International Nuclear Information System (INIS)
Fernandes, L.
1990-01-01
Radionuclide sup(201)Tl is used in Nuclear Medicine to identify myocardial ischemia or myocardial infarct. It is a cyclotron-produced radioisotope, obtained indirectly from the decay of sup(202)Pb or directly by irradiating mercury with deuterons or protons. The usual technique to prepare sup(201)Tl makes use of the nuclear reaction: sup(203)(p,3n) → sup(201)Tl, which requires proton energy of around 28 MeV. Due to the limited proton energy of IPEN'S CV-28 cyclotron, studies on the irradiating conditions of natural mercury oxide pellets and drops of natural mercury metal were made in the range of 19 - 24 MeV. At the end of the bombardment of a 6 MeV thickness target of natural mercury metal with 19 MeV protons around 10 MBq sup(201)Tl/μ A h was obtained. (author)
Isolation of radioactive thallium from mercury targets
International Nuclear Information System (INIS)
Sevast'yanova, A.S.; Kozlova, M.D.; Malinin, A.B.; Kurenkov, N.V.
1989-01-01
The extraction method of thallium-201, 202, 200 separation from mercury target irradiated by protons is suggested. Tl + in sulfuric acid solution prepared after Hg-target treatment with the sulfuric acid was oxidized up to Tl 3+ with hydrogen peroxide and then it was extracted with butylacetate. Thallium was re-exrtacted by the sulfurous acid solution in the presence of CCl 4 , and Tl 3+ was recovered up to Tl + . The method permits to separate thallium with chemical yield nor less than 95 %. 2 refs
7 CFR 201.58c - Detection of captan, mercury, or thiram on seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Detection of captan, mercury, or thiram on seed. 201.58c Section 201.58c Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL... Detection of captan, mercury, or thiram on seed. The bioassay method may be used according to the procedure...
International Nuclear Information System (INIS)
Fernandes, L.; Silva, C.P.G. da.
1991-09-01
The radiopharmaceutical 201 TlCl is used in Nuclear medicine for myocardial visualization. The solution of 201 TlCl was prepared using 201 Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of 200 Tl, 201 Tl and 202 Tl; the chemical identification of 201 Tl +1 ; the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility, pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of thallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of 201 Tl with 200 Tl and 202 Tl its use in human beings is not possible unless enriched 202 Hg is used as target of irradiation. (author)
Massive mercury target for thallium isotope production on the beam of high energy protons
International Nuclear Information System (INIS)
Novgorodov, A.F.; Kolachkovski, A.; Nguen Kong Chang.
1980-01-01
The yields of thallium radioisotopes in a massive mercury target irradiated with 660 MeV protons have been determined. The constancy of isotopic composition of radiothallium along the whole length (40 cm) of the target has been found. The yields of 200 Tl, 201 Tl and 202 Tl amount to 22.9+-2.8; 3.42+-0.45 and 0.459+-0.61 mCu/mkA h, respectively. It has been shown that the extraction of radioisotopes of thallium and some other elements from large amounts of mercury as well as their subsequent concentration may be carried out fully and relatavely fast when using dilute solutions of acetic acid
International Nuclear Information System (INIS)
Fernandes, L.; Silva, C.P.G. da
1991-01-01
The radiopharmaceutical sup(201) TlCl is used in Nuclear Medicine for myocardial visualization. The solution of sup(201)TlCl was prepared using sup(201)Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of sup(200)Tl, sup(201)Tl and sup(202)Tl; the chemical identification of sup(201)Tl sup(+1); the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of tallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of sup(201)Tl with sup(200)Tl and sup(202)Tl its use in human beings is not possible unless enriched sup(202)Hg is used as target of irradiation. (author)
Dash, Hirak R; Basu, Subham; Das, Surajit
2017-04-01
Biofilm-forming mercury-resistant marine bacterium Bacillus cereus BW-201B has been explored to evident that the bacterial biofilm-EPS (exopolymers) trap inorganic mercury but subsequently release EPS-bound mercury for induction of mer operon-mediated volatilization of inorganic mercury. The isolate was able to tolerate 50 ppm of mercury and forms biofilm in presence of mercury. mer operon-mediated volatilization was confirmed, and -SH was found to be the key functional group of bacterial EPS responsible for mercury binding. Biofilm-EPS-bound mercury was found to be internalized to the bacterial system as confirmed by reversible conformational change of -SH group and increased expression level of merA gene in a timescale experiment. Biofilm-EPS trapped Hg after 24 h of incubation, and by 96 h, the volatilization process reaches to its optimum confirming the internalization of EPS-bound mercury to the bacterial cells. Biofilm disintegration at the same time corroborates the results.
Mercury erosion experiments for spallation target system
International Nuclear Information System (INIS)
Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro
2003-01-01
The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a plan to construct the spallation neutron source at the Tokai Research Establishment, JAERI, under the High-Intensity Proton Accelerator Project (J-PARC). A mercury circulation system has been designed so as to supply mercury to the target stably under the rated flow rate of 41 m 3 /hr. Then, it was necessary to confirm a mercury pump performance from the viewpoint of making the mercury circulation system feasible, and more, to investigate erosion rate under the mercury flow as well as an amount of mercury remained on the surface after drain from the viewpoints of mechanical strength relating to the lifetime and remote handling of mercury components. The mercury pump performance was tested under the mercury flow conditions by using an experimental gear pump, which had almost the same structure as a practical mercury pump to be expected in the mercury circulation system, and the erosion rates in a mercury pipeline as well as the amount of mercury remained on the surface were also investigated. The discharged flow rates of the experimental gear pump increased linearly with the rotation speed, so that the gear pump would work as the flow meter. Erosion rates obtained under the mercury velocity less than 1.6 m/s was found to be so small that decrease of pipeline wall thickness would be 390 μm after 30-year operation under the rated mercury velocity of 0.7 m/s. For the amount of remaining mercury on the pipeline, remaining rates of weight and volume were estimated at 50.7 g/m 2 and 3.74 Hg-cm 3 /m 2 , respectively. Applying these remaining rates of weight and volume to the mercury target, the remaining mercury was estimated at about 106.5 g and 7.9 cm 3 . Radioactivity of this remaining mercury volume was found to be three-order lower than that of the target casing. (author)
Failure probability analysis on mercury target vessel
International Nuclear Information System (INIS)
Ishikura, Syuichi; Futakawa, Masatoshi; Kogawa, Hiroyuki; Sato, Hiroshi; Haga, Katsuhiro; Ikeda, Yujiro
2005-03-01
Failure probability analysis was carried out to estimate the lifetime of the mercury target which will be installed into the JSNS (Japan spallation neutron source) in J-PARC (Japan Proton Accelerator Research Complex). The lifetime was estimated as taking loading condition and materials degradation into account. Considered loads imposed on the target vessel were the static stresses due to thermal expansion and static pre-pressure on He-gas and mercury and the dynamic stresses due to the thermally shocked pressure waves generated repeatedly at 25 Hz. Materials used in target vessel will be degraded by the fatigue, neutron and proton irradiation, mercury immersion and pitting damages, etc. The imposed stresses were evaluated through static and dynamic structural analyses. The material-degradations were deduced based on published experimental data. As a result, it was quantitatively confirmed that the failure probability for the lifetime expected in the design is very much lower, 10 -11 in the safety hull, meaning that it will be hardly failed during the design lifetime. On the other hand, the beam window of mercury vessel suffered with high-pressure waves exhibits the failure probability of 12%. It was concluded, therefore, that the leaked mercury from the failed area at the beam window is adequately kept in the space between the safety hull and the mercury vessel by using mercury-leakage sensors. (author)
Methods of thallium-201 preparation from proton irradiated thallium targets
International Nuclear Information System (INIS)
Kozlova, M.D.; Sevast'yanova, A.S.; Malinin, A.B.; Kurenkov, N.V.
1989-01-01
Two methods of thallium-201 preparation from Tl-targets irradiated by protons: oxidation-extraction (1) and extraction (2) - are developed. At first radioactive lead is separated from the target material - thallium macroquantities during ∼32 hours, then thallium-201 was separated from residual activity of lead radioisotopes and transformed it into the necessary chemical formula. The 1st and 2nd methods differ from each other by the 1st stage of target retreatment; only extraction was used to separate radioactive lead in the 2nd method. The target was solved in H 2 SO 4 . The 1st method permits to separate thallium-201 with chemical yield not less than 90 %, the 2nd one - higher than 95 %. Volumetric activity of thallium-201 prepared is more than 55 MBq/ml. 5 refs
Radiochemical aspects of liquid mercury spallation targets
Neuhausen, Joerg; Eichler, Bernd; Eller, Martin; Horn, Susanne; Schumann, Dorothea; Stora, Thierry
2012-01-01
Liquid metal spallation targets using mercury as target material are used in state-of-the-art high power pulsed neutron sources that have been constructed in the USA and Japan within the last decade. Similar target concepts were also proposed for next generation ISOL, beta-beam and neutrino facilities. A large amount of radioactivity will be induced in the liquid metal during operation caused by the interaction of the target material with the intense proton beam. This radioactivity - carried by a wide range of radioisotopes of all the elements of the periodic table from hydrogen up to thallium - must be considered for the assessment of safe operation and maintenance procedures as well as for a final disposal of the used target material and components. This report presents an overview on chemical investigations performed in our laboratory that deal with the behavior of radionuclides in proton irradiated mercury samples. The solubility of elements in mercury was calculated using thermodynamical data obtained by...
Off-line tests on pitting damage in mercury target
Futakawa, M; Ishikura, S; Kogawa, H; Tsai, C C
2003-01-01
A liquid-mercury target system for the MW-scale target is being developed in the world. The moment the proton beams bombard the target, stress waves will be imposed on the beam window and pressure waves will be generated in the mercury by the thermally shocked heat deposition. Provided that the negative pressure generates through its propagation in the mercury target and causes cavitation in the mercury, there is the possibility for the cavitation bubbles collapse to form pits on the interface between the mercury and the target vessel wall. In order to estimate the cavitation erosion damage due to pitting, two types of off-line tests were performed: Split Hopkinson Pressure Bar (SHPB), and Magnetic IMpact Testing Machine (MIMTM). The data on the piping damage at the high cycle impacts up to 10 million were given by the MIMTM. Additionally the data obtained were compared with classical vibratory horn tests. As a result, it is confirmed that the mean depth erosion is predictable using a homologous line in the s...
Off-line tests on pitting damage in mercury target
International Nuclear Information System (INIS)
Futakawa, Masatoshi; Kogawa, Hiroyuki; Ishikura, Shuichi; Ikeda, Yujiro
2003-03-01
A liquid-mercury target system for the MW-scale target is being developed in the world. The moment the proton beams bombard the target, stress waves will be imposed on the beam window and pressure waves will be generated in the mercury by the thermally shocked heat deposition. Provided that the negative pressure generates through its propagation in the mercury target and causes cavitation in the mercury, there is the possibility for the cavitation bubbles collapse to form pits on the interface between the mercury and the target vessel wall. In order to estimate the cavitation erosion damage due to pitting, two types of off-line tests were performed: Split Hopkinson Pressure Bar (SHPB), and Magnetic IMpact Testing Machine (MIMTM). The data on the piping damage at the high cycle impacts up to 10 million were given by the MIMTM. Additionally the data obtained were compared with classical vibratory horn tests. As a result, it is confirmed that the mean depth erosion is predictable using a homologous line in the steady state with mass loss independently of testing machines and the incubation period is very dependent on materials and imposed pressures. (author)
A self-focusing mercury jet target
Johnson, C
2002-01-01
Mercury jet production targets have been studied in relation to antiproton production and, more recently, pion production for a neutrino factory. There has always been a temptation to include some self-focusing of the secondaries by passing a current through the mercury jet analogous to the already proven lithium lens. However, skin heating of the mercury causes fast vaporization leading to the development of a gliding discharge along the surface of the jet. This external discharge can, nevertheless, provide some useful focusing of the secondaries in the case of the neutrino factory. The technical complications must not be underestimated.
ONC201 kills breast cancer cells in vitro by targeting mitochondria.
Greer, Yoshimi Endo; Porat-Shliom, Natalie; Nagashima, Kunio; Stuelten, Christina; Crooks, Dan; Koparde, Vishal N; Gilbert, Samuel F; Islam, Celia; Ubaldini, Ashley; Ji, Yun; Gattinoni, Luca; Soheilian, Ferri; Wang, Xiantao; Hafner, Markus; Shetty, Jyoti; Tran, Bao; Jailwala, Parthav; Cam, Maggie; Lang, Martin; Voeller, Donna; Reinhold, William C; Rajapakse, Vinodh; Pommier, Yves; Weigert, Roberto; Linehan, W Marston; Lipkowitz, Stanley
2018-04-06
We report a novel mechanism of action of ONC201 as a mitochondria-targeting drug in cancer cells. ONC201 was originally identified as a small molecule that induces transcription of TNF-related apoptosis-inducing ligand (TRAIL) and subsequently kills cancer cells by activating TRAIL death receptors. In this study, we examined ONC201 toxicity on multiple human breast and endometrial cancer cell lines. ONC201 attenuated cell viability in all cancer cell lines tested. Unexpectedly, ONC201 toxicity was not dependent on either TRAIL receptors nor caspases. Time-lapse live cell imaging revealed that ONC201 induces cell membrane ballooning followed by rupture, distinct from the morphology of cells undergoing apoptosis. Further investigation found that ONC201 induces phosphorylation of AMP-dependent kinase and ATP loss. Cytotoxicity and ATP depletion were significantly enhanced in the absence of glucose, suggesting that ONC201 targets mitochondrial respiration. Further analysis indicated that ONC201 indirectly inhibits mitochondrial respiration. Confocal and electron microscopic analysis demonstrated that ONC201 triggers mitochondrial structural damage and functional impairment. Moreover, ONC201 decreased mitochondrial DNA (mtDNA). RNAseq analysis revealed that ONC201 suppresses expression of multiple mtDNA-encoded genes and nuclear-encoded mitochondrial genes involved in oxidative phosphorylation and other mitochondrial functions. Importantly, fumarate hydratase deficient cancer cells and multiple cancer cell lines with reduced amounts of mtDNA were resistant to ONC201. These results indicate that cells not dependent on mitochondrial respiration are ONC201-resistant. Our data demonstrate that ONC201 kills cancer cells by disrupting mitochondrial function and further suggests that cancer cells that are dependent on glycolysis will be resistant to ONC201.
Solubility of helium in mercury for bubbling technology of the spallation neutron mercury target
International Nuclear Information System (INIS)
Hasegawa, S.; Naoe, T.; Futakawa, M.
2010-01-01
The pitting damage of mercury target container that originates in the pressure wave excited by the proton beam incidence becomes a large problem to reach the high-power neutron source in JSNS and SNS. The lifetime of mercury container is decreased remarkably by the pitting damage. As one of solutions, the pressure wave is mitigated by injecting the helium micro bubbles in mercury. In order to inject the helium micro bubbles into mercury, it is important to understand the characteristic of micro bubbles in mercury. The solubility of mercury-helium system is a key factor to decide bubbling conditions, because the disappearance behavior, i.e. the lifetime of micro bubbles, depends on the solubility. In addition, the bubble generation method is affected by it. Moreover, the experimental data related to the solubility of helium in mercury hardly exist. In this work, the solubility was obtained experimentally by measuring precisely the pressure drop of the gas that is facing to mercury surface. The pressure drop was attributed to the helium dissolution into mercury. Based on the measured solubility, the lifetime of micro bubbles and the method of the bubble generation is estimated using the solubility data.
Preparation of isotopically enriched mercury sulphide targets
Energy Technology Data Exchange (ETDEWEB)
Szerypo, J.; Friebel, H.U.; Frischke, D.; Grossman, R.; Maier, H.J. [Dept. fuer Physik, Univ. Muenchen (LMU) (Germany); Maier-Leibnitz-Lab. (MLL), Garching (Germany)
2007-07-01
The primary difficulty in performing nuclear reactions on mercury is to obtain a suitable target. The primary difficulty in performing nuclear reactions on mercury is to obtain a suitable target. The utilization of amalgam targets has been reported in early publications. These targets, however, were lacking homogeneity and in-beam stability. A thorough investigation of literature shows, that HgS, because of its comparatively high chemical and mechanical stability, is one of the more adequate Hg compounds for accelerator target applications. In this presentation we describe the production of HgS targets consisting of an enriched Hg isotope and S of natural isotopic abundance, starting up from HgO. Following the outline given in [3], in this special case HgS can be prepared by dissolving HgO in diluted HNO{sub 3} and subsequent precipitation of the black HgS modification with gaseous H{sub 2}S. Last step of the target production procedure is evaporation-condensation of HgS in vacuum. In the present case, HgS layers of 500 {mu}g/cm{sup 2} on a backing carbon foil of 26 {mu}g/cm{sup 2} with a protective carbon layer of about 20 {mu}g/cm{sup 2} thickness on top of the HgS layer were produced. (orig.)
A New Trapped Ion Clock Based on Hg-201(+)
Taghavi-Larigani, S.; Burt, E. A.; Lea, S. N.; Prestage, J. D.; Tjoelker, R. L.
2009-01-01
There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave clock: Hg-199(+) and Hg-201(+). Virtually all trapped mercury ion clocks to date have used the 199 isotope. We have begun to investigate the viability of a trapped ion clock based on Hg-201(+). We have measured the unperturbed frequency of the (S-2)(sub 1/2) F = 1, m(sub F) = 0 to (S-2)(sub 1/2) F = 2, m(sub F) = 0 clock transition to be 29.9543658211(2) GHz. In this paper we describe initial measurements with Hg-201(+) and new applications to clocks and fundamental physics.
Thermal-hydraulic design of cross-flow type mercury target for JAERI/KEK joint project
International Nuclear Information System (INIS)
Kaminaga, Masanori; Terada, Atsuhiko; Haga, Katsuhiro; Kinoshita, Hidetaka; Hino, Ryutaro
2001-01-01
The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a plan to construct a neutron scattering facility. In the facility, 1 MW pulsed proton beam from a high-intensity proton accelerator will be injected into a mercury target in order to produce high-intensity neutrons for use in the fields of life and material sciences. In the spallation mercury target system design, an integrated structure of target vessel with a safety hull was proposed to ensure the safety and to collect mercury in case of mercury leakage caused by the target beam window failure. The inner structure arrangement of the mercury target vessel was determined based on the thermal hydraulic analytical results of 3 GeV, 1 MW proton beam injection. The safety hull consists of vessels for helium and heavy water. The vessels for mercury target, helium and heavy water will be connected each other by reinforcement ribs mounted on the surface of each vessel. From the structural analyses, the structural integrity of the safety hull would be maintained under the static pressure of 0.5 MPa. (author)
International Nuclear Information System (INIS)
Haga, Katsuhiro; Naoe, Takashi; Kogawa, Hiroyuki; Wakui, Takashi; Futakawa, Masatoshi
2009-01-01
Checking the seal performance of the mercury piping network is very important for the mercury target system operation of J-PARC, and the test method for leaks using the pressure change measurement is preferable for this purpose because it can be carried out easily and precisely by measuring the pressure change, and it is free from the risk of mercury contamination. The piping network is pressurized by helium gas. Thus, the correlation between the helium leak rate and mercury leak flow rate was investigated experimentally by carrying out leak tests for helium and mercury with an identical mockup flange model. The results showed that the mercury leak flow rates of the experimental data were lower than those of the estimated value by 64% on average. It was also found that the threshold of the helium leak rate at which good seal performance for mercury can be obtained exists between 2.18 x 10 -4 and 1.01 x 10 -2 Pa.m 3 /s. This fact confirmed the sufficient safety margin of the mercury target system against the mercury leak, where 1 x 10 -6 Pa.m 3 /s was adopted as the seal performance criterion. (author)
Recovery of 201Tl by ion exchange chromatography from proton bombarded thallium cyclotron targets
International Nuclear Information System (INIS)
Walt, T.N. van der; Naidoo, C.
2000-01-01
A method based on ion exchange chromatography is presented for the recovery of 201 Tl and its precursor 201 Pb from proton bombarded natural thallium cyclotron targets. After bombardment the target is dissolved in diluted nitric acid. Water, hydrazine and ammonium acetate are added to the solution and the lead radioisotopes separated from the thallium by cation exchange chromatography on a Bio-Rex 70 column. The sorbed lead radioisotopes are eluted with dilute nitric acid and the separation repeated on a second Bio-Rex 70 column. After elution of the remaining thallium the column is left for 32 hours and the 201 Tl formed by decay of 201 Pb is eluted with an ammonium acetate solution. The 201 Tl eluate is acidified with a HNO 3 -HBr-Br 2 mixture and the resulting solution is passed through an AG MP-1 anion exchanger column to remove any remaining lead isotopes. The 201 Tl is eluted with a hydrazine solution, the eluate evaporated to dryness and the 201 Tl finally dissolved in an appropriate solution to produce a 201 TlCl solution suitable for medical use. A high quality 201 Tl product is obtained containing ≤ 0.1 μg of Tl/mCi (37 MBq) 201 Tl. The radionuclidic impurities are less than the maximum values specified by the US Pharmacopoeia and the British Pharmacopoeia. (orig.)
International Nuclear Information System (INIS)
Pointer, D.; Ruggles, A.; Wendel, M.; Crye, J.
2000-01-01
The Spallation Neutron Source (SNS) will utilize a liquid mercury target placed in the path of a high-energy proton beam to produce neutrons for research activities. As the high-energy protons interact with the mercury target, the majority of the beam energy is converted to thermal energy. The liquid mercury must provide sufficient heat transfer to maintain the temperature of the target structure within the thermal limits of the structural materials. Therefore, the behavior of the liquid mercury flow must be characterized in sufficient detail to ensure accurate evaluation of heat transfer in the mercury target. A combination of experimental and computational methods is utilized to characterize the flow in these preliminary analyses. Preliminary studies of the liquid mercury flow in the SNS target indicate that the flow in the exit channel may exhibit multiple recirculation zones, flow asymmetries, and possibly large-scale flow instabilities. While these studies are not conclusive, they serve to focus the efforts of subsequent CFD modeling and experimental programs to better characterize the flow patterns in the SNS mercury target
Thermal shocks and magnetohydrodynamics in high power mercury jet targets
Lettry, Jacques; Gilardoni, S S; Benedikt, Michael; Farhat, M; Robert, E
2003-01-01
The response of mercury samples submitted to a pulsed proton beam and the magnetohydrodynamic (MHD) effects of a mercury jet injected into a 20 T magnetic field are reported. The experimental conditions differ from those of proposed neutrino factories and the purpose of these measurements is to provide benchmarks for simulation tools of a realistic free mercury jet target. These measurements were completed in June 2002. Analysis is ongoing and the presented results are preliminary. (12 refs).
Treatment Of Mercury Target Off-Gas At SNS
International Nuclear Information System (INIS)
DeVore, Joe R.; Freeman, David W.
2007-01-01
The Spallation Neutron Source (SNS) is the first operational spallation source to use liquid Mercury as a target material. This paper describes the treatment system to remove volatile spallation products from a Helium purge stream that emanates from the Mercury target and adjustments made to achieve design goals in response to phenomena experienced during initial operations. The Helium stream is treated to remove volatile spallation products prior to environmental release because of its activity level as these accumulate in the gas space in the Mercury Loop. Unanticipated local dose rates were noted in treatment system components during low power startup. Gamma scanning of these components identified the presence of nineteen noble gas isotopes and their daughters, indicating that the doses resulted from noble gas sorption. Treatment of this equipment with stable Xenon greatly reduced but did not eliminate these. Significant moisture was also encountered in the system, resulting in the plugging of the system cold trap. Changes to some of the system equipment were required together with moisture elimination from components to which moisture was sorbed. Necessary re-configuration of Mercury pump components presented additional requirements and system control changes to accommodate system operation at reduced pressure. The Off-Gas Treatment System has been successfully operated since April, 2006. System availability and removal effectiveness have been high. Operational issues occurring during the first year of operation have been resolved.
System dynamic analyses on the JKJ mercury target and cold moderator systems
International Nuclear Information System (INIS)
Takahashi, Toshio; Kaminaga, Masanori; Kinoshita, Hidetaka; Aso, Tomokazu; Haga, Katsuhiro; Hino, Ryutaro
2001-01-01
The temperature responses of major points in a mercury target cooling system and in a cold moderator system of JKJ (JAERI/KEK Joint Project) were simulated by the analytical code MATLAB (SIMULINK). As a result, it was made clear that non-control of mercury temperature is the best way to control the mercury target cooling system. If the mercury temperature of the system is controlled by the PID control system using an outlet temperature of heat exchanger, the PID control system shows the characteristics of an on-off control system, and the temperature cannot be controlled. Analytical results also showed that mercury temperature remained below the boiling point of 356degC under 0.1 MPa during a transient at one cooling pump trip. Analytical results for the cold moderator system showed that the outlet temperature of cold moderator vessels could be kept within a temperature range of 1 k during steady-state conditions. (author)
Cavitation damage prediction for the JSNS mercury target vessel
Energy Technology Data Exchange (ETDEWEB)
Naoe, Takashi, E-mail: naoe.takashi@jaea.go.jp; Kogawa, Hiroyuki; Wakui, Takashi; Haga, Katsuhiro; Teshigawara, Makoto; Kinoshita, Hidetaka; Takada, Hiroshi; Futakawa, Masatoshi
2016-01-15
The liquid mercury target system for the Japan Spallation Neutron Source (JSNS) at the Materials and Life science experimental Facility (MLF) in the Japan Proton Accelerator Research Complex (J-PARC) is designed to produce pulsed neutrons. The mercury target vessel in this system, which is made of type 316L stainless steel, is damaged by pressure wave-induced cavitation due to proton beam bombardment. Currently, cavitation damage is considered to be the dominant factor influencing the service life of the target vessel rather than radiation damage. In this study, cavitation damage to the interior surface of the target vessel was predicted on the basis of accumulated damage data from off-beam and on-beam experiments. The predicted damage was compared with the damage observed in a used target vessel. Furthermore, the effect of injecting gas microbubbles on cavitation damage was predicted through the measurement of the acoustic vibration of the target vessel. It was shown that the predicted depth of cavitation damage is reasonably coincident with the observed results. Moreover, it was confirmed that the injection of gas microbubbles had an effect on cavitation damage.
International Nuclear Information System (INIS)
Lee, P.L.; Boehm, F.; Hahn, A.A.
1978-01-01
The isotope shifts of atomic K x rays were measured for pairs of the six mercury isotopes with A = 198, 199, 200, 201, 202, and 204, using a curved crystal spectrometer. The changes of the nuclear charge radii were derived in terms of delta 2 > and deltaR/sub k/ and compared with optical an muonic isotope shift data. From our results, a renormalization of the optical data was obtained
International Nuclear Information System (INIS)
Jackson, Togwell A.
2016-01-01
The Wabigoon River (Ontario, Canada) was affected by dams starting in 1898 and was polluted with pulp and paper mill wastes starting in 1913 and mercury from a chlor-alkali plant from 1962 to 1975. A dated sediment core from a riverine lake was analysed to investigate resultant changes in the biogeochemistry of mercury as revealed by variations in mercury isotope ratios and sediment chemistry. A total mercury maximum formed by the mercury pollution coincided with minimums in the δ-values of the 198 Hg/ 202 Hg, 199 Hg/ 202 Hg, 200 Hg/ 202 Hg, and 201 Hg/ 202 Hg ratios, and the δ-values decreased in the order δ 201 Hg > δ 200 Hg > δ 199 Hg > δ 198 Hg. Thus, mass-dependent fractionation caused depletion in lighter isotopes, implying evaporation of Hg(0) and pollution of the atmosphere as well as the river-lake system. Concurrently, mass-independent fractionation caused 199 Hg enrichment, possibly reflecting an independently documented upsurge in methylmercury production, and 201 Hg depletion, suggesting removal of methylmercury with anomalously high 201 Hg/ 199 Hg ratios by aquatic organisms and accumulation of 201 Hg-depleted inorganic Hg(II) in sediments. The δ 201 Hg/δ 199 Hg ratio rose abruptly when mercury pollution began, reflecting the resultant increase in methylmercury production, and remained high but gradually declined as the pollution abated, paralleling trends shown by methylmercury in aquatic organisms. The δ 201 Hg/δ 199 Hg ratio of pre-1962 background mercury increased ca. 1898 and ca. 1913–1929, suggesting accelerated methylmercury production due to stimulation of microbial activities by the damming of the river and the input of pulp and paper mill wastes, respectively. Other variations were linked to economic and technological factors that affected pulp and paper manufacture. - Highlights: • A core from a lake polluted by Hg and organic wastes was analysed for Hg isotopes. • Hg from a chlor-alkali plant was depleted in lighter
CFD analysis of a liquid mercury target for the National Spallation Neutron Source
International Nuclear Information System (INIS)
Wendel, M.W.; Tov, M.S.
1997-01-01
Computational fluid dynamics (CFD) is being used to analyze the design of the National Spallation Neutron Source (NSNS) target. The target is subjected to the neutronic (internal) heat generation that results from the proton collisions with the mercury nuclei. The liquid mercury simultaneously serves as the neutronic target medium, transports away the heat generated within itself, and cools the metallic target structure. Recirculation and stagnation zones within the target are of particular concern because of the likelihood that they will result in local hot spots. These zones exist because the most feasible target designs include a complete U-turn flow redirection. Although the primary concern is that the target is adequately cooled, the pressure drop from inlet to outlet must also be considered because pressure drop directly affects structural loading and required pumping power. Various design options have been considered in an effort to satisfy these design criteria. Significant improvements to the design have been recommended based on the results. Detailed results are presented for the current target design including a comparison with published pressure-drop data. Comparisons are also made with forced convection heat transfer data for liquid mercury flow in circular tubes
CALCULATIONS FOR A MERCURY JET TARGET IN A SOLENOID MAGNET CAPTURE SYSTEM
International Nuclear Information System (INIS)
GALLARDO, J.; KAHN, S.; PALMER, R.B.; THIEBERGER, P.; WEGGEL, R.J.; MCDONALD, K.
2001-01-01
A mercury jet is being considered as the production target for a muon storage ring facility to produce an intense neutrino beam. A 20 T solenoid magnet that captures pions for muon production surrounds the mercury target. As the liquid metal jet enters or exits the field eddy currents are induced. We calculate the effects that a liquid metal jet experiences in entering and exiting the magnetic field for the magnetic configuration considered in the Neutrino Factory Feasibility Study II
International Nuclear Information System (INIS)
Hino, Ryutaro; Haga, Katsuhiro; Aita, Hideki; Sekita, Kenji; Sudo, Yukio; Koiso, Kohji; Kaminaga, Masanori; Takahashi, Hiromichi.
1997-03-01
A heavy liquid-metal target has been proposed as a representative target of a 5MW-scale neutron source for a neutron scattering facility coupled with a high-intensity proton accelerator. In the report, about mercury considered to be the best material of the heavy liquid-metal target, its properties needed for the design were formulated, and results of research on mercury treatment and of evaluation of heat removal performance on the basis of generating heat obtained by a numerical calculation of a spallation reaction were presented. From these results, a 1.5MW-scale mercury loop which equals to that for the first stage operation of the neutron science program of JAERI was designed conceptually for obtaining design data of the mercury target, and basic flow diagram of the loop and specifications of components were decided: diameter of pipelines flowing mercury at the velocity below 1m/s, power of an electro-magnet pump and structure of a cooler. Through the design, engineering problems were made clear such as selection and development of mercury-resistant materials and optimization of the loop and components for decreasing mercury inventory. (author)
International Nuclear Information System (INIS)
SIMOS, N.; LUDEWIG, H.; KIRK, H.; THIEBERGER, P.; MCDONALD, K.
2001-01-01
This paper addresses the thermodynamic interaction of an intense proton beam with the proposed mercury jet target at a neutrino factory or muon collider source, and the consequences of the generated pressure waves on the target integrity. Specifically, a 24 GeV proton beam with approximately 1.6e13 protons per pulse and a pulse length of 2 nanosec will interact with a 1 cm diameter mercury jet within a 20 Tesla magnetic field. In one option, a train of six such proton pulses is to be delivered on target within 2 microsec, in which case the state of the mercury jet following the interaction with each pulse is critical. Using the equation of state for mercury from the SESAME library, in combination with the energy deposition rates calculated the by the hadron interaction code MARS, the induced 3-D pressure field in the target is estimated. The consequent pressure wave propagation and attenuation in the mercury jet is calculated using an ANSYS code transient analysis, and the state of the mercury jet at the time of arrival of the subsequent pulse is assessed. The amplitude of the pressure wave reaching the nozzle that ejects the mercury jet into the magnetic field is estimated and the potential for mechanical damage is addressed
Bizily, Scott P.; Kim, Tehryung; Kandasamy, Muthugapatti K.; Meagher, Richard B.
2003-01-01
Methylmercury is an environmental pollutant that biomagnifies in the aquatic food chain with severe consequences for humans and other animals. In an effort to remove this toxin in situ, we have been engineering plants that express the bacterial mercury resistance enzymes organomercurial lyase MerB and mercuric ion reductase MerA. In vivo kinetics experiments suggest that the diffusion of hydrophobic organic mercury to MerB limits the rate of the coupled reaction with MerA (Bizily et al., 2000). To optimize reaction kinetics for organic mercury compounds, the merB gene was engineered to target MerB for accumulation in the endoplasmic reticulum and for secretion to the cell wall. Plants expressing the targeted MerB proteins and cytoplasmic MerA are highly resistant to organic mercury and degrade organic mercury at 10 to 70 times higher specific activity than plants with the cytoplasmically distributed wild-type MerB enzyme. MerB protein in endoplasmic reticulum-targeted plants appears to accumulate in large vesicular structures that can be visualized in immunolabeled plant cells. These results suggest that the toxic effects of organic mercury are focused in microenvironments of the secretory pathway, that these hydrophobic compartments provide more favorable reaction conditions for MerB activity, and that moderate increases in targeted MerB expression will lead to significant gains in detoxification. In summary, to maximize phytoremediation efficiency of hydrophobic pollutants in plants, it may be beneficial to target enzymes to specific subcellular environments. PMID:12586871
MERIT - The high intensity liquid mercury target experiment at the CERN PS
Efthymiopoulos, I
2009-01-01
The MERIT experiment is a proof-of-principle test of a target system for high power proton beams to be used as front-end for a Neutrino Factory complex or a Muon Collider. The experiment took data in autumn 2007 with the fast extracted beam from the CERN Proton Synchrotron (PS) to a maximum intensity of about 30 × 1012 protons per pulse. The target system, based on a free mercury jet, allowed investigation of the interseption of a 4-MW proton beam inside a 15-T magnetic field required to capture the low-energy secondary pions as the source of the required intense muon beams. Particle detectors have been installed around the target setup to measure the secondary particle flux out of the target and probe cavitation effects in the mercury jet when exited with a beam of variable intensity. With the analysis of the data ongoing, results will be presented here that demonstrate the validity of the liquid target concept.
Optimization study on structural analyses for the J-PARC mercury target vessel
Guan, Wenhai; Wakai, Eiichi; Naoe, Takashi; Kogawa, Hiroyuki; Wakui, Takashi; Haga, Katsuhiro; Takada, Hiroshi; Futakawa, Masatoshi
2018-06-01
The spallation neutron source at the Japan Proton Accelerator Research Complex (J-PARC) mercury target vessel is used for various materials science studies, work is underway to achieve stable operation at 1 MW. This is very important for enhancing the structural integrity and durability of the target vessel, which is being developed for 1 MW operation. In the present study, to reduce thermal stress and relax stress concentrations more effectively in the existing target vessel in J-PARC, an optimization approach called the Taguchi method (TM) is applied to thermo-mechanical analysis. The ribs and their relative parameters, as well as the thickness of the mercury vessel and shrouds, were selected as important design parameters for this investigation. According to the analytical results of 18 model types designed using the TM, the optimal design was determined. It is characterized by discrete ribs and a thicker vessel wall than the current design. The maximum thermal stresses in the mercury vessel and the outer shroud were reduced by 14% and 15%, respectively. Furthermore, it was indicated that variations in rib width, left/right rib intervals, and shroud thickness could influence the maximum thermal stress performance. It is therefore concluded that the TM was useful for optimizing the structure of the target vessel and to reduce the thermal stress in a small number of calculation cases.
Lev, Avital; Lulla, Amriti R; Ross, Brian C; Ralff, Marie D; Makhov, Petr B; Dicker, David T; El-Deiry, Wafik S
2018-05-01
Androgen receptor (AR) signaling plays a key role in prostate cancer progression, and androgen deprivation therapy (ADT) is a mainstay clinical treatment regimen for patients with advanced disease. Unfortunately, most prostate cancers eventually become androgen-independent and resistant to ADT with patients progressing to metastatic castration-resistant prostate cancer (mCRPC). Constitutively activated AR variants (AR-V) have emerged as mediators of resistance to AR-targeted therapy and the progression of mCRPC, and they represent an important therapeutic target. Out of at least 15 AR-Vs described thus far, AR-V7 is the most abundant, and its expression correlates with ADT resistance. ONC201/TIC10 is the founding member of the imipridone class of small molecules and has shown anticancer activity in a broad range of tumor types. ONC201 is currently being tested in phase I/II clinical trials for advanced solid tumors, including mCRPC, and hematologic malignancies. There has been promising activity observed in patients in early clinical testing. This study demonstrates preclinical single-agent efficacy of ONC201 using in vitro and in vivo models of prostate cancer. ONC201 has potent antiproliferative and proapoptotic effects in both castration-resistant and -sensitive prostate cancer cells. Furthermore, the data demonstrate that ONC201 downregulates the expression of key drivers of prostate cancer such as AR-V7 and downstream target genes including the clinically used biomarker PSA (KLK3). Finally, the data also provide a preclinical rationale for combination of ONC201 with approved therapeutics for prostate cancer such as enzalutamide, everolimus (mTOR inhibitor), or docetaxel. Implications: The preclinical efficacy of ONC201 as a single agent or in combination, in hormone-sensitive or castration-resistant prostate cancer, suggests the potential for immediate clinical translation. Mol Cancer Res; 16(5); 754-66. ©2018 AACR . ©2018 American Association for Cancer
Estimation of thermochemical behavior of spallation products in mercury target
International Nuclear Information System (INIS)
Kobayashi, Kaoru; Kaminaga, Masanori; Haga, Katsuhiro; Kinoshita, Hidetaka; Aso, Tomokazu; Teshigawara, Makoto; Hino, Ryutaro
2002-02-01
In order to examine the radiation safety of a spallation mercury target system, especially source term evaluation, it is necessary to clarify the chemical forms of spallation products generated by spallation reaction with proton beam. As for the chemical forms of spallation products in mercury that involves large amounts of spallation products, these forms were estimated by using the binary phase diagrams and the thermochemical equilibrium calculation based on the amounts of spallation product. Calculation results showed that the mercury would dissolve Al, As, B, Be, Bi, C, Co, Cr, Fe, Ga, Ge, Ir, Mo, Nb, Os, Re, Ru, Sb, Si, Ta, Tc, V and W in the element state, and Ag, Au, Ba, Br, Ca, Cd, Ce, Cl, Cs, Cu, Dy, Er, Eu, F, Gd, Hf, Ho, I, In, K, La, Li, Lu, Mg, Mn, Na, Nd, Ni, O, Pb, Pd, Pr, Pt, Rb, Rh, S, Sc, Se, Sm, Sn, Sr, Tb, Te, Ti, Tl, Tm, Y, Yb, Zn and Zr in the form of inorganic mercury compounds. As for As, Be, Co, Cr, Fe, Ge, Ir, Mo, Nb, Os, Pt, Re, Ru, Se, Ta, V, W and Zr, precipitation could be occurred when increasing the amounts of spallation products with operation time of the spallation target system. On the other hand, beryllium-7 (Be-7), which is produced by spallation reaction of oxygen in the cooling water of a safety hull, becomes the main factor of the external exposure to maintain the cooling loop. Based on the thermochemical equilibrium calculation to Be-H 2 O binary system, the chemical forms of Be in the cooling water were estimated. Then the Be could exist in the form of cations such as BeOH + , BeO + and Be 2+ under the condition of less than 10 -8 of the Be mole fraction in the cooling water. (author)
International Nuclear Information System (INIS)
SIMOS, N.; KIRK, H.; FINFROCK, C.; GREENE, G.; LUDEWIG, H.; MCDONALD, K.; MOKHOV, N.
2001-01-01
A muon collider or a neutrino factory based on a muon storage ring require intense beams of muons that can be generated by a 1-4 MW proton beam incident on a moving target inside a 20-T solenoid magnet, with a mercury jet as a preferred example. This paper addresses the thermodynamic interaction of the intense proton beam with the proposed mercury jet target, and the consequences of the generated pressure waves on the target integrity. Specifically, a 24 GeV proton beam with approximately 16 TP (1 TP = 10 12 protons) per pulse and a pulse length of 2 ns will interact with a 1 cm diameter mercury jet within the 20-Tesla magnetic field. In one option, a train of six such proton pulses is to be delivered on target within 2 micros, in which case the state of the mercury jet following the interaction with each pulse is critical. Using the equation of state for mercury from the SESAME library, in combination with the energy deposition rates calculated the by the hadron interaction code MARS, the induced 3-D pressure field in the target is estimated. The consequent pressure wave propagation and attenuation in the mercury jet is calculated using a transient analysis based on finite element modeling, and the state of the mercury jet at the time of arrival of the subsequent pulse is assessed. Issues associated with the use of a liquid metal jet as a target candidate are addressed. Lastly, some experimental results from the BNL E951 experiment are presented and discussed
A method for the production of thallium-201
International Nuclear Information System (INIS)
Ageev, V.A.; Kljuchnikov, A.A.; Linev, A.F.; Khalkin, V.A.; Zaitseva, N.G.
1987-01-01
For the production of thallium-201 a target of at least 95% enriched pure lead-206 is irradiated by a proton beam of an energy of between 50 and 70 MeV. During irradiation the reaction 206 Pb(p,6n) 201 Bi takes place. The target is kept sufficiently long for the transition 201 Bi- 201 Pb- 201 Tl to take place. The target is then dissolved in acid. The thallium-201 contained in the acid is oxidized to the trivalent state followed by precipitation of the lead. Lead traces remaining in solution are separated from the thallium-201 through cation exchange following which the thallium-201 is eluted using hydrochloric acid
Mercury flow experiments. 4th report: Measurements of erosion rate caused by mercury flow
International Nuclear Information System (INIS)
Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro
2002-06-01
The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be weak by thickness decreasing. This report presents experimental results of wall thickness change by erosion using a mercury experimental loop. In the experiments, an erosion test section and coupons were installed in the mercury experimental loop, and their wall thickness was measured with an ultra sonic thickness gage after every 1000 hours. As a result, under 0.7 m/s of mercury velocity condition which is slightly higher than the practical velocity in mercury pipelines, the erosion is about 3 μm in 1000 hours. The wall thickness decrease during facility lifetime of 30 years is estimated to be less than 0.5 mm. According to the experimental result, it is confirmed that the effect of erosion on component strength is extremely small. Moreover, a measurement of residual mercury on the piping surface was carried out. As a result, 19 g/m 2 was obtained as the residual mercury for the piping surface. According to this result, estimated amount of residual mercury for
Contribution to the structure study of mercury isotopes with the (p,d) reaction
International Nuclear Information System (INIS)
Grafeuille, S.
1985-10-01
The mercury isotopes were studied by means of the two pick-up reactions (p,d) and (p,t). Enriched targets of 204 Hg, 202 Hg, 201 Hg, 200 Hg, 199 Hg, 198 Hg and 196 Hg were bombarded by a 25 MeV proton beam from the Orsay MP tandem accelerator. Emitted particles were analyzed by a split-pole magnetic spectrometer. We present all the results (nearly 150 states) of the analysis of the (p,d) reactions. Our (p,d) and (p,t) study show new discontinuities around 200 Hg in systematics of mercury isotopes. Part of the results are compared to the U(5) limits of Interacting Bosons (and Fermions) Models. The light nuclei can be considered reasonably described but this could be somewhat fortuitous. (71 refs) [fr
Helium Pressure Shift of the Hyperfine Clock Transition in Hg-201(+)
Larigani, S. Taghavi; Burt, E. A.; Tjoelker, R. L.
2010-01-01
There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave atomic clock: Hg-199(+) and Hg-201(+). We are investigating the viability of a trapped ion clock based on Hg-201(+) in a configuration that uses a buffer gas to increase ion loading efficiency and counter ion heating from rf trapping fields. Traditionally, either helium or neon is used as the buffer gas at approx. 10(exp -5) torr to confine mercury ions near room temperature. In addition to the buffer gas, other residual background gasses such as H2O, N2, O2, CO, CO2, and CH2 may be present in trace quantities. Collisions between trapped ions and buffer gas or background gas atoms/molecules produce a momentary shift of the ion clock transition frequency and constitute one of the largest systematic effects in this type of clock. Here we report an initial measurement of the He pressure shift in Hg-201(+) and compare this to Hg-199(+).
Directory of Open Access Journals (Sweden)
Mathavan Sinnakaruppan
2010-03-01
Full Text Available Abstract Background Mercury is a prominent environmental contaminant that causes detrimental effects to human health. Although the liver has been known to be a main target organ, there is limited information on in vivo molecular mechanism of mercury-induced toxicity in the liver. By using transcriptome analysis, phenotypic anchoring and validation of targeted gene expression in zebrafish, mercury-induced hepatotoxicity was investigated and a number of perturbed cellular processes were identified and compared with those captured in the in vitro human cell line studies. Results Hepato-transcriptome analysis of mercury-exposed zebrafish revealed that the earliest deregulated genes were associated with electron transport chain, mitochondrial fatty acid beta-oxidation, nuclear receptor signaling and apoptotic pathway, followed by complement system and proteasome pathway, and thereafter DNA damage, hypoxia, Wnt signaling, fatty acid synthesis, gluconeogenesis, cell cycle and motility. Comparative meta-analysis of microarray data between zebrafish liver and human HepG2 cells exposed to mercury identified some common toxicological effects of mercury-induced hepatotoxicity in both models. Histological analyses of liver from mercury-exposed fish revealed morphological changes of liver parenchyma, decreased nucleated cell count, increased lipid vesicles, glycogen and apoptotic bodies, thus providing phenotypic evidence for anchoring of the transcriptome analysis. Validation of targeted gene expression confirmed deregulated gene-pathways from enrichment analysis. Some of these genes responding to low concentrations of mercury may serve as toxicogenomic-based markers for detection and health risk assessment of environmental mercury contaminations. Conclusion Mercury-induced hepatotoxicity was triggered by oxidative stresses, intrinsic apoptotic pathway, deregulation of nuclear receptor and kinase activities including Gsk3 that deregulates Wnt signaling
Prabhu, Varun V; Allen, Joshua E; Dicker, David T; El-Deiry, Wafik S
2015-04-01
Self-renewing colorectal cancer stem/progenitor cells (CSC) contribute to tumor maintenance and resistance to therapy. Therapeutic targeting of CSCs could improve treatment response and prolong patient survival. ONC201/TIC10 is a first-in-class antitumor agent that induces TRAIL pathway-mediated cell death in cancer cells without observed toxicity. We have previously described that ONC201/TIC10 exposure leads to transcriptional induction of the TRAIL gene via transcription factor Foxo3a, which is activated by dual inactivation of Akt and ERK. The Akt and ERK pathways serve as important targets in CSCs. Foxo3a is a key mediator of Akt and ERK-mediated CSC regulation. We hypothesized that the potent antitumor effect of ONC201/TIC10 in colorectal cancer involves targeting CSCs and bulk tumor cells. ONC201/TIC10 depletes CD133(+), CD44(+), and Aldefluor(+) cells in vitro and in vivo. TIC10 significantly inhibits colonosphere formation of unsorted and sorted 5-fluorouracil-resistant CSCs. ONC201/TIC10 significantly reduces CSC-initiated xenograft tumor growth in mice and prevents the passage of these tumors. ONC201/TIC10 treatment also decreased xenograft tumor initiation and was superior to 5-fluorouracil treatment. Thus, ONC201/TIC10 inhibits CSC self-renewal in vitro and in vivo. ONC201/TIC10 inhibits Akt and ERK, consequently activating Foxo3a and significantly induces cell surface TRAIL and DR5 expression in both CSCs and non-CSCs. ONC201/TIC10-mediated anti-CSC effect is significantly blocked by the TRAIL sequestering antibody RIK-2. Overexpression of Akt, DR5 knockdown, and Foxo3a knockdown rescues ONC201/TIC10-mediated depletion of CD44(+) cells and colonosphere inhibition. In conclusion, ONC201/TIC10 is a promising agent for colorectal cancer therapy that targets both non-CSCs and CSCs in an Akt-Foxo3a-TRAIL-dependent manner. ©2015 American Association for Cancer Research.
Prabhu, Varun V.; Allen, Joshua E.; Dicker, David T.; El-Deiry, Wafik S.
2015-01-01
Self-renewing colorectal cancer stem/progenitor cells (CSCs) contribute to tumor maintenance and resistance to therapy. Therapeutic targeting of CSCs could improve treatment response and prolong patient survival. ONC201/TIC10 is a first-in-class anti-tumor agent that induces TRAIL pathway mediated cell death in cancer cells without observed toxicity. We have previously described that ONC201/TIC10 exposure leads to transcriptional induction of the TRAIL gene via transcription factor Foxo3a, which is activated by dual inactivation of Akt and ERK. The Akt and ERK pathways serve as important targets in CSCs. Foxo3a is a key mediator of Akt and ERK-mediated CSC regulation. We hypothesized that the potent anti-tumor effect of ONC201/TIC10 in colorectal cancer involves targeting CSCs and bulk tumor cells. ONC201/TIC10 depletes CD133(+), CD44(+) and Aldefluor(+) cells in vitro and in vivo. TIC10 significantly inhibits colonosphere formation of unsorted and sorted 5-Fluorouracil-resistant CSCs. ONC201/TIC10 significantly reduces CSC-initiated xenograft tumor growth in mice and prevents the passage of these tumors. ONC201/TIC10 treatment also decreased xenograft tumor initiation and was superior to 5-Fluorouracil treatment. Thus, ONC201/TIC10 inhibits CSC self-renewal in vitro and in vivo. ONC201/TIC10 inhibits Akt and ERK, consequently activating Foxo3a and significantly induces cell surface TRAIL and DR5 expression in both CSCs and non-CSCs. ONC201/TIC10-mediated anti-CSC effect is significantly blocked by the TRAIL sequestering antibody RIK-2. Overexpression of Akt, DR5 knockdown and Foxo3a knockdown rescues ONC201/TIC10-mediated depletion of CD44(+) cells and colonosphere inhibition. In conclusion, ONC201/TIC10 is a promising agent for colorectal cancer therapy that targets both non-CSCs and CSCs in an Akt-Foxo3a-TRAIL-dependent manner. PMID:25712124
Rethinking mercury: the role of selenium in the pathophysiology of mercury toxicity.
Spiller, Henry A
2018-05-01
There is increasing evidence that the pathophysiological target of mercury is in fact selenium, rather than the covalent binding of mercury to sulfur in the body's ubiquitous sulfhydryl groups. The role of selenium in mercury poisoning is multifaceted, bidirectional, and central to understanding the target organ toxicity of mercury. An initial search was performed using Medline/PubMed, Toxline, Google Scholar, and Google for published work on mercury and selenium. These searches yielded 2018 citations. Publications that did not evaluate selenium status or evaluated environmental status (e.g., lake or ocean sediment) were excluded, leaving approximately 500 citations. This initial selection was scrutinized carefully and 117 of the most relevant and representative references were selected for use in this review. Binding of mercury to thiol/sulfhydryl groups: Mercury has a lower affinity for thiol groups and higher affinity for selenium containing groups by several orders of magnitude, allowing for binding in a multifaceted way. The established binding of mercury to thiol moieties appears to primarily involve the transport across membranes, tissue distribution, and enhanced excretion, but does not explain the oxidative stress, calcium dyshomeostasis, or specific organ injury seen with mercury. Effects of mercury on selenium and the role this plays in the pathophysiology of mercury toxicity: Mercury impairs control of intracellular redox homeostasis with subsequent increased intracellular oxidative stress. Recent work has provided convincing evidence that the primary cellular targets are the selenoproteins of the thioredoxin system (thioredoxin reductase 1 and thioredoxin reductase 2) and the glutathione-glutaredoxin system (glutathione peroxidase). Mercury binds to the selenium site on these proteins and permanently inhibits their function, disrupting the intracellular redox environment. A number of other important possible target selenoproteins have been identified
Haga, K; Kaminaga, M; Hino, R
2001-01-01
A mercury target is used in the spallation neutron source driven by a high-intensity proton accelerator. In this study, the effectiveness of the cross-flow type mercury target structure was evaluated experimentally and analytically. Prior to the experiment, the mercury flow field and the temperature distribution in the target container were analyzed assuming a proton beam energy and power of 1.5 GeV and 5 MW, respectively, and the feasibility of the cross-flow type target was evaluated. Then the average water flow velocity field in the target mock-up model, which was fabricated from Plexiglass for a water experiment, was measured at room temperature using the PIV technique. Water flow analyses were conducted and the analytical results were compared with the experimental results. The experimental results showed that the cross-flow could be realized in most of the proton beam path area and the analytical result of the water flow velocity field showed good correspondence to the experimental results in the case w...
Estimation of thermochemical behavior of spallation products in mercury target
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, Kaoru; Kaminaga, Masanori; Haga, Katsuhiro; Kinoshita, Hidetaka; Aso, Tomokazu; Teshigawara, Makoto; Hino, Ryutaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
2002-02-01
In order to examine the radiation safety of a spallation mercury target system, especially source term evaluation, it is necessary to clarify the chemical forms of spallation products generated by spallation reaction with proton beam. As for the chemical forms of spallation products in mercury that involves large amounts of spallation products, these forms were estimated by using the binary phase diagrams and the thermochemical equilibrium calculation based on the amounts of spallation product. Calculation results showed that the mercury would dissolve Al, As, B, Be, Bi, C, Co, Cr, Fe, Ga, Ge, Ir, Mo, Nb, Os, Re, Ru, Sb, Si, Ta, Tc, V and W in the element state, and Ag, Au, Ba, Br, Ca, Cd, Ce, Cl, Cs, Cu, Dy, Er, Eu, F, Gd, Hf, Ho, I, In, K, La, Li, Lu, Mg, Mn, Na, Nd, Ni, O, Pb, Pd, Pr, Pt, Rb, Rh, S, Sc, Se, Sm, Sn, Sr, Tb, Te, Ti, Tl, Tm, Y, Yb, Zn and Zr in the form of inorganic mercury compounds. As for As, Be, Co, Cr, Fe, Ge, Ir, Mo, Nb, Os, Pt, Re, Ru, Se, Ta, V, W and Zr, precipitation could be occurred when increasing the amounts of spallation products with operation time of the spallation target system. On the other hand, beryllium-7 (Be-7), which is produced by spallation reaction of oxygen in the cooling water of a safety hull, becomes the main factor of the external exposure to maintain the cooling loop. Based on the thermochemical equilibrium calculation to Be-H{sub 2}O binary system, the chemical forms of Be in the cooling water were estimated. Then the Be could exist in the form of cations such as BeOH{sup +}, BeO{sup +} and Be{sup 2+} under the condition of less than 10{sup -8} of the Be mole fraction in the cooling water. (author)
A Distinct Magnetic Isotope Effect Measured in Atmospheric Mercury in Epiphytes
Ghosh, S.; Odom, A. L.
2007-12-01
Due to the importance of Mercury as an environmental contaminant, mercury cycling in the atmosphere has been extensively studied. However, there still remain uncertainties in the relative amounts of natural and anthropogenic emissions, atmospheric deposition rates as well as the spatial variation of atmospheric mercury. Part of a study to determine the isotopic composition of mercury deposited from the atmosphere has involved the use of epiphytes as monitors. The greatest advantage of such natural monitors is that a widespread, high-density network is possible at low cost. One of the disadvantages at present is that these monitors likely contain different mercury species (for example both gaseous, elemental mercury trapped by adsorption and Hg (II) by wet deposition). The project began with the understanding that biochemical reactions involving metallothioneins within the epiphytes might have produced an isotopic effect. One such regional network was composed of samples of Tillandsia usenoides (common name: Spanish moss) collected along the eastern Coastal Plain of the U.S. from northern Florida to North Carolina. The isotopic composition of a sample is expressed as permil deviations from a standard. The deviations are defined as δAHg = \\left(\\frac{Rsample}{Rstd}-1 \\right)1000 ‰ , where A represents the atomic mass number. R=\\frac{AHg}{202Hg} were measured for the isotopes 198Hg, 199Hg, 200Hg, 201Hg, 202Hg and 204Hg relative to the mercury standard SRM NIST 3133, by a standard-sample bracketing technique. For all samples, the delta values of the even-N plotted against atomic mass numbers define a linear curve. For the odd-N isotopes, δ199Hg and δ201Hg deviate from this mass-dependent fractionation (MDF) relationship and indicate a mass-independent fractionation (MIF) effect and a negative anomaly, i.e. a depletion in 199Hg and 201Hg relative to the even-N isotopes. These deviations are expressed as Δ199Hg = δ199Hgtotal - δ199HgMDF. A Δ201Hg/Δ199Hg
Activation calculation of the EURISOL mercury target
Energy Technology Data Exchange (ETDEWEB)
Rapp, B.; David, J.C.; Blideanu, V.; Dore, D.; Ridikas, D.; Thiolliere, N
2006-08-15
We have used MCNPX coupled to CINDER to estimate the production of radioactive nuclides in the EURISOL 4 MW liquid mercury target during a 40 years'lifetime of the installation. The calculations have been done with different intra-nuclear cascade and fission evaporation model combinations. A benchmark exercise has allowed a better understanding of differences seen between these models for the creation of tritium and fission products. To obtain a realistic production yield for tritium gas in proton induced spallation reactions, we recommend using the ISABEL-RAL model, while both CEM2k and BERTINI-RAL overestimate the production rate above 1 GeV incident proton. The best combinations of models to calculate the residual nuclei production are those using ABLA fission-evaporation model, CEM2k or combinations using RAL model are giving too broad mass distributions when compared to available data. An extensive list of radio-nuclides was obtained and is available on tabular format, we show that the 4 nuclei whose contributions to the total activity of the mercury target (after 40 years of irradiation) are the most important are the following: -) 1 day after shutdown: Y{sup 91} (15%), Y{sup 90} (13%), Hg{sup 197} (6%) and Sr{sup 89} (5%); -) 1 year after shutdown: H{sup 3} (19%), Y{sup 90} (17%), Sr{sup 90} (17%) and Nb{sup 93*} (10%); -) 10 years after shutdown: Y{sup 90} (22%), Sr{sup 90} (22%), H{sup 3} (18%) and Nb{sup 93*} (14%); and -) 100 years after shutdown: Mo{sup 93} (34%), Nb{sup 93*} (32%), Pt{sup 193} (9%) and Y{sup 90} (8%). (A.C.)
Mercury flow experiments. 4th report Measurements of erosion rate caused by mercury flow
Kinoshita, H; Hino, R; Kaminaga, M
2002-01-01
The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be we...
The Merit(nTOF-11) High Intensity Liquid Mercury Target Experiment at the CERN PS
Efthymiopoulos, I; Caretta, O; Carroll, A J; Fabich, A; Graves, V B; Grudiev, A; Haug, F; Kirk, H G; Lettry, Jacques; Loveridge, P; McDonald, K T; Mokhov, N; Palm, M; Park, H; Pernegger, H; Spampinato, P T; Steerenberg, R; Striganov, S; Tsang, T
2008-01-01
The MERIT(nTOF-11) experiment is a proof-ofprinciple test of a target system for a high power proton beam to be used as front-end for a neutrino factory or a muon collider. The experiment took data in autumn 2007 with the fast-extracted beam from the CERN Proton Synchrotron (PS) to a maximum intensity of $30 × 10^{12}$ per pulse. The target system, based on a free mercury jet, is capable of intercepting a 4-MW proton beam inside a 15-T magnetic field required to capture the low energy secondary pions as the source for intense muon beams. Partice detectors installed around the target setup measure the secondary particle flux out of the target and can probe cavitation effects in the mercury jet when excited by an intense proton beam.Preliminary results of the data analysis will be presented here.
Optical diagnostics of mercury jet for an intense proton target.
Park, H; Tsang, T; Kirk, H G; Ladeinde, F; Graves, V B; Spampinato, P T; Carroll, A J; Titus, P H; McDonald, K T
2008-04-01
An optical diagnostic system is designed and constructed for imaging a free mercury jet interacting with a high intensity proton beam in a pulsed high-field solenoid magnet. The optical imaging system employs a backilluminated, laser shadow photography technique. Object illumination and image capture are transmitted through radiation-hard multimode optical fibers and flexible coherent imaging fibers. A retroreflected illumination design allows the entire passive imaging system to fit inside the bore of the solenoid magnet. A sequence of synchronized short laser light pulses are used to freeze the transient events, and the images are recorded by several high speed charge coupled devices. Quantitative and qualitative data analysis using image processing based on probability approach is described. The characteristics of free mercury jet as a high power target for beam-jet interaction at various levels of the magnetic induction field is reported in this paper.
Production of Thallium 201 for medical applications
International Nuclear Information System (INIS)
Braghirolli, A.M.S.
1981-12-01
With the purpose of producing high purity carrier-free 201 Tl, for medical use, a production and separation method was developed using the CV-28 Cyclotron of the Nuclear Engineering Institute in Rio de Janeiro, Brazil. 201 Pb was produced by 24 MeV proton bombardment of natural Tl and allowed to decay to 201 Tl. In the separation process the target is dissolved in HNO 3 , the 201 Pb produced is separated by Fe(OH) 3 coprecipitation, and the Fe is latter separated by anion exchange. The 201 Pb is permited to decay during 32 hrs. 201 Tl is then separated from remaining Pb by anion exchange. The chemical separation is done in a remote processing cell using manipulators, tongs, electric and pneumatic systems. The thick target yield of 201 Pb is 1.7 mCi/μAhr. At the moment the production is restricted to 4 mCi of 201 Tl for each irradiation. (Author) [pt
International Nuclear Information System (INIS)
Takada, Hiroshi; Kasugai, Yoshimi; Nakashima, Hiroshi; Ikeda, Yujiro; Jerde, Eric; Glasgow, David
2000-02-01
A neutronics experiment was carried out using a thick mercury target at the Alternating Gradient Synchrotron (AGS) facility of Brookhaven National Laboratory in a framework of the ASTE (AGS Spallation Target Experiment) collaboration. Reaction rate distributions around the target were measured by the activation technique at incident proton energies of 1.6, 12 and 24 GeV. Various activation detectors such as the 115 In(n,n') 115m In, 93 Nb(n,2n) 92m Nb, and 209 Bi(n,xn) reactions with threshold energies ranging from 0.3 to 70.5 MeV were employed to obtain the reaction rate data for estimating spallation source neutron characteristics of the mercury target. It was found from the measured 115 In(n,n') 115m In reaction rate distribution that the number of leakage neutrons becomes maximum at about 11 cm from the top of hemisphere of the mercury target for the 1.6-GeV proton incidence and the peak position moves towards forward direction with increase of the incident proton energy. The similar result was observed in the reaction rate distributions of other activation detectors. The experimental procedures and a full set of experimental data in numerical form are summarized in this report. (author)
EURISOL MERCURY TARGET EXPERIMENT: CERN SAFETY REPORT
J. Gulley (CERN SC/GS)
Report on a visit to the mercury-handling lab at IPUL. The aim was to provide recommendations to IPUL on general health and safety issues relatring to the handling of mercury, the objective being to reduce exposure to acceptable levels, so far as is reasonably practical.
International Nuclear Information System (INIS)
Fernandes, L.; Silva, C.P.G. da
1986-01-01
The extraction chromatography technique was used for the lig and 201 Tl separation. It was used glass columns of 5,0 cm height and 1,0 cm diameter filled with Voltalef powder impregnated with TBP/cyclohexane. By the Voltalef columns solutions of 203 Hg 2+ , 201 Tl 1+ and 20 1Te 3 were separately percolated in a nitric environment of 4 to 8 M concentration and in a hydrochloridric environment of 0,5 to 4 M. The separation of Hg and 201 Tl was obtained by the retention of 201 Tl3 + in the column during the elution of all the Hg with HCl 2 M. The 201 Tl 3+ was eluted from the column after its reduction with a hot hydrazine dichloride solution. (Author) [pt
Energy Technology Data Exchange (ETDEWEB)
Takada, Hiroshi; Kasugai, Yoshimi; Nakashima, Hiroshi; Ikeda, Yujiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Ino, Takashi; Kawai, Masayoshi [High Energy Accelerator Research Organization, Tsukuba, Ibaraki (Japan); Jerde, Eric; Glasgow, David [Oak Ridge National Laboratory, Oak Ridge, TN (United States)
2000-02-01
A neutronics experiment was carried out using a thick mercury target at the Alternating Gradient Synchrotron (AGS) facility of Brookhaven National Laboratory in a framework of the ASTE (AGS Spallation Target Experiment) collaboration. Reaction rate distributions around the target were measured by the activation technique at incident proton energies of 1.6, 12 and 24 GeV. Various activation detectors such as the {sup 115}In(n,n'){sup 115m}In, {sup 93}Nb(n,2n){sup 92m}Nb, and {sup 209}Bi(n,xn) reactions with threshold energies ranging from 0.3 to 70.5 MeV were employed to obtain the reaction rate data for estimating spallation source neutron characteristics of the mercury target. It was found from the measured {sup 115}In(n,n'){sup 115m}In reaction rate distribution that the number of leakage neutrons becomes maximum at about 11 cm from the top of hemisphere of the mercury target for the 1.6-GeV proton incidence and the peak position moves towards forward direction with increase of the incident proton energy. The similar result was observed in the reaction rate distributions of other activation detectors. The experimental procedures and a full set of experimental data in numerical form are summarized in this report. (author)
Fabich, A; Fabjan, Christian
2002-01-01
The feasibility of liquid metal jet targets for secondary particle production with high power proton beams has been studied. The main aspects of the thesis were benchmark experiments covering the behaviour of liquid targets under thermal shock waves induced by high power proton beams, and also magnetohydrodynamic effects. Severe challenges were imposed by safety issues and the restricted beam time to the tests in ISOLDE at CERN and at the High Magnetic Field Laboratory at Grenoble. Restricted access times in high radiation level areas were of the order of minutes and in this short time span, the complete experimental setup had to be performed and verified. The involvement of mercury as liquid target material and its activation during beam tests demanded special confinement precautions. The setup for both experiments was based on the use of a high speed camera system for observation of the mercury target. The presence of high radiation or high magnetic field required the installation of the sensitive camera sy...
International Nuclear Information System (INIS)
Haga, Katsuhiro; Terada, Atsuhiko; Kaminaga, Masanori; Hino, Ryutaro
2001-01-01
In this study the effectiveness of the cross-flow type mercury target structure was evaluated experimentally and analytically. The average water flow velocity field in the target mock-up model, which was fabricated with plexiglass, was measured at room temperature using the PIV (Particle Image Velocimetry) technique. The water flow analyses were conducted and the analytical results were compared with the experimental results. The experimental results showed that the cross-flow could be realized in the former part of the proton beam path where the heat load by the spallation reaction is large, and the analytical result of the water flow velocity field showed good correspondence to the experimental result in the case of the Reynolds number of more than 4.83 x 10 5 at the model inlet. With these results, the effectiveness of the cross-flow type mercury target structure and the present analysis code system was demonstrated. Then the mercury flow field and the temperature distribution in the target container were analyzed assuming the proton beam energy and power of 3 GeV and 5 MW. The analytical result showed that the cross-flow field of mercury, which is similar to the water flow field, could also be attained. (author)
Production of thallium 201 for medical use
International Nuclear Information System (INIS)
Venikov, N.I.; Konyakhin, N.A.; Kozlova, M.D.; Volkova, N.M.
1986-01-01
An important product among the radiopharmaceuticals currently used in cardiology is T1 201 chloride, due to its nuclear-physical properties and its clinical value as a diagnostic tool. The authors explain and discuss the basic characteristics which determine the radiopharmaceutical quality of T1 201: its radiochemical purity and its chemical impurity content, which depend on the target-irradiation conditions - type of nuclear reaction, target material and design, particle energy, irradiation time - and the reprocessing technology. A production flow chart is presented which shows that ions are accelerated within a wide mass and energy range suitable for the production of T1 201 in different nuclear reactions. Cyclotron reconstruction for T1 201 production is discussed
International Nuclear Information System (INIS)
Kasugai, Y.; Takada, H.; Nakashima, H.
2001-01-01
An integral experiment on radioactivity induced in spallation neutron fields was carried out under the ASTE (AGS-Spallation Target Experiment) collaboration using AGS (Alternative Gradient Synchrotron) at BNL (Brookhaven National Laboratory). The spallation neutrons were produced by bombarding a mercury target with protons of 1.6, 12 and 24 GeV. The number of protons was 3 - 4 x 10 13 for each irradiation. The irradiated materials were titanium, nickel, cobalt, yttrium, and bismuth, and placed on the cylindrical surface of the mercury target at the distance of 15 - 16 cm from the beam-incident-surface of the target. Disintegration rates of induced radioactivities were measured at several cooling-time ranging from hours to months. The principal nuclides contributing to the radioactivity were pointed out for each material. The experimental results for bismuth were compared with the calculations with DCAHIN-SP code. (author)
Mercury purification in the megawatt liquid metal spallation target of EURISOL-DS
Neuhausen, Joerg; Eller, Martin; Schumann, Dorothea; Eichler, Bernd; Horn, Susanne
High power spallation targets are going to be used extensively in future research and technical facilities such as spallation neutron sources, neutrino factories, radioactive beam facilities or accelerator driven systems for the transmutation of long-lived nuclear waste. Within EURISOL-DS, a 4 MW liquid metal spallation target is designed to provide neutrons for a fission target, where neutron rich radionuclides will be produced. For the spallation target, mercury is planned to be used as target material. A large amount of radionuclides ranging from atomic number Z=1 to 81 will be produced in the liquid metal during long term irradiation. It is planned to remove those radionuclides by chemical or physicochemical methods to reduce its radioactivity. For the development of a purification procedure, knowledge about the chemical state of the different elements present in the mixture is required. We present a general concept of applicable separation techniques in a target system and show some results of experiment...
Energy Technology Data Exchange (ETDEWEB)
Kasugai, Y.; Takada, H.; Nakashima, H. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment] [and others
2001-03-01
An integral experiment on radioactivity induced in spallation neutron fields was carried out under the ASTE (AGS-Spallation Target Experiment) collaboration using AGS (Alternative Gradient Synchrotron) at BNL (Brookhaven National Laboratory). The spallation neutrons were produced by bombarding a mercury target with protons of 1.6, 12 and 24 GeV. The number of protons was 3 - 4 x 10{sup 13} for each irradiation. The irradiated materials were titanium, nickel, cobalt, yttrium, and bismuth, and placed on the cylindrical surface of the mercury target at the distance of 15 - 16 cm from the beam-incident-surface of the target. Disintegration rates of induced radioactivities were measured at several cooling-time ranging from hours to months. The principal nuclides contributing to the radioactivity were pointed out for each material. The experimental results for bismuth were compared with the calculations with DCAHIN-SP code. (author)
Energy Technology Data Exchange (ETDEWEB)
Korbas, Malgorzata; MacDonald, Tracy C.; Pickering, Ingrid J.; George, Graham N.; Krone, Patrick H. (Saskatchewan)
2013-04-08
Mercury, one of the most toxic elements, exists in various chemical forms each with different toxicities and health implications. Some methylated mercury forms, one of which exists in fish and other seafood products, pose a potential threat, especially during embryonic and early postnatal development. Despite global concerns, little is known about the mechanisms underlying transport and toxicity of different mercury species. To investigate the impact of different mercury chemical forms on vertebrate development, we have successfully combined the zebrafish, a well-established developmental biology model system, with synchrotron-based X-ray fluorescence imaging. Our work revealed substantial differences in tissue-specific accumulation patterns of mercury in zebrafish larvae exposed to four different mercury formulations in water. Methylmercury species not only resulted in overall higher mercury burdens but also targeted different cells and tissues than their inorganic counterparts, thus revealing a significant role of speciation in cellular and molecular targeting and mercury sequestration. For methylmercury species, the highest mercury concentrations were in the eye lens epithelial cells, independent of the formulation ligand (chloride versus L-cysteine). For inorganic mercury species, in absence of L-cysteine, the olfactory epithelium and kidney accumulated the greatest amounts of mercury. However, with L-cysteine present in the treatment solution, mercuric bis-L-cysteineate species dominated the treatment, significantly decreasing uptake. Our results clearly demonstrate that the common differentiation between organic and inorganic mercury is not sufficient to determine the toxicity of various mercury species.
Double spike with isotope pattern deconvolution for mercury speciation
International Nuclear Information System (INIS)
Castillo, A.; Rodriguez-Gonzalez, P.; Centineo, G.; Roig-Navarro, A.F.; Garcia Alonso, J.I.
2009-01-01
Full text: A double-spiking approach, based on an isotope pattern deconvolution numerical methodology, has been developed and applied for the accurate and simultaneous determination of inorganic mercury (IHg) and methylmercury (MeHg). Isotopically enriched mercury species ( 199 IHg and 201 MeHg) are added before sample preparation to quantify the extent of methylation and demethylation processes. Focused microwave digestion was evaluated to perform the quantitative extraction of such compounds from solid matrices of environmental interest. Satisfactory results were obtained in different certificated reference materials (dogfish liver DOLT-4 and tuna fish CRM-464) both by using GC-ICPMS and GC-MS, demonstrating the suitability of the proposed analytical method. (author)
Dependence of quality of Thallium-201 on irradiation data
International Nuclear Information System (INIS)
Sattari, I.; Aslani, G.; Dehghan, M. K.; Shirazi, B.; Shafie, M.; Shadanpour, N.; Winkel, P. V.
2003-01-01
Background: Thallium-201 is produced through 203 Tl (p,3 n) 201 pb 201 Tl reaction by cyclotron. This radioisotope has known as one of the cyclotron radioisotopes which is used for myocardial perfusion in the coronary artery disease, Ti-201 after chemical purification and quality control in the form of 201 Tl-chloride is ready to send the hospitals. Materials and methods: In this work the effect of the proton energy on quality of a Ti-201, was studied. Radionuclidic purity was determined by high purity Ge (H P Ge) detector Gamma spectrometer, in production time and after one half-life (73 h). The targets were coated with Enriched Thallium-203 (97%). Results: The variation of thickness of targets was 18.3±1.3μm. The different energies of bombardment on quality of Tl-201 and Tl-200, Tl-202, and Pb-203 (as impurity) were studied. The results have been that optimum energy for proton was 28.5 MeV. Conclusion: The variation energy of bombardment can change the purity of Tl-201 but all results were in standard range according to the United States Pharmacopoeia (USP) and European Pharmacopoeia
Commercial production of thallium-201 chloride
International Nuclear Information System (INIS)
Sokolov, S.V.; Volkova, N.M.; Skokov, V.S.
1989-01-01
Thallium-201 chloride pharmaceuticals production practice at the Medradiopreparat factory under USSR Ministry of Public Health is described. The factory is carried out series-produced supplies of the compound prepared according to a new practice from September, 1985. Thallium-201 extraction from cyclotron targets irradiated is carried out by the extraction method
Energy Technology Data Exchange (ETDEWEB)
Gao, Ying; Shi, Zeming; Zong, Qinxia; Wu, Peng; Su, Jing [Sichuan Provincial Key Laboratory of Nuclear Technology in Geology, College of Nuclear Technology and Automation Engineering, Chengdu University of Technology, Chengdu 610059 (China); Liu, Rui, E-mail: liur.ray@gmail.com [Mineral Resources Chemistry Key Laboratory of Sichuan Higher Education Institutions, College of Materials and Chemistry and Chemical Engineering, Chengdu University of Technology, Chengdu 610059 (China)
2014-02-17
Graphical abstract: -- Highlights: •Simple, sensitive, and accurate method is established for mercury determination in cosmetics. •The sample preparation procedure is highly simplified. •Isotope dilution efficiently eliminates matrix effect. •First report of using formic acid based method in combination with PVG-ID-ICP MS for mercury quantitation in cosmetics. -- Abstract: A new method was proposed for the accurate determination of mercury in cosmetic samples based on isotopic dilution (ID)-photochemical vapor generation (PVG)-inductively coupled plasma mass spectrometry (ICP MS) measurement. Cosmetic samples were directly dissolved in formic acid solution and subsequently subjected to PVG for the reduction of mercury into vapor species following by ICP MS detection. Therefore, the risks of analyte contamination and loss were avoided. Highly enriched {sup 201}Hg isotopic spike is added to cosmetics and the isotope ratios of {sup 201}Hg/{sup 202}Hg were measured for the quantitation of mercury. With ID calibration, the influences originating from sample matrixes for the determination of mercury in cosmetic samples have been efficiently eliminated. The effects of several experimental parameters, such as the concentration of the formic acid, and the flow rates of carrier gas and sample were investigated. The method provided good reproducibility and the detection limits were found to be 0.6 pg mL{sup −1}. Finally, the developed method was successfully applied for the determination of mercury in six cosmetic samples and a spike test was performed to verify the accuracy of the method.
Mercury isotope fractionation during transfer from post-desulfurized seawater to air.
Huang, Shuyuan; Lin, Kunning; Yuan, Dongxing; Gao, Yaqin; Sun, Lumin
2016-12-15
Samples of dissolved gaseous mercury (DGM) in the post-desulfurized seawater discharged from a coal-fired power plant together with samples of gaseous elemental mercury (GEM) over the post-desulfurized seawater surface were collected and analyzed to study the mercury isotope fractionation during transfer from post-desulfurized seawater to air. Experimental results showed that when DGM in the seawater was converted to GEM in the air, the δ 202 Hg and Δ 199 Hg values were changed, ranging from -2.98 to -0.04‰ and from -0.31 to 0.64‰, respectively. Aeration played a key role in accelerating the transformation of DGM to GEM, and resulted in light mercury isotopes being more likely to be enriched in the GEM. The ratio Δ 199 Hg/Δ 201 Hg was 1.626 in all samples, suggesting that mercury mass independent fractionation occurred owing to the nuclear volume effect during the transformation. In addition, mass independent fractionation of mercury even isotopes was found in the GEM above the post-desulfurized seawater surface in the aeration pool. Copyright © 2016 Elsevier Ltd. All rights reserved.
Martensitic/ferritic steels as container materials for liquid mercury target of ESS
International Nuclear Information System (INIS)
Dai, Y.
1996-01-01
In the previous report, the suitability of steels as the ESS liquid mercury target container material was discussed on the basis of the existing database on conventional austenitic and martensitic/ferritic steels, especially on their representatives, solution annealed 316 stainless steel (SA 316) and Sandvik HT-9 martensitic steel (HT-9). Compared to solution annealed austenitic stainless steels, martensitic/ferritic steels have superior properties in terms of strength, thermal conductivity, thermal expansion, mercury corrosion resistance, void swelling and irradiation creep resistance. The main limitation for conventional martensitic/ferritic steels (CMFS) is embrittlement after low temperature (≤380 degrees C) irradiation. The ductile-brittle transition temperature (DBTT) can increase as much as 250 to 300 degrees C and the upper-shelf energy (USE), at the same time, reduce more than 50%. This makes the application temperature range of CMFS is likely between 300 degrees C to 500 degrees C. For the present target design concept, the temperature at the container will be likely controlled in a temperature range between 180 degrees C to 330 degrees C. Hence, CMFS seem to be difficult to apply. However, solution annealed austenitic stainless steels are also difficult to apply as the maximum stress level at the container will be higher than the design stress. The solution to the problem is very likely to use advanced low-activation martensitic/ferritic steels (LAMS) developed by the fusion materials community though the present database on the materials is still very limited
Mercury Thermal Hydraulic Loop (MTHL) Summary Report
Energy Technology Data Exchange (ETDEWEB)
Felde, David K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Crye, Jason Michael [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wendel, Mark W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Yoder, Jr, Graydon L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Farquharson, George [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jallouk, Philip A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); McFee, Marshall T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Pointer, William David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ruggles, Art E. [Univ. of Tennessee, Knoxville, TN (United States); Carbajo, Juan J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-03-01
The Spallation Neutron Source (SNS) is a high-power linear accelerator built at Oak Ridge National Laboratory (ORNL) which incorporates the use of a flowing liquid mercury target. The Mercury Thermal Hydraulic Loop (MTHL) was constructed to investigate and verify the heat transfer characteristics of liquid mercury in a rectangular channel. This report provides a compilation of previously reported results from the water-cooled and electrically heated straight and curved test sections that simulate the geometry of the window cooling channel in the target nose region.
Trace-level mercury removal from surface water
International Nuclear Information System (INIS)
Klasson, K.T.; Bostick, D.T.
1998-01-01
Many sorbents have been developed for the removal of mercury and heavy metals from waters; however, most of the data published thus far do not address the removal of mercury to the target levels represented in this project. The application to which these sorbents are targeted for use is the removal of mercury from microgram-per-liter levels to low nanogram-per-liter levels. Sorbents with thiouronium, thiol, amine, sulfur, and proprietary functional groups were selected for these studies. Mercury was successfully removed from surface water via adsorption onto Ionac SR-4 and Mersorb resins to levels below the target goal of 12 ng/L in batch studies. A thiol-based resin performed the best, indicating that over 200,000 volumes of water could be treated with one volume of resin. The cost of the resin is approximately $0.24 per 1,000 gal of water
Innovative Waste Management in the Mercury Loop of the EURISOL Multi-MW Converter Target
PSI: Jörg Neuhausen, Dorothea Schumann, Rugard Dressler, Susanne Horn, Sabrina Lüthi, Stephan Heinitz, Suresh ChirikiCERN: Thierry Stora, Martin Eller
The choice of mercury as target material imposes various questions concerning the safe operation of such a system that are related to the physical and chemical properties of the target material itself and the nuclear reaction products produced within the target during its life time of several decades. Therefore, a subtask was created within the EURISOL-DS project that is concerned with studying an innovative waste management for the generated radioactivity by chemical means. Such a study strongly depends on the radioactive inventory and its distribution throughout the target and loop system. Radioactive inventory calculations were performed within task 5 [6]. The distribution of nuclear reaction products and their chemical state that can be expected within the target and loop system is one of the topics covered in this report. Based on the results obtained by theoretical studies as well as laboratory scale experiments, the feasibility of waste reduction using chemical methods, both conventional (e.g. leaching...
Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT
International Nuclear Information System (INIS)
Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J.
1990-01-01
The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared
Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT
Energy Technology Data Exchange (ETDEWEB)
Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J. (Kanazawa Univ. (Japan))
1990-06-01
The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared.
Energy Technology Data Exchange (ETDEWEB)
Long, S.E.; Kelly, W.R.
2002-04-01
A method based on isotope dilution cold-vapor inductively coupled plasma mass spectrometry (ID-CV-ICPMS) has been developed for high-accuracy determinations of mercury in bituminous and sub-bituminous coals. A closed-system digestion process employing a Carius tube is used to completely oxidize the coal matrix and chemically equilibrate the mercury in the sample with a Hg-201 isotopic spike. The digestates are diluted with high-purity quartz-distilled water, and the mercury is released as a vapor by reduction with tin chloride. Measurements of Hg-201/Hg-202 isotope ratios are made using a quadrupole ICPMS system in time-resolved analysis mode. The new method has some significant advantages over existing methods. The instrument detection limit is less than 1 pg/mL. The average blank (n = 17) is 30 pg, which is roughly 1 order of magnitude lower than the equivalent microwave digestion procedure. The detection limit in coal is blank limited and is similar to 40 pg/g. Memory effects are very low. The relative reproducibility of the analytical measurements is similar to 0.5% for mercury concentrations in the range 10-150 ng/g. The method has been used to measure mercury concentrations in six coal reference materials, SRM 1632b (77.4 ng/g), SRM 1632c (94.3 ng/g), BCR 40 (433.2 ng/g), BCR 180 (125.0 ng/g), BCR 181 (135.8 ng/g), and SARM 20 (252.6 ng/g), as well as a coal fly ash, SRM 1633b (143.1 ng/g). The method is equally applicable to other types of fossil fuels including both crude and refined oils.
Energy Technology Data Exchange (ETDEWEB)
Pickhardt, Paul C. [Department of Biological Sciences, Dartmouth College, Hanover, NH 03755 (United States)]. E-mail: paul.pickhardt@stonybrook.edu; Folt, Carol L. [Department of Biological Sciences, Dartmouth College, Hanover, NH 03755 (United States); Chen, Celia Y. [Department of Biological Sciences, Dartmouth College, Hanover, NH 03755 (United States); Klaue, Bjoern [Department of Geological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Blum, Joel D. [Department of Geological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States)
2005-03-01
There is a well documented accumulation of mercury in fish to concentrations of concern for human consumption. Variation in fish Hg burden between lakes is often high and may result from differences in Hg transfer through lower levels of the food web where mercury is bioconcentrated to phytoplankton and transferred to herbivorous zooplankton. Prior research derived patterns of mercury accumulation in freshwater invertebrates from field collected animals. This study provides results from controlled mesocosm experiments comparing the effects of zooplankton composition, algal abundance, and the chemical speciation of mercury on the ability of zooplankton to accumulate mercury from phytoplankton and transfer that mercury to planktivores. Experiments were conducted in 550-L mesocosms across a gradient of algal densities manipulated by inorganic nutrient additions. Enriched, stable isotopes of organic (CH{sub 3} {sup 200}HgCl) and inorganic ({sup 201}HgCl{sub 2}) mercury were added to mesocosms and their concentrations measured in water, seston, and three common zooplankton species. After 2 weeks, monomethylmercury (MMHg) concentrations were two to three times lower in the two copepod species, Leptodiaptomus minutus and Mesocyclops edax than in the cladoceran, Daphnia mendotae. All three zooplankton species had higher MMHg concentrations in mesocosms with low versus high initial algal abundance. However, despite higher concentrations of inorganic mercury (Hg{sub I}) in seston from low nutrient mesocosms, there were no significant differences in the Hg{sub I} accumulated by zooplankton across nutrient treatments. Bioaccumulation factors for MMHg in the plankton were similar to those calculated for plankton in natural lakes and a four-compartment (aqueous, seston, macrozooplankton, and periphyton/sediments) mass balance model after 21 days accounted for {approx}18% of the CH{sub 3} {sup 200}Hg and {approx}33% of the {sup 201}Hg added. Results from our experiments
International Nuclear Information System (INIS)
Pickhardt, Paul C.; Folt, Carol L.; Chen, Celia Y.; Klaue, Bjoern; Blum, Joel D.
2005-01-01
There is a well documented accumulation of mercury in fish to concentrations of concern for human consumption. Variation in fish Hg burden between lakes is often high and may result from differences in Hg transfer through lower levels of the food web where mercury is bioconcentrated to phytoplankton and transferred to herbivorous zooplankton. Prior research derived patterns of mercury accumulation in freshwater invertebrates from field collected animals. This study provides results from controlled mesocosm experiments comparing the effects of zooplankton composition, algal abundance, and the chemical speciation of mercury on the ability of zooplankton to accumulate mercury from phytoplankton and transfer that mercury to planktivores. Experiments were conducted in 550-L mesocosms across a gradient of algal densities manipulated by inorganic nutrient additions. Enriched, stable isotopes of organic (CH 3 200 HgCl) and inorganic ( 201 HgCl 2 ) mercury were added to mesocosms and their concentrations measured in water, seston, and three common zooplankton species. After 2 weeks, monomethylmercury (MMHg) concentrations were two to three times lower in the two copepod species, Leptodiaptomus minutus and Mesocyclops edax than in the cladoceran, Daphnia mendotae. All three zooplankton species had higher MMHg concentrations in mesocosms with low versus high initial algal abundance. However, despite higher concentrations of inorganic mercury (Hg I ) in seston from low nutrient mesocosms, there were no significant differences in the Hg I accumulated by zooplankton across nutrient treatments. Bioaccumulation factors for MMHg in the plankton were similar to those calculated for plankton in natural lakes and a four-compartment (aqueous, seston, macrozooplankton, and periphyton/sediments) mass balance model after 21 days accounted for ∼18% of the CH 3 200 Hg and ∼33% of the 201 Hg added. Results from our experiments corroborate results from field studies and suggest the
International Nuclear Information System (INIS)
Tutu, N.K.; Greene, G.A.
1994-09-01
Experiments were performed to measure the fraction of mercury inventory released when droplets of molten lead, doped with a known concentration of mercury, fall through a controlled environment. The temperature of molten droplets ranged from 335 C to 346 C, and the concentration of mercury in the droplets ranged from 0.2 mass % to 1.0 mass %. The environment consisted of an air stream, at a temperature nominally equal to the melt temperature, and moving vertically upwards at a velocity of 10 cm/s. Direct observations and chemical analysis showed that no mercury was released from the molten droplets. Based upon the experimental results, it is concluded that no mercury vapor is likely to be released from the potentially molten source rod material in the APT-SILC Neutron Source Array to the confinement atmosphere during a postulated Large Break Loss Of Coolant Accident scenario leading to the melting of a fraction of the source rods
Futakawa, M; Conrad, H; Stechemesser, H
2000-01-01
The international ASTE collaboration has performed a first series of measurements on a spallation neutron source target at the Alternating Gradient Synchrotron (AGS) in Brookhaven. The dynamic response of a liquid mercury target hit by high-power proton pulses of about 40 ns duration has been measured by a laser Doppler technique and compared with finite elements calculations using the ABAQUS code. It is shown that the calculation can describe the experimental results for at least the time interval up to 100 mu s after the pulse injection. Furthermore, it has been observed that piezoelectric pressure transducers cannot be applied in the high gamma-radiation field of a spallation target.
International Nuclear Information System (INIS)
Kasugai, Yoshimi; Takada, Hiroshi; Meigo, Shin-ichiro
2001-02-01
Characteristic of spallation neutrons driven by GeV protons from a mercury target with a lead-reflector and light-water-moderator was studied experimentally using the Alternating Gradient Synchrotron (AGS) facility of Brookhaven National Laboratory in a framework of the ASTE (AGS Spallation Target Experiment) collaboration. Several reaction rates along with the mercury target were measured with the activation method at incident proton energies of 1.94, 12 and 24 GeV. Indium, niobium, aluminum, cobalt, nickel and bismuth were used as activation detectors to cover the threshold energy of between 0.33 and 40.9 MeV. This report summarizes the experimental procedure with all the measured data. (author)
Isolation of radioactive thallium from lead targets
International Nuclear Information System (INIS)
Kozlova, M.D.; Sevast'yanova, A.S.; Malinin, A.B.; Kurenkov, N.V.
1989-01-01
Two methods of thallium-201 preperation from Pb-targets irradiated with protons: precipitation-extraction (1) and extraction (2) - are developed. When the target irraiated is extracted during the time necessary for bismuth-201 transformation into lead-201, lead macroquantity containing lead-201 was separated from undesirable thallium radionuclides, which are formed in direct nuclear reactions. The lead fraction was extracted to accumulate thallium-201, and it was separated from lead mocroquantity. The target was dissolved in the nitric acid. The 1st method differs from the 2nd one by the fact that before thallium-201 extraction, lead was precipitaed by the nitric acid. The 1st method permits to separate thallium-201 with chemical yield not less than 90 %, the 2nd one - ≥95 %. 2 refs
Qing, Zhihe; Zhu, Lixuan; Li, Xiaoxuan; Yang, Sheng; Zou, Zhen; Guo, Jingru; Cao, Zhong; Yang, Ronghua
2017-10-17
As well-known, the excessive discharge of heavy-metal mercury not only destroys the ecological environment, bust also leads to severe damage of human health after ingestion via drinking and bioaccumulation of food chains, and mercury ion (Hg 2+ ) is designated as one of most prevalent toxic metal ions in drinking water. Thus, the high-performance monitoring of mercury pollution is necessary. Functional nucleic acids have been widely used as recognition probes in biochemical sensing. In this work, a carbazole derivative, ethyl-4-[3,6-bis(1-methyl-4-vinylpyridium iodine)-9H-carbazol -9-yl)] butanoate (EBCB), has been synthesized and found as a target-lighted DNA fluorescent indicator. As a proof-of-concept, Hg 2+ detection was carried out based on EBCB and Hg 2+ -mediated conformation transformation of a designed DNA probe. By comparison with conventional nucleic acid indicators, EBCB held excellent advantages, such as minimal background interference and maximal sensitivity. Outstanding detection capabilities were displayed, especially including simple operation (add-and-read manner), ultrarapidity (30 s), and low detection limit (0.82 nM). Furthermore, based on these advantages, the potential for high-performance screening of mercury antagonists was also demonstrated by the fluorescence change of EBCB. Therefore, we believe that this work is meaningful in pollution monitoring, environment restoration and emergency treatment, and may pave a way to apply EBCB as an ideal signal transducer for development of high-performance sensing strategies.
Taverne, Yannick J; de Wijs-Meijler, Daphne; Te Lintel Hekkert, Maaike; Moon-Massat, Paula F; Dubé, Gregory P; Duncker, Dirk J; Merkus, Daphne
2017-05-01
Hemoglobin-based oxygen carrier (HBOC)-201 is a cell-free modified hemoglobin solution potentially facilitating oxygen uptake and delivery in cardiovascular disorders and hemorrhagic shock. Clinical use has been hampered by vasoconstriction in the systemic and pulmonary beds. Therefore, we aimed to 1 ) determine the possibility of counteracting HBOC-201-induced pressor effects with either adenosine (ADO) or nitroglycerin (NTG); 2 ) assess the potential roles of nitric oxide (NO) scavenging, reactive oxygen species (ROS), and endothelin (ET) in mediating the observed vasoconstriction; and 3 ) compare these effects in resting and exercising swine. Chronically instrumented swine were studied at rest and during exercise after administration of HBOC-201 alone or in combination with ADO. The role of NO was assessed by supplementation with NTG or administration of the eNOS inhibitor N ω -nitro-l-arginine. Alternative vasoactive pathways were investigated via intravenous administration of the ET A /ET B receptor blocker tezosentan or a mixture of ROS scavengers. The systemic and to a lesser extent the pulmonary pressor effects of HBOC-201 could be counteracted by ADO; however, dosage titration was very important to avoid systemic hypotension. Similarly, supplementation of NO with NTG negated the pressor effects but also required titration of the dose. The pressor response to HBOC-201 was reduced after eNOS inhibition and abolished by simultaneous ET A /ET B receptor blockade, while ROS scavenging had no effect. In conclusion, the pressor response to HBOC-201 is mediated by vasoconstriction due to NO scavenging and production of ET. Further research should explore the effect of longer-acting ET receptor blockers to counteract the side effect of hemoglobin-based oxygen carriers. NEW & NOTEWORTHY Hemoglobin-based oxygen carrier (HBOC)-201 can disrupt hemodynamic homeostasis, mimicking some aspects of endothelial dysfunction, resulting in elevated systemic and pulmonary blood
International Nuclear Information System (INIS)
Vilas, F.; Chapman, C.R.; Matthews, M.S.
1988-01-01
Papers are presented on future observations of and missions to Mercury, the photometry and polarimetry of Mercury, the surface composition of Mercury from reflectance spectrophotometry, the Goldstone radar observations of Mercury, the radar observations of Mercury, the stratigraphy and geologic history of Mercury, the geomorphology of impact craters on Mercury, and the cratering record on Mercury and the origin of impacting objects. Consideration is also given to the tectonics of Mercury, the tectonic history of Mercury, Mercury's thermal history and the generation of its magnetic field, the rotational dynamics of Mercury and the state of its core, Mercury's magnetic field and interior, the magnetosphere of Mercury, and the Mercury atmosphere. Other papers are on the present bounds on the bulk composition of Mercury and the implications for planetary formation processes, the building stones of the planets, the origin and composition of Mercury, the formation of Mercury from planetesimals, and theoretical considerations on the strange density of Mercury
Sorption technique of separation of thallium-201 from proton-irradiated thallium
International Nuclear Information System (INIS)
Deptula, Cz.; Zajtseva, N.G.; Mikolaevskij, S.; Khalkin, V.A.
1989-01-01
A sorption technique is developed for radiochemical separation of thallium-201 from proton-irradiated targets of metallic thallium. The technique consists in separation of 201 Pb and 201 Tl in the column with ammonium 12-molybdophosphate fixed in the matrix of porous Teflon (AMP-sorbent). The chemical yield of radiothallium is 98 %, the duration of chemical procedures is 2.5-3 hours. 21 refs.; 1 fig.; 1 tab
Mercury emission from crematories in Japan
Directory of Open Access Journals (Sweden)
M. Takaoka
2010-04-01
Full Text Available Anthropogenic sources of mercury emissions have a significant impact on global pollution. Therefore, finding uncharacterised sources and assessing the emissions from these sources are important. However, limited data are available worldwide on mercury emissions from crematories. In Japan, 99.9% of dead bodies are cremated, which is the highest percentage in the world, and more than 1600 crematories are in operation. We thus focused on emissions from crematories in Japan. The number of targeted facilities was seven, and we used continuous emission monitoring to measure the mercury concentrations and investigate mercury behaviour. The total mercury concentrations in stack gases were a few μg/Nm3 (normal cubic meters. Considering the time profile of mercury and its species in cremations, the findings confirmed that the mercury in stack gas originated from dental amalgam. The amount of mercury emissions was calculated using the total concentration and gas flow rate. Furthermore, the annual amount of mercury emission from crematories in Japan was estimated by using the total number of corpses. The emission amount was considerably lower than that estimated in the United Kingdom. From statistical analyses on population demographics and measurements, future total emissions from crematories were also predicted. As a result, the amount of mercury emitted by crematories will likely increase by 2.6-fold from 2007 to 2037.
MESSENGER at Mercury: Early Orbital Operations
McNutt, Ralph L., Jr; Solomon, Sean C.; Bedini, Peter D.; Anderson, Brian J.; Blewett, David T.; Evans, Larry G.; Gold, Robert E.; Krimigis, Stamatios M.; Murchie, Scott L.; Nittler, Larry R.;
2013-01-01
The MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft, launched in August 2004 under NASA's Discovery Program, was inserted into orbit about the planet Mercury in March 2011. MESSENGER's three flybys of Mercury in 2008-2009 marked the first spacecraft visits to the innermost planet since the Mariner 10 flybys in 1974-1975. The unprecedented orbital operations are yielding new insights into the nature and evolution of Mercury. The scientific questions that frame the MESSENGER mission led to the mission measurement objectives to be achieved by the seven payload instruments and the radio science experiment. Interweaving the full set of required orbital observations in a manner that maximizes the opportunity to satisfy all mission objectives and yet meet stringent spacecraft pointing and thermal constraints was a complex optimization problem that was solved with a software tool that simulates science observations and tracks progress toward meeting each objective. The final orbital observation plan, the outcome of that optimization process, meets all mission objectives. MESSENGER's Mercury Dual Imaging System is acquiring a global monochromatic image mosaic at better than 90% coverage and at least 250 m average resolution, a global color image mosaic at better than 90% coverage and at least 1 km average resolution, and global stereo imaging at better than 80% coverage and at least 250 m average resolution. Higher-resolution images are also being acquired of targeted areas. The elemental remote sensing instruments, including the Gamma-Ray and Neutron Spectrometer and the X-Ray Spectrometer, are being operated nearly continuously and will establish the average surface abundances of most major elements. The Visible and Infrared Spectrograph channel of MESSENGER's Mercury Atmospheric and Surface Composition Spectrometer is acquiring a global map of spectral reflectance from 300 to 1450 nm wavelength at a range of incidence and emission
Mercury speciation analysis in marine samples by HPLC-ICPMS
DEFF Research Database (Denmark)
Rasmussen, Rie Romme; Svendsen, Maja Erecius; Herbst, M. Birgitte Koch
Mercury (Hg) is a naturally occurring element, which is found in the earth’s crust and can be released into the environment through both natural and anthropogenic processes. Mercury exists as elemental mercury (metallic), inorganic mercury and organic mercury (primarily methylmercury......). Methylmercury is highly toxic, particularly to the nervous system, and the developing brain is thought to be the most sensitive target organ for methylmercury toxicity. Methylmercury bioaccumulates and biomagnifies along the food chain and it is the most common mercury species in fish and seafood. Human...... hydrochloric acid by sonication. Hereby the protein-bound mercury species are released. The extracts were then centrifuged (10 min at 3170 x g) and the supernatant decanted (extraction step was repeated twice). The combined extracts were added 10 M sodium hydroxide to increase pH, following further dilution...
Chapman, Clark R.
2004-01-01
Forty years after Mariner 2, planetary exploration has still only just begun, and many more missions are on drawing boards, nearing the launch pad, or even en route across interplanetary space to their targets. One of the most challenging missions that will be conducted this decade is sending the MESSENGER spacecraft to orbit the planet Mercury.…
International Nuclear Information System (INIS)
Kinoshita, Hidetaka; Kaminaga, Masanori; Hino, Ryutaro
2000-02-01
In order to promote the Neutron Science Project of JAERI, the design of a 5MW-spallation target system is in progress with the purpose of producing a practical neutron application while at the same time adhering to the highest levels of safety. To establish the safety of the target system, it is important to understand the transient behaviors during anticipated operational events of the system, and to design the safety protection systems for the safe termination of the transients. This report presents the analytical results of transient behaviors in the mercury experimental loop using mercury properties. At first, the analytical pressure distributions were compared with experimental data measured with the mercury experimental loop. The modeling data were modified to reproduce the actual pressure distributions of the mercury experimental loop. Then a loss of forced convection and a loss of coolant accident were analyzed. In the case of the pump trip, the transient analysis was conducted using two types of mercury pumps, the mechanical type pump with moment of inertia, and the electrical-magnetic type pump without moment of inertia. The results show there was no clear difference in the two analyses, since the mercury had a large inertia, which was 13.5 times that of the water. Moreover, in the case of a pipe rupture at the pump exit, a moderate pressure decrease was confirmed when a small breakage area existed in which the coolant flowed out gradually. Based on these results, it was appeared that the transient fluctuation of pressure in the mercury loop would not become large and accidents would have to be detected by small fluctuations in pressure. Based on these analyses, we plan to conduct a simulation test to verify the RELAP5 code, and then the analysis of a full-scale mercury system will be performed. (author)
Target molecular weights for red cell band 3 stilbene and mercurial binding sites
International Nuclear Information System (INIS)
Verkman, A.S.; Skorecki, K.L.; Jung, C.Y.; Ausiello, D.A.
1986-01-01
Radiation inactivation was used to measure the target sizes for binding of disulfonic stilbene anion transport inhibitor 4,4'-dibenzamido-2,2'-disulfonic stilbene (DBDS) and mercurial water transport inhibitor p-chloromercuribenzene sulfonate (pCMBS) to human erythrocytes. The measured target size for erythrocyte ghost acetylcholinesterase was 78 +/- 3 kDa. DBDS binding to ghost membranes was measured by a fluorescence enhancement technique. Radiation (0-26 Mrad) had no effect on total membrane protein and DBDS binding affinity, whereas DBDS binding stoichiometry decreased exponentially with radiation dose, giving a target size of 59 +/- 4 kDa. H2-4,4'-diisothiocyano-2,2'-disulfonic stilbene (H2-DIDS, 5 microM) blocked greater than 95% of DBDS binding at all radiation doses. pCMBS binding was measured from the time course of tryptophan fluorescence quenching in ghosts treated with the sulfhydryl reagent N-ethylmaleimide (NEM). Radiation did not affect the kinetics of tryptophan quenching, whereas the total amplitude of the fluorescence signal inactivated with radiation with a target size of 31 +/- 6 kDa. These results support the notion that DBDS and pCMBS bind to the transmembrane domain of erythrocyte band 3 in NEM-treated ghosts and demonstrate that radiation inactivation may probe a target significantly smaller than a covalently linked protein subunit. The small target size for the band 3 stilbene binding site may correspond to the intramembrane domain of the band 3 monomer (52 kDa), which is physically distinct from the cytoplasmic domain (42 kDa)
Mercury Report-Children's exposure to elemental mercury
... gov . Mercury Background Mercury Report Additional Resources Mercury Report - Children's Exposure to Elemental Mercury Recommend on Facebook ... I limit exposure to mercury? Why was the report written? Children attending a daycare in New Jersey ...
Micro pit formation by mercury-sphere collision
International Nuclear Information System (INIS)
Ishikura, Syuichi; Kogawa, Hiroyuki; Futakawa, Masatoshi; Kaminaga, Masanori; Hino, Ryutaro
2004-01-01
The development of a MW-class spallation neutron source facility is being carried out under the Japan Proton Accelerator Research Complex (J-PARC) Project promoted by JAERI and KEK. A mercury target working as the spallation neutron source will be subjected to pressure waves generated by rapid thermal expansion of mercury due to a pulsed proton beam injection. The pressure wave will impose dynamic stress on the vessel and deform the vessel, which would cause cavitation in mercury. To evaluate the effect of mercury micro jets, driven by cavitation bubble collapse, on the micro-pit formation, analyses on mercury sphere collision were carried out: single bubble dynamics and collision behavior on interface between liquid and solid, which take the nonlinearity due to shock wave in mercury and the strain rate dependency of yield stress in solid metal into account. Analytical results give a good explanation to understand relationship between the micro-pit formation and material properties: the pit size could decrease with increasing the yield strength of materials. (author)
Mercury as the Unaccreted Projectile: Thermal Consequences
Asphaug, Erik; Gabriel, Travis; Jackson, Alan; Perera, Viranga
2017-10-01
Mercury retained substantial volatiles during its formation, in far greater proportion than the Moon, despite losing ~2/3 of its rocky mantle. Its volatile-rich geochemistry would contraindicate a giant impact because it would drive away the volatiles, as in the hypothesis for the Moon. However, the thermal consequences of Mercury formation vary considerably between the two giant impact scenarios, ‘direct hit’ (DH; Benz et al. 1989) and ‘hit and run’ (HR; Asphaug and Reufer 2014). Each begins with a differentiated chondritic proto-Mercury (PM) a bit larger than Mars. In DH, PM gets eroded by a very energetic impactor half its mass, at ~6-7 times the escape velocity. To remove half of PM’s mantle, the post-impact target gets completely shock-vaporized and is sheared apart into space. The bound remnant in DH would experience a comparable deposition of shock enthalpy, as in Moon formation, and would expand into a much larger volume of heliocentric space, leading to a dry planet. The bound remnant will go on to re-accrete much of the silicate mantle that it just lost, another challenge for DH. In HR, PM is the projectile that slams into a terrestrial planet twice its size (proto-Venus or proto-Earth). For typical impact angle and speed, a typical outcome is to ‘bounce”. But for HR to explain Mercury, PM must avoid accretion every time it encounters the target, until it is scattered or migrates away (or is accreted, in which case there is no Mercury), leading to multi-HR scenarios. Tides are intense in HR because the projectile grazes the target core; gravity does most of the work of mantle stripping. Shocks play a secondary role. Whereas in DH the impactor blasts the target inside-out, in HR the runner emerges relatively unshocked, and undispersed except for losing the gravitationally-unbound material. HR is a mechanism for collecting low-shocked remnants, because the intensely shocked material ends up bound to the target or escaping to heliocentric space
International Nuclear Information System (INIS)
Butzek, M.
2005-06-01
This thesis is concerning the safety relevant layout of the environment of a mercury based 5-Megawatt-spallation target. All safety relevant aspects related to construction, operation and dismantling as well as economical issues were taken into account. Safety concerns are basically driven by the toxic and radioactive inventory as well as the kind and intensity of radiation produced by the spallation process. Due to significant differences in inventory and radiation between a spallation source and a fission reactor, for the design of the spallation source mentioned above the safety philosophy of a fission reactor must not be used unchanged. Rather than this a systematic study of all safety related boundary conditions is necessary. Within this thesis all safety relevant boundary conditions for this specific type of machine are given. Beside the spatial distribution of different areas inside the target station, influence of medias to be used as well as arising radiation and handling requirements are discussed in detail. A general layout of the target station is presented, serving as a basis for all further component and system development. An enclosure concept for the target station was developed, taking into account the safety relevant issues concerning the mercury used as target materials, the water cooling loops containing massive amounts of tritium as well as the materials used for the moderators potentially forming explosive mixtures. Concept and detailed technical layout of the enclosure system was chosen to guarantee safe operation of the source as well as taking care of requirement arising for handling needs. For design of the shielding different suitable materials have been discussed. A design for assembling the shielding is shown taking into account the safety relevant requirements during operation as well as during dismantling. The neutron beam shutters, buried inside the shielding were designed to optimize handling and positioning issued of the inner part
Mercury is an element that is found in air, water and soil. It has several forms. Metallic mercury is a shiny, silver-white, odorless liquid. If ... with other elements to form powders or crystals. Mercury is in many products. Metallic mercury is used ...
Gigacycle fatigue behaviour of austenitic stainless steels used for mercury target vessels
International Nuclear Information System (INIS)
Naoe, Takashi; Xiong, Zhihong; Futakawa, Masatoshi
2016-01-01
A mercury enclosure vessel for the pulsed spallation neutron source manufactured from a type 316L austenitic stainless steel, a so-called target vessel, suffers the cyclic loading caused by the proton beam induced pressure waves. A design criteria of the JSNS target vessel which is defined based on the irradiation damage is 2500 h at 1 MW with a repetition rate of 25 Hz, that is, the target vessel suffers approximately 10 9 cyclic loading while in operation. Furthermore, strain rate of the beam window of the target vessel reaches 50 s −1 at the maximum, which is much higher than that of the conventional fatigue. Gigacycle fatigue strength up to 10 9 cycles for solution annealed 316L (SA) and cold-worked 316L (CW) were investigated through the ultrasonic fatigue tests. Fatigue tests were performed under room temperature and 250 °C which is the maximum temperature evaluated at the beam window in order to investigate the effect of temperature on fatigue strength of SA and CW 316L. The results showed that the fatigue strength at 250 °C is clearly reduced in comparison with room temperature, regardless of cold work level. In addition, residual strength and microhardness of the fatigue tested specimen were measured to investigate the change in mechanical properties by cyclic loading. Cyclic hardening was observed in both the SA and CW 316L, and cyclic softening was observed in the initial stage of cyclic loading in CW 316L. Furthermore, abrupt temperature rising just before fatigue failure was observed regardless of testing conditions.
Human Exposure and Health Effects of Inorganic and Elemental Mercury
Zheng, Wei
2012-01-01
Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability of 7% to 15% after ingestion; they are also irritants and cause gastrointestinal symptoms. Upon entering the body, inorganic mercury compounds are accumulated mainly in the kidneys and produce kidney damage. In contrast, human exposure to elemental mercury is mainly by inhalation, followed by rapid absorption and distribution in all major organs. Elemental mercury from ingestion is poorly absorbed with a bioavailability of less than 0.01%. The primary target organs of elemental mercury are the brain and kidney. Elemental mercury is lipid soluble and can cross the blood-brain barrier, while inorganic mercury compounds are not lipid soluble, rendering them unable to cross the blood-brain barrier. Elemental mercury may also enter the brain from the nasal cavity through the olfactory pathway. The blood mercury is a useful biomarker after short-term and high-level exposure, whereas the urine mercury is the ideal biomarker for long-term exposure to both elemental and inorganic mercury, and also as a good indicator of body burden. This review discusses the common sources of mercury exposure, skin lightening products containing mercury and mercury release from dental amalgam filling, two issues that happen in daily life, bear significant public health importance, and yet undergo extensive debate on their safety. PMID:23230464
Gao, Zhen-Yan; Li, Min-Ming; Wang, Ju; Yan, Jin; Zhou, Can-Can; Yan, Chong-Huai
2018-01-01
This study sought to obtain national cross-sectional data for blood mercury levels and risk factors for mercury exposure in Chinese children aged 0 to 6years to provide evidence to support preventive measures for reducing childhood blood mercury levels. A multi-stage, stratified, clustered random sampling survey was conducted May 2013-Mar 2015. Shanghai, Jilin, Shanxi, Guangdong, Qinghai, Yunnan and Hubei, which are located in seven different geographical regions in China, were selected as the study field. A total of 14,202 children aged 0-6years participated in the study. Whole-blood venous samples (3ml) were collected from the subjects for mercury exposure assessment. The DMA-80 was applied for mercury detection, and a health questionnaire gathering information on related confounders was completed by the subjects' parents of the subjects after they received guidance from the investigators. A general linear model was used for the primary descriptive statistical analysis. Odds ratios (ORs) and 95%CIs for the risk factors were estimated using unconditional logistic regression. A total of 14,202 eligible samples were collected. The mean mercury level was 1.39μg/L. Other results were as follows: median 1.23μg/L, p25 0.86μg/L, p75 1.73μg/L, and GM 1.10μg/L. Of the seven geographical regions, Qinghai, in northwestern China, had a median mercury level of 0.37μg/L, which was significantly lower than the mercury level in Guangdong, in southeastern China (2.01μg/L). The median blood mercury level of children in suburban areas was 1.34μg/L, which was remarkably higher than that of children in rural areas (1.09μg/L). Dichotomous subgroups were generated using the median mercury concentration. Unconditional logistic regression analysis revealed that fish consumption may contribute to increased blood mercury levels (pmercury concentrations and the children's anthropometric characteristics (BMI; pmercury concentrations among Chinese children aged 0-6years were
Meyers, Valerie E.; McCoy, J. Torin; Garcia, Hector D.; James, John T.
2009-01-01
Many of the operational and payload lighting units used in various spacecraft contain elemental mercury. If these devices were damaged on-orbit, elemental mercury could be released into the cabin. Although there are plans to replace operational units with alternate light sources, such as LEDs, that do not contain mercury, mercury-containing lamps efficiently produce high quality illumination and may never be completely replaced on orbit. Therefore, exposure to elemental mercury during spaceflight will remain possible and represents a toxicological hazard. Elemental mercury is a liquid metal that vaporizes slowly at room temperature. However, it may be completely vaporized at the elevated operating temperatures of lamps. Although liquid mercury is not readily absorbed through the skin or digestive tract, mercury vapors are efficiently absorbed through the respiratory tract. Therefore, the amount of mercury in the vapor form must be estimated. For mercury releases from lamps that are not being operated, we utilized a study conducted by the New Jersey Department of Environmental Quality to calculate the amount of mercury vapor expected to form over a 2-week period. For longer missions and for mercury releases occurring when lamps are operating, we conservatively assumed complete volatilization of the available mercury. Because current spacecraft environmental control systems are unable to remove mercury vapors, both short-term and long-term exposures to mercury vapors are possible. Acute exposure to high concentrations of mercury vapors can cause irritation of the respiratory tract and behavioral symptoms, such as irritability and hyperactivity. Chronic exposure can result in damage to the nervous system (tremors, memory loss, insomnia, etc.) and kidneys (proteinurea). Therefore, the JSC Toxicology Group recommends that stringent safety controls and verifications (vibrational testing, etc.) be applied to any hardware that contains elemental mercury that could yield
International Nuclear Information System (INIS)
Maekawa, Fujio; Meigo, Shin-ichiro; Kasugai, Yoshimi; Takada, Hiroshi; Ikeda, Yujiro; Ino, Takashi; Sato, Setsuo
2001-01-01
The AGS experiment on a mercury target with a moderator and a lead reflector bombarded by GeV energy protons was analyzed to investigate prediction capability of Monte Carlo simulation codes used in neutronic designs of spallation neutron sources. The NMTC/JAM code was used for nucleon meson transport calculations above 20 MeV while the MCNP-4A code with the JENDL cross section library was used for neutron transport below 20 MeV. The MCNPX code with the LA-150 library was also used for a reference. The calculations were compared with the experimental data obtained with 1.94, 12 and 24 GeV proton beams: (1) neutron flux distributions along the mercury target and (2) spectral fluxes of thermal neutrons extracted from a light water moderator. As a result, it was found that all the calculations predicted these experimental results with accuracies better than ±50% in absolute values. Accordingly, it was concluded that these calculation codes were adequate for neutronics designs of spallation neutron sources. (author)
Disposal strategy of proton irradiated mercury from high power spallation sources
International Nuclear Information System (INIS)
Chiriki, Suresh
2010-01-01
Large spallation sources are intended to be constructed in Europe (EURISOL: nuclear physics research facility and ESS: European Spallation Source). These facilities would accumulate more than 20 metric tons of irradiated mercury in the target, which has to be treated as highly radioactive and chemo-toxic waste. Liquid waste cannot be tolerated in European repositories. As part of this work on safety/decommissioning of high-power spallation sources, our investigations were focused mainly to study experimentally and theoretically the solidification of liquid mercury waste (selection of an adequate solid mercury form and of an immobilization matrix, chemical engineering process studies on solidification/stabilization and on encapsulating in a matrix). Based on experimental results and supported by literature Hg-chalcogens (HgS, HgSe) will be more stable in repositories than amalgams. Our irradiation experimental studies on mercury waste revealed that mercury sulfide is a reasonable solid for disposal and shows larger stability in possible accidents with water ingress in a repository. Additionally immobilization of mercury in a cement matrix and polysiloxane matrix were tested. HgS formation from liquid target mercury by a wet process is identified as a suitable formation procedure. These investigations reveal that an almost 99.9% elementary Hg conversion can be achieved and that wet process can be reasonably handled under hot cell conditions. (orig.)
Disposal strategy of proton irradiated mercury from high power spallation sources
Energy Technology Data Exchange (ETDEWEB)
Chiriki, Suresh
2010-07-01
Large spallation sources are intended to be constructed in Europe (EURISOL: nuclear physics research facility and ESS: European Spallation Source). These facilities would accumulate more than 20 metric tons of irradiated mercury in the target, which has to be treated as highly radioactive and chemo-toxic waste. Liquid waste cannot be tolerated in European repositories. As part of this work on safety/decommissioning of high-power spallation sources, our investigations were focused mainly to study experimentally and theoretically the solidification of liquid mercury waste (selection of an adequate solid mercury form and of an immobilization matrix, chemical engineering process studies on solidification/stabilization and on encapsulating in a matrix). Based on experimental results and supported by literature Hg-chalcogens (HgS, HgSe) will be more stable in repositories than amalgams. Our irradiation experimental studies on mercury waste revealed that mercury sulfide is a reasonable solid for disposal and shows larger stability in possible accidents with water ingress in a repository. Additionally immobilization of mercury in a cement matrix and polysiloxane matrix were tested. HgS formation from liquid target mercury by a wet process is identified as a suitable formation procedure. These investigations reveal that an almost 99.9% elementary Hg conversion can be achieved and that wet process can be reasonably handled under hot cell conditions. (orig.)
Mercury flow tests (first report). Wall friction factor measurement tests and future tests plan
International Nuclear Information System (INIS)
Kaminaga, Masanori; Kinoshita, Hidetaka; Haga, Katsuhiro; Hino, Ryutaro; Sudo, Yukio
1999-07-01
In the neutron science project at JAERI, we plan to inject a pulsed proton beam of a maximum power of 5 MW from a high intense proton accelerator into a mercury target in order to produce high energy neutrons of a magnitude of ten times or more than existing facilities. The neutrons produced by the facility will be utilized for advanced field of science such as the life sciences etc. An urgent issue in order to accomplish this project is the establishment of mercury target technology. With this in mind, a mercury experimental loop with the capacity to circulate mercury up to 15 L/min was constructed to perform thermal hydraulic tests, component tests and erosion characteristic tests. A measurement of the wall friction factor was carried out as a first step of the mercury flow tests, while testing the characteristic of components installed in the mercury loop. This report presents an outline of the mercury loop and experimental results of the wall friction factor measurement. From the wall friction factor measurement, it was made clear that the wettability of the mercury was improved with an increase of the loop operation time and at the same time the wall friction factors were increased. The measured wall friction factors were much lower than the values calculated by the Blasius equation at the beginning of the loop operation because of wall slip caused by a non-wetted condition. They agreed well with the values calculated by the Blasius equation within a deviation of 10% when the sum of the operation time increased more than 11 hours. This report also introduces technical problems with a mercury circulation and future tests plan indispensable for the development of the mercury target. (author)
Foil analysis of 1.5-GeV proton bombardment of a mercury target
Charlton, L A; Glasgow, D C; Gabriel, T A
1999-01-01
The number of reactant nuclei in a series of foils surrounding a container of mercury that has been bombarded by 1.5-GeV protons is calculated and compared with experimental measurements. This procedure is done to aid in the validation of the mercury cross sections used in the design studies of the Spallation Neutron Source (SNS). It is found that the calculations match the measurements to within the uncertainties inherent in the analysis.
International Nuclear Information System (INIS)
Arzumanov, A.; Berger, V.; Borissenko, A.; Gorodisskaya, N.; Ilmatov, I.; Knyazev, A.; Koptev, V.; Lyssukhin, S.; Platov, A.; Sychikov, G.; Zheltov, D.
2004-01-01
The objectives of the present work are to increase thermal stability of cyclotron targets for production of Tl-201 isotope, increase Tl-203 regeneration rate at radiochemical reprocessing of the targets and develop production technology for radiochemical sources based on Rd-103 isotope. Electrochemical coating of copper substrate with Tl increased the beam current at target irradiation from 100 μA to 125 μA. Further increase of the beam current results in sharp decrease of target stability time at irradiation to 15 min at beam current 150 μA. Thermal calculations and tests at the electron-beam stand predict satisfactory stability at such currents. The discrepancy with the irradiation results has not been explained. More accurate specification of regimes for Tl-203 electrochemical recovery from irradiated targets and better matching of the electrolyte composition made it possible to increase the recovery rate up to 99.5%. Before the present Project, the INP had no experience in production of radioactive sources based on Pd-103. Thermo-diffusion extraction of Pd-103 from irradiated rhodium foil has been chosen as a technology-defining method. The process assures good extraction rate and high purity of extracted isotope. Production of Pd-103 sources based on this technology is much simpler compared to the same based on electrochemical processes. (author)
2010-04-01
... at § 100.201a), ICC/ANSI A117.1-1998 (incorporated by reference at § 100.201a), CABO/ANSI A117.1-1992... (incorporated by reference at § 100.201a), ICC/ANSI A117.1-1998 (incorporated by reference at § 100.201a), CABO... (incorporated by reference at § 100.201a), CABO/ANSI A117.1-1992 (incorporated by reference at § 100.201a), ANSI...
Small Molecular TRAIL Inducer ONC201 Induces Death in Lung Cancer Cells: A Preclinical Study
Feng, Yuan; Zhou, Jihong; Li, Zhanhua; Jiang, Ying; Zhou, Ying
2016-01-01
Tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) selectively targets cancer cells. The present preclinical study investigated the anti-cancer efficiency of ONC201, a first-in-class small molecule TRAIL inducer, in lung cancer cells. We showed that ONC201 was cytotoxic and anti-proliferative in both established (A549 and H460 lines) and primary human lung cancer cells. It was yet non-cytotoxic to normal lung epithelial cells. Further, ONC201 induced exogenous apoptosis act...
1974-01-01
Mariner 10's first image of Mercury acquired on March 24, 1974. During its flight, Mariner 10's trajectory brought it behind the lighted hemisphere of Mercury, where this image was taken, in order to acquire important measurements with other instruments.This picture was acquired from a distance of 3,340,000 miles (5,380,000 km) from the surface of Mercury. The diameter of Mercury (3,031 miles; 4,878 km) is about 1/3 that of Earth.Images of Mercury were acquired in two steps, an inbound leg (images acquired before passing into Mercury's shadow) and an outbound leg (after exiting from Mercury's shadow). More than 2300 useful images of Mercury were taken, both moderate resolution (3-20 km/pixel) color and high resolution (better than 1 km/pixel) black and white coverage.
Assessment of Mercury in Fish Tissue from Select Lakes of Northeastern Oregon
A fish tissue study was conducted in five northeastern Oregon reservoirs to evaluate mercury concentrations in an area where elevated atmospheric mercury deposition had been predicted by a national EPA model, but where tissue data were sparse. The study targeted resident predator...
Multi-weight isotherm results for mercury removal in upper East Fork Popular Creek water
International Nuclear Information System (INIS)
Bostick, D.A.; Klasson, K.T.
1998-02-01
Many sorbents have been developed for the removal of mercury and heavy metals from waters; however, the majority of data published to date do not address the removal of mercury to the target levels represented in this project. The application to which these sorbents are targeted for use is the removal of mercury from microgram-per-liter levels to low nanogram-per-liter levels. Sorbents with thiouronium, thiol, amine, sulfur, and proprietary functional groups were selected for these studies. The initial mercury content in the majority of the batch samples was significantly augmented so that the equilibrium concentration was similar to that found in the original stream sample for at least one sample. Mercury was successfully removed from actual water via adsorption onto Ionac SR-4 (by Sybron Chemicals, Inc.), Keyle:X (by SolmeteX), and Mersorb (by Nucon International, Inc.) resins to levels below the target goal of 12 ng/L. A thiol-based resin (Ionac SR-4) performed the best, indicating that over 200,000 volumes of water could be treated with one volume of resin. The cost of the resin is approximately $0.24 per 1000 gal of water
Huang, Shuyuan; Sun, Lumin; Zhou, Tingjin; Yuan, Dongxing; Du, Bing; Sun, Xiuwu
2018-01-01
In this study, samples of 18 wet precipitations (WPs) and 38 aerosols were collected around a coal-fired power plant (CFPP) located in Xiamen, southeast China, which was equipped with a seawater flue gas desulfurization system. Total particulate mercury (TPM) in aerosol samples, and total mercury (WP-TM), dissolved mercury (WP-DM) and particulate mercury (WP-PM) in WP samples were analyzed for the natural isotopic compositions of mercury. For the first time, both mass dependent fractionation (MDF) and mass independent fractionation of odd (odd-MIF) and even (even-MIF) isotopes of WP-DM and WP-PM were reported and discussed. Both WP-TM and TPM displayed negative MDF and slightly positive even-MIF. Negative odd-MIF was observed in TPM and WP-PM, whereas positive odd-MIF was observed in WP-TM and WP-DM. It was found that the mercury budget in WP-PM samples was mainly controlled by atmospheric particles. Potential sources of mercury in samples were identified via analysis of mercury isotopic signatures and meteorological data with the NOAA HYSPLIT model. The results showed that TPM and WP-PM in solid samples were homologous and the isotopic compositions of WP-TM depended on those of WP-DM. The ratios of Δ199Hg/Δ201Hg resulting from photochemical reactions and positive Δ200Hg values (from -0.06‰ to 0.27‰) in all samples indicated that the mercury coming from local emission of the CFPP together with long-distance transportation were the two main contributing sources.
de Vries, Irma
2017-01-01
Mercury is a naturally occurring metal that exists in several physical and chemical forms. Inorganic mercury refers to compounds formed after the combining of mercury with elements such as chlorine, sulfur, or oxygen. After combining with carbon by covalent linkage, the compounds formed are called
International Nuclear Information System (INIS)
Huang, Shuyuan; Yuan, Dongxing; Lin, Haiying; Sun, Lumin; Lin, Shanshan
2017-01-01
In the current study, fractionation of mercury isotopes during coal combustion and seawater flue gas desulfurization (SFGD) in a coal-fired power plant using a SFGD system was investigated. Fourteen samples were collected from the power plant. The samples were pretreated with a combustion-trapping method and were analyzed with a multi-collector inductively coupled plasma mass spectrometer (MC-ICP-MS). Compared with the raw coal, the bottom ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −0.45 to −0.03‰. The fly ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −1.49 to −0.73‰ for Chinese coal and from −1.47 to −0.62‰ for Indonesian coal. The δ 202 Hg of fresh seawater and desulfurized seawater was found to be −1.32 and −0.32‰ respectively. These δ 202 Hg values indicated that the desulfurized seawater was enriched with heavier mercury isotopes. Based upon the calculated results obtained from the mass balance equation, it was suggested that the stack emissions were enriched with lighter mercury isotopes. Mass independent fractionation was observed in most of the samples with a Δ 199 Hg/Δ 201 Hg ratio of approximately 0.96. The results help in improving the understanding of mercury isotope fractionation during coal combustion and SFGD, and are also useful in tracing the mercury emissions from coal fired power plants. - Highlights: • Spread of 1.5‰ was observed in δ 202 Hg values of raw coals and coal related samples. • The δ 202 Hg values were more negative in fly ash than those in the raw coal. • The flue gas had a significant Hg fractionation after desulfurization. • The stack emissions were enriched with lighter isotopes compared with the raw coal.
Directory of Open Access Journals (Sweden)
Dony Chacko Mathew
Full Text Available Though heavy metal such as mercury is toxic to plants and microorganisms, the synergistic activity between them may offer benefit for surviving. In this study, a mercury-reducing bacterium, Photobacterium spp. strain MELD1, with an MIC of 33 mg x kg(-1 mercury was isolated from a severely mercury and dioxin contaminated rhizosphere soil of reed (Phragmites australis. While the whole genome sequencing of MELD1 confirmed the presence of a mer operon, the mercury reductase MerA gene showed 99% sequence identity to Vibrio shilloni AK1 and implicates its route resulted from the event of horizontal gene transfer. The efficiency of MELD1 to vaporize mercury (25 mg x kg(-1, 24 h and its tolerance to toxic metals and xenobiotics such as lead, cadmium, pentachlorophenol, pentachloroethylene, 3-chlorobenzoic acid, 2,3,7,8-tetrachlorodibenzo-p-dioxin and 1,2,3,7,8,9-hexachlorodibenzo-p-dioxin is promising. Combination of a long yard bean (Vigna unguiculata ssp. Sesquipedalis and strain MELD1 proved beneficial in the phytoprotection of mercury in vivo. The effect of mercury (Hg on growth, distribution and tolerance was examined in root, shoot, leaves and pod of yard long bean with and without the inoculation of strain MELD1. The model plant inoculated with MELD1 had significant increases in biomass, root length, seed number, and increased mercury uptake limited to roots. Biolog plate assay were used to assess the sole-carbon source utilization pattern of the isolate and Indole-3-acetic acid (IAA productivity was analyzed to examine if the strain could contribute to plant growth. The results of this study suggest that, as a rhizosphere-associated symbiont, the synergistic activity between the plant and MELD1 can improve the efficiency for phytoprotection, phytostabilization and phytoremediation of mercury.
Mathew, Dony Chacko; Ho, Ying-Ning; Gicana, Ronnie Gicaraya; Mathew, Gincy Marina; Chien, Mei-Chieh; Huang, Chieh-Chen
2015-01-01
Though heavy metal such as mercury is toxic to plants and microorganisms, the synergistic activity between them may offer benefit for surviving. In this study, a mercury-reducing bacterium, Photobacterium spp. strain MELD1, with an MIC of 33 mg x kg(-1) mercury was isolated from a severely mercury and dioxin contaminated rhizosphere soil of reed (Phragmites australis). While the whole genome sequencing of MELD1 confirmed the presence of a mer operon, the mercury reductase MerA gene showed 99% sequence identity to Vibrio shilloni AK1 and implicates its route resulted from the event of horizontal gene transfer. The efficiency of MELD1 to vaporize mercury (25 mg x kg(-1), 24 h) and its tolerance to toxic metals and xenobiotics such as lead, cadmium, pentachlorophenol, pentachloroethylene, 3-chlorobenzoic acid, 2,3,7,8-tetrachlorodibenzo-p-dioxin and 1,2,3,7,8,9-hexachlorodibenzo-p-dioxin is promising. Combination of a long yard bean (Vigna unguiculata ssp. Sesquipedalis) and strain MELD1 proved beneficial in the phytoprotection of mercury in vivo. The effect of mercury (Hg) on growth, distribution and tolerance was examined in root, shoot, leaves and pod of yard long bean with and without the inoculation of strain MELD1. The model plant inoculated with MELD1 had significant increases in biomass, root length, seed number, and increased mercury uptake limited to roots. Biolog plate assay were used to assess the sole-carbon source utilization pattern of the isolate and Indole-3-acetic acid (IAA) productivity was analyzed to examine if the strain could contribute to plant growth. The results of this study suggest that, as a rhizosphere-associated symbiont, the synergistic activity between the plant and MELD1 can improve the efficiency for phytoprotection, phytostabilization and phytoremediation of mercury.
Mathew, Dony Chacko; Ho, Ying-Ning; Gicana, Ronnie Gicaraya; Mathew, Gincy Marina; Chien, Mei-Chieh; Huang, Chieh-Chen
2015-01-01
Though heavy metal such as mercury is toxic to plants and microorganisms, the synergistic activity between them may offer benefit for surviving. In this study, a mercury-reducing bacterium, Photobacterium spp. strain MELD1, with an MIC of 33 mg . kg-1 mercury was isolated from a severely mercury and dioxin contaminated rhizosphere soil of reed (Phragmites australis). While the whole genome sequencing of MELD1 confirmed the presence of a mer operon, the mercury reductase MerA gene showed 99% sequence identity to Vibrio shilloni AK1 and implicates its route resulted from the event of horizontal gene transfer. The efficiency of MELD1 to vaporize mercury (25 mg . kg-1, 24 h) and its tolerance to toxic metals and xenobiotics such as lead, cadmium, pentachlorophenol, pentachloroethylene, 3-chlorobenzoic acid, 2,3,7,8-tetrachlorodibenzo-p-dioxin and 1,2,3,7,8,9-hexachlorodibenzo-p-dioxin is promising. Combination of a long yard bean (Vigna unguiculata ssp. Sesquipedalis) and strain MELD1 proved beneficial in the phytoprotection of mercury in vivo. The effect of mercury (Hg) on growth, distribution and tolerance was examined in root, shoot, leaves and pod of yard long bean with and without the inoculation of strain MELD1. The model plant inoculated with MELD1 had significant increases in biomass, root length, seed number, and increased mercury uptake limited to roots. Biolog plate assay were used to assess the sole-carbon source utilization pattern of the isolate and Indole-3-acetic acid (IAA) productivity was analyzed to examine if the strain could contribute to plant growth. The results of this study suggest that, as a rhizosphere-associated symbiont, the synergistic activity between the plant and MELD1 can improve the efficiency for phytoprotection, phytostabilization and phytoremediation of mercury. PMID:25816328
49 CFR 173.164 - Mercury (metallic and articles containing mercury).
2010-10-01
... ounces) of mercury per package; (iv) Tubes which are completely jacketed in sealed leakproof metal cases... 49 Transportation 2 2010-10-01 2010-10-01 false Mercury (metallic and articles containing mercury... Than Class 1 and Class 7 § 173.164 Mercury (metallic and articles containing mercury). (a) For...
CFD Validation of Gas Injection in Flowing Mercury over Vertical Smooth and Grooved Wall
International Nuclear Information System (INIS)
Abdou, Ashraf A.; Wendel, Mark W.; Felde, David K.; Riemer, Bernie
2009-01-01
The Spallation Neutron Source (SNS) is an accelerator-based neutron source at Oak Ridge National Laboratory (ORNL). The nuclear spallation reaction occurs when a proton beam hits liquid mercury. This interaction causes thermal expansion of the liquid mercury which produces high pressure waves. When these pressure waves hit the target vessel wall, cavitation can occur and erode the wall. Research and development efforts at SNS include creation of a vertical protective gas layer between the flowing liquid mercury and target vessel wall to mitigate the cavitation damage erosion and extend the life time of the target. Since mercury is opaque, computational fluid dynamics (CFD) can be used as a diagnostic tool to see inside the liquid mercury and guide the experimental efforts. In this study, CFD simulations of three dimensional, unsteady, turbulent, two-phase flow of helium gas injection in flowing liquid mercury over smooth, vertically grooved and horizontally grooved walls are carried out with the commercially available CFD code Fluent-12 from ANSYS. The Volume of Fluid (VOF) model is used to track the helium-mercury interface. V-shaped vertical and horizontal grooves with 0.5 mm pitch and about 0.7 mm depth were machined in the transparent wall of acrylic test sections. Flow visualization data of helium gas coverage through transparent test sections is obtained with a high-speed camera at the ORNL target test facility (TTF). The helium gas mass flow rate is 8 mg/min and introduced through a 0.5 mm diameter port. The local mercury velocity is 0.9 m/s. In this paper, the helium gas flow rate and the local mercury velocity are kept constant for the three cases. Time integration of predicted helium gas volume fraction over time is done to evaluate the gas coverage and calculate the average thickness of the helium gas layer. The predicted time-integrated gas coverage over vertically grooved and horizontally grooved test sections is better than over a smooth wall. The
Recovery of mercury from mercury compounds via electrolytic methods
Grossman, Mark W.; George, William A.
1988-01-01
A process for electrolytically recovering mercury from mercury compounds is provided. In one embodiment, Hg is recovered from Hg.sub.2 Cl.sub.2 employing as the electrolyte solution a mixture of HCl and H.sub.2 O. In another embodiment, Hg is electrolytically recovered from HgO wherein the electrolyte solution is comprised of glacial acetic acid and H.sub.2 O. Also provided is an apparatus for producing isotopically enriched mercury compounds in a reactor and then transporting the dissolved compounds into an electrolytic cell where mercury ions are electrolytically reduced and elemental mercury recovered from the mercury compounds.
Multi-MW target station: Beam Window Issues and Transverse Film Target
Herrera-Martinez, A
The analysis of the EURISOL-DS Multi_MW target precise geometry has proved that large fission yields can be achieved with a 4 MW, providing a technically feasible design to evacuate the power deposited in the liquid mercury. Different designs for the mercury flow have been proposed, which maintain its temperature below the boiling point with moderate flow speeds (maximum 4 m/s).
RECOVERY OF MERCURY FROM CONTAMINATED PRIMARY AND SECONDARY WASTES
International Nuclear Information System (INIS)
A. Faucette; J. Bognar; T. Broderick; T. Battaglia
2000-01-01
Effective removal of mercury contamination from water is a complex and difficult problem. In particular, mercury treatment of natural waters is difficult because of the low regulatory standards. For example, the Environmental Protection Agency has established a national ambient water quality standard of 12 parts-per-trillion (ppt), whereas the standard is 1.8 ppt in the Great Lakes Region. In addition, mercury is typically present in several different forms, but sorption processes are rarely effective with more than one or two of these forms. To meet the low regulatory discharge limits, a sorption process must be able to address all forms of mercury present in the water. One approach is to apply different sorbents in series depending on the mercury speciation and the regulatory discharge limits. Four new sorbents have been developed to address the variety of mercury species present in industrial discharges and natural waters. Three of these sorbents have been field tested on contaminated creek water at the Y-12 Plant. Two of these sorbents have demonstrated very high removal efficiencies for soluble mercury species, with mercury concentrations at the outlet of a pilot-scale system less than 12 ppt for as long as six months. The other sorbent tested at the Y-12 Plant is targeted at colloidal mercury that is not removed by standard sorption or filtration processes. At the Y-12 Plant, colloidal mercury appears to be associated with iron, so a sorbent that removes mercury-iron complexes in the presence of a magnetic field was evaluated. Field results indicate good removal of this mercury fraction from the Y-12 waters. In addition, this sorbent is easily regenerated by simply removing the magnetic field and flushing the columns with water. The fourth sorbent is still undergoing laboratory development, but results to date indicate exceptionally high mercury sorption capacity. The sorbent is capable of removing all forms of mercury typically present in natural and
Vaporization of elemental mercury from pools of molten lead at low concentrations
International Nuclear Information System (INIS)
Greene, G.A.; Finfrock, C.C.
2000-01-01
Should coolant accidentally be lost to the APT (Accelerator Production of Tritium) blanket and target, and the decay heat in the target be deposited in the surrounding blanket by thermal radiation, temperatures in the blanket modules could exceed structural limits and cause a physical collapse of the blanket modules into a non-coolable geometry. Such a sequence of unmitigated events could result in some melting of the APT blanket and create the potential for the release of mercury into the target-blanket cavity air space. Experiments were conducted which simulate such hypothetical accident conditions in order to measure the rate of vaporization of elemental mercury from pools of molten lead to quantify the possible severe accident source term for the APT blanket region. Molten pools of from 0.01% to 0.10% mercury in lead were prepared under inert conditions. Experiments were conducted, which varied in duration from several hours to as long as a month, to measure the mercury vaporization from the lead pools. The melt pools and gas atmospheres were held fixed at 340 C during the tests. Parameters which were varied in the tests included the mercury concentration, gas flow rate over the melt and agitation of the melt, gas atmosphere composition and the addition of aluminum to the melt. The vaporization of mercury was found to scale roughly linearly with the concentration of mercury in the pool. Variations in the gas flow rates were not found to have any effect on the mass transfer, however agitation of the melt by a submerged stirrer did enhance the mercury vaporization rate. The rate of mercury vaporization with an argon (inert) atmosphere was found to exceed that for an air (oxidizing) atmosphere by as much as a factor of from ten to 20; the causal factor in this variation was the formation of an oxide layer over the melt pool with the air atmosphere which served to retard mass transfer across the melt-atmosphere interface. Aluminum was introduced into the melt to
Selenium's importance in regulatory issues regarding mercury
Energy Technology Data Exchange (ETDEWEB)
Raymond, Laura J.; Ralston, Nicholas V.C. [University of North Dakota Energy and Environmental Research Center, 15 North 23rd Street, Stop 9018, Grand Forks, ND 58202-9018 (United States)
2009-11-15
Current seafood safety and health risk assessment criteria use mercury concentrations as their sole basis. This unfortunate limitation omits consideration of selenium, an essential trace element that appears to be the primary molecular target of mercury toxicity. Although selenium has been recognized for decades as a means of counteracting mercury toxicity, its effects have often been overlooked or misunderstood. Experimental animal studies have demonstrated that increasing concentrations of selenium throughout the normal dietary range increasingly counteracts methylmercury toxicity. Dietary concentrations of selenium that are slightly less than the average amount present in ocean fish have been shown to completely prevent the onset of toxic symptoms of mercury toxicity, while animals fed lesser amounts of selenium rapidly sickened and died. Dietary selenium from a variety of sources including ocean fish such as tuna, swordfish, menhaden, and rockfish has been shown to counteract mercury toxicity. Since ocean fish are among the richest sources of dietary selenium, it is important to include selenium concentration measurements in future mercury risk assessments and seafood safety criteria. Mercury:selenium molar ratios in blood provide far more consistent and physiologically meaningful risk assessments. Comprehensive seafood safety criteria such as the Selenium Health Benefit Value enable clear differentiation between seafoods that are safe and those that are hazardous for human consumption. Use of parameters that integrate mercury-selenium relationships also make it easy to understand the differences between the findings of maternal mercury exposure studies that have been performed in New Zealand, the Faroes, the Seychelles, and the United Kingdom. Development of criteria for evaluating mercury-selenium interactions will enhance environmental protection and improve public safety. (author)
... the Risk of Exposure to Mercury Learn About Mercury What is Mercury What is Metallic mercury? Toxicological Profile ToxFAQs Mercury Resources CDC’s National Biomonitoring Program Factsheet on Mercury ...
Directory of Open Access Journals (Sweden)
Varun V Prabhu
Full Text Available Cancer stem cells (CSCs correlate with recurrence, metastasis and poor survival in clinical studies. Encouraging results from clinical trials of CSC inhibitors have further validated CSCs as therapeutic targets. ONC201 is a first-in-class small molecule imipridone in Phase I/II clinical trials for advanced cancer. We have previously shown that ONC201 targets self-renewing, chemotherapy-resistant colorectal CSCs via Akt/ERK inhibition and DR5/TRAIL induction. In this study, we demonstrate that the anti-CSC effects of ONC201 involve early changes in stem cell-related gene expression prior to tumor cell death induction. A targeted network analysis of gene expression profiles in colorectal cancer cells revealed that ONC201 downregulates stem cell pathways such as Wnt signaling and modulates genes (ID1, ID2, ID3 and ALDH7A1 known to regulate self-renewal in colorectal, prostate cancer and glioblastoma. ONC201-mediated changes in CSC-related gene expression were validated at the RNA and protein level for each tumor type. Accordingly, we observed inhibition of self-renewal and CSC markers in prostate cancer cell lines and patient-derived glioblastoma cells upon ONC201 treatment. Interestingly, ONC201-mediated CSC depletion does not occur in colorectal cancer cells with acquired resistance to ONC201. Finally, we observed that basal expression of CSC-related genes (ID1, CD44, HES7 and TCF3 significantly correlate with ONC201 efficacy in >1000 cancer cell lines and combining the expression of multiple genes leads to a stronger overall prediction. These proof-of-concept studies provide a rationale for testing CSC expression at the RNA and protein level as a predictive and pharmacodynamic biomarker of ONC201 response in ongoing clinical studies.
Prabhu, Varun V; Lulla, Amriti R; Madhukar, Neel S; Ralff, Marie D; Zhao, Dan; Kline, Christina Leah B; Van den Heuvel, A Pieter J; Lev, Avital; Garnett, Mathew J; McDermott, Ultan; Benes, Cyril H; Batchelor, Tracy T; Chi, Andrew S; Elemento, Olivier; Allen, Joshua E; El-Deiry, Wafik S
2017-01-01
Cancer stem cells (CSCs) correlate with recurrence, metastasis and poor survival in clinical studies. Encouraging results from clinical trials of CSC inhibitors have further validated CSCs as therapeutic targets. ONC201 is a first-in-class small molecule imipridone in Phase I/II clinical trials for advanced cancer. We have previously shown that ONC201 targets self-renewing, chemotherapy-resistant colorectal CSCs via Akt/ERK inhibition and DR5/TRAIL induction. In this study, we demonstrate that the anti-CSC effects of ONC201 involve early changes in stem cell-related gene expression prior to tumor cell death induction. A targeted network analysis of gene expression profiles in colorectal cancer cells revealed that ONC201 downregulates stem cell pathways such as Wnt signaling and modulates genes (ID1, ID2, ID3 and ALDH7A1) known to regulate self-renewal in colorectal, prostate cancer and glioblastoma. ONC201-mediated changes in CSC-related gene expression were validated at the RNA and protein level for each tumor type. Accordingly, we observed inhibition of self-renewal and CSC markers in prostate cancer cell lines and patient-derived glioblastoma cells upon ONC201 treatment. Interestingly, ONC201-mediated CSC depletion does not occur in colorectal cancer cells with acquired resistance to ONC201. Finally, we observed that basal expression of CSC-related genes (ID1, CD44, HES7 and TCF3) significantly correlate with ONC201 efficacy in >1000 cancer cell lines and combining the expression of multiple genes leads to a stronger overall prediction. These proof-of-concept studies provide a rationale for testing CSC expression at the RNA and protein level as a predictive and pharmacodynamic biomarker of ONC201 response in ongoing clinical studies.
Safety concept for spallation target system. JAERI/KEK joint project
International Nuclear Information System (INIS)
Kobayashi, K.; Kaminaga, M.; Haga, K.; Kinoshita, H.; Hino, R.
2001-01-01
A MW-class mercury target of the spallation target generates much larger amounts of radioactive nuclides than existing spallation neutron sources. To estimate the maximum level of public exposure under the guillotine break of mercury pipelines that is one of the major accidents of the target system, the hazard analyses were carried out by using a transportation model which considers heat transmission of mercury decay heat, diffusion of evaporated radioactive nuclides, etc. In the analyses, mercury, iodine, bromine and noble gas were selected as the effective source term because of their high vapor pressures and activation levels. From the preliminary analytical results obtained under the conservative conditions of 2 m/s of the air velocity around the mercury leakage area, the maximum level of the public exposure was approximately 5.8 x 10 -3 mSv. This level is negligible in comparison with 1 mSV one-year natural radiation exposure. (author)
Mercury Quick Facts: Health Effects of Mercury Exposure
... 2012 What are the Health Effects of Mercury Exposure? The health effects that can be caused by breathing mercury depend ... they breathe faster and have smaller lungs. Health effects caused by long-term exposure to mercury vapors • • Anxiety • • Excessive shyness • • Anorexia • • Sleeping ...
Small Molecular TRAIL Inducer ONC201 Induces Death in Lung Cancer Cells: A Preclinical Study.
Feng, Yuan; Zhou, Jihong; Li, Zhanhua; Jiang, Ying; Zhou, Ying
2016-01-01
Tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) selectively targets cancer cells. The present preclinical study investigated the anti-cancer efficiency of ONC201, a first-in-class small molecule TRAIL inducer, in lung cancer cells. We showed that ONC201 was cytotoxic and anti-proliferative in both established (A549 and H460 lines) and primary human lung cancer cells. It was yet non-cytotoxic to normal lung epithelial cells. Further, ONC201 induced exogenous apoptosis activation in lung cancer cells, which was evidenced by TRAIL/death receptor-5 (DR5) induction and caspase-8 activation. The caspase-8 inhibitor or TRAIL/DR5 siRNA knockdown alleviated ONC201's cytotoxicity against lung cancer cells. Molecularly, ONC201 in-activated Akt-S6K1 and Erk signalings in lung cancer cells, causing Foxo3a nuclear translocation. For the in vivo studies, intraperitoneal injection of ONC201 at well-tolerated doses significantly inhibited xenografted A549 tumor growth in severe combined immunodeficient (SCID) mice. Further, ONC201 administration induced TRAIL/DR5 expression, yet inactivated Akt-S6K1 and Erk in tumor tissues. These results of the study demonstrates the potent anti-lung cancer activity by ONC201.
Small Molecular TRAIL Inducer ONC201 Induces Death in Lung Cancer Cells: A Preclinical Study.
Directory of Open Access Journals (Sweden)
Yuan Feng
Full Text Available Tumor necrosis factor (TNF-related apoptosis-inducing ligand (TRAIL selectively targets cancer cells. The present preclinical study investigated the anti-cancer efficiency of ONC201, a first-in-class small molecule TRAIL inducer, in lung cancer cells. We showed that ONC201 was cytotoxic and anti-proliferative in both established (A549 and H460 lines and primary human lung cancer cells. It was yet non-cytotoxic to normal lung epithelial cells. Further, ONC201 induced exogenous apoptosis activation in lung cancer cells, which was evidenced by TRAIL/death receptor-5 (DR5 induction and caspase-8 activation. The caspase-8 inhibitor or TRAIL/DR5 siRNA knockdown alleviated ONC201's cytotoxicity against lung cancer cells. Molecularly, ONC201 in-activated Akt-S6K1 and Erk signalings in lung cancer cells, causing Foxo3a nuclear translocation. For the in vivo studies, intraperitoneal injection of ONC201 at well-tolerated doses significantly inhibited xenografted A549 tumor growth in severe combined immunodeficient (SCID mice. Further, ONC201 administration induced TRAIL/DR5 expression, yet inactivated Akt-S6K1 and Erk in tumor tissues. These results of the study demonstrates the potent anti-lung cancer activity by ONC201.
International Nuclear Information System (INIS)
Maag, J.; Lassen, C.; Hansen, E.
1996-01-01
A detailed assessment of the consumption of mercury, divided into use areas, was carried out. Disposal and emissions to the environment were also qualified. The assessment is mainly based on data from 1992 - 1993. The most important source of emission of mercury to air is solid waste incineration which is assessed in particular to be due to the supply of mercury in batteries (most likely mercury oxide batteries from photo equipment) and to dental fillings. The second most important source of mercury emission to air is coal-fired power plants which are estimated to account for 200-500 kg of mercury emission p.a. Other mercury emissions are mainly related to waste treatment and disposal. The consumption of mercury is generally decreasing. During the period from 1982/83 - 1992-93, the total consumption of mercury in Denmark was about halved. This development is related to the fact that consumption with regard to several important use areas (batteries, dental fillings, thermometers etc.) has been significantly reduced, while for other purposes the use of mercury has completely, or almost disappeared, i.e. (fungicides for seed, tubes etc.). (EG)
Mercury Phase II Study - Mercury Behavior in Salt Processing Flowsheet
International Nuclear Information System (INIS)
Jain, V.; Shah, H.; Wilmarth, W. R.
2016-01-01
Mercury (Hg) in the Savannah River Site Liquid Waste System (LWS) originated from decades of canyon processing where it was used as a catalyst for dissolving the aluminum cladding of reactor fuel. Approximately 60 metric tons of mercury is currently present throughout the LWS. Mercury has long been a consideration in the LWS, from both hazard and processing perspectives. In February 2015, a Mercury Program Team was established at the request of the Department of Energy to develop a comprehensive action plan for long-term management and removal of mercury. Evaluation was focused in two Phases. Phase I activities assessed the Liquid Waste inventory and chemical processing behavior using a system-by-system review methodology, and determined the speciation of the different mercury forms (Hg+, Hg++, elemental Hg, organomercury, and soluble versus insoluble mercury) within the LWS. Phase II activities are building on the Phase I activities, and results of the LWS flowsheet evaluations will be summarized in three reports: Mercury Behavior in the Salt Processing Flowsheet (i.e. this report); Mercury Behavior in the Defense Waste Processing Facility (DWPF) Flowsheet; and Mercury behavior in the Tank Farm Flowsheet (Evaporator Operations). The evaluation of the mercury behavior in the salt processing flowsheet indicates, inter alia, the following: (1) In the assembled Salt Batches 7, 8 and 9 in Tank 21, the total mercury is mostly soluble with methylmercury (MHg) contributing over 50% of the total mercury. Based on the analyses of samples from 2H Evaporator feed and drop tanks (Tanks 38/43), the source of MHg in Salt Batches 7, 8 and 9 can be attributed to the 2H evaporator concentrate used in assembling the salt batches. The 2H Evaporator is used to evaporate DWPF recycle water. (2) Comparison of data between Tank 21/49, Salt Solution Feed Tank (SSFT), Decontaminated Salt Solution Hold Tank (DSSHT), and Tank 50 samples suggests that the total mercury as well as speciated
EURISOL-DS MULTI-MW TARGET ISSUES: BEAM WINDOW AND TRANSVERSE FILM TARGET
Adonai Herrera-Martínez, Yacine Kadi
The analysis of the EURISOL-DS Multi_MW target precise geometry (Fig.1) has proved that large fission yields can be achieved with a 4 MW, providing a technically feasible design to evacuate the power deposited in the liquid mercury. Different designs for the mercury flow have been proposed, which maintain its temperature below the boiling point with moderate flow speeds (maximum 4 m/s).
Dynamic Pressure of Liquid Mercury Target During 800-MeV Proton Thermal Shock Tests
International Nuclear Information System (INIS)
Allison, S.W.; Andriulli, J.B.; Cates, M.R.; Earl, D.D.; Haines, J.R.; Morrissey, F.X.; Tsai, C.C.; Wender, S.
2000-01-01
Described here are efforts to diagnose transient pressures generated by a short-pulse (about 0.5 microseconds) high intensity proton (∼ 2 * 10 14 per pulse) beam. Proton energy is 800-MeV. The tests were performed at the Los Alamos Neutron Science Center - Weapons Neutron Research (LANSCE-WNR). Such capability is required for understanding target interaction for the Spallation Neutron Source project as described previously at this conference.1-4 The main approach to effect the pressure measurements utilized the deflection of a diaphragm in intimate contact with the mercury. There are a wide variety of diaphragm-deflection methods used in scientific and industrial applications. Many deflection-sensing approaches are typically used, including, for instance, capacitive and optical fiber techniques. It was found, however, that conventional pressure measurement using commercial pressure gages with electrical leads was not possible due to the intense nuclear radiation environment. Earlier work with a fiber optic strain gauge demonstrated the viability of using fiber optics for this environment
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...
Distribution and retention of organic and inorganic mercury in methyl mercury-treated neonatal rats
International Nuclear Information System (INIS)
Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Hall, L.L.; Mushak, P.
1988-01-01
Seven-day-old Long Evans rats received one mumol of 203 Hg-labeled methyl mercury/kg sc and whole body retention and tissue distribution of organic and inorganic mercury were examined for 32 days postdosing. Neonates cleared mercury slowly until 10 days postdosing when the clearance rate abruptly increased. During the interval when whole body clearance of mercury was extremely slow, methyl mercury was metabolized to inorganic mercury. Peak concentration of mercury in kidney occurred at 2 days postdosing. At 32 days postdosing, 8% of mercury in kidney was in an organic from. Liver mercury concentration peaked at 2 days postdosing and organic mercury accounted for 38% at 32 days postdosing. Brain concentrations of mercury peaked at 2 days postdosing. At 10 days postdosing, organic mercury accounted for 86% of the brain mercury burden, and, at 32 days postdosing, for 60%. The percentage of mercury body burden in pelt rose from 30 to 70% between 1 and 10 days postdosing. At 32 days postdosing pelt contained 85% of the body burden of mercury. At all time points, about 95% of mercury in pelt was in an organic form. Compartmental analysis of these data permitted development of a model to describe the distribution and excretion of organic and inorganic mercury in methyl mercury-treated neonatal rats
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH201 (Link to dictyBase) - - - Contig-U14690-1 SLH201F (Link to Original site) SLH2...01F 395 - - - - - - Show SLH201 Library SL (Link to library) Clone ID SLH201 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH201Q.Seq.d/ Representative seq. ID SLH20...1F (Link to Original site) Representative DNA sequence >SLH201 (SLH201Q) /CSM/SL/SLH2-A/SLH201Q.Seq.d/ CACCA...M/SL/SLH4-C/SLH463Q.Seq.d/ 718 0.0 SLH201 (SLH201Q) /CSM/SL/SLH2-A/SLH201Q.Seq.d/ 718 0.0 SSF514 (SSF514Q) /
Preliminary study of mercury target structure
Energy Technology Data Exchange (ETDEWEB)
Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kumasaka, Katsuyuki; Uchida, Shoji; Nakagawa, Toshi; Mori, Seiji; Nishikawa, Akira
1997-11-01
Development of a proton accelerator based neutron source (1.5 GeV, 5.3 mA (for neutron source 3.3 mA), thermal power 8 MW) is currently conducted by the Special Task Force for Neutron Science Initiative, JAERI. Preliminary design studies and related R and D of a solid metal target for the first stage (1.5 GeV, 1 mA) and a liquid metal target for both the first and second stages (1.5 GeV, 3.3 mA) are conducted by the Target Group to develop both solid and liquid metal target systems. A few kinds of target structures have been investigated in FY 1996 and the preliminary results for the target structures are described in this paper. Investigation results of alternative materials for the target container are also described in this paper. (author)
Comparison of damage induced by mercury chloride and ionizing radiation in the susceptible rat model
International Nuclear Information System (INIS)
Kim, Ji Hyang; Yoon, Yong Dal; Kim, Jin Kyu
2003-01-01
Mercury (Hg), one of the most diffused and hazardous organ-specific environmental contaminants, exists in a wide variety of physical and chemical states. Although the reports indicate that mercury induces a deleterious damage, little has been reported from the investigations of mercury effects in living things. The purpose of this study is to evaluate the effects of mercury chloride and ionizing radiation. Prepubertal male F-344 rats were administered mercury chloride in drinking water throughout the experimental period. Two weeks after whole body irradiation, organs were collected for measuring the induced injury. Serum levels of GOT, GPT, ALP, and LDH were checked in the experimental groups and the hematological analysis was accomplished in plasma. In conclusion, the target organ of mercury chloride seems to be urinary organs and the pattern of damage induced by mercury differs from that of the irradiated group
Method for removal and stabilization of mercury in mercury-containing gas streams
Broderick, Thomas E.
2005-09-13
The present invention is directed to a process and apparatus for removing and stabilizing mercury from mercury-containing gas streams. A gas stream containing vapor phase elemental and/or speciated mercury is contacted with reagent, such as an oxygen-containing oxidant, in a liquid environment to form a mercury-containing precipitate. The mercury-containing precipitate is kept or placed in solution and reacts with one or more additional reagents to form a solid, stable mercury-containing compound.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 24.201 Section 24.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS PROTECTION OF PRIVACY AND FREEDOM OF INFORMATION Freedom of Information Act 24.201 Authority. The Freedom of...
Mercury-impacted scrap metal: Source and nature of the mercury.
Finster, Molly E; Raymond, Michelle R; Scofield, Marcienne A; Smith, Karen P
2015-09-15
The reuse and recycling of industrial solid wastes such as scrap metal is supported and encouraged both internationally and domestically, especially when such wastes can be used as substitutes for raw material. However, scrap metal processing facilities, such as mini-mills, have been identified as a source of mercury (Hg) emissions in the United States. This research aims to better define some of the key issues related to the source and nature of mercury in the scrap metal waste stream. Overall, it is difficult to pinpoint the key mercury sources feeding into scrap metal recycling facilities, quantify their associated mercury concentrations, or determine which chemical forms are most significant. Potential sources of mercury in scrap metal include mercury switches from discarded vehicles, electronic-based scrap from household appliances and related industrial systems, and Hg-impacted scrap metal from the oil and gas industry. The form of mercury associated with scrap metal varies and depends on the source type. The specific amount of mercury that can be adsorbed and retained by steel appears to be a function of both metallurgical and environmental factors. In general, the longer the steel is in contact with a fluid or condensate that contains measurable concentrations of elemental mercury, the greater the potential for mercury accumulation in that steel. Most mercury compounds are thermally unstable at elevated temperatures (i.e., above 350 °C). As such, the mercury associated with impacted scrap is expected to be volatilized out of the metal when it is heated during processing (e.g., shredding or torch cutting) or melted in a furnace. This release of fugitive gas (Hg vapor) and particulates, as well as Hg-impacted bag-house dust and control filters, could potentially pose an occupational exposure risk to workers at a scrap metal processing facility. Thus, identifying and characterizing the key sources of Hg-impacted scrap, and understanding the nature and extent
Mercury contamination extraction
Fuhrmann, Mark [Silver Spring, MD; Heiser, John [Bayport, NY; Kalb, Paul [Wading River, NY
2009-09-15
Mercury is removed from contaminated waste by firstly applying a sulfur reagent to the waste. Mercury in the waste is then permitted to migrate to the reagent and is stabilized in a mercury sulfide compound. The stable compound may then be removed from the waste which itself remains in situ following mercury removal therefrom.
Global Trends in Mercury Management
Choi, Kyunghee
2012-01-01
The United Nations Environmental Program Governing Council has regulated mercury as a global pollutant since 2001 and has been preparing the mercury convention, which will have a strongly binding force through Global Mercury Assessment, Global Mercury Partnership Activities, and establishment of the Open-Ended Working Group on Mercury. The European Union maintains an inclusive strategy on risks and contamination of mercury, and has executed the Mercury Export Ban Act since December in 2010. The US Environmental Protection Agency established the Mercury Action Plan (1998) and the Mercury Roadmap (2006) and has proposed systematic mercury management methods to reduce the health risks posed by mercury exposure. Japan, which experienced Minamata disease, aims vigorously at perfection in mercury management in several ways. In Korea, the Ministry of Environment established the Comprehensive Plan and Countermeasures for Mercury Management to prepare for the mercury convention and to reduce risks of mercury to protect public health. PMID:23230466
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Authority. 724.201 Section 724.201 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.201 Authority. The Naval Discharge Review Board...
43 CFR 20.201 - Ethics officials.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Ethics officials. 20.201 Section 20.201... Department Ethics Program § 20.201 Ethics officials. (a) Designated Agency Ethics Official refers to the official designated under 5 CFR 2638.201 to coordinate and manage the Department's ethics program. (b) The...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 17.201 Section 17.201 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN FEDERALLY ASSISTED PROGRAMS OF THE DEPARTMENT OF THE INTERIOR Nondiscrimination on the Basis of Handicap § 17.201 Application...
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Application. 16.201 Section 16.201 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN CHEMICAL TESTING Required Chemical Testing § 16.201 Application. (a) Chemical testing of personnel must be conducted as required by this...
7 CFR 201.42 - Small containers.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container or...
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Delegation. 2601.201 Section 2601.201... § 2601.201 Delegation. (a) The authority to solicit, accept, and utilize gifts in accordance with this... in accordance with paragraph (b) of this section may be redelegated only through a written delegation...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.20 Section 201.20 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.20 Germination. The label shall show the percentage of germination each kind, or kind and variety, or kind and type, or kind and hybrid of agricultural seed present...
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Frames. 393.201 Section 393.201 Transportation... SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.201 Frames. (a) The frame or chassis of each commercial motor vehicle shall not be cracked, loose, sagging or...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit. 31.201 Section 31.201 Judicial Administration DEPARTMENT OF JUSTICE OJJDP GRANT PROGRAMS Formula Grants General Requirements § 31.201 Audit. The State must assure that it adheres to the audit requirements enumerated in the “Financial and...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employment. 201.140 Section 201.140 Customs Duties... Commission § 201.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...
2010-01-01
... establishments in the private sector by personal visit of data collectors. Host activity is the local Federal... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 532.201 Section 532.201... Prevailing Rate Determinations § 532.201 Definitions. For the purposes of this part: Full-scale survey means...
SNS Target Test Facility for remote handling design and verification
International Nuclear Information System (INIS)
Spampinato, P.T.; Graves, V.B.; Schrock, S.L.
1998-01-01
The Target Test Facility will be a full-scale prototype of the Spallation Neutron Source Target Station. It will be used to demonstrate remote handling operations on various components of the mercury flow loop and for thermal/hydraulic testing. This paper describes the remote handling aspects of the Target Test Facility. Since the facility will contain approximately 1 cubic meter of mercury for the thermal/hydraulic tests, an enclosure will also be constructed that matches the actual Target Test Cell
The STS-95 crew poses with a Mercury capsule model before returning to JSC
1998-01-01
Before returning to the Johnson Space Center in Houston, Texas, members of the STS-95 crew pose with a model of a Mercury capsule following a media briefing at the Kennedy Space Center Press Site Auditorium . From left to right are Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA); Pilot Steven W. Lindsey; Mission Commander Curtis L. Brown Jr.; Friendship 7; Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts; Mission Specialist Scott E. Parazynski; and Mission Specialist Pedro Duque, with the European Space Agency (ESA). Also on the crew is Mission Specialist and Payload Commander Stephen K. Robinson (not shown). The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.63 Section 201.63 Agriculture... REGULATIONS Tolerances § 201.63 Germination. The following tolerances are applicable to the percentage of germination and also to the sum of the germination plus the hard seed when 400 or more seeds are tested. Mean...
Energy Technology Data Exchange (ETDEWEB)
Gorton, B
1924-01-01
Cats which had been kept in a thermometer factory to catch rats were afflicted with mercury poisoning. So were the rats they were supposed to eat. The symptoms of mercury poisoning were the same in both species. The source of mercury for these animals is a fine film of the metal which coats floors, a result of accidental spills during the manufacturing process.
Mercury emissions from South Africa’s coal-fired power stations
Directory of Open Access Journals (Sweden)
Belinda L. Garnham
2016-12-01
can be achieved as a co-benefit of installing other emission abatement technologies. At the very least, more accurate calculations of mercury emissions per power station should be obtained by measuring the mercury content of more recent coal samples, and developing power station-specific ERF’s before mercury emission regulations are established or an investment into targeted mercury emission reduction technology is made.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Settlement. 201.54 Section 201... Regulations Pertaining to the Equal Access to Justice Act § 201.54 Settlement. The applicant and counsel for the Office or Division of the Commission may agree on a proposed settlement of the award before final...
Directory of Open Access Journals (Sweden)
Yong Choi
2017-11-01
Full Text Available In a pilot-plant-scale thermal mercury treatment of phosphor powder from spent fluorescent lamps, energy consumption was estimated to control mercury content by the consideration of reaction kinetics. Mercury content was analyzed as a function of treatment temperature and time. The initial mercury content of the phosphor powder used in the thermal process was approximately 3500 mg/kg. The target mercury content in the phosphor powder thermal process of the phosphor powder was 5 mg/kg or less at 400 °C or higher because the target mercury content was recommended by Minamata Convention and Basel Convention. During thermal processing, the reaction rate was represented by a first order reaction with the Arrhenius equation. The reaction rate constant increased with temperature from 0.0112 min−1 at 350 °C to 0.0558 min−1 at 600 °C. The frequency factor was 2.51 min−1, and the activation energy was 6509.11 kcal/kg. Reaction rate constants were used to evaluate the treatment time required to reduce mercury content in phosphor powder to be less than 5 mg/kg. The total energy consumption in a pilot-plant-scale thermal process was evaluated to determine the optimal temperature for removing mercury in phosphor powder.
McKillop, James H.
1980-01-01
The radioactive isotope thallium 201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The radionuclide emits 80 keV x-rays which are suitable for scintillation camera imaging. The main clinical application of 201TI scintigraphy has been in myocardial imaging. Abnormal uptake of the isotope results in a cold spot on the myocardial image. In patients with coronary artery disease, the differentiation of ischemic and infarcted myocardium is made by comparing images obtained after injecting the radionuclide at the peak of a maximal exercise test with those obtained after injection at rest. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. Some investigators believe that redistribution images obtained four to six hours after stress injection (without administering further 201TI) give the same information as a separate rest study. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 percent to 95 percent, though computer processing of the images may be necessary to achieve the higher figure. The prediction of the extent of coronary disease from 201TI images is less reliable. An abnormal 201TI image is not entirely specific for coronary artery disease and the likelihood of an abnormal image being due to this diagnosis varies according to the clinical circumstances. The main clinical value of 201TI myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most
Wan, Qi; Feng, Xinbin; Lu, Julia; Zheng, Wei; Song, Xinjie; Li, Ping; Han, Shijie; Xu, Hao
2009-08-01
Reactive gaseous mercury (RGM) and particulate mercury (Hgp) concentrations in ambient air from a remote site at Changbai Mountain area in northeastern China were intermittently monitored from August 2005 to July 2006 totaling 93 days representing fall, winter-spring and summer season, respectively. Rainwater and snow samples were collected during a whole year, and total mercury (THg) in rain samples were used to calculate wet depositional flux. A throughfall method and a model method were used to estimate dry depositional flux. Results showed mean concentrations of RGM and Hgp are 65 and 77 pg m(-3). Compared to background concentrations of atmospheric mercury species in Northern Hemisphere, RGM and Hgp are significantly elevated in Changbai area. Large values for standard deviation indicated fast reactivity and a low residence time for these mercury species. Seasonal variability is also important, with lower mercury levels in summer compared to other seasons, which is attributed to scavenging by rainfall and low local mercury emissions in summer. THg concentrations ranged from 11.5 to 15.9 ng L(-1) in rainwater samples and 14.9-18.6 ng L(-1) in throughfall samples. Wet depositional flux in Changbai area is calculated to be 8.4 microg m(-2) a(-1), and dry deposition flux is estimated to be 16.5 microg m(-2) a(-1) according to a throughfall method and 20.2 microg m(-2) a(-1) using a model method.
Binary mixtures of mercury/ selenium, and lead/selenium
African Journals Online (AJOL)
Physiologically-based biokinetic models have been developed for predicting simultaneously the Absorption, Distribution, Metabolism and Elimination (ADME) properties of lead (Pb) and selenium (Se), and mercury (Hg) and selenium in a number of target tissues of humans. This was done for three population groups, ...
Xun, Yu; Feng, Liu; Li, Youdan; Dong, Haochen
2017-12-01
Cyrtomium macrophyllum naturally grown in 225.73 mg kg -1 of soil mercury in mining area was found to be a potential mercury accumulator plant with the translocation factor of 2.62 and the high mercury concentration of 36.44 mg kg -1 accumulated in its aerial parts. Pot experiments indicated that Cyrtomium macrophyllum could even grow in 500 mg kg -1 of soil mercury with observed inhibition on growth but no obvious toxic effects, and showed excellent mercury accumulation and translocation abilities with both translocation and bioconcentration factors greater than 1 when exposed to 200 mg kg -1 and lower soil mercury, indicating that it could be considered as a great mercury accumulating species. Furthermore, the leaf tissue of Cyrtomium macrophyllum showed high resistance to mercury stress because of both the increased superoxide dismutase activity and the accumulation of glutathione and proline induced by mercury stress, which favorited mercury translocation from the roots to the aerial parts, revealing the possible reason for Cyrtomium macrophyllum to tolerate high concentration of soil mercury. In sum, due to its excellent mercury accumulation and translocation abilities as well as its high resistance to mercury stress, the use of Cyrtomium macrophyllum should be a promising approach to remediating mercury polluted soils. Copyright © 2017 Elsevier Ltd. All rights reserved.
Ratio of tritiated water and hydrogen generated in mercury through a nuclear reaction
Energy Technology Data Exchange (ETDEWEB)
Manabe, K. [Nuclear Science and Engineering Directorate, Japan Atomic Energy Agency (JAEA), Tokai, Naka-gun, Ibaraki 319-1195 (Japan)], E-mail: manabe.kentaro@jaea.go.jp; Yokoyama, S. [Nuclear Science and Engineering Directorate, Japan Atomic Energy Agency (JAEA), Tokai, Naka-gun, Ibaraki 319-1195 (Japan)
2008-02-15
Tritium generated in a mercury target is a source of potential exposure of personnel at high-energy accelerator facilities. Knowledge of the chemical form of tritium is necessary to estimate the internal doses. We studied the tritium generation upon thermal neutron irradiation of a mercury target modified into liquid lithium amalgam to examine the ratio of tritiated water ([{sup 3}H]H{sub 2}O) and tritiated hydrogen ([{sup 3}H]H{sub 2}). The ratio between [{sup 3}H]H{sub 2}O and [{sup 3}H]H{sub 2} generated in lithium amalgam was 4:6 under these experimental conditions.
Toward a Unified Understanding of Mercury and Methylated Mercury from the World's Oceans
McNutt, M. K.; Krabbenhoft, D. P.; Landing, W. M.; Sunderland, E. M.
2012-12-01
Marine fish and shellfish are the main source of toxic methylmercury exposure for humans. As recently as decade ago, very limited aqueous methylated mercury data were available from marine settings, resulting in a generally poor understanding of the processes controlling mercury in pelagic marine food webs. Recent oceanographic cruises have significantly improved availability of reliable measurements of methylated mercury and total mercury in seawater. This presentation will focus on vertical seawater profiles collected to depths 1000 m from three recent sampling efforts in collaboration with the CLIVAR Repeat Hydrography Program sponsored by NOAA including: 1) the northeastern Pacific (P16N cruise from Honolulu, Hawaii to Kodiak, Alaska); (2) the southern Indian Ocean (I5 cruise from Cape Town, South Africa, to Fremantle, Australia); and, (3) the Southern Ocean cruise (S4P from McMurdo, Antarctica, to Punta Arenas, Chile). Analytical results presented were all derived from the USGS Mercury Research Lab (http://wi.water.usgs.gov/mercury-lab). Supporting data derived from these cruises on water mass ages, nutrients, carbon and dissolved oxygen provide an opportunity to develop a stronger understanding of the biogeochemical factors controlling oceanic distributions of mercury and methylated mercury. Whole-water, median total mercury, and methylated mercury concentrations for the northern Pacific, southern Indian, and Southern Ocean were 1.10, 0.80, and 1.65 pM, , and 0.11, 0.08, and 0.32 pM, respectively. For all three oceans, vertical profiles of total mercury generally show the lowest concentrations in the surface mixed layer, and concentration maxima at the 700-1000 m depths. Surface depletion of total mercury is attributed to photo-chemical reduction and evasion of gaseous elemental mercury as well as scavenging by settling particulate matter, the main vector of transport to the subsurface ocean. Methylated mercury in all the ocean profiles reveal distinct mid
Effect of tensile stress on cavitation damage formation in mercury
Energy Technology Data Exchange (ETDEWEB)
Naoe, Takashi, E-mail: naoe.takashi@jaea.go.j [J-PARC Center, Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan); Kogawa, Hiroyuki [J-PARC Center, Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan); Yamaguchi, Yoshihito [Nuclear Safety Research Center, Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan); Futakawa, Masatoshi [J-PARC Center, Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan)
2010-03-15
Cavitation erosion or so called pitting damage was investigated under tensile stress conditions in mercury. In MW-class liquid metal spallation targets, pitting damage is a critical issue to satisfy required power and/or lifetime of the target vessel. Cavitation occurs by negative pressure which is induced through pressure wave propagation due to proton beam injection. Pitting damage is formed by microjet and/or shock wave during cavitation bubble collapse. A mercury target vessel suffers tensile stress due to thermal stress or welding. In order to investigate the effect of tensile stress on pitting damage formation, cavitation erosion tests were performed using stress imposed specimens in mercury. An ultrasonic vibratory horn and electro-Magnetic IMpact Testing Machine (MIMTM) were used to vary the cavitation intensity. In the incubation period of pitting damage, damaged area was slightly increased with increasing imposed tensile stress. In the steady state period, a mean depth of erosion was increased by the tensile stress. Additionally, in order to quantitatively evaluate the effect of tensile stress, an indentation test with Vickers indenter was carried out to quasi-statically simulate the impact load. From the measurement of the diagonal length of the indent aspect ratio and hardness, it is recognized that the threshold of the deformation, i.e. pitting damage formation, was decreased by the tensile stress.
Energy Technology Data Exchange (ETDEWEB)
Ulfvarson, U
1973-01-01
The results of investigations of the distribution and excretion of organic and inorganic mercury compounds in albino rats and white leghorn hens conducted over a period of ten years are surveyed. The storage of mercury in eggs as well as its effects on the egg-lay-frequency and hatchability of the eggs have also been studied. All investigated mercury compounds were labelled with the radioactive mercury isotope /sup 203/Hg and the mercury level was measured with a scintillation technique. Since antidotes used in the treatment of mercury poisoning influence not only the excretion of mercury, but also its distribution in the body, the effects of nine antidotes on the metabolism of different mercury compounds were also investigated. The results of the survey are presented graphically. 6 references, 15 figures, 1 table.
JAERI/KEK target material program overview
International Nuclear Information System (INIS)
Kikuchi, Kenji; Kogawa, Hiroyuki; Sasa, Toshinobu
2001-01-01
Mercury target was designed for megawatt neutron scattering facility in JAERI/KEK spallation neutron source. The incident proton energy and current are 3 GeV and 333 μA, respectively: the total proton energy is 1 MW in short pulses at a frequency of 25 Hz. Under the guide rule the mercury target was designed: the maximum temperature of target window is 170degC and induced stresses for the type 316 stainless steel are within limits of design guide. In order to demonstrate ADS (Accelerator Driven Systems) transmutation critical and engineering facilities have been designed conceptually. In engineering facility lead-bismuth spallation target station is to be planned. Objective to build the facility is to demonstrate material irradiation. According to neutronics calculation irradiation damage of the target vessel window will be 5 dpa per year. (author)
Ultralow Level Mercury Treatment Using Chemical Reduction and Air Stripping: Scoping Report
International Nuclear Information System (INIS)
Looney, B.B.
2000-01-01
Data collected during the first stage of a Savannah River Technology Center (SRTC) Strategic Research and Development Project confirmed the efficacy of chemical reduction and air stripping/sparging as an ultralow level mercury treatment concept for waters containing Hg(II). The process consists of dosing the water with low levels of stannous chloride to convert the mercury to Hg. This form of mercury can easily be removed from the water by air stripping or sparging. Samples of Savannah River Site (SRS) groundwater containing approximately 130 ng/L of total mercury (as Hg(II)) were used for the study. In undosed samples, sparging removed 0 percent of the initial mercury. In the dosed samples, all of the removals were greater than 94 percent, except in one water type at one dose. This sample, which was saturated with dissolved oxygen, showed a 63 percent reduction in mercury following treatment at the lowest dose. Following dosing at minimally effective levels and sparging, treated water contained less than 10 ng/L total mercury. In general, the data indicate that the reduction of mercury is highly favored and that stannous chloride reagent efficiently targets the Hg(II) contaminant in the presence of competing reactions. Based on the results, the authors estimated that the costs of implementing and operating an ultralow level mercury treatment process based on chemical reduction and stripping/sparging are 10 percent to 20 percent of traditional treatment technologies
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Bags. 201.41 Section 201.41 Agriculture Regulations of... Sampling in the Administration of the Act § 201.41 Bags. (a) For lots of six bags or less, each bag shall be sampled. A total of at least five trierfuls shall be taken. (b) For lots of more than six bags...
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Options. 48.201 Section 48.201 National Defense...'S FAMILY PROTECTION PLAN Election of Options § 48.201 Options. As provided in § 48.203, a member may... amount equal to such 121/2 per centum. (a) Option 1 is an annuity payable to or on behalf of his widow...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT
Mechanisms involved in the transport of mercuric ions in target tissues
Bridges, Christy C.; Zalups, Rudolfs K.
2016-01-01
Mercury exists in the environment in various forms, all of which pose a risk to human health. Despite guidelines regulating the industrial release of mercury into the environment, humans continue to be exposed regularly to various forms of this metal via inhalation or ingestion. Following exposure, mercuric ions are taken up by and accumulate in numerous organs, including brain, intestine, kidney, liver, and placenta. In order to understand the toxicological effects of exposure to mercury, a thorough understanding of the mechanisms that facilitate entry of mercuric ions into target cells must first be obtained. A number of mechanisms for the transport of mercuric ions into target cells and organs have been proposed in recent years. However, the ability of these mechanisms to transport mercuric ions and the regulatory features of these carriers have not been characterized completely. The purpose of this review is to summarize the current findings related to the mechanisms that may be involved in the transport of inorganic and organic forms of mercury in target tissues and organs. This review will describe mechanisms known to be involved in the transport of mercury and will also propose additional mechanisms that may potentially be involved in the transport of mercuric ions into target cells. PMID:27422290
Mercury's exosphere: observations during MESSENGER's First Mercury flyby.
McClintock, William E; Bradley, E Todd; Vervack, Ronald J; Killen, Rosemary M; Sprague, Ann L; Izenberg, Noam R; Solomon, Sean C
2008-07-04
During MESSENGER's first Mercury flyby, the Mercury Atmospheric and Surface Composition Spectrometer measured Mercury's exospheric emissions, including those from the antisunward sodium tail, calcium and sodium close to the planet, and hydrogen at high altitudes on the dayside. Spatial variations indicate that multiple source and loss processes generate and maintain the exosphere. Energetic processes connected to the solar wind and magnetospheric interaction with the planet likely played an important role in determining the distributions of exospheric species during the flyby.
International Nuclear Information System (INIS)
Rodrigues dos Santos, Isaac; Silva-Filho, Emmanoel Vieira; Schaefer, Carlos; Maria Sella, Silvia; Silva, Carlos A.; Gomes, Vicente; Passos, Maria Jose de A.C.R.; Phan Van Ngan
2006-01-01
This paper provides the first quantitative information on mercury in soil, coastal sediment, and in characteristic organisms of terrestrial and shallow coastal marine ecosystems from Admiralty Bay (King George Island, Antarctica). As expected for a remote area, mercury content is low in abiotic components of the ecosystem, and probably similar to natural levels. Mercury also occurs in very low concentrations in the vegetation, invertebrates and fish. These low mercury levels may be due to sulphide formation in reducing sediments of this environment. Higher concentrations of mercury occurred in bird feathers and mammal hair, indicating biomagnification. This was not found for Zinc. These results may be useful as a reference background to detect future inputs of trace elements in this remote area of the earth. Terrestrial vegetation and bird feathers are suggested as target regional biomonitors. - Low levels of mercury and zinc occurred in soil and plant samples from Antarctica, but high levels occurred in birds and mammals
Spallation neutron source target station design, development, and commissioning
Energy Technology Data Exchange (ETDEWEB)
Haines, J.R., E-mail: hainesjr@ornl.gov; McManamy, T.J.; Gabriel, T.A.; Battle, R.E.; Chipley, K.K.; Crabtree, J.A.; Jacobs, L.L.; Lousteau, D.C.; Rennich, M.J.; Riemer, B.W.
2014-11-11
The spallation neutron source target station is designed to safely, reliably, and efficiently convert a 1 GeV beam of protons to a high flux of about 1 meV neutrons that are available at 24 neutron scattering instrument beam lines. Research and development findings, design requirements, design description, initial checkout testing, and results from early operation with beam are discussed for each of the primary target subsystems, including the mercury target, neutron moderators and reflector, surrounding vessels and shielding, utilities, remote handling equipment, and instrumentation and controls. Future plans for the mercury target development program are also briefly discussed.
48 CFR 1318.201 - Contingency operation.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contingency operation. 1318.201 Section 1318.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 1318.201 Contingency...
41 CFR 50-201.101 - Employees affected.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Employees affected. 50-201.101 Section 50-201.101 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.101 Employees...
LM2-Mercury, a mercury mass balance model, was developed to simulate and evaluate the transport, fate, and biogeochemical transformations of mercury in Lake Michigan. The model simulates total suspended solids (TSS), disolved organic carbon (DOC), and total, elemental, divalent, ...
Zhu, Yanqun; Zhou, Jinsong; He, Sheng; Cai, Xiaoshu; Hu, Changxin; Zheng, Jianming; Zhang, Le; Luo, Zhongyang; Cen, Kefa
2007-06-01
The mercury emission control approach attaches more importance. The accurate measurement of mercury speciation is a first step. Because OH method (accepted method) can't provide the real-time data and 2-week time for results attained, it's high time to seek on line mercury continuous emission monitors(Hg-CEM). Firstly, the gaseous elemental and oxidized mercury were conducted to measure using OH and CEM method under normal operation conditions of PC boiler after ESP, the results between two methods show good consistency. Secondly, through ESP, gaseous oxidized mercury decrease a little and particulate mercury reduce a little bit, but the elemental mercury is just the opposite. Besides, the WFGD system achieved to gaseous oxidized mercury removal of 53.4%, gaseous overall mercury and elemental mercury are 37.1% and 22.1%, respectively.
18 CFR 706.201 - Proscribed actions.
2010-04-01
... economy; (d) Losing complete independence or impartiality; (e) Making a Government decision outside....201 Section 706.201 Conservation of Power and Water Resources WATER RESOURCES COUNCIL EMPLOYEE RESPONSIBILITIES AND CONDUCT Conduct and Responsibilities of Employees § 706.201 Proscribed actions. An employee...
Global Sources and Pathways of Mercury in the Context of Human Health
Directory of Open Access Journals (Sweden)
Kyrre Sundseth
2017-01-01
Full Text Available This paper reviews information from the existing literature and the EU GMOS (Global Mercury Observation System project to assess the current scientific knowledge on global mercury releases into the atmosphere, on global atmospheric transport and deposition, and on the linkage between environmental contamination and potential impacts on human health. The review concludes that assessment of global sources and pathways of mercury in the context of human health is important for being able to monitor the effects from implementation of the Minamata Convention targets, although new research is needed on the improvement of emission inventory data, the chemical and physical behaviour of mercury in the atmosphere, the improvement of monitoring network data, predictions of future emissions and speciation, and on the subsequent effects on the environment, human health, as well as the economic costs and benefits of reducing these aspects.
Mercury in canned tuna: white versus light and temporal variation
International Nuclear Information System (INIS)
Burger, Joanna; Gochfeld, Michael
2004-01-01
mercury. These data indicate that people who eat canned tuna frequently can choose light tuna and reduce their mercury intake. Canned mackerel had much lower levels of mercury than tuna. Since cans of white tuna frequently exceed the FDA's original action level of 0.5 ppm, it would be prudent to continue some systematic monitoring of the nation's canned fish supply, particularly as the targets of commercial fisheries inevitably change as certain stocks become depleted
Biomarkers of mercury exposure at a mercury recycling facility in Ukraine
Gibb, H.J.; Kozlov, K.; Buckley, J.P.; Centeno, J.; Jurgenson, V.; Kolker, A.; Conko, K.; Landa, E.; Panov, B.; Panov, Y.; Xu, H.
2008-01-01
This study evaluates biomarkers of occupational mercury exposure among workers at a mercury recycling operation in Gorlovka, Ukraine. The 29 study participants were divided into three occupational categories for analysis: (1) those who worked in the mercury recycling operation (Group A, n = 8), (2) those who worked at the facility but not in the yard where the recycling was done (Group B, n = 14), and (3) those who did not work at the facility (Group C, n = 7). Urine, blood, hair, and nail samples were collected from the participants, and a questionnaire was administered to obtain data on age, gender, occupational history, smoking, alcohol consumption, fish consumption, tattoos, dental amalgams, home heating system, education, source of drinking water, and family employment in the former mercury mine/smelter located on the site of the recycling facility. Each factor was tested in a univariate regression with total mercury in urine, blood, hair, and nails. Median biomarker concentrations were 4.04 ??g/g-Cr (urine), 2.58 ??g/L (blood), 3.95 ??g/g (hair), and 1.16 ??g/g (nails). Occupational category was significantly correlated (p < 0.001) with both blood and urinary mercury concentrations but not with hair or nail mercury. Four individuals had urinary mercury concentrations in a range previously found to be associated with subtle neurological and subjective symptoms (e.g., fatigue, loss of appetite, irritability), and one worker had a urinary mercury concentration in a range associated with a high probability of neurological effects and proteinuria. Comparison of results by occupational category found that workers directly involved with the recycling operation had the highest blood and urinary mercury levels. Those who worked at the facility but were not directly involved with the recycling operation had higher levels than those who did not work at the facility. Copyright ?? 2008 JOEH, LLC.
Concentration of mercury in wheat samples stored with mercury tablets as preservative
International Nuclear Information System (INIS)
Lalit, B.Y.; Ramachandran, T.V.
1977-01-01
Tablets consisting of mercury in the form of a dull grey powder made by triturating mercury with chalk and sugar are used in Indian household for storing food-grains. The contamination of wheat samples by mercury, when stored with mercury tablets for period of upto four years has been assessed by using non-destructive neutron activation analysis. The details of the analytical procedure used have also been briefly described. The concentration of mercury in wheat increases with storage period. Loss of weight of mercury tablet is proportional to the storage period to a first approximation. In the present experiment, the average weight loss at the and end of first year was 0.009716 g corresponding to 6 ppm in wheat. (T.G.)
Mercury Flow Through the Mercury-Containing Lamp Sector of the Economy of the United States
Goonan, Thomas G.
2006-01-01
Introduction: This Scientific Investigations Report examines the flow of mercury through the mercury-containing lamp sector of the U.S. economy in 2001 from lamp manufacture through disposal or recycling. Mercury-containing lamps illuminate commercial and industrial buildings, outdoor areas, and residences. Mercury is an essential component in fluorescent lamps and high-intensity discharge lamps (high-pressure sodium, mercury-vapor, and metal halide). A typical fluorescent lamp is composed of a phosphor-coated glass tube with electrodes located at either end. Only a very small amount of the mercury is in vapor form. The remainder of the mercury is in the form of either liquid mercury metal or solid mercury oxide (mercury oxidizes over the life of the lamp). When voltage is applied, the electrodes energize the mercury vapor and cause it to emit ultraviolet energy. The phosphor coating absorbs the ultraviolet energy, which causes the phosphor to fluoresce and emit visible light. Mercury-containing lamps provide more lumens per watt than incandescent lamps and, as a result, require from three to four times less energy to operate. Mercury is persistent and toxic within the environment. Mercury-containing lamps are of environmental concern because they are widely distributed throughout the environment and are easily broken in handling. The magnitude of lamp sector mercury emissions, estimated to be 2.9 metric tons per year (t/yr), is small compared with the estimated mercury losses of the U.S. coal-burning and chlor-alkali industries, which are about 70 t/yr and about 90 t/yr, respectively.
Myocardial scintigraphy with thallium-201
International Nuclear Information System (INIS)
Schwaiger, M.; Silber, S.; Klein, U.; Rudolph, W.
1980-01-01
Thallium-201 myocardial scintigraphy is an important non-invasive method for assessment of coronary artery disease. Other applications of the method such as delineation of the right ventricular free wall in right ventricular overload, or the detection of hypertrophic cardiomyopathies or myocardial infiltrations are of subordinate importance. In heart disease such as congestive cardiomyopathy and mitral valve prolapse thallium-201 uptake defects have been described, the clinical implications of these findings, however, cannot be adequately interpreted at this time. Myocardial uptake of thallium-201 is an active process, dependent on and proportional to perfusion. Differentiation between myocardial ischemia and myocardial scar is based on the presence or absence of thallium-201 'redistribution'. That is, in the presence of acute reversible ischemia there is increased thallium-201 uptake in the post-ischemic phase in previously hypoperfused myocardium and, subsequently, equilibrium of the initially registered activity differences. 'Redistribution' has also been described in the resting scintigram of patients with severe coronary artery disease and chronic hypoperfusion. (orig.) [de
48 CFR 201.403 - Individual deviations.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Individual deviations. 201.403 Section 201.403 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Individual deviations. (1) Individual deviations, except those described in 201.402(1) and paragraph (2) of...
Estimating mercury emissions from a zinc smelter in relation to China's mercury control policies
International Nuclear Information System (INIS)
Wang, S.X.; Song, J.X.; Li, G.H.; Wu, Y.; Zhang, L.; Wan, Q.; Streets, D.G.; Chin, Conrad K.; Hao, J.M.
2010-01-01
Mercury concentrations of flue gas at inlet/outlet of the flue gas cleaning, electrostatic demister, reclaiming tower, acid plant, and mercury contents in zinc concentrate and by-products were measured in a hydrometallurgical zinc smelter. The removal efficiency of flue gas cleaning, electrostatic demister, mercury reclaiming and acid plant was about 17.4%, 30.3%, 87.9% and 97.4% respectively. Flue gas cleaning and electrostatic demister captured 11.7% and 25.3% of the mercury in the zinc concentrate, respectively. The mercury reclaiming tower captured 58.3% of the mercury in the zinc concentrate. About 4.2% of the mercury in the zinc concentrate was captured by the acid plant. Consequently, only 0.8% of the mercury in the zinc concentrate was emitted to the atmosphere. The atmospheric mercury emission factor was 0.5 g t -1 of zinc produced for the tested smelter, indicating that this process offers the potential to effectively reduce mercury emissions from zinc smelting. - Modern scale production equipped with acid plant and Hg reclaiming tower will significantly reduce Hg emissions from zinc smelters in China.
Chételat, John; Hickey, M Brian C; Poulain, Alexandre J; Dastoor, Ashu; Ryjkov, Andrei; McAlpine, Donald; Vanderwolf, Karen; Jung, Thomas S; Hale, Lesley; Cooke, Emma L L; Hobson, Dave; Jonasson, Kristin; Kaupas, Laura; McCarthy, Sara; McClelland, Christine; Morningstar, Derek; Norquay, Kaleigh J O; Novy, Richard; Player, Delanie; Redford, Tony; Simard, Anouk; Stamler, Samantha; Webber, Quinn M R; Yumvihoze, Emmanuel; Zanuttig, Michelle
2018-06-01
Wildlife are exposed to neurotoxic mercury at locations distant from anthropogenic emission sources because of long-range atmospheric transport of this metal. In this study, mercury bioaccumulation in insectivorous bat species (Mammalia: Chiroptera) was investigated on a broad geographic scale in Canada. Fur was analyzed (n=1178) for total mercury from 43 locations spanning 20° latitude and 77° longitude. Total mercury and methylmercury concentrations in fur were positively correlated with concentrations in internal tissues (brain, liver, kidney) for a small subset (n=21) of little brown bats (Myotis lucifugus) and big brown bats (Eptesicus fuscus), validating the use of fur to indicate internal mercury exposure. Brain methylmercury concentrations were approximately 10% of total mercury concentrations in fur. Three bat species were mainly collected (little brown bats, big brown bats, and northern long-eared bats [M. septentrionalis]), with little brown bats having lower total mercury concentrations in their fur than the other two species at sites where both species were sampled. On average, juvenile bats had lower total mercury concentrations than adults but no differences were found between males and females of a species. Combining our dataset with previously published data for eastern Canada, median total mercury concentrations in fur of little brown bats ranged from 0.88-12.78μg/g among 11 provinces and territories. Highest concentrations were found in eastern Canada where bats are most endangered from introduced disease. Model estimates of atmospheric mercury deposition indicated that eastern Canada was exposed to greater mercury deposition than central and western sites. Further, mean total mercury concentrations in fur of adult little brown bats were positively correlated with site-specific estimates of atmospheric mercury deposition. This study provides the largest geographic coverage of mercury measurements in bats to date and indicates that atmospheric
Metallic mercury recycling. Final report
Energy Technology Data Exchange (ETDEWEB)
Beck, M.A.
1994-07-01
Metallic mercury is known to be a hazardous material and is regulated as such. The disposal of mercury, usually by landfill, is expensive and does not remove mercury from the environment. Results from the Metallic Mercury Recycling Project have demonstrated that metallic mercury is a good candidate for reclamation and recycling. Most of the potential contamination of mercury resides in the scum floating on the surface of the mercury. Pinhole filtration was demonstrated to be an inexpensive and easy way of removing residues from mercury. The analysis method is shown to be sufficient for present release practices, and should be sufficient for future release requirements. Data from tests are presented. The consistently higher level of activity of the filter residue versus the bulk mercury is discussed. Recommendations for the recycling procedure are made.
Metallic mercury recycling. Final report
International Nuclear Information System (INIS)
Beck, M.A.
1994-01-01
Metallic mercury is known to be a hazardous material and is regulated as such. The disposal of mercury, usually by landfill, is expensive and does not remove mercury from the environment. Results from the Metallic Mercury Recycling Project have demonstrated that metallic mercury is a good candidate for reclamation and recycling. Most of the potential contamination of mercury resides in the scum floating on the surface of the mercury. Pinhole filtration was demonstrated to be an inexpensive and easy way of removing residues from mercury. The analysis method is shown to be sufficient for present release practices, and should be sufficient for future release requirements. Data from tests are presented. The consistently higher level of activity of the filter residue versus the bulk mercury is discussed. Recommendations for the recycling procedure are made
4 CFR 201.13 - Business information.
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Business information. 201.13 Section 201.13 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.13 Business information. (a) In general. Business information obtained by the Board from a submitter shall be disclosed...
Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2
International Nuclear Information System (INIS)
Tuzen, Mustafa; Uluozlu, Ozgur Dogan; Karaman, Isa; Soylak, Mustafa
2009-01-01
A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L -1 HCl for methyl mercury and 2 mol L -1 HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g -1 . The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L -1 . Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.
Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2
Energy Technology Data Exchange (ETDEWEB)
Tuzen, Mustafa, E-mail: m.tuzen@gmail.com [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Uluozlu, Ozgur Dogan [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Karaman, Isa [Gaziosmanpasa University, Faculty of Science and Arts, Biology Department, 60250 Tokat (Turkey); Soylak, Mustafa [Erciyes University, Faculty of Science and Arts, Chemistry Department, 38039 Kayseri (Turkey)
2009-09-30
A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L{sup -1} HCl for methyl mercury and 2 mol L{sup -1} HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g{sup -1}. The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L{sup -1}. Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.
Directory of Open Access Journals (Sweden)
J. Wang
2013-10-01
Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively
Directory of Open Access Journals (Sweden)
J Wang
2013-10-01
Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively.
Thallium-201 myocardial imaging
International Nuclear Information System (INIS)
Wackers, F.J.Th.
1980-01-01
Three views are routinely obtained for 201 Tl scintigraphy: 0 0 anterior, 45 0 left-anterior-oblique, both views with the patient supine and a left-lateral view, with the patient lying on his right side. Following intravenous injection of 201 Tl, the scintiscans of a normal subject only demonstrate the left ventricle. In patients with normal myocardial perfusion, the left ventricle appears horseshoe or ovoid in shape. The central area of decreased activity represents the left ventricular cavity and is normal. The accumulation of 201 Tl in the normal left ventricle is usually homogeneous. However, some areas with apparent diminished uptake may occur in the normal subject. These variations of the normal image are discussed. The right ventricle, because of its smaller myocardial mass and relatively less 201 Tl accumulation per gram of tissue, is usually on a resting study not, or only faintly, visualized. However, following exercise, the right ventricle is clearly visualized. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
John Schabron; Joseph Rovani; Mark Sanderson
2008-02-29
Mercury continuous emissions monitoring systems (CEMS) are being implemented in over 800 coal-fired power plant stacks. The power industry desires to conduct at least a full year of monitoring before the formal monitoring and reporting requirement begins on January 1, 2009. It is important for the industry to have available reliable, turnkey equipment from CEM vendors. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The generators are used to calibrate mercury CEMs at power plant sites. The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005 requires that calibration be performed with NIST-traceable standards (Federal Register 2007). Traceability procedures will be defined by EPA. An initial draft traceability protocol was issued by EPA in May 2007 for comment. In August 2007, EPA issued an interim traceability protocol for elemental mercury generators (EPA 2007). The protocol is based on the actual analysis of the output of each calibration unit at several concentration levels ranging initially from about 2-40 {micro}g/m{sup 3} elemental mercury, and in the future down to 0.2 {micro}g/m{sup 3}, and this analysis will be directly traceable to analyses by NIST. The document is divided into two separate sections. The first deals with the qualification of generators by the vendors for use in mercury CEM calibration. The second describes the procedure that the vendors must use to certify the generator models that meet the qualification specifications. The NIST traceable certification is performance based, traceable to analysis using isotope dilution inductively coupled plasma/mass spectrometry performed by NIST in Gaithersburg, MD. The
Process for producing thallium-201
International Nuclear Information System (INIS)
Ageev, V.A.; Kljucnikov, A.A.; Linev, A.F.; Chalkin, V.A.; Zajceva, N.G.
1985-01-01
A storage plate of pure Pb-206 enriched up to 95% is irradiated with a 50 to 70 MeV proton beam. The plate is then dissolved in acid, and the Th-201 contained in the solution is oxydated and precipitated from the Pb solution. Traces of Pb retained in the solution are separated from the Th-201 by cation exchange, and the Th-201 is eluated using hydrochloric acid. (orig./PW) [de
17 CFR 201.104 - Business hours.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission, at...
17 CFR 201.58 - Judicial review.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Judicial review. 201.58 Section 201.58 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.58 Judicial review. Judicial review of final...
24 CFR 201.41 - Loan servicing.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan servicing. 201.41 Section 201... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan Administration § 201.41 Loan servicing. (a) Generally...
International Nuclear Information System (INIS)
Su, Yi; Han, Fengxiang; Shiyab, Safwan; Chen, Jian; Monts, David L.
2007-01-01
The objective of our research is to screen and search for suitable plant species for phyto-remediation of mercury-contaminated soil. Currently our effort is specifically focused on mercury removal from the U.S. Department of Energy (DOE) sites, where mercury contamination is a major concern. In order to cost effectively implement mercury remediation efforts, it is necessary now to obtain an improved understanding of biological means of removing mercury and mercury compounds.. Phyto-remediation is a technology that uses various plants to degrade, extract, contain, or immobilize contaminants from soil and water. In particular, phyto-extraction is the uptake of contaminants by plant roots and translocation within the plants to shoots or leaves. Contaminants are generally removed by harvesting the plants. We have investigated phyto-extraction of mercury from contaminated soil by using some of the known metal-accumulating plants since no natural plant species with mercury hyper-accumulating properties has yet been identified. Different natural plant species have been studied for mercury uptake, accumulation, toxicity and overall mercury removal efficiency. Various mercury compounds, such as HgS, HgCl 2 , and Hg(NO 3 ) 2 , were used as contaminant sources. Different types of soil were examined and chosen for phyto-remediation experiments. We have applied microscopy and diffuse reflectance spectrometry as well as conventional analytical chemistry to monitor the phyto-remediation processes of mercury uptake, translocation and accumulation, and the physiological impact of mercury contaminants on selected plant species. Our results indicate that certain plant species, such as beard grass (Polypogon monospeliensis), accumulated a very limited amount of mercury in the shoots ( 2 powder, respectively; no visual stress symptoms were observed. We also studied mercury phyto-remediation using aged soils that contained HgS, HgCl 2 , or Hg(NO 3 ) 2 . We have found that up to hundreds
Virtanen, Jyrki K.; Laukkanen, Jari A.; Mursu, Jaakko; Voutilainen, Sari; Tuomainen, Tomi-Pekka
2012-01-01
Objectives Fish consumption has been associated with reduced risk of cardiovascular diseases (CVD), especially sudden cardiac death (SCD). Fish is the major source of long-chain n-3 polyunsaturated fatty acids (PUFA) eicosapentaenoic acid and docosahexaenoic acid. It is also a major source of methylmercury, which was associated with increased risk of CVD in this study population. Impact of interaction between long-chain n-3 PUFA and methylmercury on the SCD risk is unknown. Methods A total of 1857 men from the prospective, population-based Kuopio Ischaemic Heart Disease Risk Factor study, aged 42–60 years and free of CVD at baseline in 1984–1989, were studied. Serum long-chain n-3 PUFA was used as the marker for long-chain n-3 PUFA intake and hair mercury as the marker for mercury exposure. Results During the mean follow-up of 20.1 years, 91 SCD events occurred. In the multivariate Cox proportional hazards regression models, serum long-chain n-3 PUFA concentration was not associated with the risk of SCD until hair mercury was accounted for; then the hazard ratio (HR) in the highest vs. lowest tertile was 0.54 [95% confidence interval (CI) 0.32 to 0.91, p for trend = 0.046]. When the analyses were stratified by hair mercury content, among those with lower hair mercury, each 0.5 percentage unit increase in the serum long-chain n-3 PUFA was associated with HR of 0.77 (95% CI 0.64 to 0.93), whereas no association was seen among those with higher hair mercury (p for interaction = 0.01). Among the individual long-chain n-3 PUFA, docosahexaenoic acid was most strongly associated with the risk. Conclusion High exposure to mercury may reduce the benefits of long-chain n-3 PUFA on SCD. PMID:22815906
Directory of Open Access Journals (Sweden)
Jyrki K Virtanen
Full Text Available OBJECTIVES: Fish consumption has been associated with reduced risk of cardiovascular diseases (CVD, especially sudden cardiac death (SCD. Fish is the major source of long-chain n-3 polyunsaturated fatty acids (PUFA eicosapentaenoic acid and docosahexaenoic acid. It is also a major source of methylmercury, which was associated with increased risk of CVD in this study population. Impact of interaction between long-chain n-3 PUFA and methylmercury on the SCD risk is unknown. METHODS: A total of 1857 men from the prospective, population-based Kuopio Ischaemic Heart Disease Risk Factor study, aged 42-60 years and free of CVD at baseline in 1984-1989, were studied. Serum long-chain n-3 PUFA was used as the marker for long-chain n-3 PUFA intake and hair mercury as the marker for mercury exposure. RESULTS: During the mean follow-up of 20.1 years, 91 SCD events occurred. In the multivariate Cox proportional hazards regression models, serum long-chain n-3 PUFA concentration was not associated with the risk of SCD until hair mercury was accounted for; then the hazard ratio (HR in the highest vs. lowest tertile was 0.54 [95% confidence interval (CI 0.32 to 0.91, p for trend = 0.046]. When the analyses were stratified by hair mercury content, among those with lower hair mercury, each 0.5 percentage unit increase in the serum long-chain n-3 PUFA was associated with HR of 0.77 (95% CI 0.64 to 0.93, whereas no association was seen among those with higher hair mercury (p for interaction = 0.01. Among the individual long-chain n-3 PUFA, docosahexaenoic acid was most strongly associated with the risk. CONCLUSION: High exposure to mercury may reduce the benefits of long-chain n-3 PUFA on SCD.
31 CFR 800.201 - Business day.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through Friday...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan amounts. 201.10 Section 201.10... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.10 Loan amounts. (a) Property...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation or...
Methyl mercury, but not inorganic mercury, associated with higher blood pressure during pregnancy.
Wells, Ellen M; Herbstman, Julie B; Lin, Yu Hong; Hibbeln, Joseph R; Halden, Rolf U; Witter, Frank R; Goldman, Lynn R
2017-04-01
Prior studies addressing associations between mercury and blood pressure have produced inconsistent findings; some of this may result from measuring total instead of speciated mercury. This cross-sectional study of 263 pregnant women assessed total mercury, speciated mercury, selenium, and n-3 polyunsaturated fatty acids in umbilical cord blood and blood pressure during labor and delivery. Models with a) total mercury or b) methyl and inorganic mercury were evaluated. Regression models adjusted for maternal age, race/ethnicity, prepregnancy body mass index, neighborhood income, parity, smoking, n-3 fatty acids and selenium. Geometric mean total, methyl, and inorganic mercury concentrations were 1.40µg/L (95% confidence interval: 1.29, 1.52); 0.95µg/L (0.84, 1.07); and 0.13µg/L (0.10, 0.17), respectively. Elevated systolic BP, diastolic BP, and pulse pressure were found, respectively, in 11.4%, 6.8%, and 19.8% of mothers. In adjusted multivariable models, a one-tertile increase of methyl mercury was associated with 2.83mmHg (0.17, 5.50) higher systolic blood pressure and 2.99mmHg (0.91, 5.08) higher pulse pressure. In the same models, an increase of one tertile of inorganic mercury was associated with -1.18mmHg (-3.72, 1.35) lower systolic blood pressure and -2.51mmHg (-4.49, -0.53) lower pulse pressure. No associations were observed with diastolic pressure. There was a non-significant trend of higher total mercury with higher systolic blood pressure. We observed a significant association of higher methyl mercury with higher systolic and pulse pressure, yet higher inorganic mercury was significantly associated with lower pulse pressure. These results should be confirmed with larger, longitudinal studies. Copyright © 2017 Elsevier Inc. All rights reserved.
Mercury and halogens in coal--Their role in determining mercury emissions from coal combustion
Kolker, Allan; Quick, Jeffrey C.; Senior, Connie L.; Belkin, Harvey E.
2012-01-01
Mercury is a toxic pollutant. In its elemental form, gaseous mercury has a long residence time in the atmosphere, up to a year, allowing it to be transported long distances from emission sources. Mercury can be emitted from natural sources such as volcanoes, or from anthropogenic sources, such as coal-fired powerplants. In addition, all sources of mercury on the Earth's surface can re-emit it from land and sea back to the atmosphere, from which it is then redeposited. Mercury in the atmosphere is present in such low concentrations that it is not considered harmful. Once mercury enters the aquatic environment, however, it can undergo a series of biochemical transformations that convert a portion of the mercury originally present to methylmercury, a highly toxic organic form of mercury that accumulates in fish and birds. Many factors contribute to creation of methylmercury in aquatic ecosystems, including mercury availability, sediment and nutrient load, bacterial influence, and chemical conditions. In the United States, consumption of fish with high levels of methylmercury is the most common pathway for human exposure to mercury, leading the U.S. Environmental Protection Agency (EPA) to issue fish consumption advisories in every State. The EPA estimates that 50 percent of the mercury entering the atmosphere in the United States is emitted from coal-burning utility powerplants. An EPA rule, known as MATS (for Mercury and Air Toxics Standards), to reduce emissions of mercury and other toxic pollutants from powerplants, was signed in December 2011. The rule, which is currently under review, specifies limits for mercury and other toxic elements, such as arsenic, chromium, and nickel. MATS also places limits on emission of harmful acid gases, such as hydrochloric acid and hydrofluoric acid. These standards are the result of a 2010 detailed nationwide program by the EPA to sample stack emissions and thousands of shipments of coal to coal-burning powerplants. The United
Energy Technology Data Exchange (ETDEWEB)
Smith, Jeremy C [ORNL; Parks, Jerry M [ORNL
2016-01-01
Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively non-toxic, other forms such as Hg2+ and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg2+ can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg2+ to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed picture and circumvent issues associated with toxicity. Here we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intra-protein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confers mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multi-scale model of environmental mercury cycling.
21 CFR 201.105 - Veterinary drugs.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Veterinary drugs. 201.105 Section 201.105 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.105 Veterinary drugs. A drug subject to the...
19 CFR 201.110 - Self-evaluation.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...
International Nuclear Information System (INIS)
Ksanfomalifi, L.V.
1976-01-01
The latest information on Mercury planet is presented obtained by studying the planet with the aid of radar and space vehicles. Rotation of Mercury about its axis has been discovered; within 2/3 of its year it executes a complete revolution about its axis. In images obtained by the ''Mariner-10'' Mercurys surface differs little from that of the Moon. The ''Mariner-10'' has also discovered the Mercurys atmosphere, which consists of extremely rarefied helium. The helium is continuously supplied to the planet by the solar wind. The Mercury's magnetic field has been discovered, whose strength is 35 x 10 -4 at the Equator and 70 x 10 -4 E at the poles. The inclination of the dipole axis to the Mercury's rotation axis is 7 deg
Mercury nano-trap for effective and efficient removal of mercury(II) from aqueous solution
Li, Baiyan; Zhang, Yiming; Ma, Dingxuan; Shi, Zhan; Ma, Shengqian
2014-11-01
Highly effective and highly efficient decontamination of mercury from aqueous media remains a serious task for public health and ecosystem protection. Here we report that this task can be addressed by creating a mercury ‘nano-trap’ as illustrated by functionalizing a high surface area and robust porous organic polymer with a high density of strong mercury chelating groups. The resultant porous organic polymer-based mercury ‘nano-trap’ exhibits a record-high saturation mercury uptake capacity of over 1,000 mg g-1, and can effectively reduce the mercury(II) concentration from 10 p.p.m. to the extremely low level of smaller than 0.4 p.p.b. well below the acceptable limits in drinking water standards (2 p.p.b.), and can also efficiently remove >99.9% mercury(II) within a few minutes. Our work therefore presents a new benchmark for mercury adsorbent materials and provides a new perspective for removing mercury(II) and also other heavy metal ions from contaminated water for environmental remediation.
21 CFR 201.70 - Calcium labeling.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Calcium labeling. 201.70 Section 201.70 Food and... LABELING Labeling Requirements for Over-the-Counter Drugs § 201.70 Calcium labeling. (a) The labeling of over-the-counter (OTC) drug products intended for oral ingestion shall contain the calcium content per...
7 CFR 1435.201 - Civil penalties.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Civil penalties. 1435.201 Section 1435.201... Recordkeeping Requirements § 1435.201 Civil penalties. (a) Any processor, refiner, or importer of sugar, syrup... false data required under § 1435.200(a) through (e), is subject to a civil penalty of no more than $10...
Study of high levels indoor air mercury contamination from mercury amalgam use in dentistry
International Nuclear Information System (INIS)
Khwaja, M.A.; Abbasi, M.S.; Mehmood, F.; Jahangir, S.
2014-01-01
In 2005, United Nations Environment Programme (UNEP) estimated that 362 tonnes of dental mercury are consumed annually worldwide. Dental mercury amalgams also called silver fillings and amalgam fillings are widely done. These fillings gave off mercury vapours. Estimated average absorbed concentrations of mercury vapours from dental fillings vary from 3,000 to 17,000 ng Hg. Mercury (Hg) also known as quick silver is an essential constituent of dental amalgam. It is a toxic substance of global concern. A persistent pollutant, mercury is not limited to its source but it travels, on time thousands of kilometers away from the source. Scientific evidence, including, UNEP Global Mercury report, establishes mercury as an extremely toxic substance, which is a major threat to wildlife, ecosystem and human health, at a global scale. Children are more at risk from mercury poisoning which affects their neurological development and brain. Mercury poisoning diminishes memory, attention, thinking and sight. In the past, a number of studies at dental sites in many countries have been carried out and reported which have been reviewed and briefly described. This paper describes and discusses the recent investigations, regarding mercury vapours level in air, carried out at 18 dental sites in Pakistan and other countries. It is evident from the data of 42 dental sites in 17 countries, including, selected dental sites in five main cities of Pakistan, described and discussed in this paper that at most dental sites in many countries including Pakistan, the indoor mercury vapours levels exceed far above the permissible limit, recommended for safe physical and mental health. At these sites, public, in general, and the medical, paramedical staff and vulnerable population, in particular, are at most serious risk to health resulting from exposure to toxic and hazardous mercury. (author)
Concentration of mercury in wheat samples stored with mercury tablets as preservative. [Neutrons
Energy Technology Data Exchange (ETDEWEB)
Lalit, B Y; Ramachandran, T V [Bhabha Atomic Research Centre, Bombay (India). Air Monitoring Section
1977-01-01
Tablets consisting of mercury in the form of a dull grey powder made by triturating mercury with chalk and sugar are used in Indian household for storing food-grains. The contamination of wheat samples by mercury, when stored with mercury tablets for period of upto four years has been assessed by using non-destructive neutron activation analysis. The details of the analytical procedure used have also been briefly described. The concentration of mercury in wheat increases with storage period. Loss of weight of mercury tablet is proportional to the storage period to a first approximation. In the present experiment, the average weight loss at the and end of first year was 0.009716 g corresponding to 6 ppm in wheat.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The percentage...
International Nuclear Information System (INIS)
Cherian, M.G.; Hursh, J.B.; Clarkson, T.W.; Allen, J.
1978-01-01
The distribution of mercury in red blood cells (RBCs) and plasma, and its excretion in urine and feces are described in five human subjects during the first 7 days following inhalation of radioactive mercury vapor. A major portion (98%) of radioactive mercury in whole blood is initially accumulated in the RBCs and is transferred partly to the plasma compartment until the ratio of mercury in RBCs to plasma is about 2 within 20 h. The cumulative urinary and fecal excretion of mercury for 7 days is about 11.6% of the retained dose, and is closely related to the percent decline in body burden of mercury. There is little correlation between either the urinary excretion and plasma radioactivity of mercury, or the specific activities of urine and plasma mercury, suggesting a mechanism other than a direct glomerular filtration involved in the urinary excretion of recently exposed mercury. These studies suggest that blood mercury levels can be used as an index of recent exposure, while urinary levels may be an index of renal concentration of mercury. However, there is no reliable index for mercury concentration in the brain
FINAL REPORT ON THE AQUATIC MERCURY ASSESSMENT STUDY
Energy Technology Data Exchange (ETDEWEB)
Halverson, N
2008-09-30
. Methylmercury ranged from 0.002 ng/l in Upper Three Runs to 2.60 ng/l in Tims Branch. Total mercury in the Savannah River ranged from 0.62 ng/l to 43.9 ng/l, and methylmercury ranged from 0.036 ng/l to 7.54 ng/l. Both total and methylmercury concentrations were consistently high in the river near the mouth of Steel Creek. Total mercury was positively correlated with methylmercury (r = 0.88). Total mercury bound to particulates ranged from 41% to 57% in the river and from 28% to 90% in the streams. Particulate methylmercury varied from 9% to 37% in the river and from 6% to 79% in the streams. Small temporary pools in the Savannah River swamp area near and around Fourmile Branch had the highest concentrations observed in the Savannah River watershed, reaching 1,890 ng/l for total mercury and 34.0 ng/l for methylmercury. The second study developed a mercury bioaccumulation factor (BAF) for the Savannah River near SRS. A BAF is the ratio of the concentration of mercury in fish flesh to the concentration of mercury in the water. BAFs are important in the TMDL process because target concentrations for mercury in water are computed from BAFs. Mercury BAFs are known to differ substantially among fish species, water bodies, and possibly seasons. Knowledge of such variation is needed to determine a BAF that accurately represents average and extreme conditions in the water body under study. Analysis of fish tissue and aqueous methylmercury samples collected at a number of locations and over several seasons in a 110 km (68 mile) reach of the Savannah River demonstrated that BAFs for each species under study varied by factors of three to eight. Influences on BAF variability were location, habitat and season-related differences in fish mercury levels and seasonal differences in methylmercury levels in the water. Overall (all locations, habitats, and seasons) average BAFs were 3.7 x 10{sup 6} for largemouth bass, 1.4 x 10{sup 6} for sunfishes, and 2.5 x 10{sup 6} for white catfish. This study
Energy Technology Data Exchange (ETDEWEB)
John F. Schabron; Joseph F. Rovani; Susan S. Sorini
2007-03-31
The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005, requires that calibration of mercury continuous emissions monitors (CEMs) be performed with NIST-traceable standards. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The traceability protocol will be written by EPA. Traceability will be based on the actual analysis of the output of each calibration unit at several concentration levels ranging from about 2-40 ug/m{sup 3}, and this analysis will be directly traceable to analyses by NIST using isotope dilution inductively coupled plasma/mass spectrometry (ID ICP/MS) through a chain of analyses linking the calibration unit in the power plant to the NIST ID ICP/MS. Prior to this project, NIST did not provide a recommended mercury vapor pressure equation or list mercury vapor pressure in its vapor pressure database. The NIST Physical and Chemical Properties Division in Boulder, Colorado was subcontracted under this project to study the issue in detail and to recommend a mercury vapor pressure equation that the vendors of mercury vapor pressure calibration units can use to calculate the elemental mercury vapor concentration in an equilibrium chamber at a particular temperature. As part of this study, a preliminary evaluation of calibration units from five vendors was made. The work was performed by NIST in Gaithersburg, MD and Joe Rovani from WRI who traveled to NIST as a Visiting Scientist.
Tl-201 per rectum scintigraphy in chronic liver disease: assessment of Tl-201 uptake indices
International Nuclear Information System (INIS)
Moon, Won Jin; Choi, Yun Young; Cho, Suk Shin; Lee, Min Ho
1999-01-01
Heart to liver ratio on Tl-201 per rectal scintigraphy (shunt index) is known to be useful in the assessment of portal systemic shunt. We assessed Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 and correlated with shunt index in patients with chronic active hepatitis (CAH) and liver cirrhosis (LC). Fifty eight patients with biopsy-proven chronic liver disease (35 with CAH, 23 with LC) underwent Tl-201 per rectum scintigraphy after instillation of 18.5 MBq of Tl-201 into the upper rectum. We evaluated hepatic uptake (type 1: homogeneous, 2: inhomogeneous segmental, 3: inhomogeneous nonsegmental) and extrahepatic uptake of spleen, heart and kidney (grade 0: no uptake, 1: less than liver, 2: equal to liver, 3: greater than liver). We measured the early liver/heart uptake rate (the slope of the liver to heart uptake ratio for 10 mim) and shunt index (heart to liver uptake ratio). Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 was correlated with the pathologic diagnosis and shunt index. Hepatic uptake patterns of type 1 and 2 were dominant in CAH (CAH: 27/35, LC: 8/23), and type 3 in LC (CAH: 8/35, LC: 15/23)(p<0.005). The grades of extrahepatic uptake were higher in LC than in CAH (spleen: p<0.001, other soft tissue: p<0.005). The early liver/heart uptake rate of CAH (0.110±0.111) was significantly higher than that of LC (0.014±0.090)(p<0.001). The sensitivity and specificity of the early liver/heart uptake rate were 77.7% and 67.7% in differentiating LC from CAH. There was negative correlation between early liver/heart uptake rate and shunt index (r=-0.3347, p<0.01). Hepatic and extrahepatic uptake pattern and early liver/heart uptake rate on Tl-201 per rectum scintigraphy are useful in the assessment of portal systemic shunt in patients with chronic liver disease
42 CFR 50.201 - Applicability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 50.201 Section 50.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY... Public Health Service. ...
Mercury Exposure and Heart Diseases
Genchi, Giuseppe; Sinicropi, Maria Stefania; Carocci, Alessia; Lauria, Graziantonio; Catalano, Alessia
2017-01-01
Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system. PMID:28085104
Mercury Exposure and Heart Diseases.
Genchi, Giuseppe; Sinicropi, Maria Stefania; Carocci, Alessia; Lauria, Graziantonio; Catalano, Alessia
2017-01-12
Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.
Mercury Exposure and Heart Diseases
Directory of Open Access Journals (Sweden)
Giuseppe Genchi
2017-01-01
Full Text Available Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.
Mercury removal from liquid and solid mixed waste
International Nuclear Information System (INIS)
Gates, D.D.; Klasson, K.T.; Corder, S.L.; Cameron, P.A.; Perona, J.J.
1995-01-01
Based on bench-scale laboratory experiments, the following conclusions were reached: Sulfur-impregnated, activated, carbon pellets (Mersorb) can be used to remove mercury (Hg 2+ ) to below EPA's toxic characteristic level (0.2 mg/L). Mersorb works under acid conditions (pH 2) but its capacity is reduced by approximately 50% compared with neutral conditions. Competing ions present in the target waste stream reduced the Mersorb capacity by 50%. Mersorb appears to be economical compared with leading ion exchange resin. KI/I 2 leaching solution can be used to remove up to 99% of Hg in contaminated soil and glass. KI/I 2 leaching solution worked well with several mercury species, including Hg 0 , HgO, HgS, and HgCl 2 . KI/I 2 leaching solution worked well with a wide variety of initial mercury concentrations. Radionuclide surrogate studies suggested that uranium will not partition into KI/I 2 leaching solutions. Cesium may partition into the KI/I 2 leaching solution because of the high solubility of cesium salts
Sexual differences in the excretion of organic and inorganic mercury by methyl mercury-treated rats
International Nuclear Information System (INIS)
Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Mushak, P.; Hall, L.L.
1987-01-01
Adult male and female Long Evans rats received 1 mumole of methyl ( 203 Hg) mercuric chloride per kilogram sc. Whole-body retention of mercury and excretion of organic and inorganic mercury in urine and feces were monitored for 98 days after dosing. Females cleared mercury from the body more rapidly than did males. The major route of mercury excretion was feces. By 98 days after dosing, cumulative mercury excretion in feces accounted for about 51% of the dose in males and about 54% of the dose in females. For both sexes, about 33% of the dose was excreted in feces as inorganic mercury. Cumulative excretion of organic mercury in feces accounted for about 18 and 21% of the dose in males and females, respectively. Urinary excretion of mercury was quantitatively a smaller route for mercury clearance but important sexual differences in loss by this route were found. Over the 98-day experimental period, males excreted in urine about 3.2% of the dose and females excreted 7.5%. Cumulative organic Hg excretion in urine accounted for 1.8% of the dose in males and 5.3% of the dose in females. These sexual differences in urinary and fecal excretion of organic and inorganic mercury following methyl mercury treatment were consistent with previous reports of sexual differences in mercury distribution and retention in methyl mercury-treated rats, particularly sexual differences in organic mercury uptake and retention in the kidney. Relationships between body burdens of organic or inorganic Hg and output of these forms of Hg in urine and feces were also found to be influenced by the interval after MeHg treatment and by sex. Relationship between concentration of Hg in liver and feces and in kidney and urine differed for organic and inorganic Hg and depended upon sexual status and interval after MeHg treatment
Status of the Spallation Neutron Source with focus on target materials
International Nuclear Information System (INIS)
Mansur, L.K.; Haines, J.R.
2006-01-01
An overview of the design and construction of the Spallation Neutron Source (SNS) is presented. Key facility performance parameters are summarized and plans for initial operation are described. Early efforts produced a conceptual design in 1997; the project itself was initiated in 1999, with the official groundbreaking taking place in December of 1999. As of April 2005 building construction was complete and the overall project was more than 90% complete. The design of the target and surrounds are finished and the first target was installed in June 2005. First beam on target is expected in June, 2006. The engineering design of the target region is described. The key systems comprise the mercury target, moderator and reflector assemblies, remote handling systems, utilities and shielding. Through interactions with the 1 GeV proton beam, the target, moderators and reflectors produce short pulse neutrons in thermal energy ranges, which are transported to a variety of neutron scattering instruments. The mercury target module itself is described in more detail. Materials issues are expected to govern the overall lifetime and have influenced the design, fabrication and planned operation. A wide range of materials research and development has been carried out to provide experimental data and analyses to ensure the satisfactory performance of the target and to set initial design conditions. Materials R and D concentrated mainly on cavitation erosion, radiation effects, and mercury compatibility issues, including investigations of the mechanical properties during exposure to mercury. Questions that would require future materials research are discussed
Mercury dynamics in a coastal aquifer: Maunalua Bay, O´ahu, Hawai´i
Ganguli, Priya M.; Swarzenski, Peter W.; Dulaiova, Henrieta; Glenn, Craig R.; Flegal, A. Russell
2014-03-01
We evaluated the influence of groundwater-seawater interaction on mercury dynamics in Maunalua Bay, a coral reef ecosystem located on the south shore of O´ahu, Hawai´i, by combining geochemical data with submarine groundwater discharge (SGD) rates. During a rising tide, unfiltered total mercury (U-HgT) concentrations in seawater increased from ˜6 to 20 pM at Black Point (west Bay) and from ˜2.5 to 8 pM at Niu (central Bay). We attribute this change to an increase in suspended particulate matter at high tide. Approximately 90% of mercury in groundwater at Niu was in the filtered (weighted average Maunalua Bay groundwater mercury flux of 0.68 ± 0.67 mol yr-1 by combining the proportional flux of F-HgT from three distinct SGD zones, and place these results into a broader context by comparing and contrasting flux estimates from locations around the world. Results from existing SGD studies should be evaluated to develop future sampling strategies that address more targeted questions about mercury biogeochemical cycling at the groundwater-seawater interface.
2011-03-14
... National Emission Standards for Hazardous Air Pollutants: Mercury Emissions From Mercury Cell Chlor-Alkali...-5] RIN 2060-AN99 National Emission Standards for Hazardous Air Pollutants: Mercury Emissions From Mercury Cell Chlor-Alkali Plants AGENCY: Environmental Protection Agency (EPA). ACTION: Supplemental...
Mechanisms of thallium-201 myocardial accumulation
International Nuclear Information System (INIS)
Wackers, F.J.Th.; Samson, G.
1980-01-01
The practical advantages of 201 Tl over other suitable myocardial imaging agents such as potassium-43 ( 43 K), rubidium-81 ( 81 Rb), and cesium-129 ( 129 Cs), are its relatively low energy photons which makes it possible to employ high-resolution low-energy collimators and its physical half-life of 73 hr which provides sufficiently long shelf-life for practical clinical imaging. Toxicological considerations do not play a role using 201 Tl as thallous chloride. The concentration of thallous chloride in a dose of 2 mCi of 201 Tl is less than 4μg. The LD 50 of thallous chloride is a factor 10 4 more. The minimal lethal dose in man is reported to be 12 mg/kg. The kinetics of 201 Tl, its tissue distributions and radiation doses are assessed, and the effect of cardiac drugs on thallium-201 uptake are discussed. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Munthe, John; Waengberg, Ingvar (IVL Swedish Environmental Research Inst., Stockholm (SE)); Rognerud, Sigurd; Fjeld, Eirik (Norwegian Inst. for Water Research (NIVA), Oslo (Norway)); Verta, Matti; Porvari, Petri (Finnish Environment Inst. (SYKE), Helsinki (Finland)); Meili, Markus (Inst. of Applied Environmental Research (ITM), Stockholm (Sweden))
2007-12-15
This report provides a first comprehensive compilation and assessment of available data on mercury in air, precipitation, sediments and fish in the Nordic countries. The main conclusion is that mercury levels in Nordic ecosystems continue to be affected by long-range atmospheric transport. The geographical patterns of mercury concentrations in both sediments and fish are also strongly affected by ecosystem characteristics and in some regions possibly by historical pollution. An evaluation of geographical variations in mercury concentrations in precipitation indicates that the influence from anthropogenic sources from Central European areas is still significant. The annual variability of deposition is large and dependant of precipitation amounts. An evaluation of data from stations around the North Sea has indicated a significant decrease in mercury concentrations in precipitation indicating a continuous decrease of emissions in Europe (Waengberg et al., 2007). For mercury in air (TGM), the geographical pattern is less pronounced indicating the influence of mercury emissions and distribution over a larger geographical area (i.e. hemispherical transport). Comparison of recent (surficial) and historical lake sediments show significantly elevated concentrations of mercury most likely caused by anthropogenic atmospheric deposition over the past century. The highest pollution impact was observed in the coastal areas of southern Norway, in south western Finland and in Sweden from the coastal areas in the southwest across the central parts to the north-east. The general increase in recent versus old sediments was 2-5 fold. Data on mercury in Nordic freshwater fish was assembled and evaluated with respect to geographical variations. The fish data were further compared with temporal and spatial trends in mercury deposition and mercury contamination of lake sediments in order to investigate the coupling between atmospheric transport and deposition of mercury and local mercury
24 CFR 125.201 - Administrative Enforcement Initiative.
2010-04-01
... Initiative. 125.201 Section 125.201 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.201 Administrative Enforcement Initiative. The Administrative Enforcement Initiative provides funding to State and local fair housing agencies administering...
33 CFR 135.201 - Applicability.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Applicability. 135.201 Section 135.201 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND...
Kao, Richard T; Dault, Scott; Pichay, Teresa
2004-07-01
Mercury has been used in both medicine and dentistry for centuries. Recent media attention regarding the increased levels of mercury in dietary fish, high levels of mercury in air emissions, and conjecture that certain diseases may be caused by mercury exposure has increased public awareness of the potential adverse health effects of high doses of mercury. Dentistry has been criticized for its continued use of mercury in dental amalgam for both public health and environmental reasons. To address these concerns, dental professionals should understand the impact of the various levels and types of mercury on the environment and human health. Mercury is unique in its ability to form amalgams with other metals. Dental amalgam--consisting of silver, copper, tin, and mercury--has been used as a safe, stable, and cost-effective restorative material for more than 150 years. As a result of this use, the dental profession has been confronted by the public on two separate health issues concerning the mercury content in amalgam. The first issue is whether the mercury amalgamated with the various metals to create dental restorations poses a health issue for patients. The second is whether the scraps associated with amalgam placement and the removal of amalgam restorations poses environmental hazards which may eventually have an impact on human health. Despite the lack of scientific evidence for such hazards, there is growing pressure for the dental profession to address these health issues. In this article, the toxicology of mercury will be reviewed and the impact of amalgam on health and the environment will be examined.
International Nuclear Information System (INIS)
Shirazi, B.
2006-01-01
Thallium-203 is the main material for 201 TlCl 3 radiopharmaceutical. It is very important to recover the remaining enriched Thallium-203 in every stage of the process to be reused in the production loop. In this research, the recuperation of Thallium-203 was studied with Dowex 50 WΧ8 ion exchange resin and Thallium-201 as a tracer. The results based on filling of ( 1 8 X 1.5) cm columns with this resin showed that the best flow rate of eluent is 2 ml/min. Also the most suitable volumes are 200 mL (HNO 3 0.05 M), 400 mL (solution of Thallium-203), 100 mL (H 2 O), 500 mL (Citric acid), 100 mL (H 2 0), 100 mL (EDTA 0.5 M and pH∼12.5). 60 mL (H 2 0), respectively
46 CFR 201.7 - Information; special instructions.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Information; special instructions. 201.7 Section 201.7 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE General Information (Rule 1) § 201.7 Information; special instructions. Information...
14 CFR 1203.201 - Information security objectives.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Information security objectives. 1203.201 Section 1203.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM NASA Information Security Program § 1203.201 Information security objectives. The objectives of...
Energy Technology Data Exchange (ETDEWEB)
Morimoto, Setsuo; Hiraki, Yoshio; Togami, Izumi [Okayama Univ. (Japan). School of Medicine
1984-10-01
The mechanism of /sup 201/Tl chloride accumulation is unclear in thyroid gland and thyroid tumor. This report examines 108 patients that received thyroid scintigraphy examinations with both /sup 201/Tl chloride and sodium /sup 131/I. The patients were diagnosed clinically and histologically whenever possible. The ROI were obtained by subtraction imaging with both isotopes and by subtraction positive and negative areas of imaging. Dynamic curves were obtained for /sup 201/Tl chloride per square unit of each ROI. The dynamic curve in the radioiodide-accumulated area was examined. The data indicate that the clearance rate of /sup 201/Tl chloride (T/sub 15/) was correlated with the sodium /sup 131/I uptake rate at 24 h (r=0.70).
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Definitions. 266.201 Section 266.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF SPECIFIC HAZARDOUS WASTES AND SPECIFIC TYPES OF HAZARDOUS WASTE MANAGEMENT...
Lifescience Database Archive (English)
Full Text Available PPD201 PPD2 Overexpression of mammal origin membrane protein by high-density cultur...roaki Kato Graduate School of Pharmaceutical Sciences, Kyoto University Nat Protoc (2006)|Protein Expr. Purif. (2009)|Biotechnol. Prog. (1996) 17406338|8845106|18984054 PPD201.csml ...
Squadrone, S; Benedetto, A; Brizio, P; Prearo, M; Abete, M C
2015-01-01
The study of mercury and selenium bioaccumulation in fish is crucially important for evaluating the extent of contamination in freshwater environments, and the possible health risk posed for humans when the antagonistic interactions of these two elements are considered. Several factors affect the risk of mercury intake from fish consumption, including mercury levels, human consumption patterns, and sensitive populations (e.g., pregnant women, foetuses, young children and unknown genetic factors). The protective effects of selenium on mercury toxicity have been extensively publicised in recent years, particularly targeting fish consumers. In this study, mercury (Hg) and selenium (Se) concentrations were determined in the muscle of European catfish (Silurus glanis) collected from North Italian Rivers. Differences in mercury and selenium levels, as a function of size, gender and location were investigated. Hg was strongly related to length, gender and location, while Se levels are not dependent on fish size or location. The mean Se/Hg molar ratio was strongly affected by location, and significantly related to length and age. Selenium was in molar excess of mercury in all sites, with a rank order of mean Se/Hg molar ratio of the Parma River (2.55)>Po River (1.71)>Tanaro River (1.66)>Bormida River (1.36). However, in 37% of analyzed samples, Hg exceeded the maximum level set by 1881/2006/EC and 629/2008/EC in fish muscle. The molar ratio of Se/Hg was 0.5mg/kg), and therefore the mean molar ratio cannot be considered as a safety criterion in top predator fish. Copyright © 2014 Elsevier Ltd. All rights reserved.
Getting Mercury out of Schools.
1999
This guide was prepared while working with many Massachusetts schools to remove items that contain mercury and to find suitable alternatives. It contains fact sheets on: mercury in science laboratories and classrooms, mercury in school buildings and maintenance areas, mercury in the medical office and in medical technology classrooms in vocational…
46 CFR 201.144 - Offer of proof.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof. ...
48 CFR 201.303 - Publication and codification.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Publication and codification. 201.303 Section 201.303 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Regulations 201.303 Publication and codification. (a)(i) The DFARS is codified under chapter 2 in title 48...
Mercury Specie and Multi-Pollutant Control
Energy Technology Data Exchange (ETDEWEB)
Rob James; Virgil Joffrion; John McDermott; Steve Piche
2010-05-31
This project was awarded to demonstrate the ability to affect and optimize mercury speciation and multi-pollutant control using non-intrusive advanced sensor and optimization technologies. The intent was to demonstrate plant-wide optimization systems on a large coal fired steam electric power plant in order to minimize emissions, including mercury (Hg), while maximizing efficiency and maintaining saleable byproducts. Advanced solutions utilizing state-of-the-art sensors and neural network-based optimization and control technologies were proposed to maximize the removal of mercury vapor from the boiler flue gas thereby resulting in lower uncontrolled releases of mercury into the atmosphere. Budget Period 1 (Phase I) - Included the installation of sensors, software system design and establishment of the as-found baseline operating metrics for pre-project and post-project data comparison. Budget Period 2 (Phase II) - Software was installed, data communications links from the sensors were verified, and modifications required to integrate the software system to the DCS were performed. Budget Period 3 (Phase III) - Included the validation and demonstration of all control systems and software, and the comparison of the optimized test results with the targets established for the project site. This report represents the final technical report for the project, covering the entire award period and representing the final results compared to project goals. NeuCo shouldered 61% of the total project cost; while DOE shouldered the remaining 39%. The DOE requires repayment of its investment. This repayment will result from commercial sales of the products developed under the project. NRG's Limestone power plant (formerly owned by Texas Genco) contributed the host site, human resources, and engineering support to ensure the project's success.
Environmental Mercury and Its Toxic Effects
Directory of Open Access Journals (Sweden)
Kevin M. Rice
2014-03-01
Full Text Available Mercury exists naturally and as a man-made contaminant. The release of processed mercury can lead to a progressive increase in the amount of atmospheric mercury, which enters the atmospheric-soil-water distribution cycles where it can remain in circulation for years. Mercury poisoning is the result of exposure to mercury or mercury compounds resulting in various toxic effects depend on its chemical form and route of exposure. The major route of human exposure to methylmercury (MeHg is largely through eating contaminated fish, seafood, and wildlife which have been exposed to mercury through ingestion of contaminated lower organisms. MeHg toxicity is associated with nervous system damage in adults and impaired neurological development in infants and children. Ingested mercury may undergo bioaccumulation leading to progressive increases in body burdens. This review addresses the systemic pathophysiology of individual organ systems associated with mercury poisoning. Mercury has profound cellular, cardiovascular, hematological, pulmonary, renal, immunological, neurological, endocrine, reproductive, and embryonic toxicological effects.
International Nuclear Information System (INIS)
Baatrup, E.; Nielsen, M.G.; Danscher, G.
1986-01-01
Juvenile rainbow trout (Salmo gairdneri) were exposed to 100 ppb mercury (as HgCl 2 ) in the water for 14 days. Concentrations of mercury in water and fish organs were monitored using radiolabeled mercury. Tissues from kidney and liver were fixed, and sections were developed by autometallography, a method whereby accumulations of mercury sulfides and/or mercury selenides are silver amplified. In the kidney, mercury was found within lysosomes and extracellularly in the basal lamina of proximal tubules. In the liver, mercury was found within lysosomes of the hepatocytes. Additional groups of mercury-exposed trout were subjected to selenium (as Na 2 SeO 3 ), administered intraperitoneally 2 hr before fixation. Following this treatment, additional mercury could be visualized in the kidney circulatory system, including glomeruli, and in the nucleus and endoplasmic reticulum of liver cells. It is suggested that the mercury visualized prior to selenium treatment represents inorganic mercury, while additional mercury visualized after selenium administration represents an organic form
Present status of spallation target development. JAERI/KEK Joint Project
International Nuclear Information System (INIS)
Hino, R.; Kaminaga, M.; Haga, K.
2001-01-01
The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a plan to construct a neutron scattering facility under the JAERI/KEK Joint Project. Design and R and D works are being carried out vigorously for realizing the mercury target system consisting of the mercury target, moderators and reflectors working as a spallation neutron source, as well as a remote handling system for exchanging such components which will be highly irradiated. This report introduces an outline of the present status of design and development activities on the spallation target system. (author)
7 CFR 1430.201 - Administration.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice President...
Energy Technology Data Exchange (ETDEWEB)
Yoshida, Minoru; Yamamura, Yukio; Sataoh, Hiroshi
1986-04-01
Organ distribution of mercury after in utero mercury vapor exposure was investigated in neonatal guinea pigs. Mother guinea pigs in late gestation were exposed to 0.2-0.3 mg/m/sup 3/ mercury vapor 2 h per day until giving birth. Mercury concentrations in neonatal brain, lungs, heart, kidneys, plasma and erythrocytes were much lower than those of maternal organs and tissues. Neonatal liver, however, showed a mercury concentration twice as high as maternal liver. Mercury concentration ratios of erythrocytes to plasma in offspring were quite different from those of mothers, being 0.2-0.4 for offspring, and 1.3-3.0 for mothers. These results suggested that mercury vapor metabolism in fetuses was quite different from that in their mothers. This may be due to the different blood circulation, as mercury vapor transferred through the placental barrier would be rapidly oxidized into ionic mercury in fetal liver and accumulated in the organ. The different mercury vapor metabolism may prevent fetal brain, which is rapidly developing, and thus vulnerable, from being exposed to excessive mercury vapor.
Radiation induced cavitation: A possible phenomenon in liquid targets?
Energy Technology Data Exchange (ETDEWEB)
West, C.D.
1998-07-01
The proposed design of a new, short-pulse spallation neutron source includes a liquid mercury target irradiated with a 1 GeV proton beam. This paper explores the possibility that cavitation bubbles may be formed in the mercury and briefly discusses some design features that could avoid harmful effects should cavitation take place.
Radiation induced cavitation: A possible phenomenon in liquid targets?
International Nuclear Information System (INIS)
West, C.D.
1998-01-01
The proposed design of a new, short-pulse spallation neutron source includes a liquid mercury target irradiated with a 1 GeV proton beam. This paper explores the possibility that cavitation bubbles may be formed in the mercury and briefly discusses some design features that could avoid harmful effects should cavitation take place
46 CFR 201.117 - Inclusion in record.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...
7 CFR 201.1 - Meaning of words.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Definitions § 201.1 Meaning of words. Words in the regulations in this part in the singular form...
20 CFR 201.1 - Words and phrases.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Words and phrases. 201.1 Section 201.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT DEFINITIONS § 201.1 Words and phrases. For the purposes of the regulations in this chapter, except where the...
Mercury in mercury(II)-spiked soils is highly susceptible to plant bioaccumulation.
Hlodák, Michal; Urík, Martin; Matúš, Peter; Kořenková, Lucia
2016-01-01
Heavy metal phytotoxicity assessments usually use soluble metal compounds in spiked soils to evaluate metal bioaccumulation, growth inhibition and adverse effects on physiological parameters. However, exampling mercury phytotoxicity for barley (Hordeum vulgare) this paper highlights unsuitability of this experimental approach. Mercury(II) in spiked soils is extremely bioavailable, and there experimentally determined bioaccumulation is significantly higher compared to reported mercury bioaccumulation efficiency from soils collected from mercury-polluted areas. Our results indicate this is not affected by soil sorption capacity, thus soil ageing and formation of more stable mercuric complexes with soil fractions is necessary for reasonable metal phytotoxicity assessments.
Below a Historic Mercury Mine: Non-linear Patterns of Mercury Bioaccumulation in Aquatic Organisms
Haas, J.; Ichikawa, G.; Ode, P.; Salsbery, D.; Abel, J.
2001-12-01
Unlike most heavy metals, mercury is capable of bioaccumulating in aquatic food-chains, primarily because it is methylated by bacteria in sediment to the more toxic methylmercury form. Mercury concentrations in a number of riparian systems in California are highly elevated as a result of historic mining activities. These activities included both the mining of cinnabar in the coastal ranges to recover elemental mercury and the use of elemental mercury in the gold fields of the Sierra Nevada Mountains. The most productive mercury mining area was the New Almaden District, now a county park, located in the Guadalupe River drainage of Santa Clara County, where cinnabar was mined and retorted for over 100 years. As a consequence, riparian systems in several subwatersheds of the Guadalupe River drainage are contaminated with total mercury concentrations that exceed state hazardous waste criteria. Mercury concentrations in fish tissue frequently exceed human health guidelines. However, the potential ecological effects of these elevated mercury concentrations have not been thoroughly evaluated. One difficulty is in extrapolating sediment concentrations to fish tissue concentrations without accounting for physical and biological processes that determine bioaccumulation patterns. Many processes, such as methylation and demethylation of mercury by bacteria, assimilation efficiency in invertebrates, and metabolic rates in fish, are nonlinear, a factor that often confounds attempts to evaluate the effects of mercury contamination on aquatic food webs. Sediment, benthic macroinvertebrate, and fish tissue samples were collected in 1998 from the Guadalupe River drainage in Santa Clara County at 13 sites upstream and downstream from the historic mining district. Sediment and macroinvertebrate samples were analyzed for total mercury and methylmercury. Fish samples were analyzed for total mercury as whole bodies, composited by species and size. While linear correlations of sediment
Li, Ping; Feng, Xinbin; Qiu, Guangle; Shang, Lihai; Wang, Shaofeng
2012-07-01
To evaluate the environmental impacts from large scale mercury mining (LSMM) and artisanal mercury mining (AMM), total mercury (THg) and methyl mercury (MeHg) were determined in mine waste, ambient air, stream water and soil samples collected from Wuchuan mercury (Hg) mining area, Guizhou, Southwestern China. Mine wastes from both LSMM and AMM contained high THg concentrations, which are important Hg contamination sources to the local environment. Total gaseous mercury (TGM) concentrations in the ambient air near AMM furnaces were highly elevated, which indicated that AMM retorting is a major source of Hg emission. THg concentrations in the stream water varied from 43 to 2100 ng/L, where the elevated values were mainly found in the vicinity of AMM and mine waste heaps of LSMM. Surface soils were seriously contaminated with Hg, and land using types and organic matter played an important role in accumulation and transportation of Hg in soil. The results indicated heavy Hg contaminations in the study area, which were resulted from both LSMM and AMM. The areas impacted by LSMM were concentrated in the historical mining and smelting facilities, while Hg pollution resulted from AMM can be distributed anywhere in the Hg mining area. Copyright © 2011 Elsevier Ltd. All rights reserved.
Behaviour of mercury compounds in soil
Energy Technology Data Exchange (ETDEWEB)
Booer, J R
1944-01-01
The uses of inorganic compounds of mercury for the control of plant pests is reviewed, and a summary of the relevant chemical and physical properties of the compounds concerned is given. On chemical evidence a working hypothesis is propounded showing that all compounds may be expected to decompose into metallic mercury. A pot technique is described by means of which a correlation can be obtained between the effective mercury content of a given soil sample and the rate of growth of wheat seedlings. The mathematical treatment of the results is described, and the validity of the pot technique is verified by statistical analysis of results. Using the pot technqiue it is shown that volatilization losses are insignificant but that mercury is slowly rendered ineffective by the formation of mercuric sulphide. The effect of sulphur-reducing bacteria is considered and the influence of Vibrio desulphuricans on mercury is studied in detail. Experimental evidence obtained by the pot technique is produced to show that mercurous chloride slowly decomposes in the soil giving mercury and mercuric chloride, mercuric chloride rapidly decomposes into mercury and mercurous chloride, and other inorganic compounds decompose directly into mercury. The working hypothesis is substantiated in all major aspects. The uses and properties of the organo-mercury compounds are then discussed. Type compounds selected are ethyl mercury phosphate, phenyl mercury acetate and methoxyethyl mercury acetate. Using the pot technique it is shown that the formation of organo-mercury clays takes place and that these clays decompose giving metallic mercury. A mechanism is suggested.
Mercury in the environment : a review
International Nuclear Information System (INIS)
Goodarzi, F.
2000-01-01
Both geogenic and anthropogenic sources are responsible for the input of mercury into the environment. However, mercury comes mostly from geogenic sources and is found naturally in air, water and soil. Crustal degassing results in emission of mercury into the atmosphere. Mercury in water and soil is due mostly to input from sedimentary rocks. Mercury in lake sediments is related mainly to input by country rock and anthropogenic activities such as agriculture. The mercury content of coal is similar to or less than the amount found in the earths crust. Natural charcoal is also able to capture mercury at low temperature combustion. The amount of mercury emitted from the stack of coal-fired power plants is related to the nature of the milled coal and its mineralogical and elemental content. Mercury emissions originating from the combustion of coal from electric utility power plants are considered to be among the greatest contributors to global mercury air emissions. In order to quantify the impact the electric power industry has on the environment, information regarding mercury concentrations in coal and their speciation is needed. For this reason the author examined the behaviour of mercury in three coal samples ashed at increasing temperatures. Mercury removal from coal-fired power plants ranges from 10 to 50 per cent by fabric filters and 20 to 95 per cent by FGD systems. This data will help in regulating emissions of hazardous air pollutants from electric utility steam generating units and will potentially provide insight into the industry's contribution to the global mercury burden. 50 refs
International Nuclear Information System (INIS)
Gielen, John W A M; Groot, Simon de; Dijk, Jan van; Mullen, Joost J A M van der
2004-01-01
In a previous paper we had presented experimental results on mercury segregation due to cataphoresis in direct current operated low-pressure argon-mercury gas discharges. In this paper, we present our model to describe cataphoretic segregation in argon (or another noble gas)-mercury discharges. The model is based on the balance equations for mass and momentum and includes electrophoresis effects of electrons on mercury. Good agreement is found between the experimental results and model calculations. The model confirms our experimental observation that the mercury vapour pressure gradient depends on the local mercury vapour pressure. Furthermore, the model predicts the reversal of the direction of the transport of mercury under certain conditions (the phenomenon known as retrograde cataphoresis)
49 CFR 234.201 - Location of plans.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Location of plans. 234.201 Section 234.201..., Inspection, and Testing Maintenance Standards § 234.201 Location of plans. Plans required for proper maintenance and testing shall be kept at each highway-rail grade crossing warning system location. Plans shall...
41 CFR 50-201.1101 - Minimum wages.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201... Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.1101 Minimum wages. Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by the...
International Nuclear Information System (INIS)
Hollebone, B.P.
2005-01-01
Estimates for average mercury concentrations in crude oil range widely from 10 ng/g of oil to 3,500 ng/g of oil. With such a broad range of estimates, it is difficult to determine the contributions of the petroleum sector to the total budget of mercury emissions. In response to concerns that the combustion of petroleum products may be a major source of air-borne mercury pollution, Environment Canada and the Canadian Petroleum Products Institute has undertaken a survey of the average total mercury concentration in crude oil processed in Canadian refineries. In order to calculate the potential upper limit of total mercury in all refined products, samples of more than 30 different types of crude oil collected from refineries were measured for their concentration of mercury as it enters into a refinery before processing. High temperature combustion, cold vapour atomic absorption and cold vapour atomic fluorescence were the techniques used to quantify mercury in the samples. The results of the study provide information on the total mass of mercury present in crude oil processed in Canada each year. Results can be used to determine the impact of vehicle exhaust emissions to the overall Canadian mercury emission budget. 17 refs., 2 tabs., 2 figs
MESSENGER: Exploring Mercury's Magnetosphere
Slavin, James A.
2008-01-01
The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. Mercury's magnetosphere is unique in many respects. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only - 1000 to 2000 km above the surface. For this reason there are no closed dri-fi paths for energetic particles and, hence, no radiation belts; the characteristic time scales for wave propagation and convective transport are short possibly coupling kinetic and fluid modes; magnetic reconnection at the dayside magnetopause may erode the subsolar magnetosphere allowing solar wind ions to directly impact the dayside regolith; inductive currents in Mercury's interior should act to modify the solar In addition, Mercury's magnetosphere is the only one with its defining magnetic flux tubes rooted in a planetary regolith as opposed to an atmosphere with a conductive ionosphere. This lack of an ionosphere is thought to be the underlying reason for the brevity of the very intense, but short lived, approx. 1-2 min, substorm-like energetic particle events observed by Mariner 10 in Mercury's magnetic tail. In this seminar, we review what we think we know about Mercury's magnetosphere and describe the MESSENGER science team's strategy for obtaining answers to the outstanding science questions surrounding the interaction of the solar wind with Mercury and its small, but dynamic magnetosphere.
2010-10-01
.... Alternative dispute resolution (ADR) means any type of procedure or combination of procedures voluntarily used... REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.201 Definitions. As used in this subpart... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 33.201...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 201.3 Section 201.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS....3 Authority. The Administrator shall perform such duties as the Secretary may require in enforcing...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Allegation. 93.201 Section 93.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
2010-04-01
... PROCESSED TOBACCO Operations by Manufacturers of Tobacco Products Inventories and Reports § 40.201 Inventories. Every manufacturer of tobacco products shall make true and accurate inventories on Form 5210.9... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Inventories. 40.201...
The Mercury Laser Advances Laser Technology for Power Generation
Energy Technology Data Exchange (ETDEWEB)
Ebbers, C A; Caird, J; Moses, E
2009-01-21
The National Ignition Facility (NIF) at Lawrence Livermore Laboratory is on target to demonstrate 'breakeven' - creating as much fusion-energy output as laser-energy input. NIF will compress a tiny sphere of hydrogen isotopes with 1.8 MJ of laser light in a 20-ns pulse, packing the isotopes so tightly that they fuse together, producing helium nuclei and releasing energy in the form of energetic particles. The achievement of breakeven will culminate an enormous effort by thousands of scientists and engineers, not only at Livermore but around the world, during the past several decades. But what about the day after NIF achieves breakeven? NIF is a world-class engineering research facility, but if laser fusion is ever to generate power for civilian consumption, the laser will have to deliver pulses nearly 100,000 times faster than NIF - a rate of perhaps 10 shots per second as opposed to NIF's several shots a day. The Mercury laser (named after the Roman messenger god) is intended to lead the way to a 10-shots-per-second, electrically-efficient, driver laser for commercial laser fusion. While the Mercury laser will generate only a small fraction of the peak power of NIF (1/30,000), Mercury operates at higher average power. The design of Mercury takes full advantage of the technology advances manifest in its behemoth cousin (Table 1). One significant difference is that, unlike the flashlamp-pumped NIF, Mercury is pumped by highly efficient laser diodes. Mercury is a prototype laser capable of scaling in aperture and energy to a NIF-like beamline, with greater electrical efficiency, while still running at a repetition rate 100,000 times greater.
Mercury's Dynamic Magnetic Tail
Slavin, James A.
2010-01-01
The Mariner 10 and MESSENGER flybys of Mercury have revealed a magnetosphere that is likely the most responsive to upstream interplanetary conditions of any in the solar system. The source of the great dynamic variability observed during these brief passages is due to Mercury's proximity to the Sun and the inverse proportionality between reconnection rate and solar wind Alfven Mach number. However, this planet's lack of an ionosphere and its small physical dimensions also contribute to Mercury's very brief Dungey cycle, approx. 2 min, which governs the time scale for internal plasma circulation. Current observations and understanding of the structure and dynamics of Mercury's magnetotail are summarized and discussed. Special emphasis will be placed upon such questions as: 1) How much access does the solar wind have to this small magnetosphere as a function of upstream conditions? 2) What roles do heavy planetary ions play? 3) Do Earth-like substorms take place at Mercury? 4) How does Mercury's tail respond to extreme solar wind events such coronal mass ejections? Prospects for progress due to advances in the global magnetohydrodynamic and hybrid simulation modeling and the measurements to be taken by MESSENGER after it enters Mercury orbit on March 18, 2011 will be discussed.
Basic information about mercury, how it gets in the air, how people are exposed to it and health effects associated with exposure; what EPA and other organizations are doing to limit exposures; what citizens should know to minimize exposures and to reduce mercury in the environment; and information about products that contain mercury.
Characterization of cartilaginous tumors with 201Tl scintigraphy
International Nuclear Information System (INIS)
Higuchi, Takahiro; Taki, Junichi; Sumiya, Hisashi; Kinuya, Seigo; Nakajima, Kenichi; Tonami, Norihisa
2005-01-01
Histological diagnosis and grading of cartilaginous tumors are closely correlated with patient prognosis; consequently, they are essential elements. We attempted to clarify the characteristics of 201 Tl uptake in various histological types of cartilaginous tumors and to assess its clinical value. Twenty-two cases with histologically proven cartilaginous tumors (3 enchondromas, 15 conventional chondrosarcomas (grade I=9, II=5, III=1), 3 mesenchymal chondrosarcomas, and 1 de-differentiated chondrosarcoma) were examined retrospectively. Planar 201 Tl images were recorded 15 mm following intravenous injection of 201 Tl (111 MBq). 201 Tl uptake in the tumor was evaluated visually employing a five-grade scoring system: 0=no appreciable uptake, 1=faint uptake above the background level, 2=moderate uptake, 3=intense uptake but lower than heart uptake and 4=uptake higher than heart uptake. 201 Tl uptake scores were 0 in 3 of 3 enchondromas, 9 of 9 grade I, and 4 of 5 grade II conventional chondrosarcomas. 201 Tl uptake scores were 1 among 1 of 5 grades II and a grade III conventional chondrosarcoma. Mesenchymal chondrosarcoma and de-differentiated chondrosarcoma displayed 201 Tl uptake scores of 2 or 3. Absence of elevated 201 Tl uptake in cartilaginous tumors was indicative of enchondroma or low-grade conventional chondrosarcoma. However, in instances in which 201 Tl uptake is obvious, high-grade chondrosarcoma or variant types should be considered. (author)
Chiriki, S; Odoj, R; Moormann, R; Hinssen, H. K; Bukaemskiy, A
2009-01-01
Large spallation sources are intended to be constructed in Europe (EURISOL nuclear physics facility and ESS-European Spallation Source). These facilities accumulate more than 20 metric tons of irradiated mercury in the target, which has to be treated as highly radioactive and chemo-toxic waste. Because solids are the only appropriate (immobile) form for this radiotoxic and toxic type of waste solidification is required for irradiated mercury. Our irradiation experimental studies on mercury waste revealed that mercury sulfide is a reasonable solid for disposal and shows larger stability in assumed accidents with water ingress in a repository compared to amalgams. For preparation of mercury sulfide a wet process is more suitable than a dry one. It is easier to perform under hot cell conditions and allows complete Hg-conversion. Embedding HgS in a cementitious matrix increases its stability.
Directory of Open Access Journals (Sweden)
Akira Yasutake
2011-01-01
Full Text Available A chemical factory, using a production technology of acetaldehyde with mercury catalysis, was located southeast of Qingzhen City in Guizhou Province, China. Previous research showed heavy mercury pollution through an extensive downstream area. A current investigation of the mercury distribution in ambient air, soils, and plants suggests that mobile mercury species in soils created elevated mercury concentrations in ambient air and vegetation. Mercury concentrations of up to 600 ng/m3 in air over the contaminated area provided evidence of the mercury transformation to volatile Hg(0. Mercury analysis of soil and plant samples demonstrated that the mercury concentrations in soil with vaporized and plant-absorbable forms were higher in the southern area, which was closer to the factory. Our results suggest that air monitoring using a portable mercury analyzer can be a convenient and useful method for the rapid detection and mapping of mercury pollution in advanced field surveys.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Settlement. 201.240 Section... of Practice Initiation of Proceedings and Prehearing Rules § 201.240 Settlement. (a) Availability... party to a proceeding already instituted, may, at any time, propose in writing an offer of settlement...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Violations. 280.201 Section 280.201 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF... otherwise, fasteners that are required by the applicable consensus standard or standards to bear an insignia...
2010-10-01
... EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.201 Definitions. Act of terrorism means any act determined to have met the following... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 50.201...
2010-10-01
... private sector must become engaged in the interests of national survival and recovery. (g) National... (47 U.S.C. 606), as amended. (j) Private sector means those sectors of non-government entities that... 47 Telecommunication 5 2010-10-01 2010-10-01 false Definitions. 201.2 Section 201.2...
Figueiredo, Neusa L; Canário, João; O'Driscoll, Nelson J; Duarte, Aida; Carvalho, Cristina
2016-02-01
Aerobic mercury-resistant bacteria were isolated from the sediments of two highly mercury-polluted areas of the Tagus Estuary (Barreiro and Cala do Norte) and one natural reserve area (Alcochete) in order to test their capacity to transform mercury. Bacterial species were identified using 16S rRNA amplification and sequencing techniques and the results indicate the prevalence of Bacillus sp. Resistance patterns to mercurial compounds were established by the determination of minimal inhibitory concentrations. Representative Hg-resistant bacteria were further tested for transformation pathways (reduction, volatilization and methylation) in cultures containing mercury chloride. Bacterial Hg-methylation was carried out by Vibrio fluvialis, Bacillus megaterium and Serratia marcescens that transformed 2-8% of total mercury into methylmercury in 48h. In addition, most of the HgR bacterial isolates showed Hg(2+)-reduction andHg(0)-volatilization resulting 6-50% mercury loss from the culture media. In summary, the results obtained under controlled laboratory conditions indicate that aerobic Hg-resistant bacteria from the Tagus Estuary significantly affect both the methylation and reduction of mercury and may have a dual face by providing a pathway for pollution dispersion while forming methylmercury, which is highly toxic for living organisms. Copyright © 2015 Elsevier Inc. All rights reserved.
EDITORIAL: Mercury-free discharges for lighting
Haverlag, M.
2007-07-01
This special Cluster of articles in Journal of Physics D: Applied Physics covers the subject of mercury-free discharges that are being investigated by different light source researchers, as an alternative to existing mercury-containing lamps. The main driving force to move away from mercury-containing discharge light sources is connected to the environmentally unfriendly nature of mercury. After inhalation or direct contact, severe mercury exposure can lead to damage to human brain cells, the kidneys, the liver and the nervous system. For this reason, the use of mercury in products is becoming more and more restricted by different governmental bodies. In the lighting industry, however, many products still make use of mercury, for different reasons. The main reason is that mercury-containing products are, in most cases, more efficient than mercury-free products. For a realistic comparison of the environmental impact, the mercury-contamination due to electricity production must be taken into account, which depends on the type of fuel being used. For an average European fuel-mix, the amount of mercury that is released into the environment is around 29 μg kWh-1. This means that a typical 30 W TL lamp during a lifetime of 20,000 hours will release a total of about 20 mg mercury due to electricity production, which exceeds the total mercury dose in the lamp (more and more of which is being recycled) by a factor of 5-10 for a modern TL lamp. This illustrates that, quite apart from other environmental arguments like increased CO2 production, mercury-free alternatives that use more energy can in fact be detrimental for the total mercury pollution over the lifetime of the lamp. For this reason, the lighting industry has concentrated on lowering the mercury content in lamps as long as no efficient alternatives exist. Nevertheless, new initiatives for HID lamps and fluorescent lamps with more or less equal efficiency are underway, and a number of them are described in this
46 CFR 201.20 - Attorneys at law.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Attorneys at law. 201.20 Section 201.20 Shipping... PROCEDURE Appearance and Practice Before the Administration (Rule 2) § 201.20 Attorneys at law. Attorneys at law who are admitted to practice before the Federal courts or before the courts of any State or...
10 CFR 830.201 - Performance of work.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Performance of work. 830.201 Section 830.201 Energy DEPARTMENT OF ENERGY NUCLEAR SAFETY MANAGEMENT Safety Basis Requirements § 830.201 Performance of work. A contractor must perform work in accordance with the safety basis for a hazard category 1, 2, or 3 DOE nuclear...
9 CFR 201.1 - Meaning of words.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... § 201.1 Meaning of words. Words used in this part in the singular form shall be deemed to import the...
Intoxication with metallic mercury
International Nuclear Information System (INIS)
Fichte, B.; Assmann, H.; Ritzau, F.
1984-01-01
Intoxications by metallic mercury are extremely rare. Report of a patient, who tried to commit suicide by subcutaneous injection of 500 g of metallic mercury. He died 16 months later in the course of the intoxication. A short review is given of effects and reactions of metallic mercury in the human organism. (orig.) [de
Intoxication with metallic mercury
Energy Technology Data Exchange (ETDEWEB)
Fichte, B.; Ritzau, F.; Assmann, H.
1984-02-01
Intoxications by metallic mercury are extremely rare. Report is given of a patient who tried to commit suicide by subcutaneous injection of 500 g of metallic mercury. He died 16 months later in the course of the intoxication. A short review is given of effects and reactions of metallic mercury in the human organism.
Intoxication with metallic mercury
Energy Technology Data Exchange (ETDEWEB)
Fichte, B.; Assmann, H.; Ritzau, F.
1984-02-01
Intoxications by metallic mercury are extremely rare. Report is given of a patient, who tried to commit suicide by subcutaneous injection of 500 g of metallic mercury. He died 16 months later in the course of the intoxication. A short review is given of effects and reactions of metallic mercury in the human organism.
Mercury in dated Greenland marine sediments
DEFF Research Database (Denmark)
Asmund, G.; Nielsen, S.P.
2000-01-01
Twenty marine sediment cores from Greenland were analysed for mercury, and dated by the lead-210 method. In general the cores exhibit a mercury profile with higher mercury concentrations in the upper centimetres of the core. The cores were studied by linear regression of In Hg vs, age of the sedi......Twenty marine sediment cores from Greenland were analysed for mercury, and dated by the lead-210 method. In general the cores exhibit a mercury profile with higher mercury concentrations in the upper centimetres of the core. The cores were studied by linear regression of In Hg vs, age...... indicating that the mercury mainly originates from atmospheric washout. But the large variability indicates that other processes also influence the mercury flux to Arctic marine sediments. (C) 2000 Elsevier Science B.V. All rights reserved....
Mercury kinetics in marine zooplankton
International Nuclear Information System (INIS)
Fowler, S.W.; Heyraud, M.; LaRosa, J.
1976-01-01
Mercury, like many other heavy metals, is potentially available to marine animals by uptake directly from water and/or through the organisms food. Furthermore, bioavailability, assimilation and subsequent retention in biota may be affected by the chemical species of the element in sea water. While mercury is known to exist in the inorganic form in sea water, recent work has indicated that, in certain coastal areas, a good portion of the total mercury appears to be organically bound; however, the exact chemical nature of the organic fraction has yet to be determined. Methyl mercury may be one constituent of the natural organically bound fraction since microbial mechanisms for in situ methylation of mercury have been demonstrated in the aquatic environment. Despite the fact that naturally produced methyl mercury probably comprises only a small fraction of an aquatic ecosystem, the well-documented toxic effects of this organo-mercurial, caused by man-made introductions into marine food chains, make it an important compound to study
The secondary release of mercury in coal fly ash-based flue-gas mercury removal technology.
He, Jingfeng; Duan, Chenlong; Lei, Mingzhe; Zhu, Xuemei
2016-01-01
The secondary release of mercury from coal fly ash is a negative by-product from coal-fired power plants, and requires effective control to reduce environmental pollution. Analysing particle size distribution and composition of the coal fly ash produced by different mercury removing technologies indicates that the particles are generally less than 0.5 mm in size and are composed mainly of SiO2, Al2O3, and Fe2O3. The relationships between mercury concentration in the coal fly ash, its particle size, and loss of ignition were studied using different mercury removing approaches. The research indicates that the coal fly ash's mercury levels are significantly higher after injecting activated carbon or brominating activated carbon when compared to regular cooperating-pollution control technology. This is particularly true for particle size ranges of >0.125, 0.075-0.125, and 0.05-0.075 mm. Leaching experiments revealed the secondary release of mercury in discarded coal fly ash. The concentration of mercury in the coal fly ash increases as the quantity of injecting activated carbon or brominating activated carbon increases. The leached concentrations of mercury increase as the particle size of the coal fly ash increases. Therefore, the secondary release of mercury can be controlled by adding suitable activated carbon or brominating activated carbon when disposing of coal fly ash. Adding CaBr2 before coal combustion in the boiler also helps control the secondary release of mercury, by increasing the Hg(2+) concentration in the leachate. This work provides a theoretical foundation for controlling and removing mercury in coal fly ash disposal.
Biomarkers of mercury exposure at a mercury recycling facility in Ukraine.
Gibb, Herman Jones; Kozlov, Kostj; Buckley, Jessie Poulin; Centeno, Jose; Jurgenson, Vera; Kolker, Allan; Conko, Kathryn; Landa, Edward; Panov, Boris; Panov, Yuri; Xu, Hanna
2008-08-01
This study evaluates biomarkers of occupational mercury exposure among workers at a mercury recycling operation in Gorlovka, Ukraine. The 29 study participants were divided into three occupational categories for analysis: (1) those who worked in the mercury recycling operation (Group A, n = 8), (2) those who worked at the facility but not in the yard where the recycling was done (Group B, n = 14), and (3) those who did not work at the facility (Group C, n = 7). Urine, blood, hair, and nail samples were collected from the participants, and a questionnaire was administered to obtain data on age, gender, occupational history, smoking, alcohol consumption, fish consumption, tattoos, dental amalgams, home heating system, education, source of drinking water, and family employment in the former mercury mine/smelter located on the site of the recycling facility. Each factor was tested in a univariate regression with total mercury in urine, blood, hair, and nails. Median biomarker concentrations were 4.04 microg/g-Cr (urine), 2.58 microg/L (blood), 3.95 microg/g (hair), and 1.16 microg/g (nails). Occupational category was significantly correlated (p recycling operation had the highest blood and urinary mercury levels. Those who worked at the facility but were not directly involved with the recycling operation had higher levels than those who did not work at the facility.
DEFF Research Database (Denmark)
Mulkey, Sarah B; Ben-Zeev, Bruria; Nicolai, Joost
2017-01-01
OBJECTIVE: To analyze whether KCNQ2 R201C and R201H variants, which show atypical gain-of-function electrophysiologic properties in vitro, have a distinct clinical presentation and outcome. METHODS: Ten children with heterozygous, de novo KCNQ2 R201C or R201H variants were identified worldwide...... patients had encephalopathy from birth and presented with prominent startle-like myoclonus, which could be triggered by sound or touch. In seven patients, electroencephalography (EEG) was performed in the neonatal period and showed a burst-suppression pattern. However, myoclonus did not have an EEG...... respiratory failure and/or chronic hypoventilation), hypomyelination, reduced brain volume, and profound developmental delay. One patient had a later onset, and sequencing indicated that a low abundance (~20%) R201C variant had arisen by postzygotic mosaicism. SIGNIFICANCE: Heterozygous KCNQ2 R201C and R201H...
Mercury Emission Control Technologies for PPL Montana-Colstrip Testing
Energy Technology Data Exchange (ETDEWEB)
John P. Kay; Michael L. Jones; Steven A. Benson
2007-04-01
technique at Colstrip is not seen. All the additives injected resulted in some reduction in mercury emissions. However, the target reduction of 55% was not achieved. The primary reason for the lower removal rates is because of the lower levels of mercury in the flue gas stream and the lower capture level of fine particles by the scrubbers (relative to that for larger particles). The reaction and interaction of the SEA materials is with the finer fraction of the fly ash, because the SEA materials are vaporized during the combustion or reaction process and condense on the surfaces of entrained particles or form very small particles. Mercury will have a tendency to react and interact with the finer fraction of entrained ash and sorbent as a result of the higher surface areas of the finer particles. The ability to capture the finer fraction of fly ash is the key to controlling mercury. Cost estimates for mercury removal based on the performance of each sorbent during this project are projected to be extremely high. When viewed on a dollar-per-pound-of-mercury removed basis activated carbon was projected to cost nearly $1.2 million per pound of mercury removed. This value is roughly six times the cost of other sorbent-enhancing agents, which were projected to be closer to $200,000 per pound of mercury removed.
Mercury dynamics in a coastal aquifer: Maunalua Bay, Oʻahu, Hawaiʻi
Ganguli, Priya M.; Swarzenski, Peter W.; Dulaiova, Henrieta; Glenn, Craig R.; Flegal, A. Russell
2014-01-01
We evaluated the influence of groundwater–seawater interaction on mercury dynamics in Maunalua Bay, a coral reef ecosystem located on the south shore of Oʻahu, Hawaiʻi, by combining geochemical data with submarine groundwater discharge (SGD) rates. During a rising tide, unfiltered total mercury (U-HgT) concentrations in seawater increased from ∼6 to 20 pM at Black Point (west Bay) and from ∼2.5 to 8 pM at Niu (central Bay). We attribute this change to an increase in suspended particulate matter at high tide. Approximately 90% of mercury in groundwater at Niu was in the filtered (weighted average Maunalua Bay groundwater mercury flux of 0.68 ± 0.67 mol yr−1 by combining the proportional flux of F-HgT from three distinct SGD zones, and place these results into a broader context by comparing and contrasting flux estimates from locations around the world. Results from existing SGD studies should be evaluated to develop future sampling strategies that address more targeted questions about mercury biogeochemical cycling at the groundwater–seawater interface.
In Kazakhstan, there is a serious case of mercury pollution near the city of Pavlodar from an old mercury cell chlor-alkali plant. The soil, sediment, and water is severly contaminated with mercury and mercury compounds as a result of the industrial activity of this chemical pla...
21 CFR 201.61 - Statement of identity.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms of...
Merriam, Norman W.; Grimes, R. William; Tweed, Robert E.
1995-01-01
A process for producing low mercury coal during precombustion procedures by releasing mercury through discriminating mild heating that minimizes other burdensome constituents. Said mercury is recovered from the overhead gases by selective removal.
Current and future levels of mercury atmospheric pollution on a global scale
Pacyna, Jozef M.; Travnikov, Oleg; De Simone, Francesco; Hedgecock, Ian M.; Sundseth, Kyrre; Pacyna, Elisabeth G.; Steenhuisen, Frits; Pirrone, Nicola; Munthe, John; Kindbom, Karin
2016-10-01
research instrument for supporting the scientific justification for the Minamata Convention and monitoring of the implementation of targets of this convention, as well as the EU Mercury Strategy. This project provided the state of the art with regard to the development of the latest emission inventories for mercury, future emission scenarios, dispersion modelling of atmospheric mercury on a global and regional scale, and source-receptor techniques for mercury emission apportionment on a global scale.
Current and future levels of mercury atmospheric pollution on a global scale
Directory of Open Access Journals (Sweden)
J. M. Pacyna
2016-10-01
proved to be a very important research instrument for supporting the scientific justification for the Minamata Convention and monitoring of the implementation of targets of this convention, as well as the EU Mercury Strategy. This project provided the state of the art with regard to the development of the latest emission inventories for mercury, future emission scenarios, dispersion modelling of atmospheric mercury on a global and regional scale, and source–receptor techniques for mercury emission apportionment on a global scale.
Mercury's magnetic field and interior
International Nuclear Information System (INIS)
Connerney, J.E.P.; Ness, N.F.
1988-01-01
The magnetic-field data collected on Mercury by the Mariner-10 spacecraft present substantial evidence for an intrinsic global magnetic field. However, studies of Mercury's thermal evolution show that it is most likely that the inner core region of Mercury solidified or froze early in the planet's history. Thus, the explanation of Mercury's magnetic field in the framework of the traditional planetary dynamo is less than certain
Directory of Open Access Journals (Sweden)
J. Bieser
2017-06-01
Full Text Available Atmospheric chemistry and transport of mercury play a key role in the global mercury cycle. However, there are still considerable knowledge gaps concerning the fate of mercury in the atmosphere. This is the second part of a model intercomparison study investigating the impact of atmospheric chemistry and emissions on mercury in the atmosphere. While the first study focused on ground-based observations of mercury concentration and deposition, here we investigate the vertical and interhemispheric distribution and speciation of mercury from the planetary boundary layer to the lower stratosphere. So far, there have been few model studies investigating the vertical distribution of mercury, mostly focusing on single aircraft campaigns. Here, we present a first comprehensive analysis based on various aircraft observations in Europe, North America, and on intercontinental flights. The investigated models proved to be able to reproduce the distribution of total and elemental mercury concentrations in the troposphere including interhemispheric trends. One key aspect of the study is the investigation of mercury oxidation in the troposphere. We found that different chemistry schemes were better at reproducing observed oxidized mercury patterns depending on altitude. High concentrations of oxidized mercury in the upper troposphere could be reproduced with oxidation by bromine while elevated concentrations in the lower troposphere were better reproduced by OH and ozone chemistry. However, the results were not always conclusive as the physical and chemical parameterizations in the chemistry transport models also proved to have a substantial impact on model results.
Vertical Distribution of Total Mercury and Mercury Methylation in a Landfill Site in Japan
Directory of Open Access Journals (Sweden)
Jing Yang
2018-06-01
Full Text Available Mercury is a neurotoxin, with certain organic forms of the element being particularly harmful to humans. The Minamata Convention was adopted to reduce the intentional use and emission of mercury. Because mercury is an element, it cannot be decomposed. Mercury-containing products and mercury used for various processes will eventually enter the waste stream, and landfill sites will become a mercury sink. While landfill sites can be a source of mercury pollution, the behavior of mercury in solid waste within a landfill site is still not fully understood. The purpose of this study was to determine the depth profile of mercury, the levels of methyl mercury (MeHg, and the factors controlling methylation in an old landfill site that received waste for over 30 years. Three sampling cores were selected, and boring sampling was conducted to a maximum depth of 18 m, which reached the bottom layer of the landfill. Total mercury (THg and MeHg were measured in the samples to determine the characteristics of mercury at different depths. Bacterial species were identified by 16S rRNA amplification and sequencing, because the methylation process is promoted by a series of genes. It was found that the THg concentration was 19–975 ng/g, with a geometric mean of 298 ng/g, which was slightly less than the 400 ng/g concentration recorded 30 years previously. In some samples, MeHg accounted for up to 15–20% of THg, which is far greater than the general level in soils and sediments, although the source of MeHg was unclear. The genetic data indicated that hgcA was present mostly in the upper and lower layers of the three cores, merA was almost as much as hgcA, while the level of merB was hundreds of times less than those of the other two genes. A significant correlation was found between THg and MeHg, as well as between MeHg and MeHg/THg. In addition, a negative correlation was found between THg and merA. The coexistence of the three genes indicated that both
Mercury (Environmental Health Student Portal)
... in contact with) to mercury is by eating fish or shellfish that have high levels of mercury. You can also get sick from: Touching it Breathing it in Drinking contaminated water How can mercury ...
Astone, A
2002-01-01
The high neutrino output demanded for a neutri no factory requests a high power proton beam interacting with a static target. The additional circumstances of limited space and long term stability ask for development of novel concepts for such types of targets. In our working group, part of the Neutri no Factory Working Group (NFWG) of CERN, we are investigating on the proton interaction with the mercury target. This is called the study of proton induced shocks in molten metal. In the US scheme for a neutrino factory the interaction between proton beam and the mercury jet target takes place inside a 20 Tesla solenoidal magnetic field, which serv es as a focusing device for the produced particles. This field of study is refe rred to as Magneto Hydrodynamics (MHD). The high power proton beam deposits a large amount of energy in the small volume of the target, which results in disruption. The aim is to establi...
Elimination of mercury in health care facilities.
2000-03-01
Mercury is a persistent, bioaccumulative toxin that has been linked to numerous health effects in humans and wildlife. It is a potent neurotoxin that may also harm the brain, kidneys, and lungs. Unborn children and young infants are at particular risk for brain damage from mercury exposure. Hospitals' use of mercury in chemical solutions, thermometers, blood pressure gauges, batteries, and fluorescent lamps makes these facilities large contributors to the overall emission of mercury into the environment. Most hospitals recognize the dangers of mercury. In a recent survey, four out of five hospitals stated that they have policies in place to eliminate the use of mercury-containing products. Sixty-two percent of them require vendors to disclose the presence of mercury in chemicals that the hospitals purchase. Only 12 percent distribute mercury-containing thermometers to new parents. Ninety-two percent teach their employees about the health and environmental effects of mercury, and 46 percent teach all employees how to clean up mercury spills. However, the same study showed that many hospitals have not implemented their policies. Forty-two percent were not aware whether they still purchased items containing mercury. In addition, 49 percent still purchase mercury thermometers, 44 percent purchase mercury gastrointestinal diagnostic equipment, and 64 percent still purchase mercury lab thermometers.
Balogh, André; Steiger, Rudolf
2008-01-01
Mercury, the planet closest to the Sun, is different in several respects from the other three terrestrial planets. In appearance, it resembles the heavily cratered surface of the Moon, but its density is high, it has a magnetic field and magnetosphere, but no atmosphere or ionosphere. This book reviews the progress made in Mercury studies since the flybys by Mariner 10 in 1974-75, based on the continued research using the Mariner 10 archive, on observations from Earth, and on increasingly realistic models of its interior evolution.
2010-07-01
... agency agreement between a private sector entity and the Treasury for services under the TARP, other than... Stabilization Act of 2008. Key individual means an individual providing services to a private sector entity who... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 31.201 Section 31.201...
Autometallographic tracing of mercury in frog liver
International Nuclear Information System (INIS)
Loumbourdis, N.S.; Danscher, G.
2004-01-01
The distribution of mercury in the liver of the frog Rana ridibunda with the autometallographic method was investigated. The mercury specific autometallographic (HgS/Se AMG ) technique is a sensitive histochemical approach for tracing mercury in tissues from mercury-exposed organisms. Mercury accumulates in vivo as mercury sulphur/mercury selenium nanocrystals that can be silver-enhanced. Thus, only a fraction of the Hg can be visualized. Six animals were exposed for one day and another group of six animals for 6 days in 1 ppm mercury (as HgCI 2 ) dissolved in fresh water. A third group of six animals, served as controls, were sacrificed the day of arrival at the laboratory. First, mercury appears in the blood plasma and erythrocytes. Next, mercury moves to hepatocytes and in the apical part of the cells, that facing bile canaliculi. In a next step, mercury appears in the endothelial and Kupffer cells. It seems likely that, the mercury of hepatocytes moves through bile canaliculi to the gut, most probably bound to glutathione and/or other similar ligands. Most probably, the endothelial and Kupffer cells comprise the first line of defense against metal toxicity. - Frogs can be good bioindicators of mercury
International Nuclear Information System (INIS)
Kiat, H.; Berman, D.S.; Maddahi, J.; De Yang, L.; Van Train, K.; Rozanski, A.; Friedman, J.
1988-01-01
Twenty-one patients were studied who underwent thallium-201 stress-redistribution single photon emission computed tomography (SPECT) both before and after coronary artery bypass grafting (n = 15) or transluminal coronary angioplasty (n = 6). All patients underwent thallium imaging 15 min, 4 h and late (18 to 72 h) after stress as part of the preintervention thallium-201 scintigram. In a total of 201 tomographic myocardial segments with definite post-stress thallium-201 perfusion defects in which the relevant coronary arteries were subsequently successfully reperfused, the 4 h redistribution images did not predict the postintervention scintigraphic improvement: 67 (85%) of the 79 4 h reversible as well as 88 (72%) of the 122 4 h nonreversible segments improved (p = NS). The 18 to 72 h late redistribution images effectively subcategorized the 4 h nonreversible segments with respect to postintervention scintigraphic improvement: 70 (95%) of the 74 late reversible segments improved after intervention, whereas only 18 (37%) of the 48 late nonreversible segments improved (p less than 0.0001). The frequency of late reversible defects and the frequency of postrevascularization improvement of late nonreversible defects are probably overestimated by this study because of referral biases. The cardiac counts and target to background ratios from late redistribution studies resulted in satisfactory cardiac images for visual interpretation. For optimal assessment of the extent of viable myocardium by thallium-201 scintigraphic studies, late redistribution imaging should be performed when nonreversible defects are observed on 4 h redistribution images
Fatigue properties of type 316LN stainless steel in air and mercury
International Nuclear Information System (INIS)
Strizak, J.P.; Tian, H.; Liaw, P.K.; Mansur, L.K.
2005-01-01
An extensive fatigue testing program on 316LN stainless steel was recently carried out to support the design of the mercury target container for the spallation neutron source (SNS) that is currently under construction at the Oak Ridge National Laboratory in the United States. The major objective was to determine the effects of mercury on fatigue behavior. The S-N fatigue behavior of 316LN stainless steel is characterized by a family of bilinear fatigue curves which are dependent on frequency, environment, mean stress and cold work. Generally, fatigue life increases with decreasing stress and levels off in the high cycle region to an endurance limit below which the material will not fail. For fully reversed loading as well as tensile mean stress loading conditions mercury had no effect on endurance limit. However, at higher stresses a synergistic relationship between mercury and cyclic loading frequency was observed at low frequencies. As expected, fatigue life decreased with decreasing frequency, but the response was more pronounced in mercury compared with air. As a result of liquid metal embrittlement (LME), fracture surfaces of specimens tested in mercury showed widespread brittle intergranular cracking as opposed to typical transgranular cracking for specimens tested in air. For fully reversed loading (zero mean stress) the effect of mercury disappeared as frequency increased to 10 Hz. For mean stress conditions with R-ratios of 0.1 and 0.3, LME was still evident at 10 Hz, but at 700 Hz the effect of mercury had disappeared (R 0.1). Further, for higher R-ratios (0.5 and 0.75) fatigue curves for 10 Hz showed no environmental effect. Finally, cold working (20%) increased tensile strength and hardness, and improved fatigue resistance. Fatigue behavior at 10 and 700 Hz was similar and no environmental effect was observed
Fatigue properties of type 316LN stainless steel in air and mercury
Strizak, J. P.; Tian, H.; Liaw, P. K.; Mansur, L. K.
2005-08-01
An extensive fatigue testing program on 316LN stainless steel was recently carried out to support the design of the mercury target container for the spallation neutron source (SNS) that is currently under construction at the Oak Ridge National Laboratory in the United States. The major objective was to determine the effects of mercury on fatigue behavior. The S- N fatigue behavior of 316LN stainless steel is characterized by a family of bilinear fatigue curves which are dependent on frequency, environment, mean stress and cold work. Generally, fatigue life increases with decreasing stress and levels off in the high cycle region to an endurance limit below which the material will not fail. For fully reversed loading as well as tensile mean stress loading conditions mercury had no effect on endurance limit. However, at higher stresses a synergistic relationship between mercury and cyclic loading frequency was observed at low frequencies. As expected, fatigue life decreased with decreasing frequency, but the response was more pronounced in mercury compared with air. As a result of liquid metal embrittlement (LME), fracture surfaces of specimens tested in mercury showed widespread brittle intergranular cracking as opposed to typical transgranular cracking for specimens tested in air. For fully reversed loading (zero mean stress) the effect of mercury disappeared as frequency increased to 10 Hz. For mean stress conditions with R-ratios of 0.1 and 0.3, LME was still evident at 10 Hz, but at 700 Hz the effect of mercury had disappeared ( R = 0.1). Further, for higher R-ratios (0.5 and 0.75) fatigue curves for 10 Hz showed no environmental effect. Finally, cold working (20%) increased tensile strength and hardness, and improved fatigue resistance. Fatigue behavior at 10 and 700 Hz was similar and no environmental effect was observed.
Method and apparatus for sampling atmospheric mercury
Trujillo, Patricio E.; Campbell, Evan E.; Eutsler, Bernard C.
1976-01-20
A method of simultaneously sampling particulate mercury, organic mercurial vapors, and metallic mercury vapor in the working and occupational environment and determining the amount of mercury derived from each such source in the sampled air. A known volume of air is passed through a sampling tube containing a filter for particulate mercury collection, a first adsorber for the selective adsorption of organic mercurial vapors, and a second adsorber for the adsorption of metallic mercury vapor. Carbon black molecular sieves are particularly useful as the selective adsorber for organic mercurial vapors. The amount of mercury adsorbed or collected in each section of the sampling tube is readily quantitatively determined by flameless atomic absorption spectrophotometry.
International Nuclear Information System (INIS)
Eck-Smit, B.L.F. van; Wall, E.E. van der; Verhoeven, P.P.A.M.; Poots, S.; Zwinderman, A.H.; Pauwels, E.K.J.
1996-01-01
We investigated whether the kinetics of thallium-201 would differ between the standard stress-redistribution-reinjection approach and the stress-immediate reinjection approach. In 53 patients with undiagnosed chest pain, 75 MBq (2 mCi) 201 Tl was injected at maximal exercise. In 26 patients (group I), 37 MBq (1 mCi) 201 Tl was reinjected immediately after completing the exercise images and in 27 patients (group II), 37 MBq (1 mCi) 201 Tl was reinjected after completing 3-h redistribution images. Mean peak 201 Tl blood activity after exercise was 17.7±12.5 kBq/ml (4.8±3.4 mCi/ml) for group I versus 16.4±9.2 kBq/ml (4.4±2.5 mCi/ml) for group II (NS). The relative increase in 201 Tl blood activity after reinjection of half the initial dose [37 MBq (1 mCi)] exceeded 50% of the initial peak in both groups. The relative amount of 201 Tl delivered to the myocardium was assessed by the area under the curve after both exercise and reinjection, and was 117%±72% for group I and 112%±73% for group II (NS). Blood clearance of 201 Tl was at least biexponential. Mean early decay constants (λ 1 ) after exercise and reinjection were 0.30±0.18 min -1 and 0.22±0.046 min -1 resp. for group I, and 0.30±0.12 min -1 and 0.24±0.07 min -1 resp. for group II. For both procedures no significant differences were found between λ 1 after exercise and λ 1 after injection. The mean late clearance (λ 2 ) from the blood was 0.032±0.056 min -1 and 0.012±0.012 min -1 resp. for group I, and 0.036±0.030 min -1 and 0.014±0.014 min -1 resp. for group II. Also, no significant differences were found between λ 2 after exercise for both groups and between λ 2 after reinjection for both groups. (orig./MG)
Methods for dispensing mercury into devices
Grossman, Mark W.; George, William A.
1987-04-28
A process for dispensing mercury into devices which requires mercury. Mercury is first electrolytically separated from either HgO or Hg.sub.2 Cl.sub.2 and plated onto a cathode wire. The cathode wire is then placed into a device requiring mercury.
Streamwater fluxes of total mercury and methylmercury into and out of Lake Champlain
International Nuclear Information System (INIS)
Shanley, James B.; Chalmers, Ann T.
2012-01-01
From 2000 to 2004, we sampled for total mercury (THg) and methylmercury (MeHg) in inlet streams to Lake Champlain, targeting high flow periods to capture increases in THg and MeHg concentrations with increasing flow. We used these data to model stream THg and MeHg fluxes for Water Years 2001 through 2009. In this mountainous forested basin with a high watershed-to-lake area ratio of 18, fluvial export from the terrestrial watershed was the dominant source of Hg to the lake. Unfiltered THg and MeHg fluxes were dominated by the particulate fraction; about 40% of stream THg was in the filtered ( −2 yr −1 , or about 13% of atmospheric Hg wet and dry deposition to the basin. THg export from the lake represented only about 3% of atmospheric Hg input to the basin. - Highlights: ► We monitored total mercury and methylmercury in major tributaries to Lake Champlain. ► Mercury and methylmercury export was primarily as particulates during high flow. ► Only 13% of atmospheric total mercury input reached the lake via streams. ► Only 3% of atmospheric total mercury input reached the lake outlet. - Eighty-seven percent of total mercury deposition to the Lake Champlain basin is retained in the terrestrial basin; stream export of total and methylmercury to the lake is primarily in the particulate phase.
DEFF Research Database (Denmark)
Baatrup, E; Nielsen, M G; Danscher, G
1987-01-01
Juvenile rainbow trout (Salmo gairdneri) were exposed to 100 ppb mercury (as HgCl2) in the water for 14 days. Concentrations of mercury in water and fish organs were monitored using radiolabeled mercury. Tissues from kidney and liver were fixed, and sections were developed by autometallography......, a method whereby accumulations of mercury sulfides and/or mercury selenides are silver amplified. In the kidney, mercury was found within lysosomes and extracellularly in the basal lamina of proximal tubules. In the liver, mercury was found within lysosomes of the hepatocytes. Additional groups of mercury......-exposed trout were subjected to selenium (as Na2SeO3), administered intraperitoneally 2 hr before fixation. Following this treatment, additional mercury could be visualized in the kidney circulatory system, including glomeruli, and in the nucleus and endoplasmic reticulum of liver cells. It is suggested...
International Nuclear Information System (INIS)
Ogata, M.; Kenmotsu, K.; Hirota, N.; Meguro, T.; Aikoh, H.
1985-01-01
Levels of mercury in the brain and liver of acatalasemic mice immediately following exposure to metallic mercury vapor or injection of metallic mercury were higher than those found in normal mice. Acatalasemic mice had decreased levels of mercury in the blood and kidneys when the levels were compared with those of normal mice, which indicated that catalase plays a role in oxidizing and taking up mercury. Thus, the brain/blood or liver/blood ratio of mercury concentration in acatalasemic mice was significantly higher than that of normal mice. These results suggest that metallic mercury in the blood easily passed through the blood-brain or blood-liver barrier. The levels of mercury distribution to the kidneys of normal and acatalasemic mice, 1 hr after injection of mercuric chloride solution, were higher than that of normal and acatalasemic mice, respectively, 1 hr after injection of metallic mercury
International Nuclear Information System (INIS)
Chen, Jinfeng; Tang, Juan; Zhou, Jun; Zhang, Lan; Chen, Guonan; Tang, Dianping
2014-01-01
Graphical abstract: -- Highlights: •We report a new electrochemical sensing protocol for the detection of mercury ion. •Gold amalgamation on DNA-based sensing platform was used as nanocatalyst. •The signal was amplified by cycling signal amplification strategy. -- Abstract: Heavy metal ion pollution poses severe risks in human health and environmental pollutant, because of the likelihood of bioaccumulation and toxicity. Driven by the requirement to monitor trace-level mercury ion (Hg 2+ ), herein we construct a new DNA-based sensor for sensitive electrochemical monitoring of Hg 2+ by coupling target-induced formation of gold amalgamation on DNA-based sensing platform with gold amalgamation-catalyzed cycling signal amplification strategy. The sensor was simply prepared by covalent conjugation of aminated poly-T (25) oligonucleotide onto the glassy carbon electrode by typical carbodiimide coupling. Upon introduction of target analyte, Hg 2+ ion was intercalated into the DNA polyion complex membrane based on T–Hg 2+ –T coordination chemistry. The chelated Hg 2+ ion could induce the formation of gold amalgamation, which could catalyze the p-nitrophenol with the aid of NaBH 4 and Ru(NH 3 ) 6 3+ for cycling signal amplification. Experimental results indicated that the electronic signal of our system increased with the increasing Hg 2+ level in the sample, and has a detection limit of 0.02 nM with a dynamic range of up to 1000 nM Hg 2+ . The strategy afforded exquisite selectivity for Hg 2+ against other environmentally related metal ions. In addition, the methodology was evaluated for the analysis of Hg 2+ in spiked tap-water samples, and the recovery was 87.9–113.8%
Mercury content in Hot Springs
Energy Technology Data Exchange (ETDEWEB)
Nakagawa, R
1974-01-01
A method of determination of mercury in hot spring waters by flameless atomic absorption spectrophotometry is described. Further, the mercury content and the chemical behavior of the elementary mercury in hot springs are described. Sulfide and iodide ions interfered with the determination of mercury by the reduction-vapor phase technique. These interferences could, however, be minimized by the addition of potassium permanganate. Waters collected from 55 hot springs were found to contain up to 26.0 ppb mercury. High concentrations of mercury have been found in waters from Shimoburo Springs, Aomori (10.0 ppb), Osorezan Springs, Aomori (1.3 approximately 18.8 ppb), Gosyogake Springs, Akita (26.0 ppb), Manza Springs, Gunma (0.30 approximately 19.5 ppb) and Kusatu Springs, Gunma (1.70 approximately 4.50 ppb). These hot springs were acid waters containing a relatively high quantity of chloride or sulfate.
48 CFR 1536.201 - Evaluation of contracting performance.
2010-10-01
... performance. 1536.201 Section 1536.201 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY... Contracting for Construction 1536.201 Evaluation of contracting performance. (a) The Contracting Officer will... will file the form in the contractor performance evaluation files which it maintains. (e) The Quality...
Method and apparatus for monitoring mercury emissions
Durham, Michael D.; Schlager, Richard J.; Sappey, Andrew D.; Sagan, Francis J.; Marmaro, Roger W.; Wilson, Kevin G.
1997-01-01
A mercury monitoring device that continuously monitors the total mercury concentration in a gas. The device uses the same chamber for converting speciated mercury into elemental mercury and for measurement of the mercury in the chamber by radiation absorption techniques. The interior of the chamber is resistant to the absorption of speciated and elemental mercury at the operating temperature of the chamber.
Tumor grade-related thallium-201 uptake in chondrosarcomas
International Nuclear Information System (INIS)
Kaya, G.C.; Demir, Y.; Ozkal, S.
2010-01-01
Diagnosis of low-grade chondrosarcoma, especially discrimination between enchondroma and low-grade chondrosarcoma, may be difficult pathologically. The aim of this study was to evaluate the value of thallium-201 (Tl-201) scintigraphy in the diagnosis of chondrosarcoma and to investigate whether there was a correlation between Tl-201 uptake and tumor grade. We retrospectively evaluated 121 patients with pathologically proven bone and soft tissue tumors diagnosed between the years 1999 and 2007. All patients were followed by the Bone and Soft Tissue Tumor Working Group in our hospital. Twenty-three patients, mean age 44±15 (range 17-72) years, with a diagnosis of cartilaginous tumors were included. Increased Tl-201 uptake at the lesion sites greater than background was evaluated as malignant tumor. For the pathologic classification, a grading system (grade 1-3) based on the histopathologic findings was used. Pearson correlation coefficient was used to determine whether there was any correlation between Tl-201 uptake and tumor grade in chondrosarcoma. There were 7 enchondromas and 16 chondrosarcomas. Four of 16 patients with chondrosarcoma had lesions pathologically classified as grade 3, 5 as grade 2, and 7 had grade 1 chondrosarcoma. Increased Tl-201 uptake was observed in all patients with grade 3 chondrosarcoma and 2 patients with grade 2 chondrosarcoma. Of 10 patients with chondrosarcoma, 3 grade 2 chondrosarcomas and 7 grade 1 chondrosarcomas, there was no Tl-201 uptake in the tumor region. A significant correlation was found between Tl-201 uptake and tumor grade in chondrosarcoma (p=0.002, r=0.71). Only a few reports in literature have demonstrated false negative results in low-grade chondrosarcoma. Tl-201 uptake was related to tumor grade in chondrosarcoma. If there is a possibility of chondrosarcoma, Tl-201 scintigraphy should be reported with caution. (author)
24 CFR 201.16 - Default provision.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Default provision. 201.16 Section... PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.16 Default provision. The... default by the borrower. ...
Return to Mercury: a global perspective on MESSENGER's first Mercury flyby.
Solomon, Sean C; McNutt, Ralph L; Watters, Thomas R; Lawrence, David J; Feldman, William C; Head, James W; Krimigis, Stamatios M; Murchie, Scott L; Phillips, Roger J; Slavin, James A; Zuber, Maria T
2008-07-04
In January 2008, the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft became the first probe to fly past the planet Mercury in 33 years. The encounter revealed that Mercury is a dynamic system; its liquid iron-rich outer core is coupled through a dominantly dipolar magnetic field to the surface, exosphere, and magnetosphere, all of which interact with the solar wind. MESSENGER images confirm that lobate scarps are the dominant tectonic landform and record global contraction associated with cooling of the planet. The history of contraction can be related to the history of volcanism and cratering, and the total contractional strain is at least one-third greater than inferred from Mariner 10 images. On the basis of measurements of thermal neutrons made during the flyby, the average abundance of iron in Mercury's surface material is less than 6% by weight.
Siegel, S. M.
1973-01-01
A study was conducted to determine the effects of mercury pollution on the environment. The possible sources of mercury contamination in sea water are identified. The effects of mercury on food sources, as represented by swordfish, are analyzed. The physiological effects of varying concentrations of mercury are reported. Emphasis is placed on the situation existing in the Hawaiian Islands.
International Nuclear Information System (INIS)
Gielen, John W A M; Groot, Simon de; Mullen, Joost J A M van der
2004-01-01
Due to cataphoresis, axial segregation of mercury will occur when the gas discharge of a fluorescent lamp is operated by means of a direct current. A consequence of this is a non-uniform axial luminance distribution along the lamp. To determine the degree of axial mercury segregation experimentally, axial luminance distributions have been measured which are converted into axial mercury vapour pressure distributions by an appropriate calibration method. The mercury segregation has been investigated for variations in lamp tube radius (3.6-4.8 mm), argon buffer gas pressure (200-600 Pa) and lamp current (100-250 mA) at mercury vapour pressures set at the anode in the range from 0.2 to 9.0 Pa. From the experiments it has been concluded that the mercury vapour pressure gradient at any axial position for a certain lamp tube diameter, argon pressure and lamp current depends on the local mercury vapour pressure. This observation is in contrast to assumptions made in earlier modelling publications in which one mercury vapour pressure gradient is used for all axial positions. By applying a full factorial design, an empirical relation of the mercury segregation is found for any set of parameters inside the investigated parameter ranges
Mercury Sorption onto Malt Spent Rootlets
Manariotis, I. D.; Anagnostopoulos, V.; Karapanagioti, H. K.; Chrysikopoulos, C.
2011-12-01
Mercury is a metal of particular concern due to its toxicity even at relatively low concentrations. The maximum permissible level for mercury in drinking water set by the European Union is 0.001 mg/L. Mercury is released into the environment via four principal pathways: (1) natural processes; i.e. a volcanic eruption, (2) incidental to some other activity; i.e. coal burning power plants, (3) accidentally during the manufacture, breakage or disposal of products that have mercury put into them deliberately, and (4) direct use in industrial settings. The present study focuses on the removal of mercury (II) from aqueous solutions via sorption onto Malt Spent Rootlets (MSR). Batch experiments were conducted employing MSR with size ranging from 0.18 to 1 mm. The effects of pH, mercury concentration, contact time, and solid to liquid ratio on mercury sorption onto MSR were investigated. The highest mercury removal from the aqueous phase, of 41%, was observed at pH of 5.
19 CFR 201.149 - Program accessibility: Discrimination prohibited.
2010-04-01
.... 201.149 Section 201.149 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF... Conducted by the U.S. International Trade Commission § 201.149 Program accessibility: Discrimination... agency's facilities are inaccessible to or unusable by handicapped persons, be denied the benefits of, be...
48 CFR 36.201 - Evaluation of contractor performance.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation of contractor performance. 36.201 Section 36.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Contracting for Construction 36.201 Evaluation of contractor performance. See 42.1502(e) for the requirements...
International Nuclear Information System (INIS)
Ribeiro Guevara, Sergio; Perez Catan, Soledad; Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena
2007-01-01
Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H 2 SO 4 or HCl were evaluated in freshwater sediments using 197 Hg radiotracer. Values obtained for the 197 Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of 197 Hg 2+ into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg 2+ contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg 2+ contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H 2 SO 4 method is recommended, since it is free from these interferences. 197 Hg radiotracer (T 1/2 = 2.673 d) has a production rate that is about 50 times higher than that of 203 Hg (T 1/2 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to 203 Hg when it is used it in short-term experiments and produced by the irradiation of 196 Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the 196 Hg isotope is increased, the specific activity of the 197 Hg tracer can be significantly improved. In the present work, 197 Hg tracer was produced from mercury 51.58% enriched in the 196 Hg
Energy Technology Data Exchange (ETDEWEB)
Fujii, Tadashige; Tanaka, Masao; Hirose, Yoshiki; Hirayama, Jiro; Handa, Kenjiro; Nakanishi, Fumiko; Yano, Kesato; Ueda, Hitoshi
1989-04-01
Thallium-201 (Tl-201) uptake in the bone and bone marrow was examined in a total of 93 patients with various diseases. Sternal uptake of Tl-201 was observed when patients had bone marrow abnormality especially associated with hematopoietic disease. It was associated with proliferation of immature cells and of various types of bone marrow cells, especially erythroblastic and plasma cells. Whole-body Tl-201 scanning showed a high uptake (82%) in the sternum, chest, lumbar vertebrae, and pelvis. Thallium-201 was definitively taken up by the sternum in polycythemia (5/41), hemolytic anemia (2/2), iron deficiency anemia (2/2), and multiple myeloma (2/5). For leukemia, Tl-201 uptake was slight or negative. Thallium-201 scanning proved useful in visualizing bone marrow abnormality, although careful interpretation of bone and bone marrow uptake is required. (Namekawa, K).
Mercury Exposure: Protein Biomarkers of Mercury Exposure in Jaraqui Fish from the Amazon Region.
Vieira, José Cavalcante Souza; Braga, Camila Pereira; de Oliveira, Grasieli; Padilha, Cilene do Carmo Federici; de Moraes, Paula Martin; Zara, Luiz Fabricio; Leite, Aline de Lima; Buzalaf, Marília Afonso Rabelo; Padilha, Pedro de Magalhães
2018-05-01
This study presents data on the extraction and characterization of proteins associated with mercury in the muscle and liver tissues of jaraqui (Semaprochilodus spp.) from the Madeira River in the Brazilian Amazon. Protein fractionation was carried out by two-dimensional electrophoresis (2D-PAGE). Mercury determination in tissues, pellets, and protein spots was performed by graphite furnace atomic absorption spectrometry (GFAAS). Proteins in the spots that showed mercury were characterized by electrospray ionization tandem mass spectrometry (ESI-MS/MS). The highest mercury concentrations were found in liver tissues and pellets (426 ± 6 and 277 ± 4 μg kg -1 ), followed by muscle tissues and pellets (132 ± 4 and 86 ± 1 μg kg -1 , respectively). Mercury quantification in the protein spots allowed us to propose stoichiometric ratios in the range of 1-4 mercury atoms per molecule of protein in the protein spots. The proteins characterized in the analysis by ESI-MS/MS were keratin, type II cytoskeletal 8, parvalbumin beta, parvalbumin-2, ubiquitin-40S ribosomal S27a, 39S ribosomal protein L36 mitochondrial, hemoglobin subunit beta, and hemoglobin subunit beta-A/B. The results suggest that proteins such as ubiquitin-40S ribosomal protein S27a, which have specific domains, possibly zinc finger, can be used as biomarkers of mercury, whereas mercury and zinc present characteristics of soft acids.
International Nuclear Information System (INIS)
Granato, J.E.; Watson, D.D.; Flanagan, T.L.; Gascho, J.A.; Beller, G.A.
1986-01-01
Thallium-201 (201Tl) uptake and redistribution kinetics were examined in an open-chest canine preparation of occlusion and reperfusion. Seven dogs (group I) underwent 3 hr of sustained occlusion and received 1.5 mCi of 201Tl after 40 min of occlusion of the left anterior descending coronary artery (LAD). Group II (n = 18) underwent 60 min of LAD occlusion followed by sudden and total release of the ligature. Group IIa (n = 8) received intravenous 201Tl during occlusion of the LAD, whereas group IIb (n = 10) received intravenous 201Tl at the time of peak reflow. Group III dogs (n = 26) also underwent 60 min of LAD occlusion that was followed by gradual reflow through a residual critical stenosis. Animals in this group also received 201Tl either before (IIIa; n = 16) or after reflow was established (IIIb; n = 10). In group I, the relative 201Tl gradient (nonischemic minus ischemic activity) decreased from 88 +/- 8% (mean +/- SEM) to 59 +/- 6% during 3 hr of coronary occlusion (p = .034). After rapid and total reperfusion (group IIa), this gradient decreased from 71 +/- 6% during occlusion to 26 +/- 5% after reflow (p less than .001). After slow reperfusion through a residual stenosis (group IIIa), the gradient decreased from 81 +/- 5% to 31 +/- 5% (p less than .001) (p = .56 compared with group IIa). In rapidly reperfused dogs receiving intravenous thallium during peak reflow (IIb), initial 201Tl activity in the ischemic zone was 155 +/- 20% of initial normal activity and fell to 93 +/- 13% of normal after 2 hr of reperfusion. In dogs reperfused slowly through a critical stenosis (IIIb), which received 201Tl during reflow, 201Tl activity soon after reflow was 94 +/- 4% of initial normal and decreased to 80 +/- 6% at 2 hr of reperfusion (p = .10). There was histochemical evidence of necrosis in the biopsy region in 80% of the 20 dogs subjected to triphenyl tetrazolium chloride staining
Method for the removal and recovery of mercury
Easterly, Clay E.; Vass, Arpad A.; Tyndall, Richard L.
1997-01-01
The present invention is an enhanced method for the removal and recovery of mercury from mercury-contaminated matrices. The method involves contacting a mercury-contaminated matrix with an aqueous dispersant solution derived from specific intra-amoebic isolates to release the mercury from the mercury-contaminated matrix and emulsify the mercury; then, contacting the matrix with an amalgamating metal from a metal source to amalgamate the mercury to the amalgamating metal; removing the metallic source from the mercury-contaminated matrix; and heating the metallic source to vaporize the mercury in a closed system to capture the mercury vapors.
48 CFR 3019.201 - General policy.
2010-10-01
... Section 3019.201 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 3019.201 General policy. (d) DHS is committed to a unified team approach involving senior management, small business...
Isolation, screening and identification of mercury resistant bacteria from mercury contaminated soil
Kowalczyk Anna; Wilińska Magdalena; Chyc Marek; Bojko Monika; Latowski Dariusz
2016-01-01
New bacterial strains resistant to high concentration of mercury were obtained and character iz ed focusing on their potential application in bioremediation. The biological material was isolated from soil contaminated with mercury. The ability to removal of Hg from the liquid medium and the effect of the various pH and mercury concentrations in the environment on bacterial strains growth kinetics were tested. The selected strains were identified by analysis of the 16S ribosome subunit coding ...
46 CFR 201.125 - Attendance and mileage fees.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Attendance and mileage fees. 201.125 Section 201.125 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Subpoenas (Rule 12) § 201.125 Attendance and mileage fees. Persons attending...
In northern Kazakhstan, there is a serious case of mercury pollution near the city of Pavlodar from an old mercury cell chlor-alkali plant. The soil, sediment, and water is severely contaminated with mercury and mercury compounds as a result of the industrial activity of this ch...
Structural dynamic response of target container against proton beam
International Nuclear Information System (INIS)
Kikuchi, Kenji; Ishikura, Syuichi; Futakawa, Masatoshi; Hino, Ryutaro
1997-01-01
Stress waves were analyzed for a target container of neutron science research project using a high-intensity proton accelerator that generates high energy and high current proton beam. In the mercury target, the pulsed proton beam generates intense power density in the course of spallation reaction and causes pressure wave in the mercury and stress wave in the target container due to a sudden temperature change. Structural integrity of the target container depends on the power intensity at a maximum energy deposit. A broad proton profile is favorable to the structural assessment of the container rather than narrow one. Stress wave have propagated in the target container at a speed of sound. It only takes 0.1 ms for the size of 40 cm length stainless steel container. Further assessment is necessary to optimize a geometry of the container and establish a method to evaluate a life time. (author)
Structural dynamic response of target container against proton beam
Energy Technology Data Exchange (ETDEWEB)
Kikuchi, Kenji; Ishikura, Syuichi; Futakawa, Masatoshi; Hino, Ryutaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-11-01
Stress waves were analyzed for a target container of neutron science research project using a high-intensity proton accelerator that generates high energy and high current proton beam. In the mercury target, the pulsed proton beam generates intense power density in the course of spallation reaction and causes pressure wave in the mercury and stress wave in the target container due to a sudden temperature change. Structural integrity of the target container depends on the power intensity at a maximum energy deposit. A broad proton profile is favorable to the structural assessment of the container rather than narrow one. Stress wave have propagated in the target container at a speed of sound. It only takes 0.1 ms for the size of 40 cm length stainless steel container. Further assessment is necessary to optimize a geometry of the container and establish a method to evaluate a life time. (author)
Phytoremediation of Ionic and Methyl Mercury Pollution
Energy Technology Data Exchange (ETDEWEB)
Meagher, Richard B.
2004-12-01
Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems.
International Nuclear Information System (INIS)
Bruine, J.F. de.
1988-01-01
The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs
Genetic effects of organic mercury compounds
Energy Technology Data Exchange (ETDEWEB)
Ramel, C
1967-01-01
Organic mercury compounds have a c-mitotic effect on plant cells that cause polyploidi. Studies were performed on Allium root cells. These investigations involved methyl mercury dicyandiamide, methyl mercury hydroxide, and phenyl mercury hydroxide. The lowest concentration necessary for a cytologically observable effect was about 0.05 ppM Hg for the methyl compounds. For the phenyl compound, the value was lower. Experiments were performed on Drosophila melanogaster. The question was whether the mercury would reach the gonads. Experimental data with mercury treated larvae indicated a chromosome disjunction. Data indicated a preferential segregation at the meiotic division might be involved. Experiments are being performed on mice inbred (CBA) in order to investigate teratogenic effects and dominant lethality caused by organic mercury compounds. The mutagenic effects of these compounds are studied on Neurospora Drosophila. No conclusive data is now available.
Phytoremediation of Ionic and Methyl Mercury Pollution
Energy Technology Data Exchange (ETDEWEB)
Meagher, Richard B.
2005-06-01
Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to
MERCURY IN MARINE LIFE DATABASE
The purpose of the Mercury in Marine Life Project is to organize information on estuarine and marine species so that EPA can better understand both the extent of monitoring for mercury and level of mercury contamination in the biota of coastal environments. This report follows a ...
International Nuclear Information System (INIS)
Wilken, R.D.; Nitschke, F.; Falter, R.
2003-01-01
The HPLC-ICP-MS coupling technique is able to separate and detect methyl, ethyl and inorganic mercury isotopes specifically. An identification of ethyl mercury(+) is not possible when the widely used sodium tetraethylborate derivatisation method in combination with GC-AFS/AAS or ICP-MS techniques is performed because it contains ethyl groups. An unidentified compound with the same retention time as ethyl mercury was found in the HPLC chromatograms of industrial sewage samples and humic-rich soils of microcosm experiments after applying water vapour distillation. We also observed such unidentified peaks in samples of heavily contaminated sites in Eastern Germany, separated by HPLC fractionation only. In the experiments described, different mercury sulfur adducts were synthesised and tested for their retention times in the HPLC-ICP-MS system. It was found that the compound CH 3 -S-Hg + showed the same retention time as the ethyl mercury standard. It is therefore possible that ethyl mercury detected in chromatography by comparison of the retention time could also be due to an adduct of a sulfur compound and a mercury species. CH 3 -S-Hg + should be tested in other chromatographic mercury speciation methods for this effect. This work can also be regarded as a contribution to the discussion of artificially occurring methyl mercury in sediments during sample preparation. (orig.)
Advanced Gasification Mercury/Trace Metal Control with Monolith Traps
Energy Technology Data Exchange (ETDEWEB)
Musich, Mark; Swanson, Michael; Dunham, Grant; Stanislowski, Joshua
2010-10-05
Two Corning monoliths and a non-carbon-based material have been identified as potential additives for mercury capture in syngas at temperatures above 400°F and pressure of 600 psig. A new Corning monolith formulation, GR-F1-2189, described as an active sample appeared to be the best monolith tested to date. The Corning SR Liquid monolith concept continues to be a strong candidate for mercury capture. Both monolith types allowed mercury reduction to below 5-μg/m{sup 3} (~5 ppb), a current U.S. Department of Energy (DOE) goal for trace metal control. Preparation methods for formulating the SR Liquid monolith impacted the ability of the monolith to capture mercury. The Energy & Environmental Research Center (EERC)-prepared Noncarbon Sorbents 1 and 2 appeared to offer potential for sustained and significant reduction of mercury concentration in the simulated fuel gas. The Noncarbon Sorbent 1 allowed sustained mercury reduction to below 5-μg/m{sup 3} (~5 ppb). The non-carbon-based sorbent appeared to offer the potential for regeneration, that is, desorption of mercury by temperature swing (using nitrogen and steam at temperatures above where adsorption takes place). A Corning cordierite monolith treated with a Group IB metal offered limited potential as a mercury sorbent. However, a Corning carbon-based monolith containing prereduced metallic species similar to those found on the noncarbon sorbents did not exhibit significant or sustained mercury reduction. EERC sorbents prepared with Group IB and IIB selenide appeared to have some promise for mercury capture. Unfortunately, these sorbents also released Se, as was evidenced by the measurement of H2Se in the effluent gas. All sorbents tested with arsine or hydrogen selenide, including Corning monoliths and the Group IB and IIB metal-based materials, showed an ability to capture arsine or hydrogen selenide at 400°F and 600 psig. Based on current testing, the noncarbon metal-based sorbents appear to be the most
ADVANCED GASIFICATION MERCURY/TRACE METAL CONTROL WITH MONOLITH TRAPS
Energy Technology Data Exchange (ETDEWEB)
Mark A. Musich; Michael L. Swanson; Grant E. Dunham; Joshua J. Stanislowski
2010-07-31
Two Corning monoliths and a non-carbon-based material have been identified as potential additives for mercury capture in syngas at temperatures above 400°F and pressure of 600 psig. A new Corning monolith formulation, GR-F1-2189, described as an active sample appeared to be the best monolith tested to date. The Corning SR Liquid monolith concept continues to be a strong candidate for mercury capture. Both monolith types allowed mercury reduction to below 5-μg/m3 (~5 ppb), a current U.S. Department of Energy (DOE) goal for trace metal control. Preparation methods for formulating the SR Liquid monolith impacted the ability of the monolith to capture mercury. The Energy & Environmental Research Center (EERC)-prepared Noncarbon Sorbents 1 and 2 appeared to offer potential for sustained and significant reduction of mercury concentration in the simulated fuel gas. The Noncarbon Sorbent 1 allowed sustained mercury reduction to below 5-μg/m3 (~5 ppb). The non-carbon-based sorbent appeared to offer the potential for regeneration, that is, desorption of mercury by temperature swing (using nitrogen and steam at temperatures above where adsorption takes place). A Corning cordierite monolith treated with a Group IB metal offered limited potential as a mercury sorbent. However, a Corning carbon-based monolith containing prereduced metallic species similar to those found on the noncarbon sorbents did not exhibit significant or sustained mercury reduction. EERC sorbents prepared with Group IB and IIB selenide appeared to have some promise for mercury capture. Unfortunately, these sorbents also released Se, as was evidenced by the measurement of H2Se in the effluent gas. All sorbents tested with arsine or hydrogen selenide, including Corning monoliths and the Group IB and IIB metal-based materials, showed an ability to capture arsine or hydrogen selenide at 400°F and 600 psig. Based on current testing, the noncarbon metal-based sorbents appear to be the most effective arsine
Advanced Emissions Control Development Program: Mercury Control
International Nuclear Information System (INIS)
Evans, A.P.; Redinger, K.W.; Holmes, M.J.
1997-07-01
selenium and mercury, the majority of trace elements are well controlled due to their association with the particulate phase of flue gas. Reflecting the current focus of the US EPA and state environmental agencies on mercury as a potential candidate for regulation, the project specifically targets the measurement and control of mercury species. This paper discusses the results of testing on the quantity and species distribution of mercury while firing Ohio high-sulfur coal to assess the mercury emissions control potential of conventional SO 2 and particulate control systems. Results from recent AECDP tests are presented and two alternative mercury speciation methods are compared. The AECDP results clearly show that higher total mercury control efficiency can be achieved with a wet FGD scrubber than recently reported in the interim final US EPA report on HAP emissions from fossil-fired electric utility steam generating units
Studies on 201Th myocardial scintiscanning
International Nuclear Information System (INIS)
Buchner, U.
1979-01-01
The diagnostical evidence of myocardial scintiscanning with thallium-201 was tested on 98 patients with coronary heart disease. 2 mCi thallium-201 were injected into an arm vene and then scintigrams of the heart were registered partly with a scanner, partly with a gamma camera in several views. The healthy myocardium was found in the thallium-201-scintigram to be a rather homogeneous, horeshoe-shaped activity pattern with intramyocardial activity differences of up to 20% of the maximal thallium-201-activity above the myocard which can be declared to be physiological. In dependency on the local blood flow conditions, thallium-201 is stored only in the healthy, but not in the ischaemic or infarcted myocardium. In the scintigram, these regions are seen as regions with reduced radioactivity. A comparison of the localisation of the infarction in the scintigram with those in the electrocardiagram and coronary angiogram showed a good congrucucy. Scintigrams taken at different times after the infarction brought a decrease in the number of diagnosed storage failures, from 90% to 68% in infarctions older than 6 weeks. A scintigraphical differentiation between fresh and old infarctions was not possible. In cases of angiographically established coronary heart disease without infarction, pathological storage reductions were observed. By comparing the findings obtained by scintiscanning with the results of laevocardiography it was seen that hypokinetic regions in the thallium-201-myocardial scintigram showed in only 6% of the cases a pathological storage defect; akinetic, dyskinetic, and aneurysmatic regions, however, were seen in 65% of the cases as clear activity reductions or failures. (orig./MG) [de
AGS Spallation Target Experiment (ASTE) Collaboration
International Nuclear Information System (INIS)
Oyama, Yukio
1999-01-01
An experiment on mercury spallation target with high energy proton beam, called as the AGS Spallation Target Experiment (ASTE) Collaboration, has been performed at Alternating Gradient Synchrotron (AGS) of Brookhaven National Laboratory (BNL) in USA, in cooperation among the laboratories in Japan, Europe and USA. The experimental setup, scope and preliminary results are presented in the paper. (author)
4 CFR 201.9 - Restrictions on charging fees.
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Restrictions on charging fees. 201.9 Section 201.9 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.9... the news media. (2) The Board shall provide without charge to all but commercial users: (i) The first...
21 CFR 201.119 - In vitro diagnostic products.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false In vitro diagnostic products. 201.119 Section 201...) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.119 In vitro diagnostic products. (a) “In vitro diagnostic products” are those reagents, instruments and systems intended for use...
Malvandi, Hassan; Sari, Abbas Esmaili; Aliabadian, Mansour
2014-10-01
Total mercury concentrations were determined in muscle tissue of Khramulia (Capoeta capoeta) captured in the Cheshme Kile and Zarrin Gol Rivers, Iran. In Cheshme Kile River, 49 fish samples were collected. The mean total mercury concentration in the muscles of C. capoeta from this area was 249 ng g(-1) dw. In Zarrin Gol River, where 62 fish samples were collected, the total mercury in muscles averaged 164 ng g(-1) dw. A significant difference was found between means of mercury in the rivers (p rivers had mean mercury concentrations below the maximum allowable limits for mercury set by the Food and Agriculture Organization, World Health Organization, Standardization Administration of China and Environmental Protection Agency. The results of this study indicate that the values of hazard target quotient and estimated weekly intake are low and represent a negligible risk for human health.
Mercury pollution in Malaysia.
Hajeb, Parvaneh; Jinap, S; Ismail, Ahmad; Mahyudin, Nor Ainy
2012-01-01
Although several studies have been published on levels of mercury contamination of the environment, and of food and human tissues in Peninsular Malaysia, there is a serious dearth of research that has been performed in East Malaysia (Sabah and Sarawak). Industry is rapidly developing in East Malaysia, and, hence, there is a need for establishing baseline levels of mercury contamination in environmental media in that part of the country by performing monitoring studies. Residues of total mercury and inorganic in food samples have been determined in nearly all previous studies that have been conducted; however, few researchers have analyzed samples for the presence of methlymercury residues. Because methylmercury is the most toxic form of mercury, and because there is a growing public awareness of the risk posed by methylmercury exposure that is associated with fish and seafood consumption, further monitoring studies on methylmercury in food are also essential. From the results of previous studies, it is obvious that the economic development in Malaysia, in recent years, has affected the aquatic environment of the country. Primary areas of environmental concern are centered on the rivers of the west Peninsular Malaysian coast, and the coastal waters of the Straits of Malacca, wherein industrial activities are rapidly expanding. The sources of existing mercury input to both of these areas of Malaysia should be studied and identified. Considering the high levels of mercury that now exists in human tissues, efforts should be continued, and accelerated in the future, if possible, to monitor mercury contamination levels in the coastal states, and particularly along the west Peninsular Malaysian coast. Most studies that have been carried out on mercury residues in environmental samples are dated, having been conducted 20-30 years ago; therefore, the need to collect much more and more current data is urgent. Furthermore, establishing baseline levels of mercury exposure to
Mercury Information Clearinghouse
Energy Technology Data Exchange (ETDEWEB)
Chad A. Wocken; Michael J. Holmes; Dennis L. Laudal; Debra F. Pflughoeft-Hassett; Greg F. Weber; Nicholas V. C. Ralston; Stanley J. Miller; Grant E. Dunham; Edwin S. Olson; Laura J. Raymond; John H. Pavlish; Everett A. Sondreal; Steven A. Benson
2006-03-31
The Canadian Electricity Association (CEA) identified a need and contracted the Energy & Environmental Research Center (EERC) to create and maintain an information clearinghouse on global research and development activities related to mercury emissions from coal-fired electric utilities. With the support of CEA, the Center for Air Toxic Metals{reg_sign} (CATM{reg_sign}) Affiliates, and the U.S. Department of Energy (DOE), the EERC developed comprehensive quarterly information updates that provide a detailed assessment of developments in the various areas of mercury monitoring, control, policy, and research. A total of eight topical reports were completed and are summarized and updated in this final CEA quarterly report. The original quarterly reports can be viewed at the CEA Web site (www.ceamercuryprogram.ca). In addition to a comprehensive update of previous mercury-related topics, a review of results from the CEA Mercury Program is provided. Members of Canada's coal-fired electricity generation sector (ATCO Power, EPCOR, Manitoba Hydro, New Brunswick Power, Nova Scotia Power Inc., Ontario Power Generation, SaskPower, and TransAlta) and CEA, have compiled an extensive database of information from stack-, coal-, and ash-sampling activities. Data from this effort are also available at the CEA Web site and have provided critical information for establishing and reviewing a mercury standard for Canada that is protective of environment and public health and is cost-effective. Specific goals outlined for the CEA mercury program included the following: (1) Improve emission inventories and develop management options through an intensive 2-year coal-, ash-, and stack-sampling program; (2) Promote effective stack testing through the development of guidance material and the support of on-site training on the Ontario Hydro method for employees, government representatives, and contractors on an as-needed basis; (3) Strengthen laboratory analytical capabilities through
48 CFR 218.201 - Contingency operation.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contingency operation. 218... Flexibilities 218.201 Contingency operation. (1) Selection, appointment, and termination of appointment... in a contingency contracting force. See 201.603-2(2). (2) Policy for unique item identification...
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reports. 419.201-73... SMALL BUSINESS PROGRAMS Policies 419.201-73 Reports. The Director, OSDBU, shall be responsible for submitting reports concerning USDA's progress and achievements in the procurement preference program. ...
A high-power target experiment
Kirk, H G; Ludewig, H; Palmer, Robert; Samulyak, V; Simos, N; Tsang, Thomas; Bradshaw, T W; Drumm, Paul V; Edgecock, T R; Ivanyushenkov, Yury; Bennett, Roger; Efthymiopoulos, Ilias; Fabich, Adrian; Haseroth, H; Haug, F; Lettry, Jacques; Hayato, Y; Yoshimura, Koji; Gabriel, Tony A; Graves, Van; Spampinato, P; Haines, John; McDonald, Kirk T
2005-01-01
We describe an experiment designed as a proof-of-principle test for a target system capable of converting a 4 MW proton beam into a high-intensity muon beam suitable for incorporation into either a neutrino factory complex or a muon collider. The target system is based on exposing a free mercury jet to an intense proton beam in the presence of a high strength solenoidal field.
7 CFR 201.36c - Hermetically-sealed containers.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Hermetically-sealed containers. 201.36c Section 201... ACT FEDERAL SEED ACT REGULATIONS Advertising § 201.36c Hermetically-sealed containers. The 5-month... been met: (a) The seed was packaged within 9 months after harvest; (b) The container used does not...
7 CFR 868.201 - Definition of rough rice.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of rough rice. 868.201 Section 868.201... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Rough Rice Terms Defined § 868.201 Definition of rough rice. Rice (Oryza sativa L.) which consists of 50 percent or more of paddy kernels (see...
17 CFR 201.67 - Applications by legal guardians.
2010-04-01
... guardians. 201.67 Section 201.67 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES... Securities Exchange Act of 1934 § 201.67 Applications by legal guardians. An application pursuant to this... information that may be subject to a bounty payment, or by the parent or guardian of such a person if that...
Mercury recycling in the United States in 2000
Brooks, William E.; Matos, Grecia R.
2005-01-01
Reclamation and recycling of mercury from used mercury- containing products and treatment of byproduct mercury from gold mining is vital to the continued, though declining, use of this metal. Mercury is reclaimed from mercury-containing waste by treatment in multistep high-temperature retorts-the mercury is volatized and then condensed for purification and sale. Some mercury-containing waste, however, may be landfilled, and landfilled material represents loss of a recyclable resource and a threat to the environment. Related issues include mercury disposal and waste management, toxicity and human health, and regulation of mercury releases in the environment. End-users of mercury-containing products may face fines and prosecution if these products are improperly recycled or not recycled. Local and State environmental regulations require adherence to the Resource Conservation and Recovery Act and the Comprehensive Environmental Response, Compensation, and Liability Act to regulate generation, treatment, and disposal of mercury-containing products. In the United States, several large companies and a number of smaller companies collect these products from a variety of sources and then reclaim and recycle the mercury. Because mercury has not been mined as a principal product in the United States since 1992, mercury reclamation from fabricated products has become the main source of mercury. Principal product mercury and byproduct mercury from mining operations are considered to be primary materials. Mercury may also be obtained as a byproduct from domestic or foreign gold-processing operations. In the early 1990s, U.S. manufacturers used an annual average that ranged from 500 to 600 metric tons of recycled and imported mercury for fabrication of automobile convenience switches, dental amalgam, fluorescent lamps, medical uses and thermometers, and thermostats. The amount now used for fabrication is estimated to be 200 metric tons per year or less. Much of the data on
Quarter 9 Mercury information clearinghouse final report
Energy Technology Data Exchange (ETDEWEB)
Laudal, D.L.; Miller, S.; Pflughoeft-Hassett, D.; Ralston, N.; Dunham, G.; Weber, G.
2005-12-15
The Canadian Electricity Association (CEA) identified a need and contracted the Energy & Environmental Research Center (EERC) to create and maintain an information clearinghouse on global research and development activities related to mercury emissions from coal-fired electric utilities. A total of eight reports were completed and are summarized and updated in this final CEA quarterly report. Selected topics were discussed in detail in each quarterly report. Issues related to mercury from coal-fired utilities include the general areas of measurement, control, policy, and transformations. Specific topics that have been addressed in previous quarterly reports include the following: Quarterly 1 - Sorbent Control Technologies for Mercury Control; Quarterly 2 - Mercury Measurement; Quarterly 3 - Advanced and Developmental Mercury Control Technologies; Quarterly 4 - Prerelease of Mercury from Coal Combustion By-Products; Quarterly 5 - Mercury Fundamentals; Quarterly 6 - Mercury Control Field Demonstrations; Quarterly 7 - Mercury Regulations in the United States: Federal and State; and Quarterly 8 - Commercialization Aspects of Sorbent Injection Technologies in Canada. In this last of nine quarterly reports, an update of these mercury issues is presented that includes a summary of each topic, with recent information pertinent to advances made since the quarterly reports were originally presented. In addition to a comprehensive update of previous mercury-related topics, a review of results from the CEA Mercury Program is provided. 86 refs., 11 figs., 8 tabs.
Phytoremediation of Ionic and Methyl Mercury Pollution
Energy Technology Data Exchange (ETDEWEB)
Meagher, Richard B.
2005-06-01
Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to
Minamata Convention on Mercury
On November 6, 2013 the United States signed the Minamata Convention on Mercury, a new multilateral environmental agreement that addresses specific human activities which are contributing to widespread mercury pollution
Intake of mercury through fish consumption
International Nuclear Information System (INIS)
Sarmani, S.B.; Kiprawi, A.Z.; Ismail, R.B.; Hassan, R.B.; Wood, A.K.; Rahman, S.A.
1995-01-01
Fish has been known as a source of non-occupational mercury exposure to fish consuming population groups, and this is shown by the high hair mercury levels. In this study, hair samples collected from fishermen and their families, and commercial marine fishes were analyzed for mercury and methylmercury by neutron activation and gas chromatography. The results showed a correlation between hair mercury levels and fish consumption patterns. The levels of mercury found in this study were similar to those reported by other workers for fish consuming population groups worldwide. (author)
Total Mercury content of skin toning creams
African Journals Online (AJOL)
Administrator
2008-04-01
Apr 1, 2008 ... used it for cosmetics (Silberberg, 1995). Mercury- ... Cosmetic preparations containing mercury com- pounds are .... mercury determination by a modified version of an open .... level mercury exposure, which could lead to a.
19 CFR 201.205 - Salary adjustments.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Salary adjustments. 201.205 Section 201.205 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt... of coverage, or a change in coverage, under a Federal benefits program requiring periodic deductions...
45 CFR 201.11 - Personnel merit system review.
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Personnel merit system review. 201.11 Section 201... STATES FOR PUBLIC ASSISTANCE PROGRAMS Review and Audits § 201.11 Personnel merit system review. A personnel merit system review is carried out by the Office of State Merit Systems of the Office of the...
Ackerman, Joshua T; Kraus, Tamara E C; Fleck, Jacob A; Krabbenhoft, David P; Horwath, William R; Bachand, Sandra M; Herzog, Mark P; Hartman, C Alex; Bachand, Philip A M
2015-05-19
Mercury pollution is widespread globally, and strategies for managing mercury contamination in aquatic environments are necessary. We tested whether coagulation with metal-based salts could remove mercury from wetland surface waters and decrease mercury bioaccumulation in fish. In a complete randomized block design, we constructed nine experimental wetlands in California's Sacramento-San Joaquin Delta, stocked them with mosquitofish (Gambusia affinis), and then continuously applied agricultural drainage water that was either untreated (control), or treated with polyaluminum chloride or ferric sulfate coagulants. Total mercury and methylmercury concentrations in surface waters were decreased by 62% and 63% in polyaluminum chloride treated wetlands and 50% and 76% in ferric sulfate treated wetlands compared to control wetlands. Specifically, following coagulation, mercury was transferred from the filtered fraction of water into the particulate fraction of water which then settled within the wetland. Mosquitofish mercury concentrations were decreased by 35% in ferric sulfate treated wetlands compared to control wetlands. There was no reduction in mosquitofish mercury concentrations within the polyaluminum chloride treated wetlands, which may have been caused by production of bioavailable methylmercury within those wetlands. Coagulation may be an effective management strategy for reducing mercury contamination within wetlands, but further studies should explore potential effects on wetland ecosystems.
Ackerman, Joshua T.; Kraus, Tamara E.C.; Fleck, Jacob A.; Krabbenhoft, David P.; Horwarth, William R.; Bachand, Sandra M.; Herzog, Mark; Hartman, Christopher; Bachand, Philip A.M.
2015-01-01
Mercury pollution is widespread globally, and strategies for managing mercury contamination in aquatic environments are necessary. We tested whether coagulation with metal-based salts could remove mercury from wetland surface waters and decrease mercury bioaccumulation in fish. In a complete randomized block design, we constructed nine experimental wetlands in California’s Sacramento–San Joaquin Delta, stocked them with mosquitofish (Gambusia affinis), and then continuously applied agricultural drainage water that was either untreated (control), or treated with polyaluminum chloride or ferric sulfate coagulants. Total mercury and methylmercury concentrations in surface waters were decreased by 62% and 63% in polyaluminum chloride treated wetlands and 50% and 76% in ferric sulfate treated wetlands compared to control wetlands. Specifically, following coagulation, mercury was transferred from the filtered fraction of water into the particulate fraction of water which then settled within the wetland. Mosquitofish mercury concentrations were decreased by 35% in ferric sulfate treated wetlands compared to control wetlands. There was no reduction in mosquitofish mercury concentrations within the polyaluminum chloride treated wetlands, which may have been caused by production of bioavailable methylmercury within those wetlands. Coagulation may be an effective management strategy for reducing mercury contamination within wetlands, but further studies should explore potential effects on wetland ecosystems.
Determination of mercury in plant material
Energy Technology Data Exchange (ETDEWEB)
Pickard, J A; Martin, J T
1960-07-01
An analytical procedure used for the determination of traces of mercury in plant material is described. The conditions of combustion of organic matter are controlled to avoid loss of mercury and EDTA is used to reduce the values for apparent mercury on uncontaminated samples. Satisfactory recoveries of mercury added to apples, tomatoes and coffee are obtained. 10 references, 1 table.
Duan, Zhen-ya; Su, Hai-tao; Wang, Feng-yang; Zhang, Lei; Wang, Shu-xiao; Yu, Bin
2016-02-15
Waste incineration is one of the important atmospheric mercury emission sources. The aim of this article is to explore the atmospheric mercury pollution level of waste incineration industry from Chongqing. This study investigated the mercury emissions from a municipal solid waste incineration plant and a medical waste incineration plant in Chongqing. The exhaust gas samples in these two incineration plants were obtained using USA EPA 30B method. The mercury concentrations in the fly ash and bottom ash samples were analyzed. The results indicated that the mercury concentrations of the municipal solid waste and medical waste incineration plant in Chongqing were (26.4 +/- 22.7) microg x m(-3) and (3.1 +/- 0.8) microg x m(-3) in exhaust gas respectively, (5279.2 +/- 798.0) microg x kg(-1) and (11,709.5 +/- 460.5) microg x kg(-1) in fly ash respectively. Besides, the distribution proportions of the mercury content from municipal solid waste and medical waste in exhaust gas, fly ash, and bottom ash were 34.0%, 65.3%, 0.7% and 32.3%, 67.5%, 0.2% respectively; The mercury removal efficiencies of municipal solid waste and medical waste incineration plants were 66.0% and 67.7% respectively. The atmospheric mercury emission factors of municipal solid waste and medical waste incineration plants were (126.7 +/- 109.0) microg x kg(-1) and (46.5 +/- 12.0) microg x kg(-1) respectively. Compared with domestic municipal solid waste incineration plants in the Pearl River Delta region, the atmospheric mercury emission factor of municipal solid waste incineration plant in Chongqing was lower.
International Nuclear Information System (INIS)
Conley, T.B.; Morris, M.I.; Holmes-Burns, H.; Petersell, J.; Schwendiman, L.
1997-01-01
In May 1996, the U.S. Department of Energy (DOE) Mixed Waste Focus Area (MWFA) initiated the Mercury Work Group (HgWG), which was established to address and resolve the issues associated with mercury- contaminated mixed wastes. Three of the first four technology deficiencies identified during the MWFA technical baseline development process were related to mercury amalgamation, stabilization, and separation/removal. The HgWG will assist the MWFA in soliciting, identifying, initiating, and managing all the efforts required to address these deficiencies. The focus of the HgWG is to better establish the mercury-related treatment needs at the DOE sites, refine the MWFA technical baseline as it relates to mercury treatment, and make recommendations to the MWFA on how to most effectively address these needs. The team will initially focus on the sites with the most mercury-contaminated mixed wastes, whose representatives comprise the HgWG. However, the group will also work with the sites with less inventory to maximize the effectiveness of these efforts in addressing the mercury- related needs throughout the entire complex
Atmospheric mercury footprints of nations.
Liang, Sai; Wang, Yafei; Cinnirella, Sergio; Pirrone, Nicola
2015-03-17
The Minamata Convention was established to protect humans and the natural environment from the adverse effects of mercury emissions. A cogent assessment of mercury emissions is required to help implement the Minamata Convention. Here, we use an environmentally extended multi-regional input-output model to calculate atmospheric mercury footprints of nations based on upstream production (meaning direct emissions from the production activities of a nation), downstream production (meaning both direct and indirect emissions caused by the production activities of a nation), and consumption (meaning both direct and indirect emissions caused by final consumption of goods and services in a nation). Results show that nations function differently within global supply chains. Developed nations usually have larger consumption-based emissions than up- and downstream production-based emissions. India, South Korea, and Taiwan have larger downstream production-based emissions than their upstream production- and consumption-based emissions. Developed nations (e.g., United States, Japan, and Germany) are in part responsible for mercury emissions of developing nations (e.g., China, India, and Indonesia). Our findings indicate that global mercury abatement should focus on multiple stages of global supply chains. We propose three initiatives for global mercury abatement, comprising the establishment of mercury control technologies of upstream producers, productivity improvement of downstream producers, and behavior optimization of final consumers.
Does mercury vapor exposure increase urinary selenium excretion
Energy Technology Data Exchange (ETDEWEB)
Hongo, T; Suzuki, T; Himeno, S; Watanabe, C; Satoh, H; Shimada, Y
1985-01-01
It has been reported that an increase of urinary selenium excretion may occur as a result of mercury vapor exposure. However, experimental data regarding the interaction between mercury vapor and selenium have yielded ambiguous results about the retention and elimination of selenium due to mercury vapor exposure and the decrease of selenium excretion due to mercury in the form of mercuric mercury (Hg/sup 2 +/). In this study, the authors measured urinary mercury and selenium in workers with or without exposure to mercury vapor to determine whether or not urinary selenium excretion was increased as a result of mercury vapor exposure. Urine samples were collected from 141 workers, 71 men and 70 women, whose extent of exposure to mercury vapor varied according to their job sites. Workers were divided into five groups according to their urinary mercury levels. The mercury level in group I was less than 2.8 nmol/mmol creatinine which means that this group was mostly free from mercury exposure. The average age was almost identical among the groups. For both sexes, group V (with the highest urinary mercury level) had the lowest urinary selenium level, but one-way variance analysis (ANOVA) did not reveal any significant variations of urinary selenium with urinary mercury levels; however, a weak but significant negative correlation between mercury and selenium was found in men.
Isolation, screening and identification of mercury resistant bacteria from mercury contaminated soil
Directory of Open Access Journals (Sweden)
Kowalczyk Anna
2016-01-01
Full Text Available New bacterial strains resistant to high concentration of mercury were obtained and character iz ed focusing on their potential application in bioremediation. The biological material was isolated from soil contaminated with mercury. The ability to removal of Hg from the liquid medium and the effect of the various pH and mercury concentrations in the environment on bacterial strains growth kinetics were tested. The selected strains were identified by analysis of the 16S ribosome subunit coding sequenc es as Pseudomonas syringae. The analysis of Hg concentration in liquid medium as effect of microbial metabolism demonstrated that P. syringae is able to remove almost entire metal from medium after 120 hours of incubation. Obtained results revealed new ability of the isolated strain P. syringae. Analyzed properties of this soil bacteria species able to reduce concentration of Hg ors immobi lize this metal are promising for industrial wastewater treatment and bioremediation of the soils polluted especially by mercury lamps scrapping, measuring instruments, dry batteries, detonators or burning fuels made from crude oil, which may also contain mercury. Selected bacteria strains provide efficient and relatively low-cost bioremediation of the areas and waters contaminated with Hg.
Occupational Metallic Mercury Poisoning in Gilders
Directory of Open Access Journals (Sweden)
M Vahabzadeh
2016-04-01
Full Text Available Occupational exposure to elemental mercury vapor usually occurs through inhalation during its utilizations. This leads to a variety of adverse health effects. In some Islamic cities, this type of poisoning may occur during gilding of shrines using elemental mercury with gold. Herein, we report on three male patients aged 20–53 years, who were diagnosed with occupational metallic mercury poisoning due to gilding of a shrine. All patients presented with neuro-psychiatric disorders such as anxiety, loss of memory and concentration, and sleep disorders with high urinary mercury concentrations of 326–760 μg/L upon referring, 3–10 days after cessation of elemental mercury exposure. Following chelating therapy, the patients recovered clinically and their mercury concentrations declined to non-toxic level (<25 μg/L. Health, environmental and labor authorities, as well as the gilders should be aware of the toxicity risk of exposure to metalic mercury during gilding in closed environments and act accordingly.
International Nuclear Information System (INIS)
Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Marcus, A.H.; Mushak, P.; Hall, L.L.
1986-01-01
At 56 days of age, male and female Long-Evans rats received 1 μmole of 203 Hg-labeled mercuric chloride per kilogram sc and total, organic, and inorganic mercury contents and concentrations in tissues were determined for up to 98 days postdosing. When expressed on a concentration basis, the only significant sexual difference was in the higher average concentration of organic mercury in the kidneys of females. When expressed on a tissue content basis, significant male-female differences in the kinetics (sex x time interactions) of organic mercury retention were found in kidney, brain, skeletal muscle, pelt, and whole body. Significant sex x time interactions in the concentrations of organic mercury were found in kidney, skeletal muscle, and whole body. Kinetics of retention and concentration of inorganic Hg in the pelt differed significantly for males and females. Discordance of degree of statistical significance of differences in mercury contents and concentrations reflected in part differences in relative body composition of males and females. Differences in integrated exposure were estimated by the female-to-male ratio of areas under retention curves. Reconstruction of whole body organic and inorganic mercury burdens from constituent tissues indicated that integrated exposures of males and females to inorganic mercury were equal but females had a lower integrated exposure to organic mercury. Integrated exposure of liver to either form of mercury was about equal in males and females. However, the integrated exposure of the brain of females to inorganic mercury was 2.19 times that of males suggest'ing a sexual difference in accumulation or retention of inorganic mercury in the nervous system
Mechanisms of thallium-201 accumulation to thyroid gland
International Nuclear Information System (INIS)
Kishida, Toshihiro
1987-01-01
In this study 91 patients with goiter were scintigraphed for the duration of 84 minutes after intravenous administration of thallium-201 by digital γ camera lined to computer data system. Regions of interest (ROIs) were assigned for thyroid tumor, normal thyroid and back ground, and time-activity curves (TACs) were generated from these ROIs. Na + , K + -ATPase activity of microsome fraction from thyroid tumor and the normal thyroid glands was determined. The first 15 minutes accumulation of each ROI was determined as the early accumulation of thallium-201 for tumor and the normal thyroid glands. Papillary and follicular carcinomas, showing the high accumulation of thallium-201, had high activity of Na + , K + -ATPase. Microfollicular adenomas had high activity of Na + , K + -ATPase and demonstrated intense accumulation of thallium-201. However, colloid adenoma had a similar level of Na + , K + -ATPase activity to that of the normal thyroid glands and did not demonstrate radionuclide accumulation. Consequently, radionuclide accumulation in thallium-201 thyroid scintigraphy was closely correlated to Na + , K + -ATPase activity of thyroid tumor. Thyroid blood flow was measured by hydrogen gas clearance method. Thyroid blood flow of papillary carcinoma was smaller, as compared with normal thyroid blood flow. TAC of papillary carcinoma showed flattening. Thallium-201 accumulation in early image was also found to correspond to thyroid blood flow. From this study we can conclude that mechanisms of thallium-201 accumulation in a thyroid tumor depends on Na + , K + -ATPase activity and thyroid blood flow. Washout of TAC in thallium-201 scintigraphy appears dependent on blood flow of a thyroid nodule. (author)
14 CFR 201.1 - Formal requirements.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Formal requirements. 201.1 Section 201.1 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... papers. (b) Any person desiring to provide air transportation as a commuter air carrier must comply with...
Energy Technology Data Exchange (ETDEWEB)
Chen, Jinfeng; Tang, Juan; Zhou, Jun; Zhang, Lan; Chen, Guonan; Tang, Dianping, E-mail: dianping.tang@fzu.edu.cn
2014-01-31
Graphical abstract: -- Highlights: •We report a new electrochemical sensing protocol for the detection of mercury ion. •Gold amalgamation on DNA-based sensing platform was used as nanocatalyst. •The signal was amplified by cycling signal amplification strategy. -- Abstract: Heavy metal ion pollution poses severe risks in human health and environmental pollutant, because of the likelihood of bioaccumulation and toxicity. Driven by the requirement to monitor trace-level mercury ion (Hg{sup 2+}), herein we construct a new DNA-based sensor for sensitive electrochemical monitoring of Hg{sup 2+} by coupling target-induced formation of gold amalgamation on DNA-based sensing platform with gold amalgamation-catalyzed cycling signal amplification strategy. The sensor was simply prepared by covalent conjugation of aminated poly-T{sub (25)} oligonucleotide onto the glassy carbon electrode by typical carbodiimide coupling. Upon introduction of target analyte, Hg{sup 2+} ion was intercalated into the DNA polyion complex membrane based on T–Hg{sup 2+}–T coordination chemistry. The chelated Hg{sup 2+} ion could induce the formation of gold amalgamation, which could catalyze the p-nitrophenol with the aid of NaBH{sub 4} and Ru(NH{sub 3}){sub 6}{sup 3+} for cycling signal amplification. Experimental results indicated that the electronic signal of our system increased with the increasing Hg{sup 2+} level in the sample, and has a detection limit of 0.02 nM with a dynamic range of up to 1000 nM Hg{sup 2+}. The strategy afforded exquisite selectivity for Hg{sup 2+} against other environmentally related metal ions. In addition, the methodology was evaluated for the analysis of Hg{sup 2+} in spiked tap-water samples, and the recovery was 87.9–113.8%.
Thallium-201 scintigraphy in complete left bundle branch block
Energy Technology Data Exchange (ETDEWEB)
Hirzel, H.O.; Senn, M.; Nuesch, K.; Buettner, C.; Pfeiffer, A.; Hess, O.M.; Krayenbuehl, H.P.
1984-03-01
Nineteen symptomatic patients with left bundle branch block (LBBB) were examined by thallium-201 (TI-201) exercise scintigraphy and selective coronary arteriography. All elicited significant anteroseptal perfusion defects in the exercise scintigrams, but in only 4 was coronary artery disease (CAD) involving the left anterior descending coronary artery present. To further elucidate the effect of LBBB on septal TI-201 uptake in the absence of CAD, TI-201 scintigrams combined with regional myocardial blood flow measurements using radioactive microspheres were carried out in 7 dogs during right atrial and right ventricular pacing (LBBB in the ECG) at similar heart rates. During right atrial pacing, TI-201 uptake was homogeneous in the entire left ventricle, as were tissue flows. During right ventricular pacing, TI-201 activity was reduced to 69% of maximal TI-201 activity within the septum, whereas it averaged 90% in the lateral wall (p less than 0.05) in 6 dogs. Correspondingly, regional myocardial blood flow was lower within the septum as compared with that in the lateral wall, averaging 89 and 120 ml/min/100 g, respectively (p less than 0.005). In 1 dog, normal TI-201 distribution and tissue flows were found in both studies. Thus, symptomatic patients with LBBB may elicit abnormal TI-201 exercise scintigrams, suggesting anteroseptal ischemia despite normal coronary arteries. The electrical induction of LBBB in dogs results, in most instances, in a comparable reduction in septal TI-201 uptake associated with diminished septal blood flow. Therefore, exercise-induced septal perfusion defects in the presence of LBBB do not necessarily indicate CAD even in symptomatic patients, but may reflect functional ischemia due to asynchronous septal contraction.
Mercury cycling in a wastewater treatment plant treating waters with high mercury contents.
García-Noguero, Eva M.; García-Noguero, Carolina; Higueras, Pablo; Reyes-Bozo, Lorenzo; Esbrí, José M.
2015-04-01
The Almadén mercury mining district has been historically the most important producer of this element since Romans times to 2004, when both mining and metallurgic activities ceased as a consequence both of reserves exhaustion and persistent low prices for this metal. The reclamation of the main dump of the mine in 2007-2008 reduced drastically the atmospheric presence of the gaseous mercury pollutant in the local atmosphere. But still many areas, and in particular in the Almadén town area, can be considered as contaminated, and produce mercury releases that affect the urban residual waters. Two wastewater treatment plants (WWTP) where built in the area in year 2002, but in their design the projects did not considered the question of high mercury concentrations received as input from the town area. This communication presents data of mercury cycling in one of the WWTP, the Almadén-Chillón one, being the larger and receiving the higher Hg concentrations, due to the fact that it treats the waters coming from the West part of the town, in the immediate proximity to the mine area. Data were collected during a number of moments of activity of the plant, since April 2004 to nowadays. Analyses were carried out by means of cold vapor-atomic fluorescence spectroscopy (CV-AFS), using a PSA Millennium Merlin analytical device with gold trap. The detection limit is 0.1 ng/l. The calibration standards are prepared using the Panreac ICP Standard Mercury Solution (1,000±0,002 g/l Hg in HNO3 2-5%). Results of the surveys indicate that mercury concentrations in input and output waters in this plant has suffered an important descent since the cessation of mining and metallurgical activities, and minor reduction also after the reclamation of the main mine's dump. Since 2009, some minor seasonal variations are detected, in particular apparently related to accumulation during summer of mercury salts and particles, which are washed to the plant with the autumn's rains. Further
Maternal transfer of mercury to songbird eggs.
Ackerman, Joshua T; Hartman, C Alex; Herzog, Mark P
2017-11-01
We evaluated the maternal transfer of mercury to eggs in songbirds, determined whether this relationship differed between songbird species, and developed equations for predicting mercury concentrations in eggs from maternal blood. We sampled blood and feathers from 44 house wren (Troglodytes aedon) and 34 tree swallow (Tachycineta bicolor) mothers and collected their full clutches (n = 476 eggs) within 3 days of clutch completion. Additionally, we sampled blood and feathers from 53 tree swallow mothers and randomly collected one egg from their clutches (n = 53 eggs) during mid to late incubation (6-10 days incubated) to evaluate whether the relationship varied with the timing of sampling the mother's blood. Mercury concentrations in eggs were positively correlated with mercury concentrations in maternal blood sampled at (1) the time of clutch completion for both house wrens (R 2 = 0.97) and tree swallows (R 2 = 0.97) and (2) during mid to late incubation for tree swallows (R 2 = 0.71). The relationship between mercury concentrations in eggs and maternal blood did not differ with the stage of incubation when maternal blood was sampled. Importantly, the proportion of mercury transferred from mothers to their eggs decreased substantially with increasing blood mercury concentrations in tree swallows, but increased slightly with increasing blood mercury concentrations in house wrens. Additionally, the proportion of mercury transferred to eggs at the same maternal blood mercury concentration differed between species. Specifically, tree swallow mothers transferred 17%-107% more mercury to their eggs than house wren mothers over the observed mercury concentrations in maternal blood (0.15-1.92 μg/g ww). In contrast, mercury concentrations in eggs were not correlated with those in maternal feathers and, likewise, mercury concentrations in maternal blood were not correlated with those in feathers (all R 2 mercury concentrations from maternal blood to eggs
Mercury in the environment : a primer
Energy Technology Data Exchange (ETDEWEB)
Lourie, B; Glenn, W [ed.; Ogilvie, K; Everhardus, E; Friesen, K; Rae, S
2003-06-01
This report provides an overview of the occurrence and effects of mercury in the environment and its impacts on human health. Low levels of mercury occur naturally everywhere in the environment in plants, animals, rocks and air. Incidental emissions occur when natural mercury is released to the environment through human activity. In Canada, coal burning and metal processing are the two largest point sources of atmospheric mercury emissions. Energy facilities have the option to invest in expensive control technologies for coal plants, or they can generate electricity from alternative energy sources. Energy conservation, however, offers the greatest overall benefits for the environment and the public. Mercury can also be released when products containing mercury (such as electrical switches, thermostats, dental amalgam, and thermometers) are broken while in use, or when they are crushed in garbage trucks and dumped in landfills. Source separation is the best way to reduce waste-related emissions. Once mercury is released to the natural environment, it can be transported long distances through air or watercourses. It is volatile, therefore evaporates readily to the atmosphere where it may do one of three things: it may fall out near the point where it was emitted; it may be transported long distances to some point downwind; or, it may enter the global atmospheric mercury pool where it will circle the globe for a year or more within the Earth's major weather systems before being deposited. Data from Canada's National Pollutant Release Inventory indicates that mercury releases and transfers total 28,674 kg per year. The most critical component of the mercury cycle is the conversion of inorganic forms of mercury to the organic compound methylmercury which is more toxic to humans. Most concern about mercury focuses on lakes and other aquatic ecosystems. Fish in hydroelectric reservoirs have been found to contain elevated methylmercury levels because natural mercury in the
Mercury Poisoning Linked to Skin Products
... Products For Consumers Home For Consumers Consumer Updates Mercury Poisoning Linked to Skin Products Share Tweet Linkedin ... and, in some situations, criminal prosecution. Dangers of Mercury Exposure to mercury can have serious health consequences. ...
24 CFR 3285.201 - Soil conditions.
2010-04-01
... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Soil conditions. 3285.201 Section 3285.201 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MODEL MANUFACTURED HOME...
Basic Information about Mercury
... or metallic mercury is a shiny, silver-white metal and is liquid at room temperature. It is ... releases can happen naturally. Both volcanoes and forest fires send mercury into the atmosphere. Human activities, however, ...
Steffen, A.; Ferrari, C.; Dommergue, A.; Scherz, T.; Lawson, G.; Leiatch, R.
2006-12-01
Mercury is a known toxic pollutant in the Arctic environment. Atmospheric mercury depletion events (AMDEs) have been studied in the Arctic since 1995. While advances in understanding this newly discovered cycling of mercury in the atmosphere have been made, much of the chemistry and the impact of this annually reoccurring event to the Arctic ecosystem are not well understood. Four years of continuous measurements at Alert, Canada of so-called reactive gaseous mercury (RGM) and mercury associated to particles (PHg) coupled with ongoing snow sampling have produced new information on the atmospheric chemistry and deposition of these mercury species to the Arctic. A distinct pattern during the springtime period in the distribution of these atmospheric mercury species has emerged. This pattern is characterized by the predominance of PHg concentration at the onset of the AMDEs. During the latter part of the AMDE season, there is an obvious swicth in the speciation of mercury to RGM as the main component during AMDEs. This swicth from PHg to RGM is clearly linked to a significant increase of mercury in the snow. In addition, concentrations of PHg are clearly linked with particles in the air that are primarily associated with Arctic haze. Recently, similar results have also been observed in Ny-Alesund (Svalbard). Further observations indicate that once deposited, the deposited mercury appears to evolve chemically in the snow. This change in mercury may impact the transfer of mercury to the environment during snow melt. These first time observed links between atmospheric conditions and subsequent deposition of mercury may help to ascertain the conditions throughout the Arctic as to when significant deposition of mercury will occur. It is proposed that should the concentration of atmospheric particles increase in the Arctic due to long range transport from emission sources, an increase in the deposition of mercury to this environment will increase during the springtime
Mahoney, T J
2014-01-01
This gazetteer and atlas on Mercury lists, defines and illustrates every named (as opposed to merely catalogued) object and term as related to Mercury within a single reference work. It contains a glossary of terminology used, an index of all the headwords in the gazetteer, an atlas comprising maps and images with coordinate grids and labels identifying features listed in the gazetteer, and appendix material on the IAU nomenclature system and the transcription systems used for non-roman alphabets. This book is useful for the general reader, writers and editors dealing with astronomical themes, and those astronomers concerned with any aspect of astronomical nomenclature.
DEFF Research Database (Denmark)
Esteban, Marta; Schindler, Birgit K; Jiménez-Guerrero, José A
2015-01-01
Human biomonitoring (HBM) is an effective tool for assessing actual exposure to chemicals that takes into account all routes of intake. Although hair analysis is considered to be an optimal biomarker for assessing mercury exposure, the lack of harmonization as regards sampling and analytical...... assurance program (QAP) for assessing mercury levels in hair samples from more than 1800 mother-child pairs recruited in 17 European countries. To ensure the comparability of the results, standard operating procedures (SOPs) for sampling and for mercury analysis were drafted and distributed to participating...... laboratories. Training sessions were organized for field workers and four external quality-assessment exercises (ICI/EQUAS), followed by the corresponding web conferences, were organized between March 2011 and February 2012. ICI/EQUAS used native hair samples at two mercury concentration ranges (0...
7 CFR 201.26 - Kind, variety, and hybrid.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind, variety, and hybrid. 201.26 Section 201.26... REGULATIONS Labeling Vegetable Seeds § 201.26 Kind, variety, and hybrid. The label shall bear the name of each... kind or variety named on the label is “hybrid” seed, it shall be so designated on the label. If two or...
Coal fired flue gas mercury emission controls
International Nuclear Information System (INIS)
Wu, Jiang; Pan, Weiguo; Cao, Yan; Pan, Weiping
2015-01-01
Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of flue gas contents on the mercury speciation transformation process. Mercury emission control methods, such as existing APCDs (air pollution control devices) at power stations, sorbent injection, additives in coal combustion and photo-catalytic methods are introduced in detail. Lab-scale, pilot-scale and full-scale experimental studies of sorbent injection conducted by the authors are presented systematically, helping researchers and engineers to understand how this approach reduces the mercury emissions in flue gas and to apply the methods in mercury emission control at coal-fired power stations.
Coal fired flue gas mercury emission controls
Energy Technology Data Exchange (ETDEWEB)
Wu, Jiang; Pan, Weiguo [Shanghai Univ. of Electric Power (China); Cao, Yan; Pan, Weiping [Western Kentucky Univ., Bowling Green, KY (United States)
2015-05-01
Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of flue gas contents on the mercury speciation transformation process. Mercury emission control methods, such as existing APCDs (air pollution control devices) at power stations, sorbent injection, additives in coal combustion and photo-catalytic methods are introduced in detail. Lab-scale, pilot-scale and full-scale experimental studies of sorbent injection conducted by the authors are presented systematically, helping researchers and engineers to understand how this approach reduces the mercury emissions in flue gas and to apply the methods in mercury emission control at coal-fired power stations.
Mercury emission monitoring on municipal waste combustion
International Nuclear Information System (INIS)
Braun, H.; Gerig, A.
1991-01-01
In waste incineration, mercury is the only heavy metal to be released as a gas, mostly as mercury(II) chloride, because of its high volatility. Continuous emission monitoring is possible only when mercury occurs in its elemental form. This paper reports on various possibilities of converting Hg(II) into Hg(0) that has been studied and tested on a laboratory scale and in the TAMARA refuse incineration pilot facility. Continuous mercury emission measurement appears to be possible, provided mercury is converted in the flue gas condensate precipitated. The measuring results obtained on two municipal solid waste and on one sewage treatment sludge incineration plants show that the mercury monitor is a highly sensitive and selective continuously working instrument for mercury emission monitoring
Mercury Spill Responses - Five States, 2012-2015.
Wozniak, Ryan J; Hirsch, Anne E; Bush, Christina R; Schmitz, Stuart; Wenzel, Jeff
2017-03-17
Despite measures to educate the public about the dangers of elemental mercury, spills continue to occur in homes, schools, health care facilities, and other settings, endangering the public's health and requiring costly cleanup. Mercury is most efficiently absorbed by the lungs, and exposure to high levels of mercury vapor after a release can cause cough, sore throat, shortness of breath, nausea, vomiting, diarrhea, headaches, and visual disturbances (1). Children and fetuses are most susceptible to the adverse effects of mercury vapor exposure. Because their organ systems are still developing, children have increased respiratory rates, and they are closer to the ground where mercury vapors are most highly concentrated (2). To summarize key features of recent mercury spills and lessons learned, five state health departments involved in the cleanup (Iowa, Michigan, Missouri, North Carolina, and Wisconsin) compiled data from various sources on nonthermometer mercury spills from 2012 to 2015. The most common sites of contamination were residences, schools and school buses, health care facilities, and commercial and industrial facilities. Children aged mercury exposure. To protect the public's health after a mercury spill, it is important that local, state, and federal agencies communicate and coordinate effectively to ensure a quick response, and to minimize the spread of contamination. To reduce the number of mercury spills that occur in the United States, public health officials should increase awareness about exchange programs for mercury-containing items and educate school and health care workers about sources of mercury and how to dispose of them properly.
17 CFR 201.57 - Commission review.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission review. 201.57... Regulations Pertaining to the Equal Access to Justice Act § 201.57 Commission review. In accordance with the... Division of the Commission may seek review of the initial decision on the fee application, or the...
46 CFR 199.201 - Survival craft.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.201 Section 199.201 Shipping COAST... craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be... addition to the survival craft required in paragraph (b)(1) of this section, additional liferafts must be...
Effect of thallium-201 blood levels on reversible myocardial defects
International Nuclear Information System (INIS)
Nelson, C.W.; Wilson, R.A.; Angello, D.A.; Palac, R.T.
1989-01-01
To determine if 201 Tl plasma blood levels correlate with the presence of reversible myocardial defects during exercise testing, 14 patients with stable coronary artery disease underwent two separate exercise 201 Tl stress tests. Between initial and delayed imaging, on one test the patients drank an instant breakfast drink (eating) and on the other they drank an equivalent volume of water as a control (H 2 O). Thallium-201 imaging was performed immediately postexercise, immediately after eating/H 2 O and 210 min after eating/H 2 O. Between initial and immediate post eating/H 2 O images 201Tl reversible defects occurred in 27/38 regions in the H 2 O test versus 15/38 regions in the eating test (p = 0.02). Over this early time period, plasma 201 Tl activity was significantly higher in the H 2 O test than eating test (p less than 0.05). In conclusion, early reversal of 201 Tl defects may, in part, be the result of higher plasma 201 Tl activity early after initial postexercise 201 Tl imaging
Volcanic mercury in Pinus canariensis
Rodríguez Martín, José Antonio; Nanos, Nikos; Miranda, José Carlos; Carbonell, Gregoria; Gil, Luis
2013-08-01
Mercury (Hg) is a toxic element that is emitted to the atmosphere by both human activities and natural processes. Volcanic emissions are considered a natural source of mercury in the environment. In some cases, tree ring records taken close to volcanoes and their relation to volcanic activity over time are contradictory. In 1949, the Hoyo Negro volcano (La Palma-Canary Islands) produced significant pyroclastic flows that damaged the nearby stand of Pinus canariensis. Recently, 60 years after the eruption, we assessed mercury concentrations in the stem of a pine which survived volcano formation, located at a distance of 50 m from the crater. We show that Hg content in a wound caused by pyroclastic impacts (22.3 μg kg-1) is an order of magnitude higher than the Hg concentrations measured in the xylem before and after the eruption (2.3 μg kg-1). Thus, mercury emissions originating from the eruption remained only as a mark—in pyroclastic wounds—and can be considered a sporadic and very high mercury input that did not affect the overall Hg input in the xylem. In addition, mercury contents recorded in the phloem (9.5 μg kg-1) and bark (6.0 μg kg-1) suggest that mercury shifts towards non-living tissues of the pine, an aspect that can be related to detoxification in volcanism-adapted species.
Volcanic mercury in Pinus canariensis.
Rodríguez Martín, José Antonio; Nanos, Nikos; Miranda, José Carlos; Carbonell, Gregoria; Gil, Luis
2013-08-01
Mercury (Hg) is a toxic element that is emitted to the atmosphere by both human activities and natural processes. Volcanic emissions are considered a natural source of mercury in the environment. In some cases, tree ring records taken close to volcanoes and their relation to volcanic activity over time are contradictory. In 1949, the Hoyo Negro volcano (La Palma-Canary Islands) produced significant pyroclastic flows that damaged the nearby stand of Pinus canariensis. Recently, 60 years after the eruption, we assessed mercury concentrations in the stem of a pine which survived volcano formation, located at a distance of 50 m from the crater. We show that Hg content in a wound caused by pyroclastic impacts (22.3 μg kg(-1)) is an order of magnitude higher than the Hg concentrations measured in the xylem before and after the eruption (2.3 μg kg(-1)). Thus, mercury emissions originating from the eruption remained only as a mark-in pyroclastic wounds-and can be considered a sporadic and very high mercury input that did not affect the overall Hg input in the xylem. In addition, mercury contents recorded in the phloem (9.5 μg kg(-1)) and bark (6.0 μg kg(-1)) suggest that mercury shifts towards non-living tissues of the pine, an aspect that can be related to detoxification in volcanism-adapted species.
Dissolved gaseous mercury formation and mercury volatilization in intertidal sediments.
Cesário, Rute; Poissant, Laurier; Pilote, Martin; O'Driscoll, Nelson J; Mota, Ana M; Canário, João
2017-12-15
Intertidal sediments of Tagus estuary regularly experiences complex redistribution due to tidal forcing, which affects the cycling of mercury (Hg) between sediments and the water column. This study quantifies total mercury (Hg) and methylmercury (MMHg) concentrations and fluxes in a flooded mudflat as well as the effects on water-level fluctuations on the air-surface exchange of mercury. A fast increase in dissolved Hg and MMHg concentrations was observed in overlying water in the first 10min of inundation and corresponded to a decrease in pore waters, suggesting a rapid export of Hg and MMHg from sediments to the water column. Estimations of daily advective transport exceeded the predicted diffusive fluxes by 5 orders of magnitude. A fast increase in dissolved gaseous mercury (DGM) concentration was also observed in the first 20-30min of inundation (maximum of 40pg L -1 ). Suspended particulate matter (SPM) concentrations were inversely correlated with DGM concentrations. Dissolved Hg variation suggested that biotic DGM production in pore waters is a significant factor in addition to the photochemical reduction of Hg. Mercury volatilization (ranged from 1.1 to 3.3ngm -2 h -1 ; average of 2.1ngm -2 h -1 ) and DGM production exhibited the same pattern with no significant time-lag suggesting a fast release of the produced DGM. These results indicate that Hg sediment/water exchanges in the physical dominated estuaries can be underestimated when the tidal effect is not considered. Copyright © 2017 Elsevier B.V. All rights reserved.
Mercury emissions from municipal solid waste combustors
Energy Technology Data Exchange (ETDEWEB)
1993-05-01
This report examines emissions of mercury (Hg) from municipal solid waste (MSW) combustion in the United States (US). It is projected that total annual nationwide MSW combustor emissions of mercury could decrease from about 97 tonnes (1989 baseline uncontrolled emissions) to less than about 4 tonnes in the year 2000. This represents approximately a 95 percent reduction in the amount of mercury emitted from combusted MSW compared to the 1989 mercury emissions baseline. The likelihood that routinely achievable mercury emissions removal efficiencies of about 80 percent or more can be assured; it is estimated that MSW combustors in the US could prove to be a comparatively minor source of mercury emissions after about 1995. This forecast assumes that diligent measures to control mercury emissions, such as via use of supplemental control technologies (e.g., carbon adsorption), are generally employed at that time. However, no present consensus was found that such emissions control measures can be implemented industry-wide in the US within this time frame. Although the availability of technology is apparently not a limiting factor, practical implementation of necessary control technology may be limited by administrative constraints and other considerations (e.g., planning, budgeting, regulatory compliance requirements, etc.). These projections assume that: (a) about 80 percent mercury emissions reduction control efficiency is achieved with air pollution control equipment likely to be employed by that time; (b) most cylinder-shaped mercury-zinc (CSMZ) batteries used in hospital applications can be prevented from being disposed into the MSW stream or are replaced with alternative batteries that do not contain mercury; and (c) either the amount of mercury used in fluorescent lamps is decreased to an industry-wide average of about 27 milligrams of mercury per lamp or extensive diversion from the MSW stream of fluorescent lamps that contain mercury is accomplished.
20 CFR 701.201 - Office of Workers' Compensation Programs.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Office of Workers' Compensation Programs. 701.201 Section 701.201 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR...; DEFINITIONS AND USE OF TERMS Office of Workers' Compensation Programs § 701.201 Office of Workers...
48 CFR 1327.201 - Patent and copyright infringement liability.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright infringement liability. 1327.201 Section 1327.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1327.201 Patent and...
Mercury accumulation in native mammals of the Southeast
Energy Technology Data Exchange (ETDEWEB)
Cumbie, P.M.; Jenkins, J.H.
1974-01-01
Mercury levels in tissues of mammals collected in Georgia, Florida, and South Carolina were compared using hair mercury concentration as an index of total mercury content. Bobcats (Lynx rufus), raccoons (Procyon lotor), opossum (Didelphis marsupialis) and gray fox (Urocyon cinereoargenteus) from the Lower Coastal Plain of Georgia had higher mercury levels than specimens from the Upper Coastal Plain or Piedmont. The highest individual mercury levels in raccoons and bobcats occurred in specimens from the Georgia Lower Coastal Plain flatwoods. Skeletal muscle and liver of individual raccoons and bobcats taken in the coastal flatwoods exceeded the 0.5 ppm limit for mercury in human foodstuffs. No pattern of mercury accumulation was detected in white-tailed deer (Odocoileus virginianus). Hair analysis revealed elevated mercury levels in mammals from a region exposed to mercury pollution. Mercury levels in wildlife exhibit a pattern similar to that of certain fallout radioisotopes such as /sub 137/Cs. These observations indicate that significant biomagnification of mercury may occur in native mammals in certain southeastern habitats. 28 references, 6 tables.
Mercury in a coastal marine environment
Energy Technology Data Exchange (ETDEWEB)
Burton, J D; Leatherland, T M
1971-06-18
The problem of mercury pollution was investigated in Southampton Water and the English Channel. Mercury was determined in five specimens of the mollusk, Mercenaria mercenaria. The concentrations in whole organisms, without shell, ranged from 0.18 to 0.57 p.p.m. The amounts of mercury in the river and estuarine waters were found to be low. Yet, samples from the surface of the bottom mud in different parts of the estuary had mercury contents ranging from 0.19 to 0.64 p.p.m. The role of sediments in the transport of mercury in food chains could be significant, particularly for bottom living, suspension feeding animals. 14 references, 1 table.
Mercury risk in poultry in the Wanshan Mercury Mine, China
International Nuclear Information System (INIS)
Yin, Runsheng; Zhang, Wei; Sun, Guangyi; Feng, Zhaohui; Hurley, James P.; Yang, Liyuan; Shang, Lihai; Feng, Xinbin
2017-01-01
In this study, total mercury (THg) and methylmercury (MeHg) concentrations in muscles (leg and breast), organs (intestine, heart, stomach, liver) and blood were investigated for backyard chickens, ducks and geese of the Wanshan Mercury Mine, China. THg in poultry meat products range from 7.9 to 3917.1 ng/g, most of which exceeded the Chinese national standard limit for THg in meat (50 ng/g). Elevated MeHg concentrations (0.4–62.8 ng/g) were also observed in meat products, suggesting that poultry meat can be an important human MeHg exposure source. Ducks and geese showed higher Hg levels than chickens. For all poultry species, the highest Hg concentrations were observed in liver (THg: 23.2–3917.1 ng/g; MeHg: 7.1–62.8 ng/g) and blood (THg: 12.3–338.0 ng/g; MeHg: 1.4–17.6 ng/g). We estimated the Hg burdens in chickens (THg: 15.3–238.1 μg; MeHg: 2.2–15.6 μg), ducks (THg: 15.3–238.1 μg; MeHg: 3.5–14.7 μg) and geese (THg: 83.8–93.4 μg; MeHg: 15.4–29.7 μg). To not exceed the daily intake limit for THg (34.2 μg/day) and MeHg (6 μg/day), we suggested that the maximum amount (g) for chicken leg, breast, heart, stomach, intestine, liver, and blood should be 1384, 1498, 2315, 1214, 1081, 257, and 717, respectively; the maximum amount (g) for duck leg, breast, heart, stomach, intestine, liver, and blood should be 750, 1041, 986, 858, 752, 134, and 573, respectively; and the maximum amount (g) for goose leg, breast, heart, stomach, intestine, liver, and blood should be 941, 1051, 1040, 1131, 964, 137, and 562, respectively. - Highlights: • Elevated mercury levels were observed in poultry from Wanshan Mercury Mine, China. • Ducks and geese showed higher mercury levels than chickens. • Liver and blood showed the highest mercury levels. • Poultry can be an important dietary Hg exposure source for local residents. - High levels of Hg associated with poultry surrounding the Wanshan Mercury Mine pose a great risk of Hg exposure to
Sorption of mercury on chemically synthesized polyaniline
International Nuclear Information System (INIS)
Remya Devi, P.S.; Verma, R.; Sudersanan, M.
2006-01-01
Sorption of inorganic mercury (Hg 2+ ) and methyl mercury, on chemically synthesized polyaniline, in 0.1-10N HCl solutions has been studied. Hg 2+ is strongly sorbed at low acidities and the extent of sorption decreases with increase in acidity. The sorption of methyl mercury is very low in the HCl concentration range studied. Sorption of Hg 2+ on polyaniline in 0.1-10N LiCl and H 2 SO 4 solutions has also been studied. The analysis of the data indicates that the sorption of Hg 2+ depends on the degree of protonation of polyaniline and the nature of mercury(II) chloride complexes in solution. X-ray photoelectron spectroscopy analysis (XPS) of polyaniline sorbed with mercury show that mercury is bound as Hg 2+ . Sorbed mercury is quantitatively eluted from polyaniline with 0.5N HNO 3 . Polyaniline can be used for separation and pre-concentration of inorganic mercury from aqueous samples. (author)
Global Mercury Pathways in the Arctic Ecosystem
Lahoutifard, N.; Lean, D.
2003-12-01
The sudden depletions of atmospheric mercury which occur during the Arctic spring are believed to involve oxidation of gaseous elemental mercury, Hg(0), rendering it less volatile and more soluble. The Hg(II) oxidation product(s) are more susceptible to deposition, consistent with the observation of dramatic increases in snow mercury levels during depletion events. Temporal correlations with ozone depletion events and the proliferation of BrO radicals support the hypothesis that oxidation of Hg(0) occurs in the gas phase and results in its conversion to RGM (Reactive Gaseous Mercury). The mechanisms of Hg(0) oxidation and particularly Hg(II) reduction are as yet unproven. In order to evaluate the feasibility of proposed chemical processes involving mercury in the Arctic atmosphere and its pathway after deposition on the snow from the air, we investigated mercury speciation in air and snow pack at Resolute, Nunavut, Canada (latitude 75° N) prior to and during snow melt during spring 2003. Quantitative, real-time information on emission, air transport and deposition were combined with experimental studies of the distribution and concentrations of different mercury species, methyl mercury, anions, total organic carbon and total inorganic carbon in snow samples. The effect of solar radiation and photoreductants on mercury in snow samples was also investigated. In this work, we quantify mercury removed from the air, and deposited on the snow and the transformation to inorganic and methyl mercury.
African Journals Online (AJOL)
A case of mercury poisoning is reported and clinical observations of 6 .... fish ingested and occupational exposure. .... exposed to mercury as a result of inadequate industrial safety standards, and ... WHO Tech Rep Ser 1980; No. 674: 102-115.
Reference Atmosphere for Mercury
Killen, Rosemary M.
2002-01-01
We propose that Ar-40 measured in the lunar atmosphere and that in Mercury's atmosphere is due to current diffusion into connected pore space within the crust. Higher temperatures at Mercury, along with more rapid loss from the atmosphere will lead to a smaller column abundance of argon at Mercury than at the Moon, given the same crustal abundance of potassium. Because the noble gas abundance in the Hermean atmosphere represents current effusion, it is a direct measure of the crustal potassium abundance. Ar-40 in the atmospheres of the planets is a measure of potassium abundance in the interiors, since Ar-40 is a product of radiogenic decay of K-40 by electron capture with the subsequent emission of a 1.46 eV gamma-ray. Although the Ar-40 in the Earth's atmosphere is expected to have accumulated since the late bombardment, Ar-40 in the atmospheres of Mercury and the Moon is eroded quickly by photoionization and electron impact ionization. Thus, the argon content in the exospheres of the Moon and Mercury is representative of current effusion rather than accumulation over the lifetime of the planet.
Thallium-201 stress imaging in hypertensive patients
International Nuclear Information System (INIS)
Schulman, D.S.; Francis, C.K.; Black, H.R.; Wackers, F.J.
1987-01-01
To assess the potential effect of hypertension on the results of thallium-201 stress imaging in patients with chest pain, 272 thallium-201 stress tests performed in 133 hypertensive patients and 139 normotensive patients over a 1-year period were reviewed. Normotensive and hypertensive patients were similar in age, gender distribution, prevalence of cardiac risk factors (tobacco smoking, hyperlipidemia, and diabetes mellitus), medications, and clinical symptoms of coronary disease. Electrocardiographic criteria for left ventricular hypertrophy were present in 16 hypertensive patients. Stepwise probability analysis was used to determine the likelihood of coronary artery disease for each patient. In patients with mid to high likelihood of coronary disease (greater than 25% probability), abnormal thallium-201 stress images were present in 54 of 60 (90%) hypertensive patients compared with 51 of 64 (80%) normotensive patients. However, in 73 patients with a low likelihood of coronary disease (less than or equal to 25% probability), abnormal thallium-201 stress images were present in 21 patients (29%) of the hypertensive group compared with only 5 of 75 (7%) of the normotensive patients (p less than 0.001). These findings suggest that in patients with a mid to high likelihood of coronary artery disease, coexistent hypertension does not affect the results of thallium-201 exercise stress testing. However, in patients with a low likelihood of coronary artery disease, abnormal thallium-201 stress images are obtained more frequently in hypertensive patients than in normotensive patients
Health Effects of Exposures to Mercury
... IRIS database Top of Page Elemental (Metallic) Mercury Effects Exposures to metallic mercury most often occur when metallic ... poor performance on tests of mental function Higher exposures may also cause kidney effects, respiratory failure and death. Note that metallic mercury ...
Legislation, standards and methods for mercury emissions control
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-04-15
Mercury is an element of growing global concern. The United Nations Environment Programme plans to finalise and ratify a new global legally-binding convention on mercury by 2013. Canada already has legislation on mercury emissions from coal-fired utilities and the USA has recently released the new Mercury and Air Toxics Standard. Although other countries may not have mercury-specific legislation as such, many have legislation which results in significant co-benefit mercury reduction due to the installation of effective flue-gas cleaning technologies. This report reviews the current situation and trends in mercury emission legislation and, where possible, discusses the actions that will be taken under proposed or impending standards globally and regionally. The report also reviews the methods currently applied for mercury control and for mercury emission measurement with emphasis on the methodologies most appropriate for compliance. Examples of the methods of mercury control currently deployed in the USA, Canada and elsewhere are included.
International Nuclear Information System (INIS)
Melosh, H.J.; Mckinnon, W.B.
1988-01-01
The probable tectonic history of Mercury and the relative sequence of events are discussed on the basis of data collected by the Mariner-10 spacecraft. Results indicate that Mercury's tectonic activity was confined to its early history; its endogenic activity was principally due to a small change in the shape of its lithosphere, caused by tidal despinning, and a small change in area caused by shrinkage due to cooling. Exogenic processes, in particular the impact activity, have produced more abundant tectonic features. Many features associated with the Caloris basin are due to loading of Mercury's thick lithosphere by extrusive lavas or subsidence due to magma withdrawal. It is emphasized that tectonic features observed on Mercury yield insight into the earliest tectonic events on planets like Mars and, perhaps, the earth, where subsequent events obscured or erased the most ancient tectonic records
Mercury Toolset for Spatiotemporal Metadata
Devarakonda, Ranjeet; Palanisamy, Giri; Green, James; Wilson, Bruce; Rhyne, B. Timothy; Lindsley, Chris
2010-06-01
Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily)harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.
Mercury Toolset for Spatiotemporal Metadata
Wilson, Bruce E.; Palanisamy, Giri; Devarakonda, Ranjeet; Rhyne, B. Timothy; Lindsley, Chris; Green, James
2010-01-01
Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily) harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.
37 CFR 201.1 - Communication with the Copyright Office.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Communication with the Copyright Office. 201.1 Section 201.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.1 Communication with the Copyright Office...
21 CFR 880.2920 - Clinical mercury thermometer.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Clinical mercury thermometer. 880.2920 Section 880... Devices § 880.2920 Clinical mercury thermometer. (a) Identification. A clinical mercury thermometer is a... mercury. (b) Classification. Class II (special controls). The device is exempt from the premarket...
Bench-scale studies with mercury contaminated SRS soil
International Nuclear Information System (INIS)
Cicero, C.A.
1995-01-01
Bench-scale studies with mercury contaminated soil were performed at the SRTC to determine the optimum waste loading obtainable in the glass product without sacrificing durability, leach resistance, and processability. Vitrifying this waste stream also required offgas treatment for the capture of the vaporized mercury. Four soil glasses with slight variations in composition were produced, which were capable of passing the Product Consistency Test (PCT) and the Toxicity Characteristic Leaching Procedure (TCLP). The optimum glass feed composition contained 60 weight percent soil and produced a soda-lime-silica glass when melted at 1,350 C. The glass additives used to produce this glass were 24 weight percent Na 2 CO 3 and 16 weight percent CaCO 3 . Volatilized mercury released during the vitrification process was released to the proposed mercury collection system. The proposed mercury collection system consisted of quartz and silica tubing with a Na 2 S wash bottle followed by a NaOH wash bottle. Once in the system, the volatile mercury would pass through the wash bottle containing Na 2 S, where it would be converted to Hg 2 S, which is a stable form of mercury. However, attempts to capture the volatilized mercury in a Na 2 S solution wash bottle were not as successful as anticipated. Maximum mercury captured was only about 3.24% of the mercury contained in the feed. Mercury capture efforts then shifted to condensing and capturing the volatilized mercury. These attempts were much more successful at capturing the volatile mercury, with a capture efficiency of 34.24% when dry ice was used to pack the condenser. This captured mercury was treated on a mercury specific resin after digestion of the volatilized mercury
ONC201: Stressing tumors to death.
Endo Greer, Yoshimi; Lipkowitz, Stanley
2016-02-16
The small molecule ONC201 was identified in a screen for compounds that would induce expression of the gene encoding tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) in tumors and thus cause an autocrine- or paracrine-induced death in tumor cells. Two Research Articles in this issue of Science Signaling by Ishizawa et al. and Kline et al. describe how ONC201 can also trigger cytotoxicity by inducing a stress response. The mechanisms of the stress response induced differ between hematological malignancies and solid tumors, highlighting the complexity of ONC201-induced toxicity and raising intriguing issues of tissue-specific pathways activated by the drug. Copyright © 2016, American Association for the Advancement of Science.
Ishizawa, Jo; Kojima, Kensuke; Chachad, Dhruv; Ruvolo, Peter; Ruvolo, Vivian; Jacamo, Rodrigo O; Borthakur, Gautam; Mu, Hong; Zeng, Zhihong; Tabe, Yoko; Allen, Joshua E; Wang, Zhiqiang; Ma, Wencai; Lee, Hans C; Orlowski, Robert; Sarbassov, Dos D; Lorenzi, Philip L; Huang, Xuelin; Neelapu, Sattva S; McDonnell, Timothy; Miranda, Roberto N; Wang, Michael; Kantarjian, Hagop; Konopleva, Marina; Davis, R Eric; Andreeff, Michael
2016-02-16
The clinical challenge posed by p53 abnormalities in hematological malignancies requires therapeutic strategies other than standard genotoxic chemotherapies. ONC201 is a first-in-class small molecule that activates p53-independent apoptosis, has a benign safety profile, and is in early clinical trials. We found that ONC201 caused p53-independent apoptosis and cell cycle arrest in cell lines and in mantle cell lymphoma (MCL) and acute myeloid leukemia (AML) samples from patients; these included samples from patients with genetic abnormalities associated with poor prognosis or cells that had developed resistance to the nongenotoxic agents ibrutinib and bortezomib. Moreover, ONC201 caused apoptosis in stem and progenitor AML cells and abrogated the engraftment of leukemic stem cells in mice while sparing normal bone marrow cells. ONC201 caused changes in gene expression similar to those caused by the unfolded protein response (UPR) and integrated stress responses (ISRs), which increase the translation of the transcription factor ATF4 through an increase in the phosphorylation of the translation initiation factor eIF2α. However, unlike the UPR and ISR, the increase in ATF4 abundance in ONC201-treated hematopoietic cells promoted apoptosis and did not depend on increased phosphorylation of eIF2α. ONC201 also inhibited mammalian target of rapamycin complex 1 (mTORC1) signaling, likely through ATF4-mediated induction of the mTORC1 inhibitor DDIT4. Overexpression of BCL-2 protected against ONC201-induced apoptosis, and the combination of ONC201 and the BCL-2 antagonist ABT-199 synergistically increased apoptosis. Thus, our results suggest that by inducing an atypical ISR and p53-independent apoptosis, ONC201 has clinical potential in hematological malignancies. Copyright © 2016, American Association for the Advancement of Science.
201Hg excitation in plasma produced by laser
International Nuclear Information System (INIS)
Comet, Maxime
2014-01-01
The use of high power lasers allows the study of the properties of matter in extreme conditions of temperature and density. Indeed, the interaction of a power laser and a target creates a plasma in which the temperature is high enough to reach important degrees of ionization. These conditions can allow the excitation of the nucleus. A nucleus of interest to study the processes of nuclear excitation is the 201 Hg. This work aims to design an experiment where the 201 Hg excitation will be observed in a plasma produced by a high power laser. The first part of this manuscript presents the calculation of the expected nuclear excitation rates in the plasma. For about ten years, nuclear excitation rates have been calculated using the average atom model. To validate this model a code named ADAM (French acronym for Beyond The Average Atom Model) was developed to calculate the nuclear excitation rates under the DCA (Detailed Configuration Accounting) hypothesis. ADAM allows us to deduce the thermo dynamical domain where the nuclear excitation rates determined with the average atom model are relevant. The second part of this manuscript presents the coupling of the excitation rate calculation with a hydrodynamic code to calculate the number of excited nuclei produced in one laser shot for different laser intensity. Finally, in the last part, first experimental approaches which will be used to design an experiment on a laser installation are presented. These approaches are based on the detection and determination of the amount of multicharged ions obtained far from the target (∼80 cm). For this purpose, an electrostatic analyzer was used. (author) [fr
Thallium-201 scintigraphy in diagnosis of coronary stenosis
International Nuclear Information System (INIS)
Corne, R.A.; Gotsman, M.S.; Weiss, A.; Enlander, D.; Samuels, L.D.; Salomon, J.A.; Warshaw, B.; Atlan, H.
1979-01-01
The sensitivity of rest and exercise thallium-201 scintigraphy for the detection of significant coronary artery disease and myocardial ischaemia was compared with rest and exercise electrocardiography in 46 patients with chest pain. Of 26 patients with greater that 70 per cent coronary stenosis, 16 had abnormal rest thallium-201 scintigrams and 13 had Q waves. Myocardial perfusion defects in the resting scintigram correlated very well with evidence of previous myocardial infarction (16 of 17 patients, 94%) significant Q waves were present in 13 of these 17 patients (76%). After exercise, abnormal thallium-201 scintigrams consistent with ischaemia were found in 21 patients (81%). Abnormal exercise electrocardiograms were present in 15 patients (58%). The combination of abnormal exercise thallium-201 scintigrams or exercise electrocardiograms (23/26, 88%) exceeded abnormal exercise electrocardiograms alone (15/26, 58%). The two procedures were thus complementary. Abnormal rest or exercise thallium-201 scintigrams were obtained in 25/26 patients (96%) compared with abnormal rest or exercise electrocardiograms in 21/26 patients (84%). Twenty patients with less than 50 per cent coronary stenosis had normal rest thallium-201 scintigrams and no Q waves. Two had abnormal exercise thallium-201 scintigrams and 7 had abnormal exercise electrocardiograms. Thus,exercise thallium scintigraphy has higher sensitivity than exercise electrocardiography in detecting exercise induced ischaemia and is more specific. Scintigraphy appears to have a higher sensitivity than electrocardiography in detecting coronary artery disease. (author)
Methyl mercury in terrestrial compartments
International Nuclear Information System (INIS)
Stoeppler, M.; Burow, M.; Padberg, S.; May, K.
1993-09-01
On the basis of the analytical methodology available at present the state of the art for the determination of total mercury and of various organometallic compounds of mercury in air, precipitation, limnic systems, soils, plants and biota is reviewed. This is followed by the presentation and discussion of examples for the data obtained hitherto for trace and ultratrace levels of total mercury and mainly methyl mercury in terrestrial and limnic environments as well as in biota. The data discussed stem predominantly from the past decade in which, due to significant methodological progress, many new aspects were elucidated. They include the most important results in this area achieved by the Research Centre (KFA) Juelich within the project 'Origin and Fate of Methyl Mercury' (contracts EV4V-0138-D and STEP-CT90-0057) supported by the Commission of the European Communities, Brussels. (orig.) [de
DEFF Research Database (Denmark)
Baatrup, E; Danscher, G
1988-01-01
and the selected organs were determined by measuring the uptake of 203Hg-labeled MeHg. Spleen, liver, and kidney had the highest concentrations after both experimental periods, while the largest relative increases were found in brain, muscle, and kidney. The subcellular distribution of mercury accumulations...... was demonstrated cytochemically in liver and kidney using the silver enhancement method by which accumulations of mercury-sulfides and/or mercury-selenides are made visible for light and electron microscopy. When sections prepared from the liver and kidney from fish, injected with selenium 2 hr prior to being...... pronounced in the kidney. The HgSe pool, supposed to represent methyl mercury, was shown by the presence of silver deposits at new locations as well as by an increase in the amount of deposits within lysosomes. The new locations included (1) secretory-like vesicles and the bile canaliculi of the liver...
PyMercury: Interactive Python for the Mercury Monte Carlo Particle Transport Code
International Nuclear Information System (INIS)
Iandola, F.N.; O'Brien, M.J.; Procassini, R.J.
2010-01-01
Monte Carlo particle transport applications are often written in low-level languages (C/C++) for optimal performance on clusters and supercomputers. However, this development approach often sacrifices straightforward usability and testing in the interest of fast application performance. To improve usability, some high-performance computing applications employ mixed-language programming with high-level and low-level languages. In this study, we consider the benefits of incorporating an interactive Python interface into a Monte Carlo application. With PyMercury, a new Python extension to the Mercury general-purpose Monte Carlo particle transport code, we improve application usability without diminishing performance. In two case studies, we illustrate how PyMercury improves usability and simplifies testing and validation in a Monte Carlo application. In short, PyMercury demonstrates the value of interactive Python for Monte Carlo particle transport applications. In the future, we expect interactive Python to play an increasingly significant role in Monte Carlo usage and testing.
31 CFR 0.201 - Political activity.
2010-07-01
... EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.201 Political activity. (a) Employees may: (1) Take an active part in political management or in political campaigns to the extent permitted by law (5 U.S.C... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Political activity. 0.201 Section 0...
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Price test. 242.201 Section...-Regulation of Short Sales § 242.201 Price test. Link to an amendment published at 75 FR 11323, Mar. 10, 2010. (a) No short sale price test, including any short sale price test of any self-regulatory organization...
Intentional intravenous mercury injection
African Journals Online (AJOL)
In this case report, intravenous complications, treatment strategies and possible ... Mercury toxicity is commonly associated with vapour inhalation or oral ingestion, for which there exist definite treatment options. Intravenous mercury ... personality, anxiousness, irritability, insomnia, depression and drowsi- ness.[1] However ...
14 CFR 1206.201 - Records which have been published.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Records which have been published. 1206.201 Section 1206.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION AVAILABILITY OF AGENCY RECORDS TO MEMBERS OF THE PUBLIC Records Available § 1206.201 Records which have been published...
Human accumulation of mercury in Greenland
DEFF Research Database (Denmark)
Johansen, Poul; Mulvad, Gert; Pedersen, Henning Sloth
2007-01-01
In the Arctic, the traditional diet exposes its people to a high intake of mercury especially from marine mammals. To determine whether the mercury is accumulated in humans, we analyzed autopsy samples of liver, kidney and spleen from adult ethnic Greenlanders who died between 1990 and 1994 from...... a wide range of causes, natural and violent. Liver, kidney and spleen samples from between 33 and 71 case subjects were analyzed for total mercury and methylmercury, and liver samples also for selenium. Metal levels in men and women did not differ and were not related to age except in one case, i.......e. for total mercury in liver, where a significant declining concentration with age was observed. The highest total mercury levels were found in kidney followed by liver and spleen. Methylmercury followed the same pattern, but levels were much lower, constituting only 19% of the total mercury concentration...
Human accumulation of mercury in Greenland
DEFF Research Database (Denmark)
Johansen, P.; Mulvad, G.; Pedersen, H. S.
2007-01-01
a wide range of causes, natural and violent. Liver, kidney and spleen samples from between 33 and 71 case subjects were analyzed for total mercury and methylmercury, and liver samples also for selenium. Metal levels in men and women did not differ and were not related to age except in one case, i......In the Arctic, the traditional diet exposes its people to a high intake of mercury especially from marine mammals. To determine whether the mercury is accumulated in humans, we analyzed autopsy samples of liver, kidney and spleen from adult ethnic Greenlanders who died between 1990 and 1994 from.......e. for total mercury in liver, where a significant declining concentration with age was observed. The highest total mercury levels were found in kidney followed by liver and spleen. Methylmercury followed the same pattern, but levels were much lower, constituting only 19% of the total mercury concentration...
New Mechanisms of Mercury Binding to Peat
Nagy, K. L.; Manceau, A.; Gasper, J. D.; Ryan, J. N.; Aiken, G. R.
2007-12-01
Mercury can be immobilized in the aquatic environment by binding to peat, a solid form of natural organic matter. Binding mechanisms can vary in strength and reversibility, and therefore will control concentrations of bioreactive mercury, may explain rates of mercury methylation, and are important for designing approaches to improve water quality using natural wetlands or engineered phytoremediation schemes. In addition, strong binding between mercury and peat is likely to result in the fixation of mercury that ultimately resides in coal. The mechanisms by which aqueous mercury at low concentrations reacts with both dissolved and solid natural organic matter remain incompletely understood, despite recent efforts. We have identified three distinct binding mechanisms of divalent cationic mercury to solid peats from the Florida Everglades using EXAFS spectroscopic data (FAME beamline, European Synchrotron Radiation Facility (ESRF)) obtained on experimental samples as compared to relevant references including mercury-bearing solids and mercury bound to various organic molecules. The proportions of the three molecular configurations vary with Hg concentration, and two new configurations that involve sulfur ligands occur at Hg concentrations up to about 4000 ppm. The binding mechanism at the lowest experimental Hg concentration (60-80 ppm) elucidates published reports on the inhibition of metacinnabar formation in the presence of Hg-bearing solutions and dissolved natural organic matter, and also, the differences in extent of mercury methylation in distinct areas of the Florida Everglades.
Energy Technology Data Exchange (ETDEWEB)
Ribeiro Guevara, Sergio; Perez Catan, Soledad [Centro Atomico Bariloche, Laboratorio de Analisis por Activacion Neutronica, Bariloche (Argentina); Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena [Jozef Stefan Institute, Department of Environmental Sciences, Ljubljana (Slovenia)
2007-03-15
Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H{sub 2}SO{sub 4} or HCl were evaluated in freshwater sediments using {sup 197}Hg radiotracer. Values obtained for the {sup 197}Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of {sup 197}Hg{sup 2+} into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg{sup 2+} contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg{sup 2+} contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H{sub 2}SO{sub 4} method is recommended, since it is free from these interferences. {sup 197}Hg radiotracer (T{sub 1/2} = 2.673 d) has a production rate that is about 50 times higher than that of {sup 203}Hg (T{sub 1/2} = 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to {sup 203}Hg when it is used it in short-term experiments and produced by the irradiation of {sup 196}Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the {sup 196}Hg isotope is increased, the specific activity of the {sup 197}Hg tracer can be significantly improved. In
Mercury in mussels of Bellingham Bay, Washington, (USA)
Energy Technology Data Exchange (ETDEWEB)
Roesijadi, G.; Drum, A.S.; Bridge, J.R.
1978-11-01
Laboratory experiments demonstrated the existence of metallothionein-like, low molecular weight, mercury-binding proteins in the marine mussel Mytilus edulis. Relatively large quantities of mercury were associated with such proteins in gills and digestive gland, the organs of interest in the present study. /sup 14/C-incorporation indicated induction of the protein in gills, but not in digestive gland. Mercury in digestive gland may have bound to existing metal-binding proteins. Short-term incorporation of mercury occurred primarily in gills. The induction of mercury-binding proteins in gills may have facilitated detoxification of mercury at the site of uptake. Mercury in mussels of Bellingham Bay were shown to have decreased from 1970 to 1978, the collection date for the present study. Mercury levels were low but approximately three times higher than those from uncontaminated areas. Mercury associated with the mercury-binding protein of gills and digestive glands of Bellingham Bay mussels were low and reflected the concentrations measured in the whole tissues. However, the highest concentration of mercury was associated with the low molecular pool components, the identity of which is not presently known.
21 CFR 862.3600 - Mercury test system.
2010-04-01
....3600 Mercury test system. (a) Identification. A mercury test system is a device intended to measure mercury, a heavy metal, in human specimens. Measurements obtained by this device are used in the diagnosis... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mercury test system. 862.3600 Section 862.3600...
Worldwide trend of atmospheric mercury since 1995
Directory of Open Access Journals (Sweden)
F. Slemr
2011-05-01
Full Text Available Concern about the adverse effects of mercury on human health and ecosystems has led to tightening emission controls since the mid 1980s. But the resulting mercury emissions reductions in many parts of the world are believed to be offset or even surpassed by the increasing emissions in rapidly industrializing countries. Consequently, concentrations of atmospheric mercury are expected to remain roughly constant. Here we show that the worldwide atmospheric mercury concentrations have decreased by about 20 to 38 % since 1996 as indicated by long-term monitoring at stations in the Southern and Northern Hemispheres combined with intermittent measurements of latitudinal distribution over the Atlantic Ocean. The total reduction of the atmospheric mercury burden of this magnitude within 14 years is unusually large among most atmospheric trace gases and is at odds with the current mercury emission inventories with nearly constant anthropogenic emissions over this period. This suggests a major shift in the biogeochemical cycle of mercury including oceans and soil reservoirs. Decreasing reemissions from the legacy of historical mercury emissions are the most likely explanation for this decline since the hypothesis of an accelerated oxidation rate of elemental mercury in the atmosphere is not supported by the observed trends of other trace gases. Acidification of oceans, climate change, excess nutrient input and pollution may also contribute by their impact on the biogeochemistry of ocean and soils. Consequently, models of the atmospheric mercury cycle have to include soil and ocean mercury pools and their dynamics to be able to make projections of future trends.
Mercury distribution in Douro estuary (Portugal)
Energy Technology Data Exchange (ETDEWEB)
Ramalhosa, E. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal); Pereira, E. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal)]. E-mail: eduper@dq.ua.pt; Vale, C. [National Institute for Agronomy and Fishery Research, IPIMