations of Hall thrusters and is a possible candidate to explain anomalous electron transport across the magnetic field in these devices. This instability is characterized by the development of an azimuthal wave with wavelength in the mm range and velocity on the order of the ion acoustic velocity, which enhances electron transport across the magnetic field. In this paper, we study the development and convection of the E × B EDI in the acceleration and near plume regions of a Hall thruster using a simplified 2D axial-azimuthal Particle-In-Cell simulation. The simulation is collisionless and the ionization profile is not-self-consistent but rather is given as an input parameter of the model. The aim is to study the development and properties of the instability for different values of the ionization rate (i.e., of the total ion production rate or current) and to compare the results with the theory. An important result is that the wavelength of the simulated azimuthal wave scales as the electron Debye length and that its frequency is on the order of the ion plasma frequency. This is consistent with the theory predicting destruction of electron cyclotron resonance of the E × B EDI in the non-linear regime resulting in the transition to an ion acoustic instability. The simulations also show that for plasma densities smaller than under nominal conditions of Hall thrusters the field fluctuations induced by the E × B EDI are no longer sufficient to significantly enhance electron transport across the magnetic field, and transit time instabilities develop in the axial direction. The conditions and results of the simulations are described in detail in this paper and they can serve as benchmarks for comparisons between different simulation codes. Such benchmarks would be very useful to study the role of numerical noise (numerical

HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

Directory of Open Access Journals (Sweden)

Kall Lyws Barroso Sales

2014-11-01

Full Text Available http://dx.doi.org/10.5007/2175-7968.2015v35n1p313   Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

Motor development in very preterm and very low-birth-weight children from birth to adolescence: A meta-analysis

NARCIS (Netherlands)

de Kieviet, J.F.; Piek, J.P.; Aarnoudse-Moens, C.S.H.; Oosterlaan, J.

2009-01-01

Context: Infants who are very preterm (born ≤32 weeks of gestation) and very low birth weight (VLBW) (weighing ≤1500 g) are at risk for poor developmental outcomes. There is increasing evidence that very preterm birth and VLBW have a considerable effect on motor development, although findings are

Neighbourhood ethnic diversity buffers school readiness impact in ESL children.

Science.gov (United States)

Puchala, Chassidy; Vu, Lan T H; Muhajarine, Nazeem

2010-01-01

Contextual factors, as measured by neighbourhood characteristics, shape the experiences children have and affect their "school readiness", i.e., whether they are well or poorly prepared for the transition from home to kindergarten. This study assessed the independent effects of individual and neighbourhood factors on school readiness; specifically, it examined whether and to what degree neighbourhood factors modified children's language ability and thus their school readiness in a population of children in Saskatoon, Saskatchewan. The study included all children attending kindergarten in 2001, 2003 and 2005 in Saskatoon. School readiness and child characteristics were measured by the Early Development Instrument (EDI). The EDI measures child development at school commencement in five domains: physical health and well-being, social competence, emotional maturity, cognitive and language development, and communication skills and general knowledge. Data from the 2001 Census were used to characterize Saskatoon's neighbourhoods. Multilevel modeling examined the independent and buffering or exacerbating effects of individual and neighbourhood factors on the relation between English as a Second Language (ESL) status in children and EDI domain scores. ESL children had significantly lower scores on all EDI domains compared with non-ESL children. Certain factors (e.g., younger age, male, Aboriginal status, having special needs) were significantly related to lower readiness in terms of the emotional maturity, and communication skills and general knowledge domains. Importantly, children who lived in neighbourhoods that were highly transient (with a higher proportion of residents who had moved in the previous year) had lower EDI scores on both domains, and those in neighbourhoods with lower rates of employment had lower EDI scores on communication skills and general knowledge. Neighbourhood ethnic diversity mitigated the negative impact of ESL status on school readiness for both

The emotion dysregulation inventory: Psychometric properties and item response theory calibration in an autism spectrum disorder sample.

Science.gov (United States)

Mazefsky, Carla A; Yu, Lan; White, Susan W; Siegel, Matthew; Pilkonis, Paul A

2018-04-06

Individuals with autism spectrum disorder (ASD) often present with prominent emotion dysregulation that requires treatment but can be difficult to measure. The Emotion Dysregulation Inventory (EDI) was created using methods developed by the Patient-Reported Outcomes Measurement Information System (PROMIS ® ) to capture observable indicators of poor emotion regulation. Caregivers of 1,755 youth with ASD completed 66 candidate EDI items, and the final 30 items were selected based on classical test theory and item response theory (IRT) analyses. The analyses identified two factors: (a) Reactivity, characterized by intense, rapidly escalating, sustained, and poorly regulated negative emotional reactions, and (b) Dysphoria, characterized by anhedonia, sadness, and nervousness. The final items did not show differential item functioning (DIF) based on gender, age, intellectual ability, or verbal ability. Because the final items were calibrated using IRT, even a small number of items offers high precision, minimizing respondent burden. IRT co-calibration of the EDI with related measures demonstrated its superiority in assessing the severity of emotion dysregulation with as few as seven items. Validity of the EDI was supported by expert review, its association with related constructs (e.g., anxiety and depression symptoms, aggression), higher scores in psychiatric inpatients with ASD compared to a community ASD sample, and demonstration of test-retest stability and sensitivity to change. In sum, the EDI provides an efficient and sensitive method to measure emotion dysregulation for clinical assessment, monitoring, and research in youth with ASD of any level of cognitive or verbal ability. Autism Res 2018. © 2018 International Society for Autism Research, Wiley Periodicals, Inc. This paper describes a new measure of poor emotional control called the Emotion Dysregulation Inventory (EDI). Caregivers of 1,755 youth with ASD completed candidate items, and advanced statistical

Optimizing visualization in enhanced depth imaging OCT in healthy subjects and patients with retinal pigment epithelial detachment

Directory of Open Access Journals (Sweden)

Kampik A

2012-11-01

Full Text Available Lukas Reznicek, Efstathios Vounotrypidis, Florian Seidensticker, Karsten Kortuem, Anselm Kampik, Aljoscha S Neubauer, Armin WolfDepartment of Ophthalmology, Ludwig Maximilians University Muenchen, Munich, GermanyBackground: This study’s objective was to optimize the visualization of three different spectral-domain optical coherence tomography (SD-OCT display modalities and evaluate enhanced depth imaging (EDI by comparing the maximum depth of assessment in conventional versus inverted cross-sectional OCT images in healthy subjects and in patients with retinal pigment epithelial detachment (PED.Methods: Cross-sectional SD-OCT conventional and inverted images were obtained with the HRA2 (Heidelberg Retina Angiograph II, Heidelberg Engineering, Heidelberg, Germany. Horizontal as well as vertical sections in three different display modes were blinded for evaluation by three independent, experienced graders for maximal imaging depth of the deep ocular fundus layers.Results: The mean imaging depth as measured from the inner segment/outer segment (IS/OS to the outer choroid of all 14 healthy subjects was 197 ± 44 µm vs 263 ± 56 µm for conventional vs EDI scans: in black/white mode, it was significantly lower (P < 0.001 than in white/black mode (249 ± 42 µm vs 337 ± 71 µm and color/heat mode (254 ± 48 µm vs 354 ± 73 µm. The mean imaging depth of all 14 study eyes with PED was 240 ± 78 µm vs 345 ± 100 µm for conventional vs EDI scans in black/white mode, and was significantly lower (P < 0.001 than in white/black mode (393 ± 104 µm vs 464 ± 126 µm and in color/heat mode (373 ± 106 µm vs 453 ± 114 µm. In each display modality of healthy subjects and of patients with PED, EDI scans showed a significantly higher imaging depth than the corresponding conventional scans.Conclusion: White/black and color/heat modes allow increased imaging depth, compared to black/white mode using both conventional or EDI OCT scans in healthy subjects or

Edição Inspiradora

Directory of Open Access Journals (Sweden)

Luciana Di Leone

2012-12-01

Full Text Available Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

Edição Inspiradora

Directory of Open Access Journals (Sweden)

Luciana Di Leone

2012-03-01

Full Text Available http://dx.doi.org/10.5007/1984-784X.2012v12n17p120 Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

The Expanded Very Large Array Project

Science.gov (United States)

Perley, Rick

2012-10-01

The Expanded Very Large Array Project, begun in 2001, is now completed -- on time, on budget, and ``on spec.'' The major goal of the project was to multiply the key observational capabilities of the Very Large Array -- the world's most powerful, versatile, and productive radio telescope -- by a factor of at least an order of magnitude by implementation of modern technologies. The result of the project is an operationally new telescope -- renamed the Jansky Very Large Array -- which is capable of new science unimagined in 1980, when the original VLA was completed. In this talk, I will review the goals of the project, and describe the new capabilities of the Jansky Very Large Array. Already, the array is providing fabulous new insights into the physics of the universe,and I will spend the majority of the time describing examples of new results.

The Impact of Impulsivity on Weight Loss Four Years after Bariatric Surgery

Directory of Open Access Journals (Sweden)

Kathrin Schag

2016-11-01

Full Text Available Bariatric surgery has serious implications on metabolic health. The reasons for a failure of bariatric surgery, i.e., limited weight loss, are multifactorial and include psychological factors. We established a theoretical model of how impulsivity is related to weight loss outcome. We propose that depressive symptoms act as a mediator between impulsivity and pathological eating behavior, and that pathological eating behavior has a direct impact on weight loss outcome. We calculated excessive weight loss (%EWL and assessed self-reported impulsivity (using the Baratt Impulsiveness Scale (BIS-15 total score, depressive symptoms (the Patient Health Questionnaire (PHQ-9 score, and pathological eating behavior (the Eating Disorder Inventory 2 (EDI-2 total score in 65 patients four years after laparoscopic sleeve gastrectomy. Regression and mediation analyses were computed to validate the theoretical model. The BIS-15, PHQ-9, and EDI-2 have medium to high correlations between each other, and EDI-2 correlated with %EWL. The mediation analysis yielded that the PHQ-9 represents a significant mediator between BIS-15 and EDI-2. The regression model between EDI-2 and %EWL was also significant. These results support our theoretical model, i.e., suggest that impulsivity has an indirect impact on weight loss outcome after bariatric surgery, mediated by depression and transferred through pathological eating behavior. Thus, the underlying psychological factors should be addressed in post-operative care to optimize weight loss outcome.

Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler) pseudoisochromatic plate test among the Indian population of Lalima village, Terena

OpenAIRE

Marcos Rogério Mistro Piccinin; Juliana Ferrari Cunha; Herbert Paulo de Almeida; Cleiton Cassio Bach; Andréa Cristina Grubits Gonçalves de Oliveira Dossa; Reinaldo Ferreira da Silva; Valdir Filgueiras Pessoa

2007-01-01

OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

Ranking Very Many Typed Entities on Wikipedia

NARCIS (Netherlands)

Zaragoza, Hugo; Rode, H.; Mika, Peter; Atserias, Jordi; Ciaramita, Massimiliano; Attardi, Guiseppe

2007-01-01

We discuss the problem of ranking very many entities of different types. In particular we deal with a heterogeneous set of types, some being very generic and some very specific. We discuss two approaches for this problem: i) exploiting the entity containment graph and ii) using a Web search engine

Final report for EDI energy conservation with diode light; Slutrapport for EDI energibesparelser med diodelys

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

The aim of this project has been to develop technological knowledge and a competence platform for utilization of new light emitting diode technology for general lighting purposes. Furthermore the project has aimed at developing a 3 W light diode bulb to replace 15-20 W filament bulbs and halogen spotlights, and thereby demonstrating a large energy conservation potential in the use of LED technology for lighting purposes. (BA)

Endovascular treatment of very small intracranial aneurysms

DEFF Research Database (Denmark)

Iskandar, A; Nepper-Rasmussen, J

2011-01-01

to large aneurysms (> 3 mm). However the data also suggest that endovascular treatment of very small aneurysms might be associated with an increased risk of procedural ruptures and mortality. At nine-month follow-up results indicate significantly less compaction in the very small aneurysms....... endovascular treatment was attempted in 956 consecutive intracranial aneurysms. Of 956 aneurysms, 111 aneurysms were very small aneurysms with a maximal diameter of 3 mm or less. We conducted a retrospective analysis of angiographic and clinical outcome following coiling of very small aneurysms...... aneurysms and less than 90% aneurysm occlusion in six aneurysms. Complications occurred in the treatment of 15 aneurysms, including eight procedural ruptures, six thromboembolic events and one case of early hemorrhage. Compared with larger aneurysms, treatment of very small aneurysms was associated...

Methane production using resin-wafer electrodeionization

Science.gov (United States)

Snyder, Seth W; Lin, YuPo; Urgun-Demirtas, Meltem

2014-03-25

The present invention provides an efficient method for creating natural gas including the anaerobic digestion of biomass to form biogas, and the electrodeionization of biogas to form natural gas and carbon dioxide using a resin-wafer deionization (RW-EDI) system. The method may be further modified to include a wastewater treatment system and can include a chemical conditioning/dewatering system after the anaerobic digestion system. The RW-EDI system, which includes a cathode and an anode, can either comprise at least one pair of wafers, each a basic and acidic wafer, or at least one wafer comprising of a basic portion and an acidic portion. A final embodiment of the RW-EDI system can include only one basic wafer for creating natural gas.

Surface characterization of polymethylmetacrylate bombarded by charged water droplets

International Nuclear Information System (INIS)

Hiraoka, Kenzo; Takaishi, Riou; Asakawa, Daiki; Sakai, Yuji; Iijima, Yoshitoki

2009-01-01

The electrospray droplet impact (EDI), in which the charged electrospray water droplets are introduced in vacuum, accelerated, and allowed to impact the sample, is applied to polymethylmetacrylate (PMMA). The secondary ions generated were measured by an orthogonal time-of-flight mass spectrometer. In EDI mass spectra for PMMA, fragment ions originating from PMMA could not be detected. This is due to the fact that the proton affinities of fragments formed from PMMA are smaller than those from acetic acid contained in the charged droplet. The x-ray photoelectron spectroscopy spectra of PMMA irradiated by water droplets did not change with prolonged cluster irradiation, i.e., EDI is capable of shallow surface etching for PMMA with a little damage of the sample underneath the surface.

Microlensing discovery of a population of very tight, very low mass binary brown dwarfs

DEFF Research Database (Denmark)

Choi, J.-Y.; Han, C.; Udalski, A.

2013-01-01

the discovery via gravitational microlensing of two very low mass, very tight binary systems. These binaries have directly and precisely measured total system masses of 0.025 M ☉ and 0.034 M ☉, and projected separations of 0.31 AU and 0.19 AU, making them the lowest-mass and tightest field BD binaries known....... The discovery of a population of such binaries indicates that BD binaries can robustly form at least down to masses of ~0.02 M ☉. Future microlensing surveys will measure a mass-selected sample of BD binary systems, which can then be directly compared to similar samples of stellar binaries....

Brain development of very preterm and very low‐birthweight children in childhood and adolescence: a meta‐analysis

NARCIS (Netherlands)

de Kieviet, J.F.; Zoetebier, L.; van Elburg, R.M.; Vermeulen, R.J.; Oosterlaan, J.

2012-01-01

Aim The aim of this article was to clarify the impact and consequences of very preterm birth (born <32wks of gestation) and/or very low birthweight ([VLBW], weighing <1500g) on brain volume development throughout childhood and adolescence. Method The computerized databases PubMed, Web of Knowledge,

Brain development of very preterm and very low-birthweight children in childhood and adolescence: a meta-analysis

NARCIS (Netherlands)

de Kieviet, Jorrit F.; Zoetebier, Lydia; van Elburg, Ruurd M.; Vermeulen, R. Jeroen; Oosterlaan, Jaap

2012-01-01

Aim The aim of this article was to clarify the impact and consequences of very preterm birth (born <32wks of gestation) and/or very low birthweight ([VLBW], weighing <1500g) on brain volume development throughout childhood and adolescence. METHOD The computerized databases PubMed, Web of Knowledge,

Landfill disposal of very low level waste

International Nuclear Information System (INIS)

Luo Shanggeng

2009-01-01

The radioactivities of very low level wastes are very low. VLLW can be disposed by simple and economic burial process. This paper describes the significance of segregation of very low level waste (VLLW), the VLLW-definition and its limit value, and presents an introduction of VLLW-disposing approaches operated world wide. The disposal of VLLW in China is also briefly discussed and suggested here. (author)

“En-Face” Spectral-Domain Optical Coherence Tomography Findings in Multiple Evanescent White Dot Syndrome

Directory of Open Access Journals (Sweden)

Flore De bats

2014-01-01

Full Text Available Purpose. The recent use of “en-face” enhanced-depth imaging spectral-domain optical coherence tomography (EDI SD-OCT helps distinguish the retinal layers involved in the physiopathology of multiple evanescent white dot syndrome (MEWDS. Methods. Four patients presenting with MEWDS underwent a comprehensive ocular examination including C-scan (“en-face” EDI SD-OCT at the initial visit and during follow-up. Results. C-scans combined with the other multimodal imaging enabled the visualization of retinal damage. Acute lesions appeared as diffuse and focal disruptions occurring in the ellipsoid and interdigitation zones. The match between autofluorescence imaging, indocyanine green angiography, and “en-face” OCT helped identify the acute microstructural damages in the outer retina further than the choroid. Follow-up using “en-face” EDI-OCT revealed progressive and complete recovery of the central outer retinal layers. Conclusion. “En-face” EDI SD-OCT identified the site of initial damage in MEWDS as the photoreceptors and the interdigitation layers rather than the choroid. Moreover, “en-face” OCT is helpful in the follow-up of these lesions by being able to show the recovery of the outer retinal layers.

De Paris a Buenos Aires: imprensa, ideias e intelectuais no Le Monde Diplomatique

Directory of Open Access Journals (Sweden)

Juliana Sayuri Ogassawara

2016-03-01

Full Text Available Este artigo pretende expor as relações entre os intelectuais e jornalistas imbricados nas edições latino-americanas e a edição francesa do periódico Le Monde Diplomatique. Fundado em maio de 1954, em Paris, por Hubert Beuve-Méry, Le Monde Diplomatique viu suas páginas e suas ideias se alastrarem mundo afora – em 2013, o magazine tinha 47 edições internacionais, considerado um fenômeno único na imprensa mundial. Ao longo de sua trajetória, Le Monde Diplomatique teve sua linha editorial marcada por diretrizes politizadas, declaradamente antiimperialistas e antineoliberais. A tese desenvolvida focou a versão publicada em Buenos Aires, considerada a principal edição latino-americana, fundada por iniciativa do argentino Carlos Gabetta, diretor de Le Monde Diplomatique Edición Cono Sur entre 1999 e 2011. Ancorado na história dos intelectuais e na história do tempo presente, este artigo aborda as relações entre intelectuais franceses e argentinos na consolidação de uma experiência singular da imprensa.

Flux-gate magnetometer spin axis offset calibration using the electron drift instrument

International Nuclear Information System (INIS)

Plaschke, Ferdinand; Nakamura, Rumi; Baumjohann, Wolfgang; Steller, Manfred; Magnes, Werner; Leinweber, Hannes K; Chutter, Mark; Vaith, Hans

2014-01-01

Spin-stabilization of spacecraft immensely supports the in-flight calibration of on-board flux-gate magnetometers (FGMs). From 12 calibration parameters in total, 8 can be easily obtained by spectral analysis. From the remaining 4, the spin axis offset is known to be particularly variable. It is usually determined by analysis of Alfvénic fluctuations that are embedded in the solar wind. In the absence of solar wind observations, the spin axis offset may be obtained by comparison of FGM and electron drift instrument (EDI) measurements. The aim of our study is to develop methods that are readily usable for routine FGM spin axis offset calibration with EDI. This paper represents a major step forward in this direction. We improve an existing method to determine FGM spin axis offsets from EDI time-of-flight measurements by providing it with a comprehensive error analysis. In addition, we introduce a new, complementary method that uses EDI beam direction data instead of time-of-flight data. Using Cluster data, we show that both methods yield similarly accurate results, which are comparable yet more stable than those from a commonly used solar wind-based method. (paper)

Thermal conductivity at very low temperature

Energy Technology Data Exchange (ETDEWEB)

Locatelli, M [CEA Centre d' Etudes Nucleaires de Grenoble, 38 (France). Service des Basses Temperatures

1976-06-01

The interest of low and very low temperatures in solid physics and especially that of thermal measurements is briefly mentioned. Some notes on the thermal conductivity of dielectrics, the method and apparatus used to measure this property at very low temperatures (T<1.5K) and some recent results of fundamental and applied research are then presented.

Choroidal vasculature characteristics based choroid segmentation for enhanced depth imaging optical coherence tomography images

Energy Technology Data Exchange (ETDEWEB)

Chen, Qiang; Niu, Sijie [School of Computer Science and Engineering, Nanjing University of Science and Technology, Nanjing 210094 (China); Yuan, Songtao; Fan, Wen, E-mail: fanwen1029@163.com; Liu, Qinghuai [Department of Ophthalmology, The First Affiliated Hospital with Nanjing Medical University, Nanjing 210029 (China)

2016-04-15

Purpose: In clinical research, it is important to measure choroidal thickness when eyes are affected by various diseases. The main purpose is to automatically segment choroid for enhanced depth imaging optical coherence tomography (EDI-OCT) images with five B-scans averaging. Methods: The authors present an automated choroid segmentation method based on choroidal vasculature characteristics for EDI-OCT images with five B-scans averaging. By considering the large vascular of the Haller’s layer neighbor with the choroid-sclera junction (CSJ), the authors measured the intensity ascending distance and a maximum intensity image in the axial direction from a smoothed and normalized EDI-OCT image. Then, based on generated choroidal vessel image, the authors constructed the CSJ cost and constrain the CSJ search neighborhood. Finally, graph search with smooth constraints was utilized to obtain the CSJ boundary. Results: Experimental results with 49 images from 10 eyes in 8 normal persons and 270 images from 57 eyes in 44 patients with several stages of diabetic retinopathy and age-related macular degeneration demonstrate that the proposed method can accurately segment the choroid of EDI-OCT images with five B-scans averaging. The mean choroid thickness difference and overlap ratio between the authors’ proposed method and manual segmentation drawn by experts were −11.43 μm and 86.29%, respectively. Conclusions: Good performance was achieved for normal and pathologic eyes, which proves that the authors’ method is effective for the automated choroid segmentation of the EDI-OCT images with five B-scans averaging.

Choroidal vasculature characteristics based choroid segmentation for enhanced depth imaging optical coherence tomography images

International Nuclear Information System (INIS)

Chen, Qiang; Niu, Sijie; Yuan, Songtao; Fan, Wen; Liu, Qinghuai

2016-01-01

Purpose: In clinical research, it is important to measure choroidal thickness when eyes are affected by various diseases. The main purpose is to automatically segment choroid for enhanced depth imaging optical coherence tomography (EDI-OCT) images with five B-scans averaging. Methods: The authors present an automated choroid segmentation method based on choroidal vasculature characteristics for EDI-OCT images with five B-scans averaging. By considering the large vascular of the Haller’s layer neighbor with the choroid-sclera junction (CSJ), the authors measured the intensity ascending distance and a maximum intensity image in the axial direction from a smoothed and normalized EDI-OCT image. Then, based on generated choroidal vessel image, the authors constructed the CSJ cost and constrain the CSJ search neighborhood. Finally, graph search with smooth constraints was utilized to obtain the CSJ boundary. Results: Experimental results with 49 images from 10 eyes in 8 normal persons and 270 images from 57 eyes in 44 patients with several stages of diabetic retinopathy and age-related macular degeneration demonstrate that the proposed method can accurately segment the choroid of EDI-OCT images with five B-scans averaging. The mean choroid thickness difference and overlap ratio between the authors’ proposed method and manual segmentation drawn by experts were −11.43 μm and 86.29%, respectively. Conclusions: Good performance was achieved for normal and pathologic eyes, which proves that the authors’ method is effective for the automated choroid segmentation of the EDI-OCT images with five B-scans averaging.

Editorial

Directory of Open Access Journals (Sweden)

José Aparecido

2011-05-01

Full Text Available A presente edição da Revista Tecer traz para a comunidade acadêmica os resultados da terceira edição do Congresso Internacional de Dislexia (CID, que reúne bianualmente profissionais das áreas da Psicologia, Fonoaudiologia, Psicopedagogia, Pedagogia e Neurociências para discutir pesquisas realizadas no contexto nacional e internacional em torno da temática dislexia.

Human exposure to per- and polyfluoroalkyl substances (PFASs) via house dust in Korea: Implication to exposure pathway.

Science.gov (United States)

Tian, Zhexi; Kim, Seung-Kyu; Shoeib, Mahiba; Oh, Jeong-Eun; Park, Jong-Eun

2016-05-15

A wide range of per- and polyfluoroalkyl substances (PFASs), including fluorotelomer alcohols (FTOHs), perfluorooctane sulfonamidoethanols (FOSEs), perfluoroalkyl carboxylic acids (PFCAs), and perfluoroalkane sulfonic acids (PFSAs), were measured in fifteen house dust and two nonresidential indoor dust of Korea. Total concentrations of PFASs in house dust ranged from 29.9 to 97.6 ng g(-1), with a dominance of perfluorooctane sulfonic acid (PFOS), followed by 8:2 FTOH, N-Ethyl perfluorooctane sulfonamidoethanol (EtFOSE), perfluoroctanoic acid (PFOA). In a typical exposure scenario, the estimated daily intakes (EDIs) of total PFASs via house dust ingestion were 2.83 ng d(-1) for toddlers and 1.13 ng d(-1) for adults, which were within the range of the mean EDIs reported from several countries. For PFOA and PFOS exposure via house dust ingestion, indirect exposure (via precursors) was a minor contributor, accounting for 5% and 12%, respectively. An aggregated exposure (hereafter, overall-EDIs) of PFOA and PFOS occurring via all pathways, estimated using data compiled from the literature, were 53.6 and 14.8 ng d(-1) for toddlers, and 20.5 and 40.6 ng d(-1) for adults, respectively, in a typical scenario. These overall-EDIs corresponded to 82% (PFOA) and 92% (PFOS) of a pharmacokinetic model-based EDIs estimated from adults' serum data. Direct dietary exposure was a major contributor (>89% of overall-EDI) to PFOS in both toddlers and adults, and PFOA in toddlers. As for PFOA exposure of adults, however direct exposure via tap water drinking (37%) and indirect exposure via inhalation (22%) were as important as direct dietary exposure (41%). House dust-ingested exposure (direct+indirect) was responsible for 5% (PFOS in toddlers) and house-dust ingestion was a minor contributor in this study, but should not be ignored for toddlers' PFOS exposure due to its significance in the worst-case scenario. Copyright © 2016 Elsevier B.V. All rights reserved.

Oligocone Trichromacy:

DEFF Research Database (Denmark)

Andersen, Mette Klindt; Christoffersen, Nynne L.B.; Sander, Birgit Agnes

2010-01-01

ERG). Five patients also underwent multifocal (mf)ERG, autofluorescence recording, and optical coherence tomography (OCT). Genetic analysis included sequencing of all coding regions and flanking introns of CNGA3, CNGB3, GNAT2, KCNV2, and PDE6C. RESULTS: All patients had subnormal visual acuity, a history...... investigations showed either complete absence of recordable cone responses or severely reduced amplitudes. All retinal layers were identifiable by OCT, which also showed thinning of the peripheral retina. Genetic analysis revealed two causative CNGB3 mutations in one patient and single heterozygous mutations...

Real-time in vivo micromorphology and histopathology of choroidal osteoma using enhanced depth imaging

Directory of Open Access Journals (Sweden)

Rameez Hussain

2015-01-01

Full Text Available Choroidal osteoma is a usually unilateral benign tumor of the choroid composed of mature bone. Optical coherence tomography (OCT has been used to image osteoma for several years. With the advent of enhanced depth imaging (EDI feature of spectral-domain OCT (SD-OCT, better visualization of the morphology of choroidal lesions has been possible. Herein we present a case of choroidal osteoma in a 45-year-old woman, wherein in vivo morphology of the choroidal osteoma had been visualized using EDI technique of SD-OCT before and after performing photodynamic therapy. EDI OCT has proven to be a valuable noninvasive imaging modality, almost comparable to histopathological examination, for diagnosing choroidal osteomas and for providing an insight into the in vivo micromorphological changes occurring during the course of the disease.

Phenomena at very high spins

International Nuclear Information System (INIS)

Stephens, F.S.

1980-03-01

The present talk has three parts: first, a discussion of current ideas about the physics of very high spin states; second, some comments about noncollective behavior up to the highest spins where it is known, approx. 40 h; and finally, a presentation of the newest method for studying collective behavior up to spins of 60 to 70 h. The intention is that the overview presented in the first part will be sufficiently broad to indicate the relationship of the noncollective and collective behavior discussed in the other parts, and to provide some understanding of the compromise in behavior that seems to occur at the very highest spins. 13 figures

Nothing a very short introduction

CERN Document Server

Close, Frank

2009-01-01

What is 'nothing'? What remains when you take all the matter away? Can empty space - a void - exist? This Very Short Introduction explores the science and the history of the elusive void: from Aristotle who insisted that the vacuum was impossible, via the theories of Newton and Einstein, to our very latest discoveries and why they can tell us extraordinary things about the cosmos. Frank Close tells the story of how scientists have explored the elusive void, and the rich discoveries that they have made there. He takes the reader on a lively and accessible history through ancient ideas and cultural superstitions to the frontiers of current research

7 CFR 51.2294 - Very serious damage.

Science.gov (United States)

2010-01-01

... serious damage. Very serious damage means any defect, other than color, which very seriously affects the... than one-fourth of the surface of the portion of kernel in the aggregate; (c) Discoloration of the meat...

Very high energy colliders

International Nuclear Information System (INIS)

Richter, B.

1986-03-01

The luminosity and energy requirements are considered for both proton colliders and electron-positron colliders. Some of the basic design equations for high energy linear electron colliders are summarized, as well as design constraints. A few examples are given of parameters for very high energy machines. 4 refs., 6 figs

Validating Advanced Supply-Chain Technology (VAST)

Science.gov (United States)

2004-06-01

Use philosophy that is so important in today’s procurement environment. Electronic Data Interchange (EDI) and eCommerce is proving to be a major...the STEPwise methodology are particularly encouraging. These new EDI and eCommerce technologies are becoming more important with the customers who...critical assumption is based upon the 55 fact that eCommerce is growing throughout the commercial and military sector and those who are not

Astrophysics at very high energies

International Nuclear Information System (INIS)

Aharonian, Felix; Bergstroem, Lars; Dermer, Charles

2013-01-01

Presents three complementary lectures on very-high-energy astrophysics given by worldwide leaders in the field. Reviews the recent advances in and prospects of gamma-ray astrophysics and of multi-messenger astronomy. Prepares readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors. With the success of Cherenkov Astronomy and more recently with the launch of NASA's Fermi mission, very-high-energy astrophysics has undergone a revolution in the last years. This book provides three comprehensive and up-to-date reviews of the recent advances in gamma-ray astrophysics and of multi-messenger astronomy. Felix Aharonian and Charles Dermer address our current knowledge on the sources of GeV and TeV photons, gleaned from the precise measurements made by the new instrumentation. Lars Bergstroem presents the challenges and prospects of astro-particle physics with a particular emphasis on the detection of dark matter candidates. The topics covered by the 40th Saas-Fee Course present the capabilities of current instrumentation and the physics at play in sources of very-high-energy radiation to students and researchers alike. This book will encourage and prepare readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors.

Very long baseline interferometry

International Nuclear Information System (INIS)

Eckart, A.

1982-01-01

In the last few years the resolution of the instruments used in radioastronomy could be enhanced by a factor of 10 000 compared with the human eye. As this method is relatively young and not very well known, the principles of the technique are presented in combination with the most important results. (orig.) [de

Drought over Seoul and Its Association with Solar Cycles

Directory of Open Access Journals (Sweden)

Jong-Hyeok Park

2013-12-01

Full Text Available We have investigated drought periodicities occurred in Seoul to find out any indication of relationship between drought in Korea and solar activities. It is motivated, in view of solar-terrestrial connection, to search for an example of extreme weather condition controlled by solar activity. The periodicity of drought in Seoul has been re-examined using the wavelet transform technique as the consensus is not achieved yet. The reason we have chosen Seoul is because daily precipitation was recorded for longer than 200 years, which meets our requirement that analyses of drought frequency demand long-term historical data to ensure reliable estimates. We have examined three types of time series of the Effective Drought Index (EDI. We have directly analyzed EDI time series in the first place. And we have constructed and analyzed time series of histogram in which the number of days whose EDI is less than -1.5 for a given month of the year is given as a function of time, and one in which the number of occasions where EDI values of three consecutive days are all less than -1.5 is given as a function of time. All the time series data sets we analyzed are periodic. Apart from the annual cycle due to seasonal variations, periodicities shorter than the 11 year sunspot cycle, ~ 3, ~ 4, ~ 6 years, have been confirmed. Periodicities to which theses short periodicities (shorter than Hale period may be corresponding are not yet known. Longer periodicities possibly related to Gleissberg cycles, ~ 55, ~ 120 years, can be also seen. However, periodicity comparable to the 11 year solar cycle seems absent in both EDI and the constructed data sets.

A change of course: The importance to DoD of international standards for electronic commerce

Science.gov (United States)

Payne, Judith E.

1991-12-01

The U.S. Department of Defense (DoD) is committed to using electronic commerce in the future with the over 300,000 vendors interested in doing business with DoD. Electronic commerce will move DoD from a paper-based world to one based on electronic transactions enabled by the exchange of formatted, electronic messages referred to as electronic data interchange (EDI). With electronic commerce, DoD plans to reduce costs, increase effectiveness, and make it easier for vendors to deal with DoD. Benefits from electronic commerce are enhanced when many businesses use the same standards for EDI messages themselves and their transmission. The fewer standards used, the less time and resources must be spent translating messages and agreeing on how to use different standards. To enhance benefits and smooth the transition to electronic commerce for itself and its vendors, DoD has chosen to use the widely accepted American National Standards Institute (ANSI) X12 standards for EDI messages, coupled with international standards for delivering messages and organizing addresses. In the past 18 months, EDI standards sponsored by a United Nations body and serving the same purpose as ANSI X12 message standards have begun to gain wider acceptance internationally.

Exploring Intrinsic and Extrinsic Reading Motivation among Very Good and Very Poor Readers

Science.gov (United States)

McGeown, Sarah P.; Norgate, Roger; Warhurst, Amy

2012-01-01

Background: Research examining the relationship between reading skill and reading motivation has typically been carried out among children with a wide range of reading abilities. There is less research focusing on children who excel in reading or who are attaining very low reading scores. Purpose: To examine whether there were differences between…

WEB Services Networks and Technological Hybrids — The Integration Challenges of WAN Distributed Computing for ASP Providers

Science.gov (United States)

Mroczkiewicz, Pawel

A necessity of integration of both information systems and office software existing in organizations has had a long history. The beginning of this kind of solutions reaches back to the old generation of network protocols called EDI (Electronic Data Interchange) and EDIFACT standard, which was initiated in 1988 and has dynamically evolved ever since (S. Michalski, M. Suskiewicz, 1995). The mentioned protocol was usually used for converting documents into natural formats processed by applications. It caused problems with binary files and, furthermore, the communication mechanisms had to be modified each time new documents or applications were added. When we compare EDI with the previously used communication mechanisms, EDI was a great step forward as it was the first, big scale attempt to define standards of data interchange between the applications in business transactions (V. Leyland, 1995, p. 47).

The Influence of Volume and Anatomic Location of Optic Disc Drusen on the Sensitivity of Autofluorescence

DEFF Research Database (Denmark)

Loft, Frederik Cornelius; Malmqvist, Lasse; Lindberg, Anne-Sofie Wessel

2018-01-01

Optic disc drusen (ODD) are acellular deposits in the optic nerve head. ODD can be diagnosed using different imaging modalities, including enhanced depth imaging optical coherence tomography (EDI-OCT) and autofluorescence (AF). It is unknown which factors determine the sensitivity of AF. The aim...... of this study was to investigate the effect of volume and anatomic location of ODD on the sensitivity of AF. Cross-sectional study. A total of 38 patients (75 eyes) with ODD were included. In 12 of 75 eyes (16%) and in 11 of 38 patients (29%), EDI-OCT detected ODD that were not detected by AF. In 24 distinctly...... solitary ODD, both increase in ODD volume (P = 0.0388) and a more superficial ODD location (P EDI-OCT is superior to AF in the diagnosis of ODD. Volume and anatomic location of ODD have a significant impact...

General very special relativity in Finsler cosmology

International Nuclear Information System (INIS)

Kouretsis, A. P.; Stathakopoulos, M.; Stavrinos, P. C.

2009-01-01

General very special relativity (GVSR) is the curved space-time of very special relativity (VSR) proposed by Cohen and Glashow. The geometry of general very special relativity possesses a line element of Finsler geometry introduced by Bogoslovsky. We calculate the Einstein field equations and derive a modified Friedmann-Robertson-Walker cosmology for an osculating Riemannian space. The Friedmann equation of motion leads to an explanation of the cosmological acceleration in terms of an alternative non-Lorentz invariant theory. A first order approach for a primordial-spurionic vector field introduced into the metric gives back an estimation of the energy evolution and inflation.

Very fast kicker for accelerator applications

International Nuclear Information System (INIS)

Grishanov, B.I.; Podgorny, F.V.; Shiltsev, V.D.

1996-11-01

We describe a very fast counter traveling wave kicker with a full pulse width of about 7 ns. Successful test experiment has been done with hi-tech semiconductor technology FET pulse generator with a MHz- range repetition rates and maximum kick strength of the order of 3 G·m. Further. increase of the strength seems to be quite possible with the FET pursers, that makes the kicker to be very useful tool for bunch-by-bunch injection/extraction and other accelerator applications

The Reformation: A Very Short Introduction

OpenAIRE

TKACHENKO, Rostislav

2017-01-01

A small, relatively recent, and well-written book by Peter Marshall belongs tothe well-known Oxford series called “Very Short Introductions.” It is an informativeand analytical introduction to the history, culture, politics, and theology of theReformation that took place in sixteenth-century Europe. The Reformation is anacademic research-based book that is nevertheless very accessible to a wide audience. It is part of the larger company of historical and cultural mini-handbooks such as, The M...

Psycholinguistic factors in testing children’s theory of mind: false belief in their own words

DEFF Research Database (Denmark)

Hansen, Mikkel

Symposium presented by Nathalie Nader-Grosbois, Valerie Plumet, Edy Veneziano, Koviljka Barisnikov, discussant: Koviljka Barisnikov. How does Theory of mind explain social skills? What is the impact of communicative and linguistic factors on Theory of mind?......Symposium presented by Nathalie Nader-Grosbois, Valerie Plumet, Edy Veneziano, Koviljka Barisnikov, discussant: Koviljka Barisnikov. How does Theory of mind explain social skills? What is the impact of communicative and linguistic factors on Theory of mind?...

Why do very unattractive workers earn so much?

Science.gov (United States)

Kanazawa, Satoshi; Hu, Shihao; Larere, Adrien

2018-05-01

Kanazawa and Still (2018) showed that very unattractive workers earned more than unattractive workers, sometimes more than average-looking or attractive workers, because they had higher levels of intelligence and education, but they did not explain why very unattractive workers had higher intelligence and education. There are both theoretical and empirical reasons to expect that some intelligent men may prefer to marry very unattractive women. The analysis of the National Longitudinal Study of Adolescent Health (Add Health) shows that very unattractive women were significantly more likely to be married at Age 29 than unattractive or average-looking women, and their spouses or partners earned significantly more than those of unattractive or average-looking women. If intelligent men have historically preferred to marry very unattractive women generation after generation, then, because both general intelligence and physical attractiveness are highly heritable, this can explain why very unattractive workers are more intelligent and achieve higher education, thereby earning more. It can also explain why the positive correlation between intelligence and physical attractiveness is not larger despite assortative mating of intelligent men of higher status and physically attractive women over many generations. Copyright © 2018 Elsevier B.V. All rights reserved.

Very high energy colliders

International Nuclear Information System (INIS)

Richter, B.

1985-05-01

The conclusions are relatively simple, but represent a considerable challenge to the machine builder. High luminosity is essential. We may in the future discover some new kind of high cross section physics, but all we know now indicates that the luminosity has to increase as the square of the center of mass energy. A reasonable luminosity to scale from for electron machines would be 10 33 cm -2 s -1 at a center of mass energy of 3 TeV. The required emittances in very high energy machines are small. It will be a real challenge to produce these small emittances and to maintain them during acceleration. The small emittances probably make acceleration by laser techniques easier, if such techniques will be practical at all. The beam spot sizes are very small indeed. It will be a challenge to design beam transport systems with the necessary freedom from aberration required for these small spot sizes. It would of course help if the beta functions at the collision points could be reduced. Beam power will be large - to paraphrase the old saying, ''power is money'' - and efficient acceleration systems will be required

Very preterm/very low birthweight infants' attachment: infant and maternal characteristics.

Science.gov (United States)

Wolke, Dieter; Eryigit-Madzwamuse, Suna; Gutbrod, Tina

2014-01-01

To investigate whether there are differences in attachment security and disorganisation between very preterm or very low birthweight (VP/VLBW) (infants (37-42 weeks gestation) and whether the pathways to disorganised attachment differ between VP/VLBW and full-term infants. The sample with complete longitudinal data consisted of 71 VP/VLBW and 105 full-term children and their mothers matched for twin status, maternal age, income and maternal education. Infant attachment was assessed with the Strange Situation Assessment at 18 months of age. Maternal sensitivity in the VP/VLBW and full-term samples was rated by neonatal nurses and community midwives in the neonatal period, respectively, and mother-infant interaction was observed at 3 months. Infant difficultness was assessed by maternal report at 3 months and infant's developmental status was assessed with the Bayley Scales (BSID-II). Most VP/VLBW (61%) and full-term (72%) children were found to be securely attached. However, more VP/VLBW (32%) than full-term children (17%) had disorganised attachment. Longitudinal path analysis found that maternal sensitivity was predictive of attachment disorganisation in full-term children. In contrast, infant's distressing cry and infant's developmental delay, but not maternal sensitivity, were predictive of disorganised attachment in VP/VLBW children. A third of VP/VLBW children showed disorganised attachment. Underlying neurodevelopmental problems associated with VP/VLBW birth appear to be a common pathway to a range of social relationship problems in this group. Clinicians should be aware that disorganised attachment and relationship problems in VP/VLBW infants are frequent despite sensitive parenting.

Social Lifestyle, Risk-taking Behavior, and Psychopathology in Young Adults Born Very Preterm or with a Very Low Birthweight

NARCIS (Netherlands)

Hille, E.T.M.; Dorrepaal, C.; Perenboom, R.; Gravenhorst, J.B.; Brand, R.; Verloove-Vanhorick, S.P.

2008-01-01

Objective: To assess social lifestyle, risk-taking behavior, and psychopathology in young adults born very preterm or with a very low birthweight. Study design: This study was part of the 19-year follow-up in a large ongoing collaborative study in the Netherlands (the POPS study) on the long-term

Social lifestyle, risk-taking behavior, and psychopathology in young adults born very preterm or with a very low birthweight

NARCIS (Netherlands)

Hille, Elysée T. M.; Dorrepaal, Caroline; Perenboom, Rom; Gravenhorst, Jack Bennebroek; Brand, Ronald; Verloove-Vanhorick, S. Pauline; Hille, E. T. M.; de Groot, C. H.; Kloosterboer-Boerrigter, H.; den Ouden, A. L.; Rijpstra, A.; Verloove-Vanhorick, S. P.; Vogelaar, J. A.; Kok, J. H.; Ilsen, A.; van der Lans, M.; Boelen-van der Loo, W. J. C.; Lundqvist, T.; Heymans, H. S. A.; Duiverman, E. J.; Geven, W. B.; Duiverman, M. L.; Geven, L. I.; Vrijlandt, E. J. L. E.; Mulder, A. L. M.; Gerver, A.; Kollée, L. A. A.; Reijmers, L.; Sonnemans, R.; Wit, J. M.; Dekker, F. W.; Finken, M. J. J.; Weisglas-Kuperus, N.; Keijzer-Veen, M. G.; van der Heijden, A. J.; van Goudoever, J. B.; van Weissenbruch, M. M.; Cranendonk, A.; Delemarre-van de Waal, H. A.; de Groot, L.; Samsom, J. F.; de Vries, L. S.; Rademaker, K. J.; Moerman, E.; Voogsgeerd, M.; de Kleine, M. J. K.; Andriessen, P.; Dielissen-van Helvoirt, C. C. M.; Mohamed, I.; van Straaten, H. L. M.

2008-01-01

OBJECTIVE: To assess social lifestyle, risk-taking behavior, and psychopathology in young adults born very preterm or with a very low birthweight. STUDY DESIGN: This study was part of the 19-year follow-up in a large ongoing collaborative study in The Netherlands (the POPS study) on the long-term

Rapid Onset of Retinal Toxicity From High-Dose Hydroxychloroquine Given for Cancer Therapy.

Science.gov (United States)

Leung, Loh-Shan B; Neal, Joel W; Wakelee, Heather A; Sequist, Lecia V; Marmor, Michael F

2015-10-01

To report rapid onset of retinal toxicity in a series of patients followed on high-dose (1000 mg daily) hydroxychloroquine during an oncologic clinical trial studying hydroxychloroquine with erlotinib for non-small cell lung cancer. Retrospective observational case series. Ophthalmic surveillance was performed on patients in a multicenter clinical trial testing high-dose (1000 mg daily) hydroxychloroquine for advanced non-small cell lung cancer. The US Food & Drug Administration-recommended screening protocol included only visual acuity testing, dilated fundus examination, Amsler grid testing, and color vision testing. In patients seen at Stanford, additional sensitive screening procedures were added at the discretion of the retinal physician: high-resolution spectral-domain optical coherence tomography (OCT), fundus autofluorescence (FAF) imaging, Humphrey visual field (HVF) testing, and multifocal electroretinography (mfERG). Out of the 7 patients having exposure of at least 6 months, 2 developed retinal toxicity (at 11 and 17 months of exposure). Damage was identified by OCT imaging, mfERG testing, and, in 1 case, visual field testing. Fundus autofluorescence imaging remained normal. Neither patient had symptomatic visual acuity loss. These cases show that high doses of hydroxychloroquine can initiate the development of retinal toxicity within 1-2 years. Although synergy with erlotinib is theoretically possible, there are no prior reports of erlotinib-associated retinal toxicity despite over a decade of use in oncology. These results also suggest that sensitive retinal screening tests should be added to ongoing and future clinical trials involving high-dose hydroxychloroquine to improve safety monitoring and preservation of vision. Published by Elsevier Inc.

Evaluation of the central macula in commotio retinae not associated with other types of traumatic retinopathy.

Science.gov (United States)

Park, Joo Youn; Nam, Woo Ho; Kim, Seung Hoon; Jang, Sun Young; Ohn, Young-Hoon; Park, Tae Kwann

2011-08-01

To report on the anatomical and functional changes to the macula in nine patients suffering from commotio retinae not accompanied by any other types of traumatic retinopathy. Nine injured eyes with commotio retinae were evaluated soon after ocular trauma with ophthalmic examination, including Spectral-domain optical coherence tomography (SD-OCT). In 12 eyes of 6 patients, Humphrey visual field (HVF) and multifocal electroretinogram (mfERG) were performed. Re-examinations were periodically performed for a mean of 26 days. Data from 9 injured eyes were collected and compared to data collected from the 9 non-affected eyes of the same patients. SD-OCT revealed no significant differences in the foveal thickness and total macular volume between traumatized and intact eyes in all 9 patients. Only 3 out of the 9 injured eyes showed abnormal findings in SD-OCT images such as discontinuity of the inner/outer segment (IS/OS) junction or abnormal hyper-reflectivity from the IS/OS and retinal pigment epithelium (RPE) lines in the macula. HVF and mfERG results did not show any functional deterioration in the injured eyes compared with intact eyes. During follow-up, the commotio retinae resolved in all 9 eyes. The changes to the outer retinal region detected in 3 patients by SD-OCT were also resolved. Acute retinal changes in commotio retinae, not associated with other retinal pathologies, were resolved without histological and functional sequelae. In a few cases of commotio retinae, SD-OCT revealed transient abnormalities mainly observed at the IS/OS and RPE complexes.

RISK FACTORS FOR VERY PRETERM DELIVERY

Directory of Open Access Journals (Sweden)

Наталья Витальевна Батырева

2018-01-01

Full Text Available The aim of the research – assess risk factors for very preterm delivery in the Omsk region. Materials and methods. The main group comprised women with very preterm delivery (n = 64; сomparison group – pregnant women with a threat of interruption in terms of 22-27 weeks and successful preserving therapy (n = 63; control group – pregnant women in whom this pregnancy was taking place without the threat of interruption (n = 62. Results. Risk factors for very preterm delivery were bacterial vaginosis, specific vaginitis, kidney disease and the threat of interruption. There was a significant lead in streptococci (32.3 ± 5.8 %, especially group B (19.0 ± 4.9 % in the main group. The risk factor for very preterm delivery was infectious viral diseases transferred during pregnancy, observed in 12.7 ± 4.2 % of women in the main group, in 7.8 ± 3.3 % in the comparison group (p < 0.01 and in 4.8 ± 2,7 % – control (p < 0,001. In the main group, placental insufficiency was 2 times more common than in the comparison group and 13 times than in the control group. Every sixth pregnant of the main group had manifestations of gestosis. Such complications of gestation as the premature detachment of the normally inserted placenta (7.8 ± 3.3 % and inborn malformations of a fruit (1.6 ± 1.6 % were observed only in the main group. Conclusion. The results of the research and literature data showed that the significant influence on the level of very early premature births is due to: the age of the parents, the abuse of nicotine, alcohol, drugs, abortion, preterm birth, urinary tract and genital tract infections, severe somatic diseases, multiple pregnancies. In the structure of complications of gestation during miscarriages, placental insufficiency predominates, the threat of abortion, fetal growth retardation, and polyhydramnios.

Discovery Mondays: The very early Universe

CERN Multimedia

2003-01-01

Copyright NASARetracing the very early Universe to understand why there is "something rather than nothing" is one of the challenges facing astrophysics today. It is also the theme of the third Discovery Monday, to be held in the Microcosm on 7 July, where you will be welcomed by a number of scientists. A professional astronomer will allow you to look through his telescope and explain how it works. A cosmologist will talk to you about the very early Universe and a CERN physicist will show you how it's possible to trap antimatter. The mirror of matter, antimatter should have existed in the same quantities as matter in the very early stages of the Universe but today it seems to have virtually disappeared. Perhaps the research being done at CERN will one day explain how an infinitesimal predominance of matter over antimatter resulted in such a richly structured Universe. Come along to the Microcosm on Monday, 7 July between 7.30 p.m. and 9.00 p.m. Entrance is free http://www.cern.ch/microcosm N.B.: The Discove...

Very forward measurements at the LHC

CERN Document Server

Berretti, Mirko

2017-01-01

In this talk we present a selection of forward physics results recently obtained with the run-1 and run-2 LHC data by the CMS, LHCf and TOTEM experiments. The status of the very forward LHC proton spectrometer, CT-PPS, is discussed: emphasis is given to the physics potential of CT-PPS and to the analyses that are currently ongoing with the data collected in 2016. Very recent forward measurements obtained with the LHCf and the CMS-CASTOR calorimeter are then addressed. In particular, CMS measured the inclusive energy spectrum in the very forward direction for proton-proton collisions at a center-of-mass energy of 13 TeV and the jet cross sections for p+Pb collisions at 5.02 TeV. The LHCf experiment has instead recently published the inclusive energy spectra of forward photons for pp collisions at 13 TeV. Finally, the new measurements of the total, elastic and inelastic cross sections obtained by the TOTEM collaboration at 2.76 and 13 TeV center of mass energy are presented.

全膜分离技术及其在电厂化学水处理中的应用%Whole Membrane Separation Technology and Its Application in Chemical Water Treatment of Power Plant

Institute of Scientific and Technical Information of China (English)

马福刚

2011-01-01

This paper introduces the definition, types and characteristics of membrane separation technology, and application instance of whole membrane separation treatment process (UF-RO-EDI) in power plant boiler feed water treatment.%介绍了膜分离技术的定义、种类、特点以及全膜分离处理工艺(UF-RO-EDI)在电厂锅炉补给水处理中的应用实例.

Very special conformal field theories and their holographic duals

Science.gov (United States)

Nakayama, Yu

2018-03-01

Cohen and Glashow introduced the notion of very special relativity as viable space-time symmetry of elementary particle physics. As a natural generalization of their idea, we study the subgroup of the conformal group, dubbed very special conformal symmetry, which is an extension of the very special relativity. We classify all of them and construct field theory examples as well as holographic realization of the very special conformal field theories.

The Long Term Effects of Electronic Commerce and Data Interchange on Firms

Directory of Open Access Journals (Sweden)

François Bergeron

1998-11-01

Full Text Available This research aims to identify the determinants of electronic commerce effectiveness, as well as the variation over time of their effect. A two-phased study was undertaken for this purpose, using EDI as a specific form of electronic commerce. Sixty-five organisations were surveyed twice over a three-year period. In Phase 1, determining factors were found to be the level of organisational support, the rigour of the implementation process, the presence of control procedures, and the level of internal integration, external integration and imposition of EDI. Imposition also has a negative effect on the organisational context of EDI. In Phase 2, the implementation process, internal integration and imposition lost their importance, whereas the effect of imposition on the organisational context became positive. In the future, we expect the security and external integration to be the most important success factors of electronic commerce.

Population-level associations between preschool vulnerability and grade-four basic skills.

Directory of Open Access Journals (Sweden)

Amedeo D'Angiulli

2009-11-01

Full Text Available This is a predictive validity study examining the extent to which developmental vulnerability at kindergarten entry (as measured by the Early Development Instrument, EDI is associated with children's basic skills in 4th grade (as measured by the Foundation Skills Assessment, FSA.Relative risk analysis was performed on a large database linking individual-level EDI ratings to the scores the same children obtained on a provincial assessment of academic skills (FSA--Foundation Skills Assessment four years later. We found that early vulnerability in kindergarten is associated with the basic skills that underlie populations of children's academic achievement in reading, writing and math, indicating that the Early Development Instrument permits to predict achievement-related skills four years in advance.The EDI can be used to predict children's educational trends at the population level and can help select early prevention and intervention programs targeting pre-school populations at minimum cost.

Drivers and obstacles for employee-driven innovation in large client project organisations

DEFF Research Database (Denmark)

Sørensen, Henrik; Wandahl, Søren

2012-01-01

of employees’ spoken and tacit knowledge in development of new tools and structures to optimise the construction project management processes is a relatively new approach to engage innovation. In this broad perspective the aim is to map the boundary conditions for an EDI approach in a client project......, and in sequence increased revenue, this study suggests that the key source for innovation is the employees. Employee-driven innovation (EDI) is often seen in a greater innovation context, in which it is often de-emphasised contrary to product and process innovation. Hence a methodology to take advantage...... a literature review to clarify the most potential methodologies and tools. Based on this review a framework of tools and methods is derived from related development theories to engage EDI in client project organisa-tions, where product and process knowledge often are closely related to, and irregular driven by...

Electronic commerce can cut purchasing costs

Energy Technology Data Exchange (ETDEWEB)

Hansen, T.

1995-06-01

Electronic commerce could be the most important strategy exercised by utilities involved in transmission and distribution in the next five to ten years. One key element of electronic commerce is electronic data interchange (EDI). EDI is the direct, standardized computer-to-computer exchange of business documents, such as purchase orders, invoices, payments and inventory analysis between trading partners. EDI enables business documents delivery in seconds instead of days. Inventory has been a big expense for utilities, especially in the transmission and distribution area. In order to provide and restore electrical service to customers, utilities have been required to stock high levels of many different items. At times, warehouse personnel have had difficulty determining the minimum quantity needed for a particular part so items are stocked just-in-case.Electronic commerce will allow utilities to more accurately determine minimum stocking requirements and reduce inventory without sacrificing customer service.

Respiratory morbidity in very preterm and very low birth weight infants: the first 2 years of life

Directory of Open Access Journals (Sweden)

Mariana Ferreira

2014-06-01

Full Text Available Respiratory morbidity in the first two years of life, including recurrent symptoms and frequent hospitalizations, is a common problem in very preterm and very low birth weight (VLBW infants. We conducted a retrospective cohort study aiming to describe the respiratory morbidity at 2 years of corrected age for very preterm and VLBW infants and to identify potential risk factors for its development in a Portuguese based population born in a tertiary referral center between 2009 and 2011. Data were collected from patient’s clinical files and using a standardized questionnaire-based clinical interview for parents. A total 59 children were included. Thirteen (22.0% had recurrent respiratory symptoms and 12 (20.3% were using chronic respiratory medication. Health care utilization for respiratory causes was frequent (57.6%, particularly emergency department attendance (50.8%. Twenty seven (45.8% had additional outpatient visits for respiratory causes and hospital admission was necessary for 8 (13.6% patients. Factors associated with increased recurrent respiratory symptoms included maternal hypertensive disorders during pregnancy, umbilical artery flow disturbances, being small for gestational age, bronchopulmonary dysplasia, retinopathy of prematurity, intraventricular hemorrhage and a weight percentile below 3 at 6, 12 and 24 months of corrected age. Premature rupture of membranes was negatively associated with respiratory morbidity. Respiratory morbidity at 2 years of age is a common problem in very preterm and VLBW children from our population. Several perinatal and developmental risk factors were identified for respiratory morbidity. Further studies are needed to clarify the importance of these factors, as they can lead to changes in healthcare guidelines.

Intensive inpatient treatment for bulimia nervosa: Statistical and clinical significance of symptom changes.

Science.gov (United States)

Diedrich, Alice; Schlegl, Sandra; Greetfeld, Martin; Fumi, Markus; Voderholzer, Ulrich

2018-03-01

This study examines the statistical and clinical significance of symptom changes during an intensive inpatient treatment program with a strong psychotherapeutic focus for individuals with severe bulimia nervosa. 295 consecutively admitted bulimic patients were administered the Structured Interview for Anorexic and Bulimic Syndromes-Self-Rating (SIAB-S), the Eating Disorder Inventory-2 (EDI-2), the Brief Symptom Inventory (BSI), and the Beck Depression Inventory-II (BDI-II) at treatment intake and discharge. Results indicated statistically significant symptom reductions with large effect sizes regarding severity of binge eating and compensatory behavior (SIAB-S), overall eating disorder symptom severity (EDI-2), overall psychopathology (BSI), and depressive symptom severity (BDI-II) even when controlling for antidepressant medication. The majority of patients showed either reliable (EDI-2: 33.7%, BSI: 34.8%, BDI-II: 18.1%) or even clinically significant symptom changes (EDI-2: 43.2%, BSI: 33.9%, BDI-II: 56.9%). Patients with clinically significant improvement were less distressed at intake and less likely to suffer from a comorbid borderline personality disorder when compared with those who did not improve to a clinically significant extent. Findings indicate that intensive psychotherapeutic inpatient treatment may be effective in about 75% of severely affected bulimic patients. For the remaining non-responding patients, inpatient treatment might be improved through an even stronger focus on the reduction of comorbid borderline personality traits.

Prospective pilot study of a tablet computer in an Emergency Department.

Science.gov (United States)

Horng, Steven; Goss, Foster R; Chen, Richard S; Nathanson, Larry A

2012-05-01

The recent availability of low-cost tablet computers can facilitate bedside information retrieval by clinicians. To evaluate the effect of physician tablet use in the Emergency Department. Prospective cohort study comparing physician workstation usage with and without a tablet. 55,000 visits/year Level 1 Emergency Department at a tertiary academic teaching hospital. 13 emergency physicians (7 Attendings, 4 EM3s, and 2 EM1s) worked a total of 168 scheduled shifts (130 without and 38 with tablets) during the study period. Physician use of a tablet computer while delivering direct patient care in the Emergency Department. The primary outcome measure was the time spent using the Emergency Department Information System (EDIS) at a computer workstation per shift. The secondary outcome measure was the number of EDIS logins at a computer workstation per shift. Clinician use of a tablet was associated with a 38min (17-59) decrease in time spent per shift using the EDIS at a computer workstation (pcomputer was associated with a reduction in the number of times physicians logged into a computer workstation and a reduction in the amount of time they spent there using the EDIS. The presumed benefit is that decreasing time at a computer workstation increases physician availability at the bedside. However, this association will require further investigation. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

Neutron moderation at very low temperatures (1691)

International Nuclear Information System (INIS)

Lacaze, A.

1961-04-01

Starting from Harwell experiment carried out inside a low-power reactor, we intended to maintain a liquid hydrogen cell in a channel of the EL3 reactor (at Saclay) whose thermal neutrons flux is 10 14 neutrons/cm 2 /s. We tried to work out a device giving off an important beam of cold neutrons and able to operate in a way as automatic as possible during many consecutive day without a stop. Several circuits have already been achieved at very low temperatures but they brought out volumes and fluxes much lower than those we used this time. The difficulties we have met in carrying out such a device arose on the one hand from the very high energy release to which any kind of experiment is inevitably submitted when placed near the core of the reactor, on the other, hand from the very little room which is available in experimental channels of reactors. In such condition, it is necessary to use a moderator as effective as possible. This study is divided into three parts ; in the first part, we try to determine: a) conditions in which moderation takes place, hence the volume of the cell; b) materials likely to be used at low temperature and in pile; c) cooling system; hence we had to study fluid flow conditions at very low temperatures in very long ducts. The second part is devoted to the description of the device. The third part ventilates the results we have obtained. (author) [fr

Intelligence of very preterm or very low birthweight infants in young adulthood.

Science.gov (United States)

Weisglas-Kuperus, N; Hille, E T M; Duivenvoorden, H J; Finken, M J J; Wit, J M; van Buuren, S; van Goudoever, J B; Verloove-Vanhorick, S P

2009-05-01

To examine the effect of intrauterine and neonatal growth, prematurity and personal and environmental risk factors on intelligence in adulthood in survivors of the early neonatal intensive care era. A large geographically based cohort comprised 94% of all babies born alive in the Netherlands in 1983 with a gestational age below 32 weeks and/or a birth weight >1500 g (POPS study). Intelligence was assessed in 596 participants at 19 years of age. Intrauterine and neonatal growth were assessed at birth and 3 months of corrected age. Environmental and personal risk factors were maternal age, education of the parent, sex and origin. The mean (SD) IQ of the cohort was 97.8 (15.6). In multiple regression analysis, participants with highly educated parents had a 14.2-point higher IQ than those with less well-educated parents. A 1 SD increase in birth weight was associated with a 2.6-point higher IQ, and a 1-week increase in gestational age was associated with a 1.3-point higher IQ. Participants born to young mothers (intelligence after early (symmetric) intrauterine growth retardation was more pronounced than after later (asymmetric) intrauterine or neonatal growth retardation. These differences in mean IQ remained when participants with overt handicaps were excluded. Prematurity as well as the timing of growth retardation are important for later intelligence. Parental education, however, best predicted later intelligence in very preterm or very low birthweight infants.

Rheological Properties of Very High-Strength Portland Cement Pastes: Influence of Very Effective Superplasticizers

Directory of Open Access Journals (Sweden)

Adriano Papo

2010-01-01

Full Text Available The influence of the addition of very effective superplasticizers, that are commercially available, employed for maximising the solid loading of very high-strength Portland cement pastes, has been investigated. Cement pastes were prepared from deionized water and a commercially manufactured Portland cement (Ultracem 52.5 R. Cement and water were mixed with a vane stirrer according to ASTM Standard C305. The 0.38 to 0.44 water/cement ratio range was investigated. Three commercial superplasticizing agents produced by Ruredil S.p.a. were used. They are based on a melamine resin (Fluiment 33 M, on a modified lignosulphonate (Concretan 200 L, and on a modified polyacrylate (Ergomix 1000. Rheological tests were performed at 25°C by using the rate controlled coaxial cylinder viscometer Rotovisko-Haake 20, system M5-osc., measuring device MV2P with serrated surfaces. The tests were carried out under continuous flow conditions. The results of this study were compared with those obtained in a previous article for an ordinary Portland cement paste.

Very massive runaway stars from three-body encounters

Science.gov (United States)

Gvaramadze, Vasilii V.; Gualandris, Alessia

2011-01-01

Very massive stars preferentially reside in the cores of their parent clusters and form binary or multiple systems. We study the role of tight very massive binaries in the origin of the field population of very massive stars. We performed numerical simulations of dynamical encounters between single (massive) stars and a very massive binary with parameters similar to those of the most massive known Galactic binaries, WR 20a and NGC 3603-A1. We found that these three-body encounters could be responsible for the origin of high peculiar velocities (≥70 km s-1) observed for some very massive (≥60-70 M⊙) runaway stars in the Milky Way and the Large Magellanic Cloud (e.g. λ Cep, BD+43°3654, Sk -67°22, BI 237, 30 Dor 016), which can hardly be explained within the framework of the binary-supernova scenario. The production of high-velocity massive stars via three-body encounters is accompanied by the recoil of the binary in the opposite direction to the ejected star. We show that the relative position of the very massive binary R145 and the runaway early B-type star Sk-69°206 on the sky is consistent with the possibility that both objects were ejected from the central cluster, R136, of the star-forming region 30 Doradus via the same dynamical event - a three-body encounter.

Complexity a very short introduction

CERN Document Server

Holland, John H

2014-01-01

The importance of complexity is well-captured by Hawking's comment: "Complexity is the science of the 21st century". From the movement of flocks of birds to the Internet, environmental sustainability, and market regulation, the study and understanding of complex non-linear systems has become highly influential over the last 30 years. In this Very Short Introduction, one of the leading figures in the field, John Holland, introduces the key elements and conceptual framework of complexity. From complex physical systems such as fluid flow and the difficulties of predicting weather, to complex adaptive systems such as the highly diverse and interdependent ecosystems of rainforests, he combines simple, well-known examples - Adam Smith's pin factory, Darwin's comet orchid, and Simon's 'watchmaker' - with an account of the approaches, involving agents and urn models, taken by complexity theory. ABOUT THE SERIES: The Very Short Introductions series from Oxford University Press contains hundreds of titles in almost eve...

Isotopes a very short introduction

CERN Document Server

Ellam, Rob

2016-01-01

An isotope is a variant form of a chemical element, containing a different number of neutrons in its nucleus. Most elements exist as several isotopes. Many are stable while others are radioactive, and some may only exist fleetingly before decaying into other elements. In this Very Short Introduction, Rob Ellam explains how isotopes have proved enormously important across all the sciences and in archaeology. Radioactive isotopes may be familiar from their use in nuclear weapons, nuclear power, and in medicine, as well as in carbon dating. They have been central to establishing the age of the Earth and the origins of the solar system. Combining previous and new research, Ellam provides an overview of the nature of stable and radioactive isotopes, and considers their wide range of modern applications. ABOUT THE SERIES: The Very Short Introductions series from Oxford University Press contains hundreds of titles in almost every subject area. These pocket-sized books are the perfect way to get ahead in a new subjec...

Socioeconomic inequalities in very preterm birth rates.

Science.gov (United States)

Smith, L K; Draper, E S; Manktelow, B N; Dorling, J S; Field, D J

2007-01-01

To investigate the extent of socioeconomic inequalities in the incidence of very preterm birth over the past decade. Ecological study of all 549 618 births in the former Trent health region, UK, from 1 January 1994 to 31 December 2003. All singleton births of 22(+0) to 32(+6) weeks gestation (7 185 births) were identified from population surveys of neonatal services and stillbirths. Poisson regression was used to calculate incidence of very preterm birth (22-32 weeks) and extremely preterm birth (22-28 weeks) by year of birth and decile of deprivation (child poverty section of the Index of Multiple Deprivation). Incidence of very preterm singleton birth rose from 11.9 per 1000 births in 1994 to 13.7 per 1000 births in 2003. Those from the most deprived decile were at nearly twice the risk of very preterm birth compared with those from the least deprived decile, with 16.4 per 1000 births in the most deprived decile compared with 8.5 per 1000 births in the least deprived decile (incidence rate ratio 1.94; 95% CI (1.73 to 2.17)). This deprivation gap remained unchanged throughout the 10-year period. The magnitude of socio-economic inequalities was the same for extremely preterm births (22-28 weeks incidence rate ratio 1.94; 95% CI (1.62 to 2.32)). This large, unique dataset of very preterm births shows wide socio-economic inequalities that persist over time. These findings are likely to have consequences on the burden of long-term morbidity. Our research can assist future healthcare planning, the monitoring of socio-economic inequalities and the targeting of interventions in order to reduce this persistent deprivation gap.

Pressurized-helium breakdown at very low temperatures

Energy Technology Data Exchange (ETDEWEB)

Metas, R J

1972-06-01

An investigation of the electrical-breakdown behavior of helium at very low temperatures has been carried out to assist the design and development of superconducting power cables. At very high densities, both liquid and gaseous helium showed an enhancement in electric strength when pressurized to a few atmospheres; conditioned values of breakdown fields then varied between 30 and 45 MV/m. Breakdown processes occurring over a wide range of helium densities are discussed. 24 references.

Outer Retinal and Choroidal Evaluation in Multiple Evanescent White Dot Syndrome (MEWDS): An Enhanced Depth Imaging Optical Coherence Tomography Study.

Science.gov (United States)

Fiore, Tito; Iaccheri, Barbara; Cerquaglia, Alessio; Lupidi, Marco; Torroni, Giovanni; Fruttini, Daniela; Cagini, Carlo

2018-01-01

To perform an analysis of optical coherence tomography (OCT) abnormalities in patients with MEWDS, during the acute and recovery stages, using enhanced depth imaging-OCT (EDI-OCT). A retrospective case series of five patients with MEWDS was included. EDI-OCT imaging was evaluated to detect retinal and choroidal features. In the acute phase, focal impairment of the ellipsoid zone and external limiting membrane, hyperreflective dots in the inner choroid, and full-thickness increase of the choroidal profile were observed in the affected eye; disappearance of these findings and restoration of the choroidal thickness (p = 0.046) was appreciated in the recovery phase. No OCT abnormalities were assessed in the unaffected eye. EDI-OCT revealed transient outer retinal layer changes and inner choroidal hyperreflective dots. A transient increased thickness of the whole choroid was also identified. This might confirm a short-lasting inflammatory involvement of the whole choroidal tissue in the active phase of MEWDS.

Coupled-spin filtered MR imaging in a low field

International Nuclear Information System (INIS)

Baudouin, C.J.; Bryant, D.J.; Coutts, G.A.; Bydder, G.M.; Young, I.R.

1990-01-01

This paper investigates the use of an editing method of imaging using spin-echo sequences with differing radio-frequency (RF) pulses for lipid imaging in poor fields and to compare it with solvent-suppression methods. A technique of echo difference imaging (EDI) has been described in which two data sets are acquired: a normal spin-echo sequence (90-180) and a 90-90 spin-echo sequence. The intrinsic signal of uncoupled spins in the EDI method is one-half that of the conventional sequence, so that subtracting twice the EDI signal from the conventional signal should result in signal cancellation. With coupled spins, the application of the second 90 degrees pulse results in coherence transfer, and echo magnitude will not be one-half that of the 90-180 echo. This method of lipid imaging may be less vulnerable to field inhomogeneity than are solvent-suppression methods. Phantom and in vivo studies were performed at 0.15 T (TE = 44 msec and various TRs)

Measurement of very low alpha activity in water

International Nuclear Information System (INIS)

Crespo, M. T.; Acena, M. L.

1987-01-01

Measurement of very low levels of alpha-emitting nuclides in water needs substantial improvements. A system based on the adsorbing properties manganese dioxide eliminates the need for transporting very large volumes of water and increases the sensitivity of the measurement. (Author) 21 refs

Very high energy gamma-ray astronomy

International Nuclear Information System (INIS)

Weekes, T.C.

1989-01-01

It is apparent that very high gamma-ray astronomy, at the very end of the electromagnetic spectrum, is just at the threshold of becoming an important channel of astronomical information. The author discusses how, to fully develop, it requires telescopes with improved minimum flux sensitivity; development of techniques that characterize the nature of the primary; more overlapping observations to remove any question of the reality of the detected phenomenon; more consistency in the application of statistics among experimenters and more openness about methods used; development of models that will predict the phenomenon to be expected rather than explain what has been observed; and more accurate calibrations to determine absolute fluxes and energies

Changes in quality of life into adulthood after very preterm birth and/or very low birth weight in the Netherlands

NARCIS (Netherlands)

Lunenburg, A.; Pal, S.M. van der; Dommelen, P. van. der; Pal-de Bruin, K.M. van der; Bennebroek Gravenhorst, J.; Verrips, G.H.W.

2013-01-01

It is important to know the impact of Very Preterm (VP) birth or Very Low Birth Weight (VLBW). The purpose of this study is to evaluate changes in Health-Related Quality of Life (HRQoL) of adults born VP or with a VLBW, between age 19 and age 28. Methods The 1983 nationwide Dutch Project On Preterm

Young adults with very low birth weight: leaving the parental home and sexual relationships--Helsinki Study of Very Low Birth Weight Adults.

Science.gov (United States)

Kajantie, Eero; Hovi, Petteri; Räikkönen, Katri; Pesonen, Anu-Katriina; Heinonen, Kati; Järvenpää, Anna-Liisa; Eriksson, Johan G; Strang-Karlsson, Sonja; Andersson, Sture

2008-07-01

Although most children and adults who are born very preterm live healthy lives, they have, on average, lower cognitive scores, more internalizing behaviors, and deficits in social skills. This could well affect their transition to adulthood. We studied the tempo of first leaving the parental home and starting cohabitation with an intimate partner and sexual experience of young adults with very low birth weight (Adults, 162 very low birth weight individuals and 188 individuals who were born at term (mean age: 22.3 years [range: 18.5-27.1]) and did not have any major disability filled out a questionnaire. For analysis of their ages at events which had not occurred in all subjects, we used survival analysis (Cox regression), adjusted for gender, current height, parents' ages at the birth, maternal smoking during pregnancy, parental educational attainment, number of siblings, and parental divorce/death. During their late teens and early adulthood, these very low birth weight adults were less likely to leave the parental home and to start cohabiting with an intimate partner. In gender-stratified analyses, these hazard ratios were similar between genders, but the latter was statistically significant for women only. These very low birth weight adults were also less likely to experience sexual intercourse. This relationship was statistically significant for women but not for men; however, very low birth weight women and men both reported a smaller lifetime number of sex partners than did control subjects. Healthy young adults with very low birth weight show a delay in leaving the parental home and starting sexual activity and partnerships.

Very Long Instruction Word Processors

Indian Academy of Sciences (India)

Explicitly Parallel Instruction Computing (EPIC) is an instruction processing paradigm that has been in the spot- light due to its adoption by the next generation of Intel. Processors starting with the IA-64. The EPIC processing paradigm is an evolution of the Very Long Instruction. Word (VLIW) paradigm. This article gives an ...

Describing the association between socioeconomic inequalities and cancer survival: methodological guidelines and illustration with population-based data

Directory of Open Access Journals (Sweden)

Belot A

2018-05-01

Full Text Available Aurélien Belot,1-3 Laurent Remontet,3,4 Bernard Rachet,1 Olivier Dejardin,5,6 Hadrien Charvat,7 Simona Bara,8 Anne-Valérie Guizard,5,9 Laurent Roche,3,4 Guy Launoy,5,6 Nadine Bossard3,4 1Cancer Survival Group, Department of Non-Communicable Disease Epidemiology, Faculty of Epidemiology and Population Health, London School of Hygiene and Tropical Medicine, London, United Kingdom; 2Non-Communicable Diseases and Trauma Direction, The French Public Health Agency, Saint-Maurice, France; 3Department of Biostatistics and Bioinformatics, Hospices Civils de Lyon, Lyon, France; 4UMR 5558, Biometry and Evolutionary Biology Laboratory, Biostatistics Health Group, CNRS, University Lyon 1, Lyon, France; 5National Institute of Health and Medical Research U1086 ANTICIPE, Caen, France; 6Calvados Digestive Cancer Registry, Centre Hospitalier Universitaire, Caen, France; 7Prevention Division, Center for Public Health Sciences, National Cancer Center, Tokyo, Japan; 8Manche General Cancer Registry, Centre Hospitalier Public du Cotentin, Cherbourg-en-Cotentin, France; 9Calvados General Cancer Registry, Centre François Baclesse, Caen, France Background: Describing the relationship between socioeconomic inequalities and cancer survival is important but methodologically challenging. We propose guidelines for addressing these challenges and illustrate their implementation on French population-based data. Methods: We analyzed 17 cancers. Socioeconomic deprivation was measured by an ecological measure, the European Deprivation Index (EDI. The Excess Mortality Hazard (EMH, ie, the mortality hazard among cancer patients after accounting for other causes of death, was modeled using a flexible parametric model, allowing for nonlinear and/or time-dependent association between the EDI and the EMH. The model included a cluster-specific random effect to deal with the hierarchical structure of the data. Results: We reported the conventional age-standardized net survival (ASNS

7 CFR 51.481 - Very good internal quality.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Very good internal quality. 51.481 Section 51.481 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... quality. Very good internal quality means that the combined juice from the edible portion of a sample of...

Very special relativity.

Science.gov (United States)

Cohen, Andrew G; Glashow, Sheldon L

2006-07-14

By very special relativity (VSR) we mean descriptions of nature whose space-time symmetries are certain proper subgroups of the Poincaré group. These subgroups contain space-time translations together with at least a two-parameter subgroup of the Lorentz group isomorphic to that generated by K(x) + J(y) and K(y)- J(x). We find that VSR implies special relativity (SR) in the context of local quantum field theory or of conservation. Absent both of these added hypotheses, VSR provides a simulacrum of SR for which most of the consequences of Lorentz invariance remain wholly or essentially intact, and for which many sensitive searches for departures from Lorentz invariance must fail. Several feasible experiments are discussed for which Lorentz-violating effects in VSR may be detectable.

The Radio And Very Low Frequency (VLF) Electromagnetic ...

African Journals Online (AJOL)

The Radio And Very Low Frequency (VLF) Electromagnetic Response Of A Layered Earth Media With Variable Dielectric Permittivity. ... A radio frequency of 125 KHz and a very low frequency (VLF) of 20 KHz were used in the computations and the field parameters studied over a dimensionless induction number, B. The ...

Alkaptonuria: a very rare metabolic disorder.

Science.gov (United States)

Aquaron, Robert

2013-10-01

Alkaptonuria (AKU) is a very rare autosomal recessive disorder of tyrosine metabolism in the liver due to deficiency of homogentisate 1,2 dioxygenase (HGD) activity, resulting in the accumulation of homogentisic acid (HGA). Circulating HGA pass into various tissues through-out the body, mainly in cartilage and connective tissues, where its oxidation products polymerize and deposit as a melanin-like pigment. Gram quantities of HGA are excreted in the urine. AKU is a progressive disease and the three main features, according the chronology of appearance, are: darkening of the urine at birth, then ochronosis (blue-dark pigmentation of the connective tissue) clinically visible at around 30 yrs in the ear and eye, and finally a severe ochronotic arthropathy at around 50 yrs with spine and large joints involvements. Cardiovascular and renal complications have been described in numerous case report studies. A treatment now is available in the form of a drug nitisinone, which decreases the production of HGA. The enzymatic defect in AKU is caused by the homozygous or compound heterozygous mutations within the HGD gene. This disease has a very low prevalence (1:100,000-250,000) in most of the ethnic groups, except Slovakia and Dominican Republic, where the incidence has shown increase up to 1:19,000. This review highlights classical and recent findings on this very rare disease.

[Runoff loss of soil mineral nitrogen and its relationship with grass coverage on Loess slope land].

Science.gov (United States)

Zhang, Yali; Li, Huai'en; Zhang, Xingchang; Xiao, Bo

2006-12-01

In a simulated rainfall experiment on Loess slope land, this paper determined the rainfall, surface runoff and the effective depth of interaction (EDI) between rainfall and soil mineral nitrogen, and studied the effects of grass coverage on the EDI and the runoff loss of soil mineral nitrogen. The results showed that with the increase of EDI, soil nitrogen in deeper layers could be released into surface runoff through dissolution and desorption. The higher the grass coverage, the deeper the EDI was. Grass coverage promoted the interaction between surface runoff and surface soil. On the slope land with 60%, 80% and 100% of grass coverage, the mean content of runoff mineral nitrogen increased by 34.52%, 32.67% and 6.00%, while surface runoff decreased by 4.72%, 9.84% and 12.89%, and eroded sediment decreased by 83.55%, 87.11% and 89.01%, respectively, compared with bare slope land. The total runoff loss of soil mineral nitrogen on the lands with 60%, 80%, and 100% of grass coverage was 95.73%, 109.04%, and 84.05% of that on bare land, respectively. Grass cover had dual effects on the surface runoff of soil mineral nitrogen. On one hand, it enhanced the influx of soil mineral nitrogen to surface runoff, and on the other hand, it markedly decreased the runoff, resulting in the decrease of soil mineral nitrogen loss through runoff and sediment. These two distinct factors codetermined the total runoff loss of soil mineral nitrogen.

Determination of total vanadium and vanadium(V) in groundwater from Mt. Etna and estimate of daily intake of vanadium(V) through drinking water.

Science.gov (United States)

Arena, Giovanni; Copat, Chiara; Dimartino, Angela; Grasso, Alfina; Fallico, Roberto; Sciacca, Salvatore; Fiore, Maria; Ferrante, Margherita

2015-06-01

Vanadium(V) can be found in natural waters in the form of V(IV) and V(V) species, which have different biological properties and toxicity. The purpose of this study was to determine the concentrations of total V and V(V) in groundwater from the area of Mt. Etna and to assess the estimated daily intake (EDI) of V(V) of adults and children through drinking water. Water was sampled monthly at 21 sites in 2011. Total vanadium was determined by inductively coupled plasma-mass spectrometry (ICP-MS) and speciation by ion chromatography-ICP-MS (IC-ICP-MS). The concentration of V(V) species ranged from 62.8 to 98.9% of total V, with significantly higher concentrations in samples from the S/SW slope of Mt. Etna. The annual mean concentrations of total V exceeded the Italian legal limit of 140 μg/L at four sites on the S/SW slope. In the absence of thresholds for V(V) intake, only the Environmental Protection Agency (EPA) has calculated a reference dose. Children's EDI of V(V) at the sites with the higher V concentrations exceeded EPA thresholds (9 μg/kg/day). In particular, we found in Camporotondo, Mascalucia, Ragalna and San Pietro Clarenza sites children's EDIs of 11, 9.3, 11 and 9.9, respectively. The EDI of V(V) was significantly higher than the literature range (0.09-0.34 μg/kg/day).

Røveri af bil - forbrydelsen der ikke findes

DEFF Research Database (Denmark)

Lentz, Lene Wacher

2018-01-01

Artiklen behandler den særegne strafferetlige problematik, at røveri af bil ikke straffes som sådan, men alene som ulovlig tvang og brugstyveri. Dette skyldes en formodning om, at tyven kun vil bruge bilen, ikke tilegne sig bilen. Konsekvensen bliver en langt lavere straf for "røveri af bil", end...

Validation of the colour difference plot scoring system analysis of the 103 hexagon multifocal electroretinogram in the evaluation of hydroxychloroquine retinal toxicity.

Science.gov (United States)

Graves, Gabrielle S; Adam, Murtaza K; Stepien, Kimberly E; Han, Dennis P

2014-08-01

To evaluate sensitivity, specificity and reproducibility of colour difference plot analysis (CDPA) of 103 hexagon multifocal electroretinogram (mfERG) in detecting established hydroxychloroquine (HCQ) retinal toxicity. Twenty-three patients taking HCQ were divided into those with and without retinal toxicity and were compared with a control group without retinal disease and not taking HCQ. CDPA with two masked examiners was performed using age-corrected mfERG responses in the central ring (Rc ; 0-5.5 degrees from fixation) and paracentral ring (Rp ; 5.5-11 degrees from fixation). An abnormal ring was defined as containing any hexagons with a difference in two or more standard deviations from normal (colour blue or black). Categorical analysis (ring involvement or not) showed Rc had 83% sensitivity and 93% specificity. Rp had 89% sensitivity and 82% specificity. Requiring abnormal hexagons in both Rc and Rp yielded sensitivity and specificity of 83% and 95%, respectively. If required in only one ring, they were 89% and 80%, respectively. In this population, there was complete agreement in identifying toxicity when comparing CDPA using Rp with ring ratio analysis using R5/R4 P1 ring responses (89% sensitivity and 95% specificity). Continuous analysis of CDPA with receiver operating characteristic analysis showed optimized detection (83% sensitivity and 96% specificity) when ≥4 abnormal hexagons were present anywhere within the Rp ring outline. Intergrader agreement and reproducibility were good. Colour difference plot analysis had sensitivity and specificity that approached that of ring ratio analysis of R5/R4 P₁ responses. Ease of implementation and reproducibility are notable advantages of CDPA. © 2014 Acta Ophthalmologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.

Hydroxychloroquine screening practice patterns within a large multispecialty ophthalmic practice.

Science.gov (United States)

Au, Adrian; Parikh, Vishal; Modi, Yasha S; Ehlers, Justis P; Schachat, Andrew P; Singh, Rishi P

2015-09-01

To determine provider compliance with hydroxychloroquine screening following the revised recommendations published in 2011 by the American Academy of Ophthalmology. Evaluation of adherence to a screening protocol. Subjects were identified with hydroxychloroquine as a medication by electronic query at a large multispecialty ophthalmic practice. Patients were excluded if patients: (1) were screened by an outside physician; (2) lacked recorded height, weight, start date, or dosing; or (3) took hydroxychloroquine for malaria prophylaxis. Screening tests were stratified by ophthalmic subspecialty. Guidelines define proper screening as 1 subjective test-Humphrey visual field (HVF), and 1 objective test-spectral-domain optical coherence tomography (SD OCT), fundus autofluorescence (FAF), or multifocal electroretinography (mfERG). Adherence to guidelines was determined by categorizing practices as: (1) "appropriate"-consistent with guidelines; (2) "underscreened"-insufficient testing; or (3) "inappropriate"-no testing. The study comprised 756 patients with a mean age of 56 years undergoing 1294 screening visits. Twenty-one patients received initial screenings outside the institution. Most common screening tests employed included SD OCT (56.6%), 10-2 HVF (55.0%), and Amsler grid (40.0%). Of the 735 initial screenings, 341 (46.4%) were appropriately screened, 204 (27.8%) underscreened, and 190 (25.9%) inappropriately screened. Of those who presented solely for screening (560), 307 (54.8%) were appropriately screened, 144 (25.7%) underscreened, and 109 (19.5%) inappropriately screened. Of patients presenting for hydroxychloroquine screening, 54.8% of patients received appropriate evaluation, indicating lack of adherence to guidelines. Overall, SD OCT and 10-2 HVF were the preferred screening modalities, with FAF and mfERG less frequently ordered. Copyright © 2015 Elsevier Inc. All rights reserved.

Electroretinographic findings in transplant chorioretinopathy

Directory of Open Access Journals (Sweden)

Brian T Chan-Kai

2010-07-01

Full Text Available Brian T Chan-Kai1, Steven Yeh2, Richard G Weleber2, Peter J Francis2, Grazyna Adamus2, S Robert Witherspoon3, Andreas K Lauer11Cullen Eye Institute, Baylor College of Medicine, Houston, Texas; 2Casey Eye Institute, Oregon Health and Science University, Portland, Oregon; 3Retina Institute of Texas, Dallas, Texas, USAAim: Transplant chorioretinopathy is a rare complication following solid organ or bone ­marrow transplantation and can result in severe vision loss. This series presents electroretinogram (ERG results in patients with this condition.Methods: Patients who presented with bilateral vision loss following bone marrow or solid organ transplantation were identified. A complete ophthalmologic examination, fundus ­photography, and fluorescein angiography (FA were performed. Full-field ERG was obtained in all patients and a multifocal ERG (mfERG was obtained in two patients.Results: Four patients were identified. All patients had bilateral vision loss and displayed a characteristic pattern of mottled hyperfluorescence on FA. Three patients developed ­progressive vision loss ranging from 20/60 to hand motions whereas one retained 20/40 vision. All patients exhibited moderate to severe cone dysfunction, while the degree of rod abnormalities was varied. Two patients with severe cone dysfunction showed mild clinical changes initially, but later developed progressive vision loss and chorioretinal atrophy.Conclusion: Transplant chorioretinopathy patients undergoing ERG testing show cone ­dysfunction with a variable degree of rod dysfunction. ERG abnormalities preceded the visual acuity and clinical changes in two patients, suggesting that ERG may be a helpful predictor of the clinical course in this rare disease.Keywords: transplant, chorioretinopathy, electroretinogram, ERG, mfERG

Very Complicated, indeed! / Jürgen Rooste

Index Scriptorium Estoniae

Rooste, Jürgen, 1979-

2005-01-01

Marco Laimre ja Killu Sukmiti näitus "Very Complicated Rock'n'Roll" Kunstihoone galeriis kuni 22. V. Heli: Indrek Pinsel, Andres Lõo, Riho Sibul, Erkki-Sven Tüür, Rainer Jancis (heliinstallatsiooni seadmine)

Very low-energy hydrogen-antihydrogen scattering

International Nuclear Information System (INIS)

Armour, E.A.G.; Chamberlain, C.W.

2003-01-01

In view of current interest in the trapping of antihydrogen (H-bar) atoms at very low temperatures, we have carried out a calculation of s-wave hydrogen-antihydrogen scattering at very low energies, using the Kohn variational method, taking into account rearrangement scattering into the three channels that contain positronium in its ground state and lie closest to threshold. We find that our values for the elastic cross section are in good agreement with the values obtained by Jonsell et al. [2001 Phys. Rev. A 64 052712] using a distorted wave approximation. However, our values for the total rearrangement cross section are much larger than their values and we predict that cooling of H-bar by cold H would be considerably less efficient than was found to be the case by Jonsell et al.. (author)

'Bad boys'' Bodies

DEFF Research Database (Denmark)

Skårderud, Finn; Nygren, Pär; Edlund, Birgitta

2005-01-01

(n= 196) completed the Eating Disorders Inventory ? Child version (EDI-C). The childcare residents also completed an extended questionnaire, including questions regarding the use of anabolic?andro-genic steroids. Our main ?ndings were high scores on EDI-C symptom scales for boys in the childcare...... resident group; few differences between girls in the two samples; and a high frequency of having used anabolic?androgenic steroids among boys in care. Body-image problems among boys have hitherto been given little attention. The results call for increased efforts in describing and detecting patho...

Singularidades en ecuaciones diferenciales implícitas: aplicaciones a circuitos eléctricos

OpenAIRE

Kleiman, Diana

2015-01-01

El objetivo principal de esta tesis es aplicar resultados de la teoría de EDIs al análisis de distintos modelos de circuitos eléctricos. Dentro de estos modelos existen redes eléctricas lineales y no lineales. Para el caso de los circuitos lineales, se ha desarrollado una amplia teoría vinculada a las EDIs lineales que puede utilizarse para su estudio. En cambio, cuando se trabaja con circuitos no lineales, particularmente, en el estudio de cierto tipo de singularidades que aparecen en ellos,...

Dos novelas colombianas olvidadas

Directory of Open Access Journals (Sweden)

Eduardo García Piedrahita

1980-06-01

Full Text Available Estas dos novelas olvidadas llevan por títulos Pax de don Lorenzo Marroquín (pr. edi. 1907, y Diana Cazadora de don Clímaco Soto Borda(pr. edi. 1917, ambos bogotanos aunque de disímiles estirpes literarias; y como tales en sus obras fluyen física y verbalmente, el ambiente de su ciudad natal; espíritu hecho de zumbona crítica, individualismo cáustico y solapada parodia de usos y costumbres. Y sobre tales bases sentimentales y estilísticas debe considerárselas.

Confiabilidad de la detección de problemas de desarrollo mediante el semáforo de la prueba de Evaluación del Desarrollo Infantil: ¿es diferente un resultado amarillo de uno rojo?

OpenAIRE

Rizzoli-Córdoba, Antonio; Ortega-Ríosvelasco, Fernando; Villasís-Keever, Miguel Ángel; Pizarro-Castellanos, Mariel; Buenrostro-Márquez, Guillermo; Aceves-Villagrán, Daniel; O'Shea-Cuevas, Gabriel; Muñoz-Hernández, Onofre

2014-01-01

Introducción: La prueba Evaluación del Desarrollo Infantil (EDI) es un instrumento de tamizaje de problemas en el desarrollo diseñado y validado en México. La calificación obtenida se expresa como semáforo. Se consideran positivos tanto el resultado amarillo como el rojo, aunque se plantea una intervención diferente para cada uno. El objetivo de este trabajo fue evaluar la capacidad de la prueba EDI para discriminar entre los niños identificados con semáforo amarillo y los identificados con r...

Guia de receitas brasileiras: uma saborosa viagem pela literatura

OpenAIRE

Santos, Denísia Moraes dos

2011-01-01

Esta dissertação tem por objetivo compreender, sob o ponto de vista da Análise Dialógica do Discurso, o processo de construção dos sentidos em Guia de receitas brasileiras ─ texto premiado na primeira edição do Concurso Cultural Viagem Nestlé pela Literatura (1999). Com o tema A literatura e a vida nos 500 anos de Brasil , essa edição desafiou alunos e professores a produzir um intertexto literário-cultural, utilizando cinco obras da literatura brasileira ─ Cronistas do Descobrim...

FASTING IN COUNTRIES WHERE THE DAY IS VERY LONG OR VERY SHORT: A Study of Muslims in the Netherlands

Directory of Open Access Journals (Sweden)

Ahmad Najib Burhani

2013-07-01

Full Text Available Ramadan falls both during winter and autumn months, when the days are cool and short, and spring and summer months, when the days are long and hot. Fasting in areas where the climate is extremely hot and the day is more than twenty hours is a double hardship that can be a dangerous assault on physical condition. In contrast to that, fasting in areas where the day is very short is, to some extent, like an interval between breakfast and lunch or between lunch and dinner. This article, therefore, intends to discover how Muslims in the countries where the day is either very long or very short deal with the problem of the fasting time. This research is based on the practices of some Muslims in the Netherlands with a variety of countries of origin. This article attempts to answer the following questions: How did they manage their fasting time in the summer or when the day is very long? How did they manage their fasting time in the winter or when the day is very short? What kind of fiqh book or fatwa did they use as reference? Did they think that fasting obligation was dangerous for their health when the day was very long?   [Bulan Ramadan bisa tiba pada musim dingin dan musim gugur, ketika siang hari pendek dan sejuk, tapi Ramadan juga bisa tiba pada musim semi dan musim panas, ketika siang hari sangat panjang dan panas. Puasa di tempat yang sangat panas dan dengan panjang siang hari lebih dari dua puluh jam adalah beban yang berat dan bisa berbahaya bagi kondisi fisik pelakunya. Sebaliknya, puasa di tempat yang siang harinya sangat pendek terasa tak seperti puasa karena ia hanya seperti interval antara makan pagi dan makan siang atau antara makan siang dan makan malam. Tulisan ini didasarkan pada penelitian terhadap praktik berpuasa orang-orang Islam di Belanda dari berbagai negara asal. Pertanyaan yang ingin dijawab dalam tulisan ini adalah: Bagaimana umat Islam Belanda melaksanakan puasa pada musim panas atau ketika siang hari teramat panjang

A very special relationship

International Nuclear Information System (INIS)

Arnold, L.M.

1987-01-01

The book shows why Britain adopted postwar defence policies that entailed nuclear weapon tests, why more than half of these tests were in Australia, where and how they took place, how the two nations cooperated and what was achieved at what cost. The radiation safety standards of the time and of the present day are compared and the safety aspects of the trials are looked at from the contemporary and present day viewpoint. The book covers the five series of trials in Australia and discusses the very special relationship that existed between the United Kingdom and Australia that made them possible. (author)

THE REST-FRAME OPTICAL LUMINOSITY FUNCTION OF CLUSTER GALAXIES AT z < 0.8 AND THE ASSEMBLY OF THE CLUSTER RED SEQUENCE

International Nuclear Information System (INIS)

Rudnick, Gregory; Von der Linden, Anja; De Lucia, Gabriella; White, Simon; Pello, Roser; Aragon-Salamanca, Alfonso; Marchesini, Danilo; Clowe, Douglas; Halliday, Claire; Jablonka, Pascale; Milvang-Jensen, Bo; Poggianti, Bianca; Saglia, Roberto; Simard, Luc; Zaritsky, Dennis

2009-01-01

We present the rest-frame optical luminosity function (LF) of red-sequence galaxies in 16 clusters at 0.4 < z < 0.8 drawn from the ESO Distant Cluster Survey (EDisCS). We compare our clusters to an analogous sample from the Sloan Digital Sky Survey (SDSS) and match the EDisCS clusters to their most likely descendants. We measure all LFs down to M ∼ M * + (2.5-3.5). At z < 0.8, the bright end of the LF is consistent with passive evolution but there is a significant buildup of the faint end of the red sequence toward lower redshift. There is a weak dependence of the LF on cluster velocity dispersion for EDisCS but no such dependence for the SDSS clusters. We find tentative evidence that red-sequence galaxies brighter than a threshold magnitude are already in place, and that this threshold evolves to fainter magnitudes toward lower redshifts. We compare the EDisCS LFs with the LF of coeval red-sequence galaxies in the field and find that the bright end of the LFs agree. However, relative to the number of bright red galaxies, the field has more faint red galaxies than clusters at 0.6 < z < 0.8 but fewer at 0.4 < z < 0.6, implying differential evolution. We compare the total light in the EDisCS cluster red sequences to the total red-sequence light in our SDSS cluster sample. Clusters at 0.4 < z < 0.8 must increase their luminosity on the red sequence (and therefore stellar mass in red galaxies) by a factor of 1-3 by z = 0. The necessary processes that add mass to the red sequence in clusters predict local clusters that are overluminous as compared to those observed in the SDSS. The predicted cluster luminosities can be reconciled with observed local cluster luminosities by combining multiple previously known effects.

Very-low-frequency magnetic plasma

International Nuclear Information System (INIS)

Pendry, J.B.; O'Brien, S.

2002-01-01

We show that a set of current-carrying wires can exhibit an effective magnetic permeability at very low frequencies of a few hertz. The resonant permeability, which is negative above the resonance frequency, arises from the oscillations of the wires driven by the applied magnetic field. We show that a large, frequency-specific and tunable effective permeability can be realized for a wide range of strengths of the applied field. (author)

Bursts from the very early universe

International Nuclear Information System (INIS)

Silk, J.; Stodolsky, L.

2006-01-01

Bursts of weakly interacting particles such as neutrinos or even more weakly interacting particles such as wimps and gravitons from the very early universe would offer a much deeper 'look back time' to early epochs than is possible with photons. We consider some of the issues related to the existence of such bursts and their detectability. Characterizing the burst rate by a probability P per Hubble four-volume we find, for events in the radiation-dominated era, that the natural unit of description is the present intensity of the CMB times P. The existence of such bursts would make the observation of phenomena associated with very early times in cosmology at least conceptually possible. One might even hope to probe the transplanckian epoch if complexes more weakly interacting than the graviton can exist. Other conceivable applications include the potential detectability of the formation of 'pocket universes' in a multiverse

Very low-excitation Herbig-Haro objects

International Nuclear Information System (INIS)

Boehm, K.H.; Brugel, E.W.; Mannery, E.

1980-01-01

Spectrophotometric observations show that H-H 7 and H-H 11 belong to a class of very low-excitation Herbig-Haro objects of which H-H 47 has been the only known example. Typical properties include line flux ratios [N I] (lambda5198+lambda5200)/Hβ and [S II] lambda/6717/Hα, which are both considerably larger than 1, very strong [O I] and [C I] lines, as well as relatively faint [O II] lines. So far no shock-wave models are available for these low-excitation objects. H-H 7 and H-H 11 have electron densities which are lower by about one order of magnitude, and electron temperatures which are slightly lower than those for high-excitation objects like H-H 1 and H-H 2. H-H 11 has a filling factor of about 1, much higher than other H-H objects

Inpatient Treatment for Adolescents with Anorexia Nervosa: Clinical Significance and Predictors of Treatment Outcome.

Science.gov (United States)

Schlegl, Sandra; Diedrich, Alice; Neumayr, Christina; Fumi, Markus; Naab, Silke; Voderholzer, Ulrich

2016-05-01

This study evaluated the clinical significance as well as predictors of outcome for adolescents with severe anorexia nervosa (AN) treated in an inpatient setting. Body mass index (BMI), eating disorder (ED) symptoms [Eating Disorder Inventory-2 (EDI-2)], general psychopathology and depression were assessed in 238 patients at admission and discharge. BMI increased from 14.8 + 1.2 to 17.3 + 1.4 kg/m(2). Almost a fourth (23.6%) of the patients showed reliable changes, and 44.7% showed clinically significant changes (EDI-2). BMI change did not significantly differ between those with reliable or clinically significant change or no reliable change in EDI-2. Length of stay, depression and body dissatisfaction were negative predictors of a clinically significant change. Inpatient treatment is effective in about two thirds of adolescents with AN and should be considered when outpatient treatment fails. About one third of patients showed significant weight gain, but did not improve regarding overall ED symptomatology. Future studies should focus on treatment strategies for non-responders. Copyright © 2015 John Wiley & Sons, Ltd and Eating Disorders Association.

Early-onset restrictive eating disturbances in primary school boys and girls.

Science.gov (United States)

Kurz, Susanne; van Dyck, Zoé; Dremmel, Daniela; Munsch, Simone; Hilbert, Anja

2015-07-01

This study sought to determine the distribution of early-onset restrictive eating disturbances characteristic of the new DSM-5 diagnosis, avoidant/restrictive food intake disorder (ARFID) in middle childhood, as well as to evaluate the screening instrument, Eating Disturbances in Youth-Questionnaire (EDY-Q). A total of 1,444 8- to 13-year-old children were screened in regular schools (3rd to 6th grade) in Switzerland using the self-report measure EDY-Q, consisting of 12 items based on the DSM-5 criteria for ARFID. 46 children (3.2%) reported features of ARFID in the self-rating. Group differences were found for body mass index, with underweight children reporting features of ARFID more often than normal and overweight children. The EDY-Q revealed good psychometric properties, including adequate discriminant and convergent validity. Early-onset restrictive eating disturbances are commonly reported in middle childhood. Because of possible negative short- and long-term impact, early detection is essential. Further studies with structured interviews and parent reports are needed to confirm this study's findings.

Age at menarche and digit ratio (2D:4D): relationships with body dissatisfaction, drive for thinness, and bulimia symptoms in women.

Science.gov (United States)

Oinonen, Kirsten A; Bird, Jessica L

2012-03-01

This study examined the hypothesis that lower prenatal androgen exposure and earlier puberty are associated with more dysfunctional eating attitudes and behaviors. Relationships between both age at menarche (AAM) and 2D:4D (a marker of prenatal androgen exposure), and EDI-2-Body Dissatisfaction, EDI-2-Drive for Thinness, and EDI-2-Bulimia scores, were examined in women using correlations and regressions. Earlier menarche was associated with higher drive for thinness after controlling for BMI and negative affect, but only in women who were not exclusively heterosexual. Higher 2D:4D was associated with higher Bulimia and Body Dissatisfaction scores, but only in exclusively heterosexual women, and relationships disappeared when covariates were controlled. Later AAM and higher 2D:4D were unique predictors of higher Bulimia scores for exclusive heterosexuals when BMI was controlled. These findings suggest future research should examine sexual orientation as a mediator or moderator of prenatal and postnatal organizational hormonal effects on women's disordered eating attitudes and behaviors. Copyright © 2011 Elsevier Ltd. All rights reserved.

Embodiment Mediates the Relationship between Avoidant Attachment and Eating Disorder Psychopathology.

Science.gov (United States)

Monteleone, Alessio Maria; Castellini, Giovanni; Ricca, Valdo; Volpe, Umberto; De Riso, Francesco; Nigro, Massimiliano; Zamponi, Francesco; Mancini, Milena; Stanghellini, Giovanni; Monteleone, Palmiero; Treasure, Janet; Maj, Mario

2017-11-01

The overvaluation of body shape and weight of persons with eating disorders (EDs) is putatively explained by a disturbance in the way they experience their own body (embodiment). Moreover, attachment disorders seem to promote the use of body as source for self-definition. Therefore, we assessed the role of embodiment in the connection between attachment styles and ED psychopathology. One-hundred and thirteen ED patients and 117 healthy subjects completed the Identity and Eating Disorders (IDEA) Questionnaire, the Eating Disorder Inventory-2 (EDI-2) and the Experiences in Close Relationships Scale. Eating disorder patients displayed IDEA, EDI-2 and Experiences in Close Relationships scores significantly higher than controls. IDEA total and subtotal scores mediated entirely the influence of avoidant attachment on EDI-2 interoceptive awareness and impulsivity. These findings demonstrate a relationship between insecure attachment and disorders of identity and embodiment and point to embodiment as a possible mediator between avoidant attachment and specific ED psychopathological traits. Copyright © 2017 John Wiley & Sons, Ltd and Eating Disorders Association. Copyright © 2017 John Wiley & Sons, Ltd and Eating Disorders Association.

Food survey: levels and potential health risks of chromium, lead, zinc and copper content in fruits and vegetables consumed in Algeria.

Science.gov (United States)

Cherfi, Abdelhamid; Abdoun, Samira; Gaci, Ouardia

2014-08-01

A food survey was carried out with the aim to investigate the levels of lead (Pb), zinc (Zn), copper (Cu) and chromium (Cr) in various fruits and vegetables sold in Algeria. Concentrations (mg/kgdry wt.) in selected foodstuffs were detected within the following ranges: 4-29.49, 11.17-49, 12.33-39.33 and 3-16.33 for Cu, Zn, Pb and Cr respectively. The food ingestion rate of the selected items was investigated by self-administered questionnaires which were filled by a total of 843 people randomly recruited at the exit of markets. The potential health risk for consumers was investigated by estimating the daily intake (EDI) and the target hazard quotient (THQ) for each heavy metal. For all foodstuffs, the EDI and the THQ were below the threshold values for Cu, Zn and Cr while they exceeded the thresholds for Pb (EDI: 15.66μgPb/kg body weight/day; THQ: 4.37), indicating an obvious health risk over a life time of exposure. Copyright © 2014 Elsevier Ltd. All rights reserved.

Serial single molecule electron diffraction imaging: diffraction background of superfluid helium droplets

Science.gov (United States)

Zhang, Jie; He, Yunteng; Lei, Lei; Alghamdi, Maha; Oswalt, Andrew; Kong, Wei

2017-08-01

In an effort to solve the crystallization problem in crystallography, we have been engaged in developing a method termed "serial single molecule electron diffraction imaging" (SS-EDI). The unique features of SS-EDI are superfluid helium droplet cooling and field-induced orientation: together the two features constitute a molecular goniometer. Unfortunately, the helium atoms surrounding the sample molecule also contribute to a diffraction background. In this report, we analyze the properties of a superfluid helium droplet beam and its doping statistics, and demonstrate the feasibility of overcoming the background issue by using the velocity slip phenomenon of a pulsed droplet beam. Electron diffraction profiles and pair correlation functions of ferrocene-monomer-doped droplets and iodine-nanocluster-doped droplets are presented. The timing of the pulsed electron gun and the effective doping efficiency under different dopant pressures can both be controlled for size selection. This work clears any doubt of the effectiveness of superfluid helium droplets in SS-EDI, thereby advancing the effort in demonstrating the "proof-of-concept" one step further.

Monitoring and risk assessment of pesticides in fresh omija (Schizandra chinensis Baillon) fruit and juice.

Science.gov (United States)

Jeong, Hye Ran; Lim, Sung Jin; Cho, Jae Young

2012-02-01

Schizandra chinensis Baillon, or omija, is a fruit native to northeast Asia that is cultivated in South Korea and China. Fresh omija fruit has been used in beverages, traditional East Asian medicine and cosmetics because of its complex flavor and pharmacological effectiveness. The objective of this study was to analyze residue levels of 33 kinds of pesticides on fresh omija fruits and in omija juices produced in South Korea. A risk assessment of the pesticides in omija juice was conducted by calculating EDI and ADI. Most of the pesticide levels were below the LOD in fresh omija fruits. Among the detected compounds, the most frequently detected pesticide was ethoprophos. The EDIs of ethoprophos, pendimethalin and hexaconazole were 5.89E-03, 7.08E-04 and 4.73E-05, respectively. The percent of EDI to ADI of ethoprophos, pendimethalin and hexaconazole was 28.0%, 13.6% and 4.5%, respectively. The results of this research concluded that the detected pesticides are not harmful to human beings. Published by Elsevier Ltd.

Parallel motif extraction from very long sequences

KAUST Repository

Sahli, Majed

2013-01-01

Motifs are frequent patterns used to identify biological functionality in genomic sequences, periodicity in time series, or user trends in web logs. In contrast to a lot of existing work that focuses on collections of many short sequences, modern applications require mining of motifs in one very long sequence (i.e., in the order of several gigabytes). For this case, there exist statistical approaches that are fast but inaccurate; or combinatorial methods that are sound and complete. Unfortunately, existing combinatorial methods are serial and very slow. Consequently, they are limited to very short sequences (i.e., a few megabytes), small alphabets (typically 4 symbols for DNA sequences), and restricted types of motifs. This paper presents ACME, a combinatorial method for extracting motifs from a single very long sequence. ACME arranges the search space in contiguous blocks that take advantage of the cache hierarchy in modern architectures, and achieves almost an order of magnitude performance gain in serial execution. It also decomposes the search space in a smart way that allows scalability to thousands of processors with more than 90% speedup. ACME is the only method that: (i) scales to gigabyte-long sequences; (ii) handles large alphabets; (iii) supports interesting types of motifs with minimal additional cost; and (iv) is optimized for a variety of architectures such as multi-core systems, clusters in the cloud, and supercomputers. ACME reduces the extraction time for an exact-length query from 4 hours to 7 minutes on a typical workstation; handles 3 orders of magnitude longer sequences; and scales up to 16, 384 cores on a supercomputer. Copyright is held by the owner/author(s).

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... succinogenes] ... Length = 120 ... Query: 6 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVD...LPGVQKEDI 65 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQK...EDI Sbjct: 1 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQKEDI 60 ...

Nuclear design of a very-low-activation fusion reactor

International Nuclear Information System (INIS)

Cheng, E.T.; Hopkins, G.R.

1983-06-01

An investigation was conducted to study the nuclear design aspects of using very-low-activation materials, such as SiC, MgO, and aluminum for fusion-reactor first wall, blanket, and shield applications. In addition to the advantage of very-low radioactive inventory, it was found that the very-low-activation fusion reactor can also offer an adequate tritium-breeding ratio and substantial amount of blanket nuclear heating as a conventional-material-structured reactor does. The most-stringent design constraint found in a very-low-activation fusion reactor is the limited space available in the inboard region of a tokamak concept for shielding to protect the superconducting toroidal field coil. A reference design was developed which mitigates the constraint by adopting a removable tungsten shield design that retains the inboard dimensions and gives the same shield performance as the reference STARFIRE tokamak reactor design

Sustainable Regulation of Information Sharing with Electronic Data Interchange by a Trust-Embedded Contract

Directory of Open Access Journals (Sweden)

Guanghua Han

2017-06-01

Full Text Available This paper studies the risks in demand information sharing applications by electronic soft-orders using electronic data interchange (EDI systems in e-commerce and aims to suggest a sustainable regulation mechanism with a trust-embedded contract. In a supply chain with one retailer and one supplier, the retailer solicits private forecasted demand and places soft-orders via EDI to the supplier. To ensure abundant supply, the retailer has an incentive to inflate her soft-orders, which potentially harms the credible information sharing and sustainability of business cooperation. Normally, the degree to which the supplier relies on the retailer’s order information is specified by trust, which is evaluated according to the retailer’s reputation and supplier’s intuition in this study. Based on standard game theory, we find that both the retailer’s order and the quantity of supplier prepared materials are independent of the retailer’s forecast. Therefore, EDI based information sharing in e-commerce without a regulation mechanism leads to inefficient demand information sharing. Since both the supplier and retailer are proved to faces huge of potential profit losses due to the failure of information sharing, the commerce by EDI based information sharing is full of risk and unsustainable. Therefore, a regulation mechanism that leaded by the retailer is proposed to establish ‘win-win’ sustainable cooperation. Numerical experiments highlight the value of trust, the impact of reputation and intuition in decisions, and the effectiveness of the regulation mechanism by a cost-sharing contract.

Bursts from the very early universe

Energy Technology Data Exchange (ETDEWEB)

Silk, J. [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom); Stodolsky, L. [Max-Planck-Institut fuer Physik, Foehringer Ring 6, 80805 Munich (Germany)]. E-mail: les@mppmu.mpg.de

2006-07-27

Bursts of weakly interacting particles such as neutrinos or even more weakly interacting particles such as wimps and gravitons from the very early universe would offer a much deeper 'look back time' to early epochs than is possible with photons. We consider some of the issues related to the existence of such bursts and their detectability. Characterizing the burst rate by a probability P per Hubble four-volume we find, for events in the radiation-dominated era, that the natural unit of description is the present intensity of the CMB times P. The existence of such bursts would make the observation of pheno associated with very early times in cosmology at least conceptually possible. One might even hope to probe the transplanckian epoch if complexes more weakly interacting than the graviton can exist. Other conceivable applications include the potential detectability of the formation of 'pocket universes' in a multiverse.

A functional approach to cerebral visual impairments in very preterm/very-low-birth-weight children.

Science.gov (United States)

Geldof, Christiaan J A; van Wassenaer-Leemhuis, Aleid G; Dik, Marjolein; Kok, Joke H; Oosterlaan, Jaap

2015-08-01

Cerebral visual impairment (CVI) is a major cause of visual impairment, with very preterm birth/very low birth weight (VP/VLBW) being a major risk factor. There is no generally accepted definition of CVI. This study aims to investigate the usefulness of an empirically-based functional definition of CVI. One-hundred-five VP/VLBW children and 67 controls participated. CVI was defined after comprehensive oculomotor, visual sensory and perceptive assessment, and validated against vision problems in daily life and in terms of intellectual, behavioral, emotional and social functioning, as well as use of therapeutic services. Twenty-four per cent of the VP/VLBW children met criteria for CVI, compared to 7% of controls (P = 0.006, OR: 3.86, 95% CI: 1.40-10.70). VP/VLBW children with CVI had lower performance IQ, but not verbal IQ, than those without CVI. Visual problems in daily life were confirmed in VP/VLBW children classified with CVI. Additionally, difficulties in behavioral and social functioning were most prominent among VP/VLBW children with CVI. In VP/VLBW children, CVI defined in terms of visual function deficits is accompanied by intellectual, behavioral, and social impairments, validating our operational definition of CVI. CVI might act as a marker for developmental problems in VP/VLBW children.

Preliminary assessment of the risk linked to furan ingestion by babies consuming only ready-to-eat food.

Science.gov (United States)

Scholl, Georges; Humblet, Marie-France; Scippo, Marie-Louise; De Pauw, Edwin; Eppe, Gauthier; Saegerman, Claude

2013-01-01

The risk linked to furan ingestion has been assessed in previous papers for Belgian adults and children. The present paper focuses on infants consuming only ready-to-eat baby food. As there is no Belgian baby dietary database, the furan exposure assessment was carried out by using an Italian infant consumption database and Belgian contamination data. The estimated daily intake (EDI) was calculated according to a deterministic methodology. It involved 42 commercially available ready-to-eat baby food and 36 baby consumption records. The mean EDI was 1460 ng*(kg(bw)*day)⁻¹ which is 3.8 times higher than the 381 ng*(kg(bw)*day)⁻¹ reported for Belgian adults, and 3.5 times higher than the 419 ng*(kg(bw)*day)⁻¹ measured for Belgian children. To assess and characterise the risk for babies' exposure, the margin of exposure (MoE) was calculated. It highlighted that 74% of infants have a MoE < 1000, with a minimum of 140. However, these are only preliminary results as they were calculated from a very small dataset and the infant cytochrome P450 activity is significantly different compared with the adult's. Therefore, the risk linked to furan ingestion by babies should be assessed in a different manner. To this end, additional data regarding a baby diet as well as a better understanding of furan toxicity for babies are needed to characterise more accurately the risk for infants.

Very low energy scanning electron microscopy in nanotechnology

Czech Academy of Sciences Publication Activity Database

Müllerová, Ilona; Hovorka, Miloš; Mika, Filip; Mikmeková, Eliška; Mikmeková, Šárka; Pokorná, Zuzana; Frank, Luděk

2012-01-01

Roč. 9, 8/9 (2012), s. 695-716 ISSN 1475-7435 R&D Projects: GA MŠk OE08012; GA MŠk ED0017/01/01; GA AV ČR IAA100650902 Institutional research plan: CEZ:AV0Z20650511 Keywords : scanning electron microscopy * very low energy electrons * cathode lens * grain contrast * strain contrast * imaging of participates * dopant contrast * very low energy STEM * graphene Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.087, year: 2012

Building Very Large Neighbour-Joining Trees

DEFF Research Database (Denmark)

Simonsen, Martin; Mailund, Thomas; Pedersen, Christian Nørgaard Storm

2010-01-01

, and the NJ method in general, becomes a problem when inferring phylogenies with 10000+ taxa. In this paper we present two extentions of RapidNJ which reduce memory requirements and enable RapidNJ to infer very large phylogenetic trees efficiently. We also present an improved search heuristic for Rapid...

Management of very low-level radioactive waste

International Nuclear Information System (INIS)

Chapalain, E.; Damoy, J.; Joly, J.M.

2003-01-01

This document comprises 3 articles. The first article presents the concern of very low-level radioactive wastes generated in nuclear installations, the second article describes the management of the wastes issued from the dismantling operations of the ALS (linear accelerator of Saclay) and of the Saturn synchrotron both located in Saclay Cea's center. The last article presents the storage facility which is specifically dedicated to very low-level radioactive wastes. This storage facility, which is located at Morvilliers, near the 'Centre de l Aube' (used to store the low-, and medium-level, short-lived radioactive wastes), will receive the first packages next summer. Like the other storage facilities, it will be managed by ANDRA (national radioactive waste management agency)

Mechanical properties of very thin cover slip glass disk

Indian Academy of Sciences (India)

Unknown

Mechanical properties of very thin cover slip glass disk. A SEAL, A K DALUI, M BANERJEE, A K MUKHOPADHYAY* and K K PHANI. Central Glass and Ceramic Research Institute, Kolkata 700 032, India. Abstract. The biaxial flexural strength, Young's modulus, Vicker's microhardness and fracture toughness data for very ...

«Recetario de cocina mexicana»: edición semidiplomática y modernizada de un manuscrito inédito del siglo XIX

OpenAIRE

Susana Echeverría Echeverría

2010-01-01

Resumo: Neste trabalho apresentam-se amostras de edição semidiplomática e modernizada do texto manuscrito inédito intitulado Recetario de cocina mexicana (Mss/23133/15), ca. 1850, que se guarda na Biblioteca Nacional de España, em Madri. Para terminar, acrescenta-se um comentário linguístico sobre alguns aspectos destacáveis do recetuário. Palavras-chave: Crítica textual; edição; manuscrito; cozinha mexicana; século XIX.  Resumen: En este trabajo se presentan muestras de edición semidiplomáti...

Diseño de un modelo de supervisión para la aplicación de la prueba de Evaluación del Desarrollo Infantil en las unidades de atención primaria en México

OpenAIRE

Villasís-Keever, Miguel Ángel; Rizzoli-Córdoba, Antonio; Delgado-Ginebra, Ismael; Mares-Serratos, Blanca Berenice; Martell-Valdez, Liliana; Sánchez-Velázquez, Olivia; Reyes-Morales, Hortensia; O'Shea-Cuevas, Gabriel; Aceves-Villagrán, Daniel; Carrasco-Mendoza, Joaquín; Antillón-Ocampo, Fátima Adriana; Villagrán-Muñoz, Víctor Manuel; Halley-Castillo, Elizabeth; Baqueiro-Hernández, César Iván; Pizarro-Castellanos, Mariel

2015-01-01

Introducción: La prueba Evaluación del Desarrollo Infantil (EDI), diseñada y validada en México, se ha aplicado en las unidades de atención primaria del país. Los resultados han sido heterogéneos entre los estados en que se aplicaron las pruebas, a pesar de haber utilizado un modelo de capacitación estandarizado con la misma metodología para la aplicación. El objetivo de este trabajo fue evaluar un modelo de supervisión que permita identificar la calidad de la aplicación de la prueba EDI a ni...

NAVA: Nuevo modo de Ventilación

OpenAIRE

Martín Lorenzo, María del Carmen; Montón Giménez, Nuria; Paz Martín, Daniel

2013-01-01

La Ventilación Asistida Ajustada Neuronalmente (NAVA) es un nuevo modo de Ventilación Mecánica Asistida que utiliza la actividad eléctrica diafragmática (Edi) para el control del respirador. La Edi es registrada a través de un catéter esofágico, y representa directamente el impulso respiratorio central y, por lo tanto, la duración y la intensidad con que el paciente desea ventilar. La asistencia inspiratoria mecánica se inicia en el momento en que el centro respiratorio lo demanda, y el di...

Para uma (re)leitura das Anotações sobre as cores de Wittgenstein

OpenAIRE

Salles, João Carlos

2017-01-01

As Anotações sobre as cores não têm tido o destaque merecido, pois parecem um conjunto parcialmente amorfo e desconexo, com precária estrutura de conjunto. Isso se deve, em grande medida, ao estado da edição dos textos realizada por G. E. M. Anscombe, que despreza variantes, faz sugestões equivocadas para a datação dos manuscritos, suprime parágrafos (inclusive uma quarta parte), além de ter desfigurado a Parte II, ordenando equivocadamente esses parágrafos. Uma edição bem cuidadaé necessária...

EDI at the Jet Propulsion Laboratory Library

Science.gov (United States)

Amago, B.

1994-01-01

The JPL Library and Information Center orders and claims material elecronically whenever feasible. The NASA Aerospace Research Information Network (ARIN) is used to order books for the library collection; BIP Plus on CD-ROM is used to order office copies. Paper copies of invoices are processed when material is received. Subscriptions are ordered using the vendor's online system; monthly and annual invoices are received both in paper and electronic format (diskette of FTP). Library-developed dbase programs complement or duplicate functions available through ARIN and/or the JPL institutional accounting system.

Book Review: Leslie Holmes, Corruption: A Very Short Introduction

DEFF Research Database (Denmark)

Keremis, Anestis

2017-01-01

Book review of: Corruption. A Very Short Introduction / by Leslie Holmes. Oxford: Oxford University Press, 2015. 143pp., £7.99 (p/b), ISBN 9780199689699.......Book review of: Corruption. A Very Short Introduction / by Leslie Holmes. Oxford: Oxford University Press, 2015. 143pp., £7.99 (p/b), ISBN 9780199689699....

Research on near-surface disposal of very low level radioactive waste

International Nuclear Information System (INIS)

Wang Shaowei; Yue Huiguo; Hou Jie; Chen Haiying; Zuo Rui; Wang Jinsheng

2012-01-01

Radioactive waste disposal is one of the most sensitive environmental problems to control and solve. As the arriving of decommissioning of early period nuclear facilities in China, large amounts of very low level radioactive waste will be produced inevitably. The domestic and abroad definitions about very low level radioactive waste and its disposal were introduced, and then siting principles of near-surface disposal of very low level radioactive waste were discussed. The near- surface disposal siting methods of very low level radioactive waste were analyzed from natural and geographical conditions assessment, geological conditions analysis, hydrogeological conditions analysis, geological hazard assessment and radioactive background investigation; the near-surface disposal sites'natural barriers of very low level radioactive waste were analyzed from the crustal structure and physico-chemical characteristics, the dynamics characteristics of groundwater, the radionuclide adsorption characteristics of natural barriers and so on; the near-surface disposal sites' engineered barriers of very low level radioactive waste were analyzed from the repository design, the repository barrier materials selection and so on. Finally, the improving direction of very low level radioactive waste disposal was proposed. (authors)

Very high multiplicity hadron processes

International Nuclear Information System (INIS)

Mandzhavidze, I.; Sisakyan, A.

2000-01-01

The paper contains a description of a first attempt to understand the extremely inelastic high energy hadron collisions, when the multiplicity of produced hadrons considerably exceeds its mean value. Problems with existing model predictions are discussed. The real-time finite-temperature S-matrix theory is built to have a possibility to find model-free predictions. This allows one to include the statistical effects into consideration and build the phenomenology. The questions to experiment are formulated at the very end of the paper

Development of very large helicon plasma source

International Nuclear Information System (INIS)

Shinohara, Shunjiro; Tanikawa, Takao

2004-01-01

We have developed a very large volume, high-density helicon plasma source, 75 cm in diameter and 486 cm in axial length; full width at half maximum of the plasma density is up to ∼42 cm with good plasma uniformity along the z axis. By the use of a spiral antenna located just outside the end of the vacuum chamber through a quartz-glass window, plasma can be initiated with a very low value of radio frequency (rf) power ( 12 cm -3 is successfully produced with less than several hundred Watt; achieving excellent discharge efficiency. It is possible to control the radial density profile in this device by changing the magnetic field configurations near the antenna and/or the antenna radiation-field patterns

A Synergistic Combination of Advanced Separation and Chemical Scale Inhibitor Technologies for Efficient Use of Imparied Water As Cooling Water in Coal-based Power Plants

Energy Technology Data Exchange (ETDEWEB)

Jasbir Gill

2010-08-30

Nalco Company is partnering with Argonne National Laboratory (ANL) in this project to jointly develop advanced scale control technologies that will provide cost-effective solutions for coal-based power plants to operate recirculating cooling water systems at high cycles using impaired waters. The overall approach is to use combinations of novel membrane separations and scale inhibitor technologies that will work synergistically, with membrane separations reducing the scaling potential of the cooling water and scale inhibitors extending the safe operating range of the cooling water system. The project started on March 31, 2006 and ended in August 30, 2010. The project was a multiyear, multi-phase project with laboratory research and development as well as a small pilot-scale field demonstration. In Phase 1 (Technical Targets and Proof of Concept), the objectives were to establish quantitative technical targets and develop calcite and silica scale inhibitor chemistries for high stress conditions. Additional Phase I work included bench-scale testing to determine the feasibility of two membrane separation technologies (electrodialysis ED and electrode-ionization EDI) for scale minimization. In Phase 2 (Technology Development and Integration), the objectives were to develop additional novel scale inhibitor chemistries, develop selected separation processes, and optimize the integration of the technology components at the laboratory scale. Phase 3 (Technology Validation) validated the integrated system's performance with a pilot-scale demonstration. During Phase 1, Initial evaluations of impaired water characteristics focused on produced waters and reclaimed municipal wastewater effluents. Literature and new data were collected and evaluated. Characteristics of produced waters vary significantly from one site to another, whereas reclaimed municipal wastewater effluents have relatively more uniform characteristics. Assessment to date confirmed that calcite and silica

Very low mass stars

International Nuclear Information System (INIS)

Liebert, J.; Probst, R.G.

1987-01-01

This paper discusses several theoretical and observational topics involved in discovering and analyzing very low mass stellar objects below about 0.3 M circle, as well as their likely extension into the substellar range. The authors hereafter refer to these two classes of objects as VLM stars and brown dwarfs, respectively; collectively, they are called VLM objects. The authors outline recent theoretical work on low-mass stellar interiors and atmospheres, the determination of the hydrogen-burning mass limit, important dynamical evidence bearing on the expected numbers of such objects, and the expectations for such objects from star-formation theory. They focus on the properties of substellar objects near the stellar mass limit. Observational techniques used to discover and analyze VLM objects are summarized

Visual search and attention in five-year-old very preterm/very low birth weight children.

Science.gov (United States)

Geldof, Christiaan J A; de Kieviet, Jorrit F; Dik, Marjolein; Kok, Joke H; van Wassenaer-Leemhuis, Aleid G; Oosterlaan, Jaap

2013-12-01

This study aimed to establish visual search performance and attention functioning in very preterm/very low birth weight (VP/VLBW) children using novel and well established measures, and to study their contribution to intellectual functioning. Visual search and attention network efficiency were assessed in 108 VP/VLBW children and 72 age matched term controls at 5.5 years corrected age. Visual search performance was investigated with a newly developed paradigm manipulating stimulus density and stimulus organization. Attention functioning was studied using the Attention Network Test (ANT). Intellectual functioning was measured by a short form of the Wechsler Preschool and Primary Scale of Intelligence. Data were analyzed using ANOVAs and multiple regression analyses. Visual search was less efficient in VP/VLBW children as compared to term controls, as indicated by increased search time (0.31 SD, p = .04) and increased error rate (0.36 SD, p = .02). In addition, VP/VLBW children demonstrated poorer executive attention as indicated by lower accuracy for the executive attention measure of the ANT (0.61 SD, p attention measures (0.13 SD, p = .42). Visual search time and error rate, and executive attention, collectively, accounted for 14% explained variance in full scale IQ (R(2) = .14, p attention. Visual attention dysfunctions contributed to intelligence, suggesting the opportunity to improve intellectual functioning by using interventions programs that may enhance attention capacities. © 2013.

Long term follow-up of health-related quality of life in young adults born very preterm or with a very low birth weight

NARCIS (Netherlands)

Verrips, Gijsbert; Brouwer, Leonoor; Vogels, Ton; Taal, Erik; Drossaert, Constance H.C.; Feeny, David; Verheijden, Marieke; Verloove-Vanhorick, Pauline

2012-01-01

Background The purpose was, first, to evaluate changes in health-related quality of life (HRQL) in a cohort of very low birth weight (VLBW; <1500 g.) or very preterm (< 32 weeks of gestation) children between ages 14 and 19, and second, to identify correlates of HRQL at age 19. Methods HRQL was

Health Behaviours during Pregnancy in Women with Very Severe Obesity

Directory of Open Access Journals (Sweden)

Nor A. Mohd-Shukri

2015-10-01

Full Text Available The health behaviours of pregnant women with very severe obesity are not known, though these women are at high risk of pregnancy complications. We carried out a prospective case-control study including 148 very severely obese (BMI >40 kg/m2 and 93 lean (BMI <25 kg/m2 pregnant women. Diet, physical activity, smoking, alcohol and folic acid consumption were assessed by questionnaire in early and late (16 and 28 weeks gestation pregnancy. Circulating levels of iron, vitamin B12 and folate and other essential trace elements and minerals were measured in a subset at each time point. The findings biochemically confirmed that very severely obese women consumed diets that were energy-rich but poor in essential micronutrients. A third of all women met physical activity recommendations for pregnancy. A third of very severely obese women and two thirds of lean women took folic acid supplements prior to pregnancy. Very severely obese women were more likely to smoke but less likely to drink alcohol than lean women (all p < 0.05. Women with very severe obesity have low self-reported intakes and circulating levels of essential micronutrients in pregnancy and few follow current recommendations for pregnancy nutrition and lifestyle. These high-risk women represent a group to target for education about health behaviours prior to and during pregnancy.

Lung Maturation: The Survival Miracle of Very Low Birth Weight Infants

Directory of Open Access Journals (Sweden)

Alan H. Jobe

2010-02-01

Full Text Available The increased survival of very preterm infants is generally attributed to improved care strategies. This review develops the thesis that the features of abnormal pregnancies responsible for very preterm deliveries also provide an explanation of why very preterm infants often survive. A normal fetus born at 24 weeks is very unlikely to survive. However, pregnancies that result in deliveries at 24 weeks are generally highly abnormal, and may have been so for prolonged periods prior to the preterm deliveries. Inflammatory or vascular developmental abnormalities resulting in very preterm birth can alter fetal development in such a way that organ system maturation is induced. This is supported clinically by the relative lack of very preterm infants with respiratory distress syndrome. Interventions such as antenatal corticosteroid treatment and postnatal surfactant treatment for infants with respiratory distress syndrome and gentle ventilation strategies maximize fetal adaptations to the abnormal fetal environment and improve outcomes.

Advances in Very High Frequency Power Conversion

DEFF Research Database (Denmark)

Kovacevic, Milovan

Resonant and quasi-resonant converters operated at frequencies above 30 MHz have attracted special attention in the last two decades. Compared to conventional converters operated at ~100 kHz, they offer significant advantages: smaller volume and weight, lower cost, and faster transient performance....... Excellent performance and small size of magnetic components and capacitors at very high frequencies, along with constant advances in performance of power semiconductor devices, suggests a sizable shift in consumer power supplies market into this area in the near future. To operate dc-dc converter power...... method provides low complexity and low gate loss simultaneously. A direct design synthesis method is provided for resonant SEPIC converters employing this technique. Most experimental prototypes were developed using low cost, commercially available power semiconductors. Due to very fast transient...

The future of very low level radioactive wastes in question

International Nuclear Information System (INIS)

Vignes, Emmanuelle

2016-01-01

After having recalled that nuclear plants produce various radioactive wastes, that the Cigeo project is the proposed solution to store these radioactive wastes, this article more particularly addresses the issue of very low level radioactive wastes which are now the main matter of concern for the IRSN as their quantity is expected to increase during the years to come (notably in relationship with nuclear reactor lifetime extension), and as present storage capacities will soon be saturated. The author first outlines that these wastes are not very dangerous but very cumbersome. Among these so-defined 'very low level' wastes, 30 to 50 per cent could be considered as harmless, but are now processed as dangerous wastes through costly processes. Various possibilities are then envisaged such as a diversification of storage options

Superconductivity a very short introduction

CERN Document Server

Blundell, Stephen

2009-01-01

Superconductivity is one of the most exciting areas of research in physics today. Outlining the history of its discovery, and the race to understand its many mysterious and counter-intuitive phenomena, this Very Short Introduction explains in accessible terms the theories that have been developed, and how they have influenced other areas of science, including the Higgs boson of particle physics and ideas about the early Universe. It is an engaging and informative accountof a fascinating scientific detective story, and an intelligible insight into some deep and beautiful ideas of physics

Radioactivity a very short introduction

CERN Document Server

Tuniz, Claudio

2012-01-01

Radioactivity: A Very Short Introduction explains radioactivity and discusses its fundamental role in nature. Radioactivity remains misunderstood and feared perhaps because nuclear radiation cannot be detected by human senses, and can undoubtedly do great harm if appropriate precautions are not taken. Radioactivity in the stars and in the Earth and its wide range of applications in biomedicine, science, industry, agriculture are described, as well as the mechanisms of nuclear fission and fusion, and the harnessing of nuclear power. The issues surrounding safety and security and the increasing concerns about nuclear terrorism are also considered.

Study and realization of pixelated APD Geiger photodetectors of very high sensitivity for Very High Energy gamma astronomy

International Nuclear Information System (INIS)

Jradi, K.

2010-07-01

Very High Energy gamma ray astronomy uses till now exclusively as detector the Photomultiplier Tube (PMT) to collect weak light flux of atmospheric showers. But an alternative is now emerging: Avalanche Photodiodes polarized in Geiger mode called 'Geiger-APD'. The PMT is a detector designed in the 70's which presents many advantages but also suffers from several drawbacks: size, weight, cost, sensitivity to magnetic field but especially difficulty to realize its pixelation in matrix. Geiger-APDs are semi-conductor devices made of PN junction integrated in a special technology to detect very low light flux, thanks to the polarization beyond the avalanche voltage. Geiger-APD presents very high photoelectron gain (∼106) strongly dependant on the polarization voltage beyond avalanche. These photodiodes present many advantages with respect to PMT, mainly as concerns miniaturization for applications based on imaging, such as the detection of Cerenkov flashes in gamma ray astronomy. In this thesis, we present the study, the design and the realization of a technological structure, based on Silicon. This structure has shown reliability to detect weak luminous flux with breakdown voltage at 12 V and dark current below 10 pA at breakdown. We also developed several models, physical and electrical, necessary to the technological optimization, as well to the development of control and readout circuits, i.e. the basis of any imaging technology. The work presented here consists in the study, the design and the realization of a matrix of high sensitivity pixels. A project of a Cerenkov telescope based on this innovative technology is also presented. (author)

Estimated intake of the sweeteners, acesulfame-K and aspartame, from soft drinks, soft drinks based on mineral waters and nectars for a group of Portuguese teenage students.

Science.gov (United States)

Lino, C M; Costa, I M; Pena, A; Ferreira, R; Cardoso, S M

2008-11-01

In a survey of levels of acesulfame-K and aspartame in soft drinks and in light nectars, the intake of these intense sweeteners was estimated for a group of teenage students. Acesulfame-K was detected in 72% of the soft drinks, with a mean concentration of 72 mg l(-1) and aspartame was found in 92% of the samples with a mean concentration of 89 mg l(-1). When data on the content of these sweeteners in soft drinks were analysed according to flavour, cola drinks had the highest mean levels for both sweeteners with 98 and 103 mg l(-1) for acesulfame-K and aspartame, respectively. For soft drinks based on mineral water, aspartame was found in 62% of the samples, with a mean concentration of 82 mg l(-1) and acesulfame-K was found in 77%, with a mean level of 48 mg l(-1). All samples of nectars contained acesulfame-K, with a mean concentration of 128 mg l(-1) and aspartame was detected in 80% of the samples with a mean concentration of 73 mg l(-1). A frequency questionnaire, designed to identify adolescents having high consumption of these drinks, was completed by a randomly selected sample of teenagers (n = 65) living in the city of Coimbra, in 2007. The estimated daily intakes (EDI) of acesulfame-K and aspartame for the average consumer were below the acceptable daily intakes (ADIs). For acesulfame-K, the EDI was 0.7 mg kg(-1) bw day(-1) for soft drinks, 0.2 mg kg(-1) bw day(-1) for soft drinks based on mineral waters, and 0.5 mg kg(-1) bw day(-1) for nectars, representing 8.0%, 2.2%, and 5.8% of the ADI, respectively. A similar situation was observed for aspartame. In this way, the EDI for soft drinks was 1.1 mg kg(-1) day(-1), representing only 2.9% of the ADI. In respect of nectars, the EDI was 0.2 mg kg(-1) bw day(-1), representing 0.5% of the ADI. Soft drinks based on mineral waters showed the lowest EDI values of 0.3 mg kg(-1) bw day(-1), accounting for 0.7% of the ADI.

Bioequivalence of a fixed-dose repaglinide/metformin combination tablet and equivalent doses of repaglinide and metformin tablets
.

Science.gov (United States)

Cho, Hea-Young; Ngo, Lien; Kim, Sang-Ki; Choi, Yoonho; Lee, Yong-Bok

2018-06-01

This study was conducted to determine whether a fixed-dose combination (FDC) tablet of repaglinide/metformin (2/500 mg) is equivalent to coadministration of equivalent doses of individual (EDI) tablets of repaglinide (2 mg) and metformin (500 mg) in healthy Korean male subjects. This study was conducted as an open-label, randomized, single-dose, two-period, two-sequence crossover design in 50 healthy Korean male subjects who received an FDC tablet or EDI tablets. Plasma concentrations of repaglinide and metformin were determined for up to 24 hours using a validated UPLC-MS/MS method. Bioequivalence was assessed according to current guidelines issued by the U.S. Food and Drug Administration (FDA) and Korean legislation. Tolerability was also evaluated throughout the study via subject interview, vital signs, and blood sampling. Point estimates (90% CIs) for AUC0-t, AUC0-∞, and Cmax based on EDI tablets were 110.07 (102.25 - 118.49), 109.90 (101.70 - 118.39), and 112.60 (101.49 - 124.85), respectively, for repaglinide. They were 95.18 (89.62 - 101.05), 95.00 (89.74 - 100.65), and 98.44 (92.72 - 104.50), respectively, for metformin. These results satisfied the bioequivalence criteria of 80.00 - 125.00% proposed by the FDA and Korean legislation. Results of pharmacokinetic analysis suggested that repaglinide and metformin in FDC tablets were bioequivalent to EDI tablets of repaglinide (2 mg) and metformin (500 mg) in healthy Korean male subjects. Both formulations appeared to be well tolerated.
.

Electric field measurements on Cluster: comparing the double-probe and electron drift techniques

Directory of Open Access Journals (Sweden)

A. I. Eriksson

2006-03-01

Full Text Available The four Cluster satellites each carry two instruments designed for measuring the electric field: a double-probe instrument (EFW and an electron drift instrument (EDI. We compare data from the two instruments in a representative sample of plasma regions. The complementary merits and weaknesses of the two techniques are illustrated. EDI operations are confined to regions of magnetic fields above 30 nT and where wave activity and keV electron fluxes are not too high, while EFW can provide data everywhere, and can go far higher in sampling frequency than EDI. On the other hand, the EDI technique is immune to variations in the low energy plasma, while EFW sometimes detects significant nongeophysical electric fields, particularly in regions with drifting plasma, with ion energy (in eV below the spacecraft potential (in volts. We show that the polar cap is a particularly intricate region for the double-probe technique, where large nongeophysical fields regularly contaminate EFW measurments of the DC electric field. We present a model explaining this in terms of enhanced cold plasma wake effects appearing when the ion flow energy is higher than the thermal energy but below the spacecraft potential multiplied by the ion charge. We suggest that these conditions, which are typical of the polar wind and occur sporadically in other regions containing a significant low energy ion population, cause a large cold plasma wake behind the spacecraft, resulting in spurious electric fields in EFW data. This interpretation is supported by an analysis of the direction of the spurious electric field, and by showing that use of active potential control alleviates the situation.

Ultracold and very cold neutron facility in KUR

International Nuclear Information System (INIS)

Kawabata, Yuji; Utsuro, Masahiko

1992-01-01

The present status of the ultracold and very cold neutron facility installed in the Kyoto University Reactor (KUR) is described in this presentation. It consists of a VCN (very cold neutrons) guide tube, a VCN bender and a supermirror neutron turbine. The guide tube extracts VCN from a liquid deuterium cold neutron source in a graphite thermal column and the neutron turbine converts VCN to UCN (ultracold neutrons). As for the utilization of the present facility, VCN radiography and an UCN gravity spectrometer are shown for the practical examples of the research with VCN and UCN. (author)

Optical coherence tomography and fundus autofluorescence findings in presumed congenital simple retinal pigment epithelium hamartoma

Directory of Open Access Journals (Sweden)

Baskaran, Prabu

2017-10-01

Full Text Available Aim: Presumed congenital simple retinal pigment epithelium hamartoma is a rare benign lesion of the macula that mimics congenital hypertrophy of the retinal pigment epithelium (RPE and combined hamartoma of the retina and the RPE; newer imaging modalities can help in diagnosis. We report three patients with presumed congenital simple RPE hamartoma, and describe the enhanced-depth imaging optical coherence tomography (EDI-OCT and fundus autofluorescence (FAF findings. Methods: Two patients were asymptomatic; one had an intraocular foreign body in addition to the hamartoma. All had a similar jet black, elevated lesion in the macula, sparing the fovea. EDI-OCT showed a characteristic hyperreflective layer with complete optical shadowing of the deeper layers; FAF showed pronounced hypoautofluorescence of the lesion. Conclusion: Multimodal imaging with FAF and EDI-OCT can help to differentiate simple RPE hamartoma from similar RPE lesions, and may serve as a useful adjunct to clinical diagnosis of this rare tumor. We present the second largest series of presumed congenital simple RPE hamartoma, and – to the best of our knowledge – the first report of FAF findings of this tumor.

Management of Patients with Graves’ Disease and Orbital Involvement: Role of Spectral Domain Optical Coherence Tomography

Directory of Open Access Journals (Sweden)

Alice Bruscolini

2018-01-01

Full Text Available Purpose. To investigate the role of choroidal thickness evaluation with spectral domain optical coherence tomography (SDOCT and enhanced depth imaging (EDI technique in the management of patients with Graves’ disease and orbitopathy (GO. Methods. Thirty-six eyes of 18 patients with GO and 36 eyes of 18 age-matched control subjects were included in this retrospective observational study. All the subjects underwent a complete ophthalmological evaluation, including clinical activity score (CAS and exophthalmometry. The SDOCT images of the choroid were obtained by EDI modality. Results. Choroidal thickness was significantly increased in GO than in control eyes (p<0.01. A significant correlation was found between choroidal thickness and CAS, proptosis, and the duration of disease (p<0.05. Conclusion. This study shows that choroidal thickness, evaluated with EDI-OCT, is significantly increased in patients with GO and correlates with the activity of the disease, proptosis, and duration of the disease. The choroidal thickening may reflect the ocular hemodynamic changes, and enhanced depth imaging optical coherence tomography may be a useful tool for the evaluation of orbital congestion and management of patients with Graves’ disease and orbital involvement.

A facile electrochemical intercalation and microwave assisted exfoliation methodology applied to screen-printed electrochemical-based sensing platforms to impart improved electroanalytical outputs.

Science.gov (United States)

Pierini, Gastón D; Foster, Christopher W; Rowley-Neale, Samuel J; Fernández, Héctor; Banks, Craig E

2018-06-12

Screen-printed electrodes (SPEs) are ubiquitous with the field of electrochemistry allowing researchers to translate sensors from the laboratory to the field. In this paper, we report an electrochemically driven intercalation process where an electrochemical reaction uses an electrolyte as a conductive medium as well as the intercalation source, which is followed by exfoliation and heating/drying via microwave irradiation, and applied to the working electrode of screen-printed electrodes/sensors (termed EDI-SPEs) for the first time. This novel methodology results in an increase of up to 85% of the sensor area (electrochemically active surface area, as evaluated using an outer-sphere redox probe). Upon further investigation, it is found that an increase in the electroactive area of the EDI-screen-printed based electrochemical sensing platforms is critically dependent upon the analyte and its associated electrochemical mechanism (i.e. adsorption vs. diffusion). Proof-of-concept for the electrochemical sensing of capsaicin, a measure of the hotness of chillies and chilli sauce, within both model aqueous solutions and a real sample (Tabasco sauce) is demonstrated in which the electroanalytical sensitivity (a plot of signal vs. concentration) is doubled when utilising EDI-SPEs over that of SPEs.

VERY SLOW SPEED AXIAL MOTION RELUCTANCE MOTOR

African Journals Online (AJOL)

Dr Obe

1984-09-01

Sep 1, 1984 ... VERY SLOW SPEED AXIAL MOTION RELUCTANCE MOTOR by. L. A. Agu ... order as that of the screw-thread motor can be obtained. LIST OF .... The n stator have equal non- magnetic spacers .... induction motor. An.

A CMOS transconductance-C filter technique for very high frequencies

NARCIS (Netherlands)

Nauta, Bram

1992-01-01

CMOS circuits for integrated analog filters at very high frequencies, based on transconductance-C integrators, are presented. First a differential transconductance element based on CMOS inverters is described. With this circuit a linear, tunable integrator for very-high-frequency integrated filters

Very low field magnetic resonance imaging

International Nuclear Information System (INIS)

Herreros, Quentin

2013-01-01

The aim of this thesis is to perform Magnetic Resonance Imaging at very low field (from 1 mT to 10 mT). A new kind of sensor called 'mixed sensor' has been used to achieve a good detectivity at low frequencies. Combining a superconducting loop and a giant magnetoresistance, those detectors have a competitive equivalent field noise compared to existing devices (Tuned coils, SQUIDs and Atomic Magnetometers). They have been combined with flux transformers to increase the coupling between the sample and the sensor. A complete study has been performed to adapt it to mixed sensors and then maximize the gain. This set has been incorporated in an existing small MRI device to test its robustness in real conditions. In parallel, several MRI sequences (GE, SE, FLASH, EPI,...) have been integrated and adapted to very low field requirements. They have been used to perform in-vivo three dimensional imaging and relaxometry studies on well known products to test their reliability. Finally, a larger setup adapted for full-head imaging has been designed and built to perform images on a larger working volume. (author) [fr

Foucault, Derrida e a História da Loucura: notas sobre uma polêmica

OpenAIRE

André de Faria Pereira Neto

1998-01-01

A publicação do livro Folie et Déraison. Histoire de la Folie à l'âge Classique (1961), de Michel Foucault, promoveu um debate entre o autor e o filósofo Jacques Derrida, durante os anos 60/70. Derrida criticou a proposta metodológica e a organização da História da Loucura, apresentadas por Foucault, no prefácio da primeira edição. Essa polêmica parece ter motivado o autor a retirar, da segunda edição, o prefácio que abria a primeira versão do livro. O objetivo deste artigo é analisar alguns ...

Inteligência Humana: Investigações e Aplicações

OpenAIRE

Candeias, Adelinda Maria; Almeida, Leandro Silva

2007-01-01

Este livro reúne contributos teóricos, empíricos e práticos em torno de uma das variáveis mais relevantes e mais polémicas no seio da psicologia – a Inteligência –, estando a sua edição na sequência da realização, na Universidade de Évora (6-8 de Outubro, 2005) do I Simpósio Internacional “Inteligência Humana: Investigação e Aplicações”. Nesta primeira edição, o Congresso reportou-se a autores de Portugal, Espanha e Brasil, devendo este espectro alargar-se nas suas futura...

Very low level radioactive material

International Nuclear Information System (INIS)

Schaller, K.H.; Linsley, G.; Elert, M.

1993-01-01

Man's environment contains naturally occurring radionuclides and doses from exposures to these radionuclides mostly cannot be avoided. Consequently, almost everything may be considered as very low level radioactive material. In practical terms, management and the selection of different routes for low level material is confined to material which was subject to industrial processing or which is under a system of radiological control. Natural radionuclides with concentrations reaching reporting or notification levels will be discussed below; nevertheless, the main body of this paper will be devoted to material, mainly of artificial origin, which is in the system involving notification, registration and licensing of practices and sources. It includes material managed in the nuclear sector and sources containing artificially produced radionuclides used in hospitals, and in industry. Radioactive materials emit ionising radiations which are harmful to man and his environment. National and international regulations provide the frame for the system of radiation protection. Nevertheless, concentrations, quantities or types of radionuclide may be such, that the material presents a very low hazard, and may therefore be removed from regulatory control, as it would be a waste of time and effort to continue supervision. These materials are said to be exempted from regulatory control. Material exempted in a particular country is no longer distinguishable from ''ordinary'' material and may be moved from country to country. Unfortunately, criteria for exempting radioactive materials differ strongly between countries and free trade. Therefore there is a necessity for an international approach to be developed for exemption levels

Deficits in vision and visual attention associated with motor performance of very preterm/very low birth weight children.

Science.gov (United States)

Geldof, Christiaan J A; van Hus, Janeline W P; Jeukens-Visser, Martine; Nollet, Frans; Kok, Joke H; Oosterlaan, Jaap; van Wassenaer-Leemhuis, Aleid G

2016-01-01

To extend understanding of impaired motor functioning of very preterm (VP)/very low birth weight (VLBW) children by investigating its relationship with visual attention, visual and visual-motor functioning. Motor functioning (Movement Assessment Battery for Children, MABC-2; Manual Dexterity, Aiming & Catching, and Balance component), as well as visual attention (attention network and visual search tests), vision (oculomotor, visual sensory and perceptive functioning), visual-motor integration (Beery Visual Motor Integration), and neurological status (Touwen examination) were comprehensively assessed in a sample of 106 5.5-year-old VP/VLBW children. Stepwise linear regression analyses were conducted to investigate multivariate associations between deficits in visual attention, oculomotor, visual sensory, perceptive and visual-motor integration functioning, abnormal neurological status, neonatal risk factors, and MABC-2 scores. Abnormal MABC-2 Total or component scores occurred in 23-36% of VP/VLBW children. Visual and visual-motor functioning accounted for 9-11% of variance in MABC-2 Total, Manual Dexterity and Balance scores. Visual perceptive deficits only were associated with Aiming & Catching. Abnormal neurological status accounted for an additional 19-30% of variance in MABC-2 Total, Manual Dexterity and Balance scores, and 5% of variance in Aiming & Catching, and neonatal risk factors for 3-6% of variance in MABC-2 Total, Manual Dexterity and Balance scores. Motor functioning is weakly associated with visual and visual-motor integration deficits and moderately associated with abnormal neurological status, indicating that motor performance reflects long term vulnerability following very preterm birth, and that visual deficits are of minor importance in understanding motor functioning of VP/VLBW children. Copyright © 2016 Elsevier Ltd. All rights reserved.

Sound a very short introduction

CERN Document Server

Goldsmith, Mike

2015-01-01

Sound is integral to how we experience the world, in the form of noise as well as music. But what is sound? What is the physical basis of pitch and harmony? And how are sound waves exploited in musical instruments? Sound: A Very Short Introduction looks at the science of sound and the behaviour of sound waves with their different frequencies. It also explores sound in different contexts, covering the audible and inaudible, sound underground and underwater, acoustic and electronic sound, and hearing in humans and animals. It concludes with the problem of sound out of place—noise and its reduction.

Galaxies a very short introduction

CERN Document Server

Gribbin, John

2008-01-01

Galaxies: A Very Short Introduction explores the building blocks of the Universe. Standing like islands in space, each is made up of many hundreds of millions of stars in which the chemical elements are made, around which planets form, and where on at least one of those planets intelligent life has emerged. Our own galaxy, the Milky Way, is just one of several hundred million other galaxies. Yet it was only in the 1920s that we realised that there is more to the Universe. Since then, many exciting discoveries have been made about our own galaxy and about those beyond.

Creep at very low rates

CSIR Research Space (South Africa)

Nabarro, FRN

2002-02-01

Full Text Available stream_source_info nabarro_2002.pdf.txt stream_content_type text/plain stream_size 31615 Content-Encoding ISO-8859-1 stream_name nabarro_2002.pdf.txt Content-Type text/plain; charset=ISO-8859-1 Creep at Very Low Rates F... to the necessary condition: vol. 29, p. 1285. 10. J.E. Harris, R.B. Jones, G.W. Greenwood, and M.J. Ward: J. Aust.L/b . m/2psp [5] Inst. Met., 1969, vol. 14, p. 154. 11. G.B. Gibbs: Mem. Sci. Rev. Met., 1965, vol. 62, p. 781.Even if this condition is satisfied, H...

Acoustic MIMO communications in a very shallow water channel

Science.gov (United States)

Zhou, Yuehai; Cao, Xiuling; Tong, Feng

2015-12-01

Underwater acoustic channels pose significant difficulty for the development of high speed communication due to highly limited band-width as well as hostile multipath interference. Enlightened by rapid progress of multiple input multiple output (MIMO) technologies in wireless communication scenarios, MIMO systems offer a potential solution by enabling multiple spatially parallel communication channels to improve communication performance as well as capacity. For MIMO acoustic communications, deep sea channels offer substantial spatial diversity among multiple channels that can be exploited to address simultaneous multipath and co-channel interference. At the same time, there are increasing requirements for high speed underwater communication in very shallow water area (for example, a depth less than 10 m). In this paper, a space-time multichannel adaptive receiver consisting of multiple decision feedback equalizers (DFE) is adopted as the receiver for a very shallow water MIMO acoustic communication system. The performance of multichannel DFE receivers with relatively small number of receiving elements are analyzed and compared with that of the multichannel time reversal receiver to evaluate the impact of limited spatial diversity on multi-channel equalization and time reversal processing. The results of sea trials in a very shallow water channel are presented to demonstrate the feasibility of very shallow water MIMO acoustic communication.

An overview of PCI in the very elderly

Science.gov (United States)

Shanmugam, Vimalraj Bogana; Harper, Richard; Meredith, Ian; Malaiapan, Yuvaraj; Psaltis, Peter J

2015-01-01

Cardiovascular disease, and in particular ischemic heart disease (IHD), is a major cause of morbidity and mortality in the very elderly (> 80 years) worldwide. These patients represent a rapidly growing cohort presenting for percutaneous coronary intervention (PCI), now constituting more than one in five patients treated with PCI in real-world practice. Furthermore, they often have greater ischemic burden than their younger counterparts, suggesting that they have greater scope of benefit from coronary revascularization therapy. Despite this, the very elderly are frequently under-represented in clinical revascularization trials and historically there has been a degree of physician reluctance in referring them for PCI procedures, with perceptions of disappointing outcomes, low success and high complication rates. Several issues have contributed to this, including the tendency for older patients with IHD to present late, with atypical symptoms or non-diagnostic ECGs, and reservations regarding their procedural risk-to-benefit ratio, due to shorter life expectancy, presence of comorbidities and increased bleeding risk from antiplatelet and anticoagulation medications. However, advances in PCI technology and techniques over the past decade have led to better outcomes and lower risk of complications and the existing body of evidence now indicates that the very elderly actually derive more relative benefit from PCI than younger populations. Importantly, this applies to all PCI settings: elective, urgent and emergency. This review discusses the role of PCI in the very elderly presenting with chronic stable IHD, non ST-elevation acute coronary syndrome, and ST-elevation myocardial infarction. It also addresses the clinical challenges met when considering PCI in this cohort and the ongoing need for research and development to further improve outcomes in these challenging patients. PMID:25870621

Transient hypothyroxinaemia associated with developmental delay in very preterm infants

NARCIS (Netherlands)

Meijer, W.J.; Verloove-Vanhorick, S.P.; Brand, R.; Brande, J.L. van den

1992-01-01

In 563 surviving very preterm (<32 weeks gestational age) and/or very low birthweight (<1500 g) infants the relationship between neonatal thyroxine concentration and psychomotor development at 2 years of age (corrected for preterm birth) was studied. A significant association was found between low

European Multicenter Study on Analytical Performance of Veris HIV-1 Assay.

Science.gov (United States)

Braun, Patrick; Delgado, Rafael; Drago, Monica; Fanti, Diana; Fleury, Hervé; Hofmann, Jörg; Izopet, Jacques; Kalus, Ulrich; Lombardi, Alessandra; Marcos, Maria Angeles; Mileto, Davide; Sauné, Karine; O'Shea, Siobhan; Pérez-Rivilla, Alfredo; Ramble, John; Trimoulet, Pascale; Vila, Jordi; Whittaker, Duncan; Artus, Alain; Rhodes, Daniel W

2017-07-01

The analytical performance of the Veris HIV-1 assay for use on the new, fully automated Beckman Coulter DxN Veris molecular diagnostics system was evaluated at 10 European virology laboratories. The precision, analytical sensitivity, performance with negative samples, linearity, and performance with HIV-1 groups/subtypes were evaluated. The precision for the 1-ml assay showed a standard deviation (SD) of 0.14 log 10 copies/ml or less and a coefficient of variation (CV) of ≤6.1% for each level tested. The 0.175-ml assay showed an SD of 0.17 log 10 copies/ml or less and a CV of ≤5.2% for each level tested. The analytical sensitivities determined by probit analysis were 19.3 copies/ml for the 1-ml assay and 126 copies/ml for the 0.175-ml assay. The performance with 1,357 negative samples demonstrated 99.2% with not detected results. Linearity using patient samples was shown from 1.54 to 6.93 log 10 copies/ml. The assay performed well, detecting and showing linearity with all HIV-1 genotypes tested. The Veris HIV-1 assay demonstrated analytical performance comparable to that of currently marketed HIV-1 assays. (DxN Veris products are Conformité Européenne [CE]-marked in vitro diagnostic products. The DxN Veris product line has not been submitted to the U.S. FDA and is not available in the U.S. market. The DxN Veris molecular diagnostics system is also known as the Veris MDx molecular diagnostics system and the Veris MDx system.). Copyright © 2017 American Society for Microbiology.

Very Good Medicine: Indigenous Humor and Laughter

Science.gov (United States)

Mala, Cynthia Lindquist

2016-01-01

Humor is not only instinctive and a basic human need, but it also is very good medicine. Laughter boosts the immune system, lowers blood pressure, reduces stress hormones, and is linked to healthy functioning organs. [This article was written with Mylo Redwater Smith.

Termination of pregnancy among very preterm births and its impact on very preterm mortality : results from ten European population-based cohorts in the MOSAIC study

NARCIS (Netherlands)

Papiernik, E.; Zeitlin, J.; Delmas, D.; Draper, E. S.; Gadzinowski, J.; Kuenzel, W.; Cuttini, M.; Di Lallo, D.; Weber, T.; Kollee, L.; Bekaert, A.; Breart, G.

Objective To study the impact of terminations of pregnancy (TOP) on very preterm mortality in Europe. Design European prospective population-based cohort study. Setting Ten regions from nine European countries participating in the MOSAIC (Models of OrganiSing Access to Intensive Care for very

Veri Madenciliğinin Finansal Kararlarda Kullanımı

Directory of Open Access Journals (Sweden)

Mehmet ÖZKAN

2014-04-01

Full Text Available Çağımız bilgi çağı olup, her türlü bilgiye sahip olmayı gerektirmektedir. Veri içinden analizler yapılarak anlamlı örüntüler çıkartıldığında pek çok kimse tarafından bilinmeyen, rakiplerin önüne geçilmesini olanak veren anlamlı bilgiler elde edilebilir. İlgili yöntemler, şirketlerin finansal göstergeleri olan finansal tablolara uygulandığında, şirketlerin finansal davranışlarına ait faydalı bilgiler elde etmek mümkün olacaktır. Veri madenciliği, finansal analiz yöntemleri olarak çok yaygın kullanılan yatay analiz, dikey analiz, eğilim yüzdeleri analizi ve oran analizinin yanında beşinci finansal analiz yöntemidir. Veri madenciliğinin söz konusu bu analiz tekniklerine göre daha üstün olmasının nedeni, çok yoğun verileri kullanabilmesi ve pek çok kimse tarafından bilinmeyen bilgileri kullanıma sunmayı amaçlamasıdır. Veri madenciliğinin uygulanmasında en önemli iki kısıt; veri madenciliği ve veri madenciliğinin uygulanacağı alan bilgisine sahip uzman bulmaktaki zorluk ile kullanılacak bilgisayar yazılım ve donanımının oldukça maliyetli olmasıdır.

Nutrient adequacy of a very low-fat vegan diet.

Science.gov (United States)

Dunn-Emke, Stacey R; Weidner, Gerdi; Pettengill, Elaine B; Marlin, Ruth O; Chi, Christine; Ornish, Dean M

2005-09-01

This study assessed the nutrient adequacy of a very low-fat vegan diet. Thirty-nine men (mean age=65 years) with early stage prostate cancer who chose the "watchful waiting" approach to disease management, were instructed by a registered dietitian and a chef on following a very low-fat (10%) vegan diet with the addition of a fortified soy protein powdered beverage. Three-day food diaries, excluding vitamin and mineral supplements, were analyzed and nutrient values were compared against Dietary Reference Intakes (DRI). Mean dietary intake met the recommended DRIs. On the basis of the Adequate Intake standard, a less than adequate intake was observed for vitamin D. This demonstrates that a very low-fat vegan diet with comprehensive nutrition education emphasizing nutrient-fortified plant foods is nutritionally adequate, with the exception of vitamin D. Vitamin D supplementation, especially for those with limited sun exposure, can help assure nutritional adequacy.

Distance and Kinematics of the Red Hypergiant VY CMa: Very Long Baseline Array and Very Large Array Astrometry

Science.gov (United States)

Zhang, B.; Reid, M. J.; Menten, K. M.; Zheng, X. W.

2012-01-01

We report astrometric results of phase-referencing very long baseline interferometry observations of 43 GHz SiO maser emission toward the red hypergiant VY Canis Majoris (VY CMa) using the Very Long Baseline Array (VLBA). We measured a trigonometric parallax of 0.83 ± 0.08 mas, corresponding to a distance of 1.20+0.13 -0.10 kpc. Compared to previous studies, the spatial distribution of SiO masers has changed dramatically, while its total extent remains similar. The internal motions of the maser spots are up to 1.4 mas yr-1, corresponding to 8 km s-1, and show a tendency for expansion. After modeling the expansion of maser spots, we derived an absolute proper motion for the central star of μ x = -2.8 ± 0.2 and μ y = 2.6 ± 0.2 mas yr-1 eastward and northward, respectively. Based on the maser distribution from the VLBA observations, and the relative position between the radio photosphere and the SiO maser emission at 43 GHz from the complementary Very Large Array observations, we estimate the absolute position of VY CMa at mean epoch 2006.53 to be αJ2000 = 07h22m58.s3259 ± 0.s0007, δJ2000 = -25°46'03farcs063 ± 0farcs010. The position and proper motion of VY CMa from the VLBA observations differ significantly with values measured by the Hipparcos satellite. These discrepancies are most likely associated with inhomogeneities and dust scattering the optical light in the circumstellar envelope. The absolute proper motion measured with VLBA suggests that VY CMa may be drifting out of the giant molecular cloud to the east of it.

DISTANCE AND KINEMATICS OF THE RED HYPERGIANT VY CMa: VERY LONG BASELINE ARRAY AND VERY LARGE ARRAY ASTROMETRY

Energy Technology Data Exchange (ETDEWEB)

Zhang, B. [Shanghai Astronomical Observatory, Chinese Academy of Sciences, Shanghai 200030 (China); Reid, M. J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Menten, K. M. [Max-Plank-Institut fuer Radioastronomie, Auf dem Huegel 69, 53121 Bonn (Germany); Zheng, X. W., E-mail: bzhang@mpifr.de [Department of Astronomy, Nanjing University, Nanjing 210093 (China)

2012-01-01

We report astrometric results of phase-referencing very long baseline interferometry observations of 43 GHz SiO maser emission toward the red hypergiant VY Canis Majoris (VY CMa) using the Very Long Baseline Array (VLBA). We measured a trigonometric parallax of 0.83 {+-} 0.08 mas, corresponding to a distance of 1.20{sup +0.13}{sub -0.10} kpc. Compared to previous studies, the spatial distribution of SiO masers has changed dramatically, while its total extent remains similar. The internal motions of the maser spots are up to 1.4 mas yr{sup -1}, corresponding to 8 km s{sup -1}, and show a tendency for expansion. After modeling the expansion of maser spots, we derived an absolute proper motion for the central star of {mu}{sub x} = -2.8 {+-} 0.2 and {mu}{sub y} = 2.6 {+-} 0.2 mas yr{sup -1} eastward and northward, respectively. Based on the maser distribution from the VLBA observations, and the relative position between the radio photosphere and the SiO maser emission at 43 GHz from the complementary Very Large Array observations, we estimate the absolute position of VY CMa at mean epoch 2006.53 to be {alpha}{sub J2000} = 07{sup h}22{sup m}58.{sup s}3259 {+-} 0.{sup s}0007, {delta}{sub J2000} = -25 Degree-Sign 46'03.''063 {+-} 0.''010. The position and proper motion of VY CMa from the VLBA observations differ significantly with values measured by the Hipparcos satellite. These discrepancies are most likely associated with inhomogeneities and dust scattering the optical light in the circumstellar envelope. The absolute proper motion measured with VLBA suggests that VY CMa may be drifting out of the giant molecular cloud to the east of it.

DISTANCE AND KINEMATICS OF THE RED HYPERGIANT VY CMa: VERY LONG BASELINE ARRAY AND VERY LARGE ARRAY ASTROMETRY

International Nuclear Information System (INIS)

Zhang, B.; Reid, M. J.; Menten, K. M.; Zheng, X. W.

2012-01-01

We report astrometric results of phase-referencing very long baseline interferometry observations of 43 GHz SiO maser emission toward the red hypergiant VY Canis Majoris (VY CMa) using the Very Long Baseline Array (VLBA). We measured a trigonometric parallax of 0.83 ± 0.08 mas, corresponding to a distance of 1.20 +0.13 –0.10 kpc. Compared to previous studies, the spatial distribution of SiO masers has changed dramatically, while its total extent remains similar. The internal motions of the maser spots are up to 1.4 mas yr –1 , corresponding to 8 km s –1 , and show a tendency for expansion. After modeling the expansion of maser spots, we derived an absolute proper motion for the central star of μ x = –2.8 ± 0.2 and μ y = 2.6 ± 0.2 mas yr –1 eastward and northward, respectively. Based on the maser distribution from the VLBA observations, and the relative position between the radio photosphere and the SiO maser emission at 43 GHz from the complementary Very Large Array observations, we estimate the absolute position of VY CMa at mean epoch 2006.53 to be α J2000 = 07 h 22 m 58. s 3259 ± 0. s 0007, δ J2000 = –25°46'03.''063 ± 0.''010. The position and proper motion of VY CMa from the VLBA observations differ significantly with values measured by the Hipparcos satellite. These discrepancies are most likely associated with inhomogeneities and dust scattering the optical light in the circumstellar envelope. The absolute proper motion measured with VLBA suggests that VY CMa may be drifting out of the giant molecular cloud to the east of it.

Frequency selectivity at very low centre frequencies

DEFF Research Database (Denmark)

Orellana, Carlos Andrés Jurado; Pedersen, Christian Sejer; Marquardt, Torsten

2010-01-01

measurements based on OAE suppression techniques and notched-noise masking data psychophysically measured for centre frequencies in the range 50-125 Hz, this study examines how individual differences in frequency selectivity, as well as in masking, may occur at very low CFs due to individual differences...

Ageing effects of polymers at very low dose-rates

International Nuclear Information System (INIS)

Chenion, J.; Armand, X.; Berthet, J.; Carlin, F.; Gaussens, G.; Le Meur, M.

1987-10-01

The equipment irradiation dose-rate into the containment is variable from 10 -6 to 10 -4 gray per second for the most exposed materials. During qualification, safety equipments are submitted in France to dose-rates around 0.28 gray per second. This study purpose is to now if a so large irradiation dose-rate increase is reasonable. Three elastomeric materials used in electrical cables, o'rings seals and connectors, are exposed to a very large dose-rates scale between 2.1.10 -4 and 1.4 gray per second, to 49 KGy dose. This work was carried out during 3.5 years. Oxygen consumption measurement of the air in contact with polymer materials, as mechanical properties measurement show that: - at very low dose-rate, oxygen consumption is maximum at the same time (1.4 year) for the three elastomeric samples. Also, mechanical properties simultaneously change with oxygen consumption. At very low dose-rate, for the low irradiation doses, oxygen consumption is at least 10 times more important that it is showed when irradiation is carried out with usual material qualification dose-rate. At very low dose-rate, oxygen consumption decreases when absorbed irradiation dose by samples increases. The polymer samples irradiation dose is not still sufficient (49 KGy) to certainly determine, for the three chosen polymer materials, the reasonable irradiation acceleration boundary during nuclear qualification tests [fr

Planets a very short introduction

CERN Document Server

Rothery, David A

2010-01-01

Planets: A Very Short Introduction demonstrates the excitement, uncertainties, and challenges faced by planetary scientists, and provides an overview of our Solar System and its origins, nature, and evolution. Terrestrial planets, giant planets, dwarf planets and various other objects such as satellites (moons), asteroids, trans-Neptunian objects, and exoplanets are discussed. Our knowledge about planets has advanced over the centuries, and has expanded at a rapidly growing rate in recent years. Controversial issues are outlined, such as What qualifies as a planet? What conditions are required for a planetary body to be potentially inhabited by life? Why does Pluto no longer have planet status? And Is there life on other planets?

Relativity a very short introduction

CERN Document Server

Stannard, F Russell

2008-01-01

Relativity: A Very Short Introduction makes the theory of relativity understandable and accessible. 100 years ago, Einstein's theory of relativity shattered the world of physics. Our comforting Newtonian ideas of space and time were replaced by bizarre and counterintuitive conclusions: if you move at high speed, time slows down, space squashes up and you get heavier; travel fast enough and you could weigh as much as a jumbo jet, be squashed thinner than a CD without feeling a thing - and live forever. And that was just the special theory. With the general theory came even stranger ideas of curved space-time, which changed our understanding of gravity and the cosmos.

Moons a very short introduction

CERN Document Server

Rothery, David A

2015-01-01

Moons: A Very Short Introduction introduces the reader to the varied and fascinating moons of our Solar System. Beginning with the early discoveries of Galileo and others, it describes their variety of mostly mythological names, and the early use of Jupiter’s moons to establish position at sea and to estimate the speed of light. It discusses the structure, formation, and profound influence of our Moon, those of the other planets, and ends with the recent discovery of moons orbiting asteroids, whilst looking forward to the possibility of discovering microbial life beyond Earth and of finding moons of exoplanets in planetary systems far beyond our own.

Magnetism a very short introduction

CERN Document Server

Blundell, Stephen J

2012-01-01

Magnetism: A Very Short Introduction explains the mysteries and importance of magnetism. For centuries magnetism has been used for various exploits: as a great healer, a navigation aid through compasses, and through motors, generators, and turbines it has given us power. Our understanding of electricity and magnetism, from the work of Galvani, Ampère, Faraday, and Tesla is explored, and how Maxwell and Faraday's work led to the unification of electricity and magnetism is explained. With a discussion of the relationship between magnetism and relativity, quantum magnetism, and its impact on computers and information storage, how magnetism has changed our fundamental understanding of the Universe is shown.

Cosmic very high-energy {gamma}-rays

Energy Technology Data Exchange (ETDEWEB)

Plaga, R. [Max-Planck-Institut fur Physik, Muenchen (Germany)

1998-12-31

The article gives a brief overview, aimed at nonspecialists, about the goals and selected recent results of the detection of very-high energy {gamma}-rays (energies above 100 GeV) with ground based detectors. The stress is on the physics questions, specially the origin of Galactic Cosmic Rays and the emission of TeV {gamma}-radiation from active galaxies. Moreover some particle-physics questions which are addressed in this area are discussed.

Scalable Newton-Krylov solver for very large power flow problems

NARCIS (Netherlands)

Idema, R.; Lahaye, D.J.P.; Vuik, C.; Van der Sluis, L.

2010-01-01

The power flow problem is generally solved by the Newton-Raphson method with a sparse direct solver for the linear system of equations in each iteration. While this works fine for small power flow problems, we will show that for very large problems the direct solver is very slow and we present

The study of very high spin states

International Nuclear Information System (INIS)

Nolan, P.J.

1992-01-01

Some examples are given of the study of very high spin states that decay by discrete line gamma-ray emission. States up to spin 70(h/2π) have been seen in superdeformed bands. In other bands with normal deformation the limit is near 50(h/2π). (Author)

The Very High Risk Prostate Cancer – a Contemporary Update

Science.gov (United States)

Mano, Roy; Eastham, James; Yossepowitch, Ofer

2017-01-01

Background Treatment of high-risk prostate cancer has evolved considerably over the past two decades, yet patients with very high-risk features may still experience poor outcome despite aggressive therapy. We review the contemporary literature focusing on current definitions, role of modern imaging and treatment alternatives in very high-risk prostate cancer. Methods We searched the MEDLINE database for all clinical trials or practice guidelines published in English between 2000 – 2016 with the following search terms: ‘prostatic neoplasms’ (MeSH Terms) AND (‘high risk’ (keyword) OR ‘locally advanced’ (keyword) OR ‘node positive’ (keyword)). Abstracts pertaining to very high-risk prostate cancer were evaluated and 40 pertinent studies served as the basis for this review. Results The term ‘very’ high-risk prostate cancer remains ill defined. The EAU and NCCN guidelines provide the only available definitions, categorizing those with clinical stage T3-4 or minimal nodal involvement as very-high risk irrespective of PSA level or biopsy Gleason score. Modern imaging with mpMRI and PET-PSMA scans plays a role in pretreatment assessment. Local definitive therapy by external beam radiation combined with androgen deprivation is supported by several randomized clinical trials whereas the role of surgery in the very high-risk setting combined with adjuvant radiation/ androgen deprivation therapy is emerging. Growing evidence suggest neoadjuvant taxane based chemotherapy in the context of a multimodal approach may be beneficial. Conclusions Men with very high-risk tumors may benefit from local definitive treatment in the setting of a multimodal regimen, offering local control and possibly cure in well selected patients. Further studies are necessary to better characterize the ‘very’ high-risk category and determine the optimal therapy for the individual patient. PMID:27618950

Very local interstellar spectra for galactic electrons, protons and helium

Energy Technology Data Exchange (ETDEWEB)

Potgieter, Marius S., E-mail: Marius.Potgieter@nwu.ac.za [Centre for Space Research, North-West University (South Africa)

2014-07-01

The local interstellar spectra (LIS) for cosmic rays at energies below ∼30 GeV/nuc are increasingly obscured from view at Earth by solar modulation, the lower the energy becomes. These charged particles encounter significant changes in the heliosphere, over an 11-year cycle, which include processes such as convection, diffusion, adiabatic energy losses and gradient, curvature and current sheet drifts. Particle drifts cause charge-sign-dependent modulation and a 22-year cycle, adding complexity to determining the respective very LIS from observations only at Earth. However, with measurements now made by the Voyager 1 spacecraft in the vicinity of the helio pause, it is possible to determine a very LIS for galactic electrons between ∼5 and ∼120 MeV. At these low energies, also galactic protons observed in the outer heliosphere had been completely obscured by the so-called anomalous component which is accelerated inside the helio sheath. Since August 2012, these anomalous cosmic rays are substantially depleted at Voyager 1 so that for cosmic ray ions, it is now possible to obtain a lower limit to their very LIS. Combining numerical modelling of solar modulation with the accurate measurements by the PAMELA mission and with Voyager observations, the lower limit of the very LIS for electrons, protons and helium and other ions can be determined from ∼5 MeV and above. These spectra are called helio pause spectra which is considered to be the lowest possible very LIS. Also, from an astrophysics point of view, the determination of what can be called a very LIS, not just an averaged galactic spectrum, is encouraging. The mentioned aspects are discussed, focusing on a comparison of recent heliospheric observations and corresponding solar modulation modelling. (author)

DHA supplementation for late onset Stargardt disease: NAT-3 study

Directory of Open Access Journals (Sweden)

Giuseppe Querques

2010-06-01

Full Text Available Giuseppe Querques1, Pascale Benlian1, Bernard Chanu2, Nicolas Leveziel1, Gabriel Coscas1, Gisele Soubrane1, Eric H Souied11Department of Ophthalmology, University of Paris XII, Centre Hospitalier Intercommunal de Creteil, 2Department of Nutrition, University of Paris XII, Hopital Henry Mondor, Creteil, FranceBackground: We analyzed the effects of a docosahexaenoic acid (DHA supplementation in patients affected with late onset Stargardt disease (STGD.Methods: DHA (840 mg/day was given to 20 STGD patients for six months. A complete ophthalmologic examination, including best-corrected visual acuity (BCVA and multifocal electroretinogram (mfERG, was performed at inclusion day 0 (D0 and at month 6 (M6.Results: Overall, no statistical differences have been observed at M6 vs D0 as regards BCVA and mfERG (P > 0.05. Mild Improvement of BCVA and improvement of mfERG was noted in seven/40 eyes of four/20 patients. In the first patient, the peak of the a wave increased from 66 nV/deg² to 75.4 nV/deg² in the right eye (RE and 24.5 nV/deg² to 49.1 nV/deg² in the left eye (LE. The peak of the b wave improved from 122 nV/deg² to 157 nV/deg² in the RE, and 102 nV/deg² to 149 nV/deg² in the LE. In the second patient peaks of the a and b waves respectively increased from 11.8 nV/deg² to 72.1 nV/deg² and 53 nV/deg² to 185 nV/deg² in the RE. In the third patient the peak of the a wave increased from 37 nV/deg² to 43 nV/deg² in the RE, and from 31 nV/deg² to 45 nV/deg² in the LE; the peak of the b wave improved from 70 nV/deg² to 89 nV/deg² in the RE, and from 101 nV/deg² to 108 nV/deg² in the LE. In the fourth patient, the peak of the a wave increased from 39 nV/deg² to 42 nV/deg² in the RE, and from 40 nV/deg² to 43 nV/deg² in the LE; the peak of the b wave improved from 86 nV/deg² to 94 nV/deg² in the RE, and from 87 nV/deg² to 107 nV/deg² in the LE.Conclusion: DHA seems to influence some functional parameters in patients affected with

Very low energy geothermics

International Nuclear Information System (INIS)

Anon.

1995-01-01

Very low energy geothermics correspond to temperatures below 30 C and has been developed to cover heating and cooling needs of recent individual houses or tertiary industries using heat pumps and low depth aquifers (<100 m). Geothermal heat pumps industry has made great strides in European Northern countries, China, Japan and the United States of America. Geothermal heat pumps are less energy consuming than air heat pumps and require less cooling fluid and maintenance. The Aquapac procedure has been developed in France in 1983 by the AFME (French Energy Control Agency), EdF and the BRGM (Geologic and Mining Research Office) to encourage the use of geothermal heat pump for domestic and sanitary water heating and to make a survey of low-depth aquifers in the whole french territory. The decay of energy costs that started in 1986 has led to a loss of interest for the Aquapac procedure, even in the tertiary industries for which the air-conditioning demand is growing up. (J.S.). 1 tab

A Very Cool Pair of Brown Dwarfs

Science.gov (United States)

2011-03-01

Observations with the European Southern Observatory's Very Large Telescope, along with two other telescopes, have shown that there is a new candidate for the coldest known star: a brown dwarf in a double system with about the same temperature as a freshly made cup of tea - hot in human terms, but extraordinarily cold for the surface of a star. This object is cool enough to begin crossing the blurred line dividing small cold stars from big hot planets. Brown dwarfs are essentially failed stars: they lack enough mass for gravity to trigger the nuclear reactions that make stars shine. The newly discovered brown dwarf, identified as CFBDSIR 1458+10B, is the dimmer member of a binary brown dwarf system located just 75 light-years from Earth [1]. The powerful X-shooter spectrograph on ESO's Very Large Telescope (VLT) was used to show that the composite object was very cool by brown dwarf standards. "We were very excited to see that this object had such a low temperature, but we couldn't have guessed that it would turn out to be a double system and have an even more interesting, even colder component," said Philippe Delorme of the Institut de planétologie et d'astrophysique de Grenoble (CNRS/Université Joseph Fourier), a co-author of the paper. CFBDSIR 1458+10 is the coolest brown dwarf binary found to date. The dimmer of the two dwarfs has now been found to have a temperature of about 100 degrees Celsius - the boiling point of water, and not much different from the temperature inside a sauna [2]. "At such temperatures we expect the brown dwarf to have properties that are different from previously known brown dwarfs and much closer to those of giant exoplanets - it could even have water clouds in its atmosphere," said Michael Liu of the University of Hawaii's Institute for Astronomy, who is lead author of the paper describing this new work. "In fact, once we start taking images of gas-giant planets around Sun-like stars in the near future, I expect that many of them

[Binge eating disorder: Links with personality and emotionality].

Science.gov (United States)

Dorard, G; Khorramian-Pour, M

2017-04-01

Our two objectives were: (1) to investigate the relationship between binge eating disorder, dimensions of personality (according to the Big Five model of Costa and McCrae) and those of emotionality in the "tripartite" model of emotions of Watson and Clark; (2) to evaluate the correspondence between the Binge Eating Scale (BES) and the Eating Disorder Inventory (EDI-2) scores. Four self-administered questionnaires were completed on a shared doc website: the EDI-2, the BES, the BFI-Fr (Big Five Inventory-French version) and the EPN-31 (Positive and Negative Emotionality Scale). The analyses were conducted in a sample of 101 participants (36 men and 65 women), aged 20-59 years (mean age=35.28±9.76) from the general population. We found that 11% of the participants had moderate to severe binge eating disorder. Among them, nearly 4% were overweight and 4% were obese. The correlations analyses indicated that binge eating disorder was associated with two dimensions of personality, the neuroticism (P=0.001) and the consciousness (P=0.010), and with the emotions of joy (P=0.008), tenderness (P=0.036), fear (P=0.011), shame (Pbinge eating disorder get higher scores on EDI-2 subscales: search for thinness (P=0.001), bulimia (Pbinge eating disorder is associated with negative affectivity both as a personality dimension and as an emotional feeling. The patterns of associations, observed with the EDI scale, seem to confirm the good convergent validity of the Binge Eating Scale. Thus, like other eating disorders, emotional functioning should be a prime target for prevention and treatment. Copyright © 2016 L’Encéphale, Paris. Published by Elsevier Masson SAS. All rights reserved.

Editorial Revista GeAS v.6 n.3 Setembro /Dezembro 2017

Directory of Open Access Journals (Sweden)

Claudia Terezinha Kniess

2017-12-01

Full Text Available É com satisfação que apresentamos a última edição do ano de 2017 da revista Gestão Ambiental e Sustentabilidade - Revista GeAS. A Revista GeAS consolida-se a cada edição como um importante meio para divulgação e discussão de trabalhos científicos que contribuem com o avanço das pesquisas na área de Gestão Ambiental e Sustentabilidade, agora com a ampliação do seu alcance por meio dos indexadores Emerging Sources Citation Index da Web of Science (ESCI e Sistema de Información Científica Redalyc - Red de Revistas Científicas de América Latina y el Caribe, España y Portugal. A revista GeAS é classificada como Qualis B2 na área de avaliação da CAPES de Administração e Qualis B3 na área de Planejamento Urbano Regional - Demografia. No ano de 2017 alcançou um número expressivo de submissões, contanto com 270 artigos recebidos. A presente edição da Revista GeAS contempla um conjunto de dez artigos selecionados por meio da avaliação por pares em sistema blind review, que abrangem temáticas de interesse no contexto acadêmico e empresarial, como também da comunidade de modo geral. Os artigos publicados nesta edição discutem temas relacionados a: sustentabilidade e gestão da imagem; ordenamento territorial; logística reversa; responsabilidade social corporativa; gestão do capital intelectual; governança de TI verde; tratamento de águas residuárias; recursos minerais; gestão da coleta seletiva de resíduos sólidos entre outros.

Novel brominated flame retardants in food composites and human milk from the Chinese Total Diet Study in 2011: Concentrations and a dietary exposure assessment.

Science.gov (United States)

Shi, Zhixiong; Zhang, Lei; Li, Jingguang; Zhao, Yunfeng; Sun, Zhiwei; Zhou, Xianqing; Wu, Yongning

2016-11-01

On the basis of the fifth Chinese total diet study (TDS) performed in 2011, the dietary exposure of the Chinese population to novel brominated flame retardants (NBFRs) was assessed. Six NBFRs were determined in 80 composite samples from four animal origin food groups and 29 pooled human milk samples. Based on gas chromatography-negative chemical ionization mass spectrometry (GC-NCI/MS) analysis, the levels of the total NBFRs ranged from human milk samples. Decabromodiphenyl ethane (DBDPE), with mean levels of 9.03ng/g lw in food composites and 8.06ng/g lw in human milk, was the most abundant compound in the total NBFRs. No obvious spatial distribution patterns in China were observed in food samples or human milk. The average estimated daily intake (EDI) of total NBFRs via food consumption for a "standard Chinese man" was 4.77ng/kg bodyweight (bw)/day, with a range of 0.681 to 18.9ng/kgbw/day. Meat and meat products were the main dietary source of NBFRs, although levels of NBFRs in aquatic food were found to be the highest among the four food groups. The average EDI of total NBFRs for nursing infants was 38.4ng/kgbw/day, with a range of 17.4 to 113ng/kgbw/day, which was approximately eight-fold higher than the EDI for adults, suggesting the heavy body burden of NBFRs on nursing infants. The levels and EDI of DBDPE in the present study were similar to or higher than those of legacy BFRs (i.e., PBDEs and HBCD) in the TDS 2007, indicating that DBDPE, as a main alternative to PBDEs, might have become the primary BFR used in China. Copyright © 2016 Elsevier Ltd. All rights reserved.

[Study on application of CPP-ACP on tooth mineralization during orthodontic treatment with fixed appliance].

Science.gov (United States)

He, Wen-dan; Liu, Ying-zhi; Xu, Yuan-yuan; Chen, Dong

2010-04-01

To determine the value of clinical application of CPP-ACP during orthodontic treatment with fixed appliance. Seventy-five subjects were divided randomly into three groups, the control group, experimental group A and experimental group B. The control group were emphasized on daily oral hygiene. Experimental group A used fluor protector every three months under the dentist's guidance. Experimental group B used Casein phosphopeptide amorphous calcium phosphate(CCP-ACP) once a day. After finishing the orthodontic treatment, photos were taken under the same condition ,then the degree of the enamel's demineralization was examined and the enamel decalcification index(EDI) was calculated. SPSS11.0 software package was used for statistical analysis. (1)The incidence of three groups' enamel decalcification declined in sequence as the control group(60%),experimental group A (36%), experimental group B (32%).(2)The incidence of the teeth's enamel calcification of three groups declined in sequence as the control group(14.7%),experimental group A (8.46%), experimental group B (7.72%), the difference between the control group and two experimental groups was significant, while no significant difference was found between the two experimental groups.(3(EDI of the control group was 0.155+/-0.023, EDI of the experimental group A was 0.082+/-0.009,while EDI of the experimental group B was 0.078+/-0.006. The difference between the control group and two experimental groups was statistically significant, while was not statistically significant between the two experimental groups. The application of fluor protector and CPP-ACP can improve the mineralization of the teeth during orthodontic treatment with fixed appliance. CPP-ACP is more convenient for the patients to use. Supported by Research Fund of Bureau of Science and Technology of Futian District Shenzhen City(Grant No.FTWS056).

Influence of mathematical and physical background of drought indices on their complementarity and drought recognition ability

Science.gov (United States)

Frank, Anna; Armenski, Tanja; Gocic, Milan; Popov, Srdjan; Popovic, Ljiljana; Trajkovic, Slavisa

2017-09-01

The aim of this study is to test how effective and physically correct are the mathematical approaches of operational indices used by relevant National Agencies across the globe. To do so, the following indices were analysed Standardized Precipitation Index (SPI) -1, 3, 6, 12 and 24, Standardized Precipitation - Evapotranspiration Index (SPEI) - 1, 3, 6, 12 and 24, Effective Drought Index (EDI) and Index of Drying Efficiency of Air (IDEA). To make regions more comparable to each other and follow the spatial development of drought SPI index was advised by World Meteorological Organisation to be used widely by official meteorological services. The SPI and SPEI are used for Drought Early Warning in the USA, National Drought Mitigation Center and NASA, and in the EU by the European Drought Centre (EDC) and in the Balkan Region by National Meteorological Agencies. The EDI Index has wide application in Asia. In this paper four different issues were investigated: 1) how the mathematical method used in a drought indicator's computation influence drought indices' (DI) comparative analyses; 2) the sensitivity of the DIs on any change of the length of observational period; 3) similarities between the DIs time series; 4) and how accurate DIs are when compared to historical drought records. Results suggest that it is necessary to apply a few crucial changes in the Drought Monitoring and Early Warning Systems: 1) reconsider use of SPI and SPEI family indices as a measure of quality of other indices; and for Drought Early Recognition Programs 2) switch to DIs with a solid physical background, such as EDI; 3) Adopt solid physics for modelling drought processes and define the physical measure of drought, e.g. EDI and IDEA indices; 4) investigate further the IDEA index, which, supported by our study as well, is valuable for simulation of a drought process.

Employee-driven Innovation in Welfare Services

Directory of Open Access Journals (Sweden)

Thomas Wihlman

2014-05-01

Full Text Available There is a growing interest in both employee-driven innovation (EDI and innovation in welfare services, but a lack of empirical studies addressing innovation from the employee perspective. Accordingly, this study was designed to contribute with well-grounded empirical knowledge, aiming to explore the barriers to and opportunities for participation in innovation experienced by employees of the Swedish welfare services. In order to reach the aim, a qualitative thematic analysis of 27 semi-structured interviews with employees in four municipalities was performed. The study identified three main themes, with a great impact on the innovative performance of the studied organizations: support, including leadership and innovation processes; development, including creativity and learning; and organizational culture, which includes attitudes and communication, all essential ingredients in EDI. Experienced barriers for innovation were unclear or non-existing innovation processes with ambiguous goals, insufficient learning, and deficient organizational slack, thus creating a tension between day-to-day work and innovation and hindering reflection and exploration. Attitudes of colleagues and lack of communication were also barriers to implementing innovation, suggesting the need for better management support for a communicative and open culture. Opportunities were found, including commitment to innovation and willingness to try new ideas, but the employees must be given the mandate and sufficient time to develop the potential that emerges from continuous learning, time for reflection, and user dialogue. The conclusion was that incremental innovations existed, but the full potential of these did not benefit the entire organization due to inadequate communication and lack of innovation processes. The study improves our understanding of how employees regard their involvement in innovation. It also discusses how to make better use of employees’ resources in

Middle-School-Age Outcomes in Children with Very Low Birthweight.

Science.gov (United States)

Taylor, H. Gerry; Klein, Nancy; Minich, Nori M.; Hack, Maureen

2000-01-01

Compared outcomes of middle-school-age children born at very low (less than 750-g) or low birthweights (750 to 1,499-g) and full-term. Found that the very-low-weight group fared less well at school age than the low weight and term groups on cognitive functioning, achievement, behavior, and academic performance. Those without neurosensory disorders…

Editorial Refas

Directory of Open Access Journals (Sweden)

Adriano Maniçoba da Silva

2017-04-01

Full Text Available Nesta edição especial, Volume 3, Número 3, publicada em abril de 2017, a Revista Fatec Zona Sul em sua primeira parceria com o Instituto Federal de São Paulo, campus Suzano, apresenta os artigos selecionados no fast track do II Congresso de Logística, IFLOG, realizado em 18 e 19 de outubro de 2016, tendo ainda, como destaque, o Editorial escrito pelo doutor Adriano Maniçoba da Silva, professor daquele instituto e membro da comissão organizadora do Congresso. Carlos Vital Giordano e Luiz Cláudio Gonçalves. Editores. É com muita satisfação que escrevo este editorial da edição especial da Revista Refas, publicação de abril de 2017. Em nome da Comissão Organizadora do Congresso, parabenizo os editores da Refas pelo resultado positivo obtido na última avaliação do Qualis Capes. Esperamos ainda contar com o apoio da revista em futuras edições do IFLOG no sentido de ampliar a divulgação das pesquisas conduzidas na área de Gestão de Produção e Operações. Quanto aos trabalhos selecionados para esta edição, verifica-se uma evolução qualitativa em relação aos artigos apresentados na primeira edição do congresso, ocorrida em 2015. Os artigos selecionados para esta edição apresentam temas diversos no âmbito da Gestão da Produção e Operações permitindo que se divulguem contribuições pontuais dos tópicos pesquisados. O impacto da armazenagem própria no custo de transporte de curta distância foi analisado por Telo, Silva e Gomes por meio de um estudo de caso em uma indústria química. Os autores verificaram que o modelo proposto teria viabilidade econômica já no primeiro ano de operação. Costa, Santana e Fernandes analisaram a gestão de estoque em uma microempresa fabricante de materiais esportivos sob a ótica da previsão da demanda. Após compararem diversos métodos de previsão, os autores sugeriram o mais aderente ao histórico da empresa. Num trabalho sobre o crescimento da demanda da cadeia

Very-cold-neutron optics and interferometry at ILL

International Nuclear Information System (INIS)

Eder, K.; Zeilinger, A.; Gruber, M.; Rasel, E.; Gaehler, R.; Mampe, W.; Drexel, W.

1994-01-01

At the vertical neutron guide from the cold source of the Institut Laue-Langevin (ILL) an optical bench with vibration isolation has been installed. The beam of very cold neutrons has a nominal wavelength of 100 A. An interferometer using three transmission phase gratings sputter-etched into quartz glass plates has been developed. Extensive experiments on the diffraction of very cold neutrons at these large area gratings with grating constants d = 2 μm and d = 1 μm were carried out. The experimental results were compared with Fresnel-Kirchhoff calculations showing agreement in great detail. A prototype interferometer with an overall length of 50 cm has been tested for λ = 105 A (ν = 38.7 m/s) neutrons. Finally we list the experiments envisaged. (author)

Very high energy emission sources beyond the Galaxy

Directory of Open Access Journals (Sweden)

Sinitsyna V.G.

2017-01-01

Full Text Available Active Galactic Nuclei (AGN are considered as potential extragalactic sources of very and ultra high energy cosmic rays. According to theoretical predictions cosmic ray acceleration can take place at the shock created by the expanding cocoons around active galactic nuclei as well as at AGN jets. The measurements of AGN TeV spectra, the variability time scale of TeV emission can provide essential information on the dynamics of AGN jets, the localization of acceleration region and an estimation of its size. SHALON observations yielded data on extragalactic sources of different AGN types in the energy range of 800 GeV–100 TeV. The data from SHALON observations are compared with those from other experiments at high and very high energies.

Very-high-temperature reactors for future use

International Nuclear Information System (INIS)

Kasten, P.R.

1988-01-01

Very-High-Temperature Reactors (VHTRs) show promise for economic generation of electricity and of high-temperature process heat. The key is the development of high-temperature materials which permit gas turbine VHTRs to generate electricity economically, at helium temperatures which can be used for fossil fuel conversion processes. 7 refs., 5 figs

Very-high-temperature reactors for future use

International Nuclear Information System (INIS)

Kasten, P.R.

1988-08-01

Very-high-temperature reactors (VHTRs) show promise for economic generation of electricity and of high-temperature process heat. The key is the development of high-temperature materials which permit gas turbine VHTRs to generate electricity economically, at reactor coolant temperatures which can be used for fossil fuel conversion processes. 7 refs., 5 figs

Copernicus a very short introduction

CERN Document Server

Gingerich, Owen

2016-01-01

Nicolaus Copernicus (1473–1543) was the astronomer whose shocking vision of a sun-centered universe turned out to be the essential blueprint for a physical understanding of celestial motions. Copernicus: A Very Short Introduction offers a fascinating portrayal of the man who launched the modern vision of the universe. It sets Copernicus in the context of a rapidly changing world, where the recent invention of printing with movable type not only made sources more readily available to him, but also fueled Martin Luther’s transformation of the religious landscape. Copernicus’s heliocentric revolution is revealed as an aesthetic achievement not dictated by observational “proofs,” but another new way of looking at the ancient cosmos.

Uma lição vinda da África do Sul: os cartéis da construção estão aumentando significativamente os custos de infraestrutura da copa do mundo FIFA 2014 no Brasil?

Directory of Open Access Journals (Sweden)

Eddie Cottle

2013-11-01

Full Text Available http://dx.doi.org/10.5007/2175-8042.2013v25n41p166 O artigo é o resultado da parceria acadêmica entre IELA / UFSC - Instituto de Estudos Latino-Americanos  e Edie Cottle, um pesquisador Sul-Africano, autor de artigos críticos sobre os impactos da Copa do Mundo da FIFA de 2010 na vida da população daquele país. A metodologia utilizada na pesquisa é a desenvolvida pelo pesquisador Edie Cottle e o estudo tem como objetivo revelar os verdadeiros custos e possíveis superfaturamentos na construção de arenas brasileiras que receberão os jogos da Copa do Mundo 2014.

E-Commerce in Ports

Directory of Open Access Journals (Sweden)

Elen Twrdy

2002-01-01

Full Text Available EDI (Electronic Data Interchange and electronic businessshould be looked upon as a natural evolution in the internationaltrade and transport cycle. One of the principal reasonsfor starting to use EDI are the heaps of documents written,shifted, handled, conected, transcribed and copied for normalbusiness and administrative transactions. EDJ and in generalelectronic business would have none of the disadvantages ofpaper documents and have already brought substantial benefitsand savings to companies that implement it.Most port community systems today still do not provide forelectronic transfer of funds or for electronic interchange of invoicesand other trade documents, for instance bills of lading.Such services are specific toe-business and they are the necessarytransport-related documents.

Investigation of very long jet chambers

Energy Technology Data Exchange (ETDEWEB)

Burckhart, H J; Va' vra, J; Zankel, K; Dudziak, U; Schaile, D; Schaile, O; Igo-Kemenes, P; Lennert, P

1986-04-01

The electrostatic properties and the performances of very long jet chambers have been investigated. Using 100 MHz FADC wave form digitisers, the tracking accuracy, the charge division and the dE/dx performance of two chambers, one with 4.5 m long tungsten wires and one with 4 m long highly resistive ''NiCoTi'' wires have been studied. The geometry of the chambers was chosen to define some of the design parameters of the jet chamber for the OPAL detector for LEP.

A very light Higgs at LEP

International Nuclear Information System (INIS)

Brown, N.

1990-01-01

If the standard Higgs particle is very light (≤50 MeV) then it will be sufficiently long lived that it could decay outside the detectors at LEP. This could give a signal of two final state leptons which are not back-to-back, with missing transverse momentum. We show that with suitable cuts this Higgs signal can be distinguished from backgrounds with a large enough rate that such a light Higgs will either be discovered or completely ruled out. (author)

Preparation of very pure active carbon

International Nuclear Information System (INIS)

Sloot, H.A. van der; Hoede, D.; Zonderhuis, J.; Meijer, C.

1980-02-01

The preparation of very pure active carbon is described. Starting from polyvinylidene chloride active carbon is prepared by carbonization in a nitrogen atmosphere, grinding, sieving and activation of the powder fraction with CO 2 at 950 0 to approximately 50% burn-off. The concentrations of trace and major elements are reduced to the ppb and ppm level, respectively. In the present set-up 100 g of carbon grains and approximately 50 g of active carbon powder can be produced weekly

Symmetric splitting of very light systems

International Nuclear Information System (INIS)

Grotowski, K.; Majka, Z.; Planeta, R.

1984-01-01

Inclusive and coincidence measurements have been performed to study symmetric products from the reactions 74--186 MeV 12 C+ 40 Ca, 141 MeV 9 Be+ 40 Ca, and 153 MeV 6 Li+ 40 Ca. The binary decay of the composite system has been verified. Energy spectra, angular distributions, and fragment correlations are presented. The total kinetic energies for the symmetric products from these very light composite systems are compared to liquid drop model calculations and fission systematics

ELDRS Characterization for a Very High Dose Mission

Science.gov (United States)

Harris, Richard D.; McClure, Steven S.; Rax, Bernard G.; Kenna, Aaron J.; Thorbourn, Dennis O.; Clark, Karla B.; Yan, Tsun-Yee

2010-01-01

Evaluation of bipolar linear parts which may have Enhanced Low Dose Rate Sensitivity (ELDRS) is problematic for missions that have very high dose radiation requirements. The accepted standards for evaluating parts that display ELDRS require testing at a very low dose rate which could be prohibitively long for very high dose missions. In this work, a methodology for ELDRS characterization of bipolar parts for mission doses up to 1 Mrad(Si) is evaluated. The procedure employs an initial dose rate of 0.01 rad(Si)/s to a total dose of 50 krad(Si) and then changes to 0.04 rad(Si)/s to a total dose of 1 Mrad(Si). This procedure appears to work well. No change in rate of degradation with dose has been observed when the dose rate is changed from 0.01 to 0.04 rad(Si)/s. This is taken as an indication that the degradation due to the higher dose rate is equivalent to that at the lower dose rate at the higher dose levels, at least for the parts studied to date. In several cases, significant parameter degradation or functional failure not observed at HDR was observed at fairly high total doses (50 to 250 krad(Si)) at LDR. This behavior calls into question the use of dose rate trend data and enhancement factors to predict LDR performance.

Altered Network Oscillations and Functional Connectivity Dynamics in Children Born Very Preterm.

Science.gov (United States)

Moiseev, Alexander; Doesburg, Sam M; Herdman, Anthony T; Ribary, Urs; Grunau, Ruth E

2015-09-01

Structural brain connections develop atypically in very preterm children, and altered functional connectivity is also evident in fMRI studies. Such alterations in brain network connectivity are associated with cognitive difficulties in this population. Little is known, however, about electrophysiological interactions among specific brain networks in children born very preterm. In the present study, we recorded magnetoencephalography while very preterm children and full-term controls performed a visual short-term memory task. Regions expressing task-dependent activity changes were identified using beamformer analysis, and inter-regional phase synchrony was calculated. Very preterm children expressed altered regional recruitment in distributed networks of brain areas, across standard physiological frequency ranges including the theta, alpha, beta and gamma bands. Reduced oscillatory synchrony was observed among task-activated brain regions in very preterm children, particularly for connections involving areas critical for executive abilities, including middle frontal gyrus. These findings suggest that inability to recruit neurophysiological activity and interactions in distributed networks including frontal regions may contribute to difficulties in cognitive development in children born very preterm.

Focused training programmes for solving growth problems of very small businesses

Directory of Open Access Journals (Sweden)

S. Perks

2008-12-01

Full Text Available Purpose and objectives: The purpose of the study is to investigate the various types of focused training programmes that should be designed for eliminating or preventing small business growth problems. To help achieve this main objective, the following secondary goals are identified : • To highlight the role and nature of entrepreneurial training. • To identify possible focused training programmes for solving very small business problems. • To determine how training programmes should be structured to target very small business growth problems. • To explore which other method(s, besides training programmes could be uitilised for solving very small black business entrepreneurs' growth problems. • To provide trainers with guidelines in designing focused training programmes for solving very small business problems. Problem investigated: South African entrepreneurs have a poor skills record, which inhibits small business growth. The needs of a business changes as the business grows, resulting in growing pains for the very small business entrepreneur. Successful entrepreneurs are not necessarily academically inclined and often learn in a more dynamic, non-linear environment, therefore various specific focused training programmes need to be designed that can assist very small business entrepreneurs in eliminating or preventing small business growth problems. Methodology: A qualitative study was done, in which an empirical survey was conducted by means of a series of in-depth interviews with ten very small black business entrepreneurs. Findings: The empirical results identified seven types of training programmes focusing on financial management computer training, operations management, people management, marketing management, management and investment management. Other training programmes indicated were stress management, time management and security management. Within each of these types of training programmes specific focus areas were

Neutron elastic scattering at very small angles

CERN Multimedia

2002-01-01

This experiment will measure neutron-proton elastic scattering at very small angles and hence very small four-momentum transfer, |t|. The range of |t| depends on the incident neutron momentum of the events but the geometrical acceptance will cover the angular range 0.025 < $\\Theta_{lab}$ < 1.9 mrad. The higher figure could be extended to 8.4 mrad by changing the geometry of the experiment in a later phase. \\\\ \\\\ The neutron beam will be highly collimated and will be derived from a 400 GeV external proton beam of up to $4 \\times 10^{10}$ protons per pulse in the SPS North Area Hall 1. The hydrogen target will be gaseous, operating at 40 atm. pressure and acts as a multiwire proportional chamber to detect the recoil protons. The forward neutron will be detected and located by interaction in a neutron vertex detector and its energy measured by a conventional steel plate calorimeter. \\\\ \\\\ The experiment will cover the angular region of nucleon-nucleon scattering which is dominated by Coulomb scattering ...

HTGR fuel behavior at very high temperature

International Nuclear Information System (INIS)

Kashimura, Satoru; Ogawa, Touru; Fukuda, Kousaku; Iwamoto, Kazumi

1986-03-01

Fuel behavior at very high temperature simulating abnormal transient of the reactor operation and accidents have been investigated on TRISO coating LEU oxide particle fuels at JAERI. The test simulating the abnormal transient was carried out by irradiation of loose coated particles above 1600 deg C. The irradiation test indicated that particle failure was principally caused by kernel migration. For simulation of the core heat-up accident, two experiments of out-of-pile heating were made. Survival temperature limits were measured and fuel performance at very high temperature were investigated by the heatings. Study on the fuel behavior under reactivity initiated accident was made by NSRR(Nuclear Safety Research Reactor) pulse irradiation, where maximum temperature was higher than 2800 deg C. It was found in the pulse irradiation experiments that the coated particles incorporated in the compacts did not so severely fail unlike the loose coated particles at ultra high temperature above 2800 deg C. In the former particles UO 2 material at the center of the kernel vaporized, leaving a spherical void. (author)

Et nationalt studie af bankrøveri

DEFF Research Database (Denmark)

Hansen, Maj; Elklit, Ask

11,1 % (n = 41) af ASD og seks måneder efter røveriet led 6,2 % (n = 23) af PTSD. Begge prævalenser var begrænset af kravet om undgåelsessymptomer (ASD uden undgåelse: 14 %, PTSD uden undgåelse: 17,8 %), men ASD diagnosen var især begrænset af kravet om dissociationssymptomer (ASD uden dissociation......: 26,7 %). Hierarkisk regressionsanalyse viste, at 51 % af variansen i PTSD sværhedsgrad blev forklaret af peritraumatisk dissociation, ASD sværhedsgrad, emotionel coping og negative tanker om egen person og evner. ASD sværhedsgrad var den stærkeste prædiktorer for PTSD sværhedsgrad og forudsagde alene...... diagnoser. Særligt ASD sværhedsgrad og negative tanker om egen person og evner synes at kunne forudsige PTSD sværhedsgrad efter bankrøveri. Det anbefales derfor, at ”Acute Stress Disorder Scale” anvendes til at screene for PTSD efter bankrøveri. Fremtidig forskning anbefales at fokusere på udvikling af...

Very light Higgs bosons in extended models at the LHC

International Nuclear Information System (INIS)

Belyaev, Alexander; Guedes, Renato; Santos, Rui; Moretti, Stefano

2010-01-01

The Large Electron-Positron (LEP) collider experiments have constrained the mass of the standard model (SM) Higgs boson to be above 114.4 GeV. This bound applies to all extensions of the SM where the coupling of a Higgs boson to the Z boson and also the Higgs decay profile do not differ much from the SM one. However, in scenarios with extended Higgs sectors, this coupling can be made very small by a suitable choice of the parameters of the model. In such cases, the lightest CP-even Higgs boson mass can in turn be made very small. Such a very light Higgs state, with a mass of the order of the Z boson one or even smaller, could have escaped detection at LEP. In this work we perform a detailed parton level study on the feasibility of the detection of such a very light Higgs particle at the Large Hadron Collider (LHC) in the production process pp→hj→τ + τ - j, where j is a resolved jet. We conclude that there are several models where such a Higgs state could be detected at the LHC with early data.

Variants of early-onset restrictive eating disturbances in middle childhood.

Science.gov (United States)

Kurz, Susanne; van Dyck, Zoé; Dremmel, Daniela; Munsch, Simone; Hilbert, Anja

2016-01-01

This study sought to determine the factor structure of the newly developed self-report screening questionnaire Eating Disturbances in Youth-Questionnaire (EDY-Q) as well as to report the distribution of variants of early-onset restrictive eating disturbances characteristic of avoidant/restrictive food intake disorder (ARFID) in a middle childhood population sample. Using the EDY-Q, a total of 1,444 children aged 8-13 years were screened in elementary schools in Switzerland via self-report. The factor analysis of the 12 items covering ARFID related symptoms was performed using a principal component analysis (PCA). The PCA showed a four factor solution, with clear allocation to the scales covering three variants of early-onset restrictive eating disturbances and weight problems. Inadequate overall food intake was reported by 19.3% of the children, a limited accepted amount of food by 26.1%, and food avoidance based on a specific underlying fear by 5.0%. The postulated factor structure of the EDY-Q was confirmed, further supporting the existence of distinct variants of early-onset restrictive eating disturbances. Avoidant/restrictive eating behavior seems to be a common experience in middle childhood, but results have to be confirmed using validated interviews. © 2015 Wiley Periodicals, Inc.

de Secundaria

Directory of Open Access Journals (Sweden)

Manuel Herrero

2005-01-01

Full Text Available Los objetivos de este estudio transversal han sido determinar la frecuencia de las actitudes y conductas autoinformadas asociadas con los trastornos de la conducta alimentaria evaluadas mediante el Inventario de Trastornos de la Conducta Alimentaria (EDI-2, comprobar si existen diferencias en esas variables en función de las variables sociodemográficas tenidas en cuenta y, por último, estimar el porcentaje de población en situación de riesgo. Se aplicó el EDI-2 a una muestra aleatoria y representativa de estudiantes de Secundaria (n = 1190 en un diseño transversal. Las medias de las subescalas de Obsesión por la Delgadez, Bulimia e Insatisfacción Corporal se enmarcan dentro del rango de lo encontrado en la literatura. Al comparar las medias de las escalas y subescalas del EDI en función de las distintas variables demográficas tenidas en cuenta se obtienen diferencias significativas sobre todo en género. Se analizan distintos criterios para determinar el porcentaje de personas en situación de riesgo de presentar y/o desarrollar un trastorno de la conducta alimentaria y se ofrecen estos resultados en función de las distintas variables demográficas consideradas en este estudio.

Physical activity, function, and longevity among the very old.

Science.gov (United States)

Stessman, Jochanan; Hammerman-Rozenberg, Robert; Cohen, Aaron; Ein-Mor, Eliana; Jacobs, Jeremy M

2009-09-14

Recommendations encouraging physical activity (PA) set no upper age limit, yet evidence supporting the benefits of PA among the very old is sparse. We examined the effects of continuing, increasing, or decreasing PA levels on survival, function, and health status among the very old. Mortality data from ages 70 to 88 years and health, comorbidity, and functional status at ages 70, 78, and 85 years were assessed through the Jerusalem Longitudinal Cohort Study (1990-2008). A representative sample of 1861 people born in 1920 and 1921 enrolled in this prospective study, resulting in 17 109 person-years of follow-up for all-cause mortality. Among physically active vs sedentary participants, respectively, at age 70, the 8-year mortality was 15.2% vs 27.2% (P activities of daily living at age 85 (odds ratio, 1.92; 95% confidence interval, 1.11-3.33). Among the very old, not only continuing but also initiating PA was associated with better survival and function. This finding supports the encouragement of PA into advanced old age.

Rates of Very Preterm Birth in Europe and Neonatal Mortality Rates

DEFF Research Database (Denmark)

Field, David John; Draper, Elizabeth S; Fenton, Alan

2008-01-01

OBJECTIVE: To estimate the influence of variation in the rate of very preterm delivery on the reported rate of neonatal death in ten European regions. DESIGN: Comparison of 10 separate geographically defined European populations, from nine European countries, over a one year period (seven months......) a standardised rate of very preterm delivery and b) the existing death rate for babies born at this gestation in the individual region. This produced much greater homogeneity in terms of neonatal mortality. CONCLUSIONS: Variation in the rate of very preterm delivery has a major influence on reported neonatal...

"Veri hakkab voolama" filmiajakirjanike aasta parim / J. R.

Index Scriptorium Estoniae

J. R.

2008-01-01

Paul Thomas Andersoni Upton Sinclairi "Õli" järgi lavastatud "Veri hakkab voolama" ("There Will Be Blood") : Ameerika Ühendriigid 2007. Filmi hääletas aasta parimaks Rahvusvaheline Filmiajakirjanike Föderatsioon (FIPRESCI)

School performance at nine years of age in very premature and very low birth weight infants : Perinatal risk factors and predictors at five years of age

NARCIS (Netherlands)

Hille, E.T.M.; Ouden, A.L. den; Bauer, L.; Oudenrijn, C. van den; Brand, R.; Verloove-Vanhorick, S.P.

1994-01-01

To assess the impact of both perinatal disorders and developmental problems identified at preschool age on school performance, we followed a virtually complete birth cohort of very premature (<32 completed weeks of gestation) and very low birth weight infants until they were 9 years of age. In 84%

Design considerations and expectations of a very large hadron collider

International Nuclear Information System (INIS)

Ruggiero, A.G.

1996-01-01

The ELOISATRON Project is a proton-proton collider at very high energy and very large luminosity. The main goal is to determine the ultimate performance that is possible to achieve with reasonable extrapolation of the present accelerator technology. A complete study and design of the collider requires that several steps of investigations are undertaken. The authors count five of such steps as outlined in the report

Experiments on very high energy heavy ions

International Nuclear Information System (INIS)

Willis, W.J.

1981-01-01

In this paper I describe experimental techniques which could be used to investigate central collision of very high energy heavy ions. For my purposes, the energy range is defined by the number of pions produced, Nsub(π) >> 100, and consequently Nsub(π) >> Nsub(nucleon). In this regime we may expect that new phenomena will appear. (orig.)

Genre Identification of Very Brief Musical Excerpts

Science.gov (United States)

Mace, Sandra T.; Wagoner, Cynthia L.; Teachout, David J.; Hodges, Donald A.

2012-01-01

The purpose of this study was to examine how well individuals were able to identify different music genres from very brief excerpts and whether musical training, gender and preference played a role in genre identification. Listeners were asked to identify genre from classical, jazz, country, metal, and rap/hip hop excerpts that were 125, 250, 500,…

Factors associated with successful establishment of breastfeeding in very preterm infants

DEFF Research Database (Denmark)

Zachariassen, G; Faerk, J; Grytter, C

2010-01-01

To describe feeding practices at hospital discharge in relation to characteristics of the very preterm infants (VPI) and their mothers.......To describe feeding practices at hospital discharge in relation to characteristics of the very preterm infants (VPI) and their mothers....

Family functioning, burden and parenting stress 2 years after very preterm birth.

Science.gov (United States)

Treyvaud, Karli; Doyle, Lex W; Lee, Katherine J; Roberts, Gehan; Cheong, Jeanie L Y; Inder, Terrie E; Anderson, Peter J

2011-06-01

Examining rates of difficulties in family functioning following very preterm birth has been a relatively neglected area of research. To examine family functioning, burden and parenting stress in families with very preterm compared with term born children, and investigate influences of parental mental health problems and child neurodevelopmental disability on family outcomes in families with preterm children. Participants were 184 very preterm and 71 term children and their parents. Parents completed the Family Assessment Device, Parenting Stress Index and Impact on Family questionnaires when their children were 2 years old (corrected for prematurity). Parental mental health and social risk information were also collected. Children were assessed for neurodevelopmental disability. Families with very preterm children reported poorer family functioning (p=.03) compared with families with term born children, with less evidence for differences between families with very preterm and term born children in parenting stress and family burden. Within very preterm families, parental mental health problems were associated with higher levels of parenting stress (p=.001), and parents of children with a neurodevelopmental disability were more likely to report higher family burden (p=.04). For families with very preterm children, parental mental health symptoms and child neurodevelopmental disability may identify families at risk of greater stress and burden who may benefit from additional support. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

Investigation of very long jet chambers

Energy Technology Data Exchange (ETDEWEB)

Burckhart, H J; Va' vra, J; Zankel, K; Dudziak, U; Schaile, D; Schaile, O; Igo-Kemenes, P; Lennert, P

1986-04-01

The electrostatic properties and the performances of very long jet chambers have been investigated. Using 100 MHz FADC wave form digitisers, the tracking accuracy, the charge division and the dE/dx performance of two chambers, one with 4.5 m long tungsten wires and one with 4 m long highly resistive ''NiCoTi'' wires have been studied. The geometry of the chambers was chosen to define some of the design parameters of the jet chamber for the OPAL detector for LEP. (orig.).

Very high energy gamma ray astrophysics

International Nuclear Information System (INIS)

Lamb, R.C.; Lewis, D.A.

1991-01-01

The Whipple Observatory High Resolution Camera will be used in a vigorous program of observations to search for new sources of very-high-energy gamma rays. In addition, a search for antimatter using the moon-earth system as an ion spectrometer will be begun. The first phase of GRANITE, the new 37-element 11-m camera, will be concluded with first light scheduled for September, 1991. The two cameras will operate in support of the Gamma Ray Observatory mission in the winter of 1991/2

VeriClick: an efficient tool for table format verification

Science.gov (United States)

Nagy, George; Tamhankar, Mangesh

2012-01-01

The essential layout attributes of a visual table can be defined by the location of four critical grid cells. Although these critical cells can often be located by automated analysis, some means of human interaction is necessary for correcting residual errors. VeriClick is a macro-enabled spreadsheet interface that provides ground-truthing, confirmation, correction, and verification functions for CSV tables. All user actions are logged. Experimental results of seven subjects on one hundred tables suggest that VeriClick can provide a ten- to twenty-fold speedup over performing the same functions with standard spreadsheet editing commands.

Outphasing control of gallium nitride based very high frequency resonant converters

DEFF Research Database (Denmark)

Madsen, Mickey Pierre; Knott, Arnold; Andersen, Michael A. E.

2015-01-01

In this paper an outphasing modulation control method suitable for line regulation of very high frequency resonant converters is described. The pros and cons of several control methods suitable for very high frequency resonant converters are described and compared to outphasing modulation...

PNGMDR 2013-2015. Industrial scheme for very-low-level waste management

International Nuclear Information System (INIS)

2015-08-01

The objectives of this document are to recall quantitative and qualitative situations of the very-low-level waste management sector, to consolidate production perspectives for producers, to make an inventory of possibilities of extension and optimisation of industrial capacities of the sector, to define priorities for the different envisaged optimisation options, and to describe the organisation for the follow-up of action progress. After a brief presentation of the context, it presents the French very-low-level waste sector which is specific to the French context, outlines the main challenges for the industrial very-low-level waste management sector, indicates current projects of assessment for the sector, reports an analysis of the relevance of the different envisaged volume optimisation ways, briefly presents different scenarios, gives a brief overview of examples of very-low-level waste management in other countries, and finally states some proposals

Acta Unitatis Fratrum. Ediční projekt

Czech Academy of Sciences Publication Activity Database

Just, Jiří

2014-01-01

Roč. 29, č. 2 (2014), s. 451-462 ISSN 0231-7494 Institutional support: RVO:67985963 Keywords : The Bohemian Brethren * protestant historiography * manuscript sources * regesta edition * Acta Unitatis Fratrum Subject RIV: AB - History

Identification of User Needs. EDIS Task I Report.

Science.gov (United States)

Howard Research Co., Arlington, VA.

This report presents the identification of user needs in the Army research, development, test and evaluation (RDT&E) community. Two types of information are provided in this report. The first type includes discussions of the RDT&E cycle, the level of informational need, time response, item categories and other factors as they relate to the…

Daniel Day-Lewis - veri peab voolama / Kristiina Davidjants

Index Scriptorium Estoniae

Davidjants, Kristiina, 1974-

2008-01-01

Iiri-juudi näitleja Daniel Day-Lewis, kes võitis oma rolliga P.T. Andersoni filmis "Veri hakkab voolama" parima meespeaosatäitja Oscari. Tema põhjalikust tööst rollidega läbi tema filmiloomingu

Very Long Baseline Interferometry: Dependencies on Frequency Stability

Science.gov (United States)

Nothnagel, Axel; Nilsson, Tobias; Schuh, Harald

2018-04-01

Very Long Baseline Interferometry (VLBI) is a differential technique observing radiation of compact extra-galactic radio sources with pairs of radio telescopes. For these observations, the frequency standards at the telescopes need to have very high stability. In this article we discuss why this is, and we investigate exactly how precise the frequency standards need to be. Four areas where good clock performance is needed are considered: coherence, geodetic parameter estimation, correlator synchronization, and UT1 determination. We show that in order to ensure the highest accuracy of VLBI, stability similar to that of a hydrogen maser is needed for time-scales up to a few hours. In the article, we are considering both traditional VLBI where extra-galactic radio sources are observed, as well as observation of man-made artificial radio sources emitted by satellites or spacecrafts.

Kaon interactions with very light nuclei

International Nuclear Information System (INIS)

Gibson, B.F.

1979-01-01

Low energy kaon interactions (both K and anti K) with very light nuclei are reviewed. Limitations upon present K-nucleus studies due to uncertainties in the K-N amplitudes are emphasized along with promising uses. A brief review of some of the many interesting aspects of anti K-nucleus scattering is given. Comparison of the limited anti K-d and anti K- 4 He elastic data with theory is made. The anti Kd → πΛp reaction is discussed including the possible ΣN virtual bound state. 49 references

Psychiatric hospitalisation and suicide among the very old in Denmark

DEFF Research Database (Denmark)

Erlangsen, Annette; Mortensen, Preben Bo; Vach, Werner

2005-01-01

BACKGROUND: Very old people have higher suicide rates than the younger elderly population. Psychiatric disorders are known to have a strong association with suicide among elderly people. AIMS: To analyse the analyse the suicide risk associated with psychiatric hospitalisation among the very old...... (> or =80 years) compared with the middle-aged (50-64 years) and old (65-79 years) populations. METHOD: Individual-level data on the entire Danish population aged 50 years or over were analysed for the period 1994-1998. Relative suicide risks were calculated using event-history analysis. RESULTS: Among 1978...... 527 persons, 2323 died by suicide. Although the very old group exhibited a four-fold to five-fold increase in risk of suicide for those previously hospitalised, we noted an inverse interaction effect: the increase is distinctly smaller compared with that in the middle-aged and old groups. CONCLUSIONS...

Novel Emplacement Device for a Very Deep Borehole Disposal

Energy Technology Data Exchange (ETDEWEB)

Lee, Min Soo; Choi, Heui-joo; Lee, Jong Yul [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2016-10-15

There is a worldwide attempt of HLW disposal into a very deep borehole of around 3-5 km depth with the advancement of an underground excavation technology recently. As it goes into deeper underground, the rock becomes more uniform and flawless. And then the underground water circulation system at 3-5 km depth is almost disconnected with near groundwater circulation system. The canister integrity is less important in this very deep borehole disposal system unlike a general geologic disposal system at 500 m. In the deep borehole disposal procedures, one SNF (Spent Nuclear Fuel) assembly is stored in one disposal canister (D30-40cm, H4.7-5.0m), and approximately 10-40 disposal canisters are connected axially, which parade length can leach to around 200m in maximum. The connected canister parade is lowered through a very deep borehole (D40-50cm) by emplacement devices. Therefore the connections between canisters and canister to lowering joint are very important for the safe operation of it. The well-known connection method between canisters is Threaded Coupled Connection method, in which releasing of the connection is almost impossible after thread fastening in the borehole. The novel joint device suggested in this paper can accommodate a canister emplacement and retrieval in the borehole disposal process. The joint can be lowered by bound to a drilling pipe, or high tension cable along 3-5 km distance. This novel device can cope with an accidental event easily without any joint head change. When canisters are damaged or stuck on the borehole wall during their descending, the canisters in trouble can be retrieved simply by the control of a lifting speed.

The Use of Very Low Calorie Diets in the Management of Type 2

African Journals Online (AJOL)

normalised following a very low calorie diet (VLCD) (less than (<) ...... obese patients with Type II diabetes: Does inclusion of an intermittent very low calorie ... exercise on weight-loss maintenance after a very-low-calorie diet or low-calorie diet: ...

Very short functionalized carbon nanotubes for membrane applications

NARCIS (Netherlands)

Fonseca, A.; Reijerkerk, Sander; Potreck, Jens; Nijmeijer, Dorothea C.; Mekhalif, Z.; Delhalle, J.

2010-01-01

The cutting and functionalization of carbon nanotubes is described, applying a single-step ball-mill based process. Very short carbon nanotubes bearing primary amine functions were produced, characterized and incorporated in polymeric membranes. The gas separation performance of the composite

Image segmentation evaluation for very-large datasets

Science.gov (United States)

Reeves, Anthony P.; Liu, Shuang; Xie, Yiting

2016-03-01

With the advent of modern machine learning methods and fully automated image analysis there is a need for very large image datasets having documented segmentations for both computer algorithm training and evaluation. Current approaches of visual inspection and manual markings do not scale well to big data. We present a new approach that depends on fully automated algorithm outcomes for segmentation documentation, requires no manual marking, and provides quantitative evaluation for computer algorithms. The documentation of new image segmentations and new algorithm outcomes are achieved by visual inspection. The burden of visual inspection on large datasets is minimized by (a) customized visualizations for rapid review and (b) reducing the number of cases to be reviewed through analysis of quantitative segmentation evaluation. This method has been applied to a dataset of 7,440 whole-lung CT images for 6 different segmentation algorithms designed to fully automatically facilitate the measurement of a number of very important quantitative image biomarkers. The results indicate that we could achieve 93% to 99% successful segmentation for these algorithms on this relatively large image database. The presented evaluation method may be scaled to much larger image databases.

VERY LATE PHOTOMETRY OF SN 2011fe

International Nuclear Information System (INIS)

Kerzendorf, W. E.; Taubenberger, S.; Seitenzahl, I. R.; Ruiter, A. J.

2014-01-01

The Type Ia supernova SN 2011fe is one of the closest supernovae of the past decades. Due to its proximity and low dust extinction, this object provides a very rare opportunity to study the extremely late time evolution (>900 days) of thermonuclear supernovae. In this Letter, we present our photometric data of SN 2011fe taken at an unprecedented late epoch of ≈930 days with GMOS-N mounted on the Gemini North telescope (g = 23.43 ± 0.28, r = 24.14 ± 0.14, i = 23.91 ± 0.18, and z = 23.90 ± 0.17) to study the energy production and retention in the ejecta of SN 2011fe. Together with previous measurements by other groups, our result suggests that the optical supernova light curve can still be explained by the full thermalization of the decay positrons of 56 Co. This is in spite of theoretical predicted effects (e.g., infrared catastrophe, positron escape, and dust) that advocate a substantial energy redistribution and/or loss via various processes that result in a more rapid dimming at these very late epochs

Very-long-term storage of fission products

International Nuclear Information System (INIS)

Sousselier, Y.; Pradel, J.; Cousin, O.

The large majority of the fission products, with 99.9 percent of the radioactivity content, do not pose actual problems in storage in a geological formation for which we can guarantee total confinement. Safety of storage in a geological formation for the radionuclides of long half-life is based in particular on the absorption capacity of the geological formations and the example of the Oklo fossil reactor and the retention of Pu which is produced is a striking example. But the problems are not the same, and the properties that we look for in the terrain are not the same. We could thus be led to storage in different geological formations for the fission products and the long-half-life emitters. Their separation is interesting from this point of view, but the date at which the separation is made will not be necessarily that of reprocessing. But there is a question of one or the other, and these storages will offer a very high level of insurance and will present only the potential hazards that are very comparable with those presented by natural conditions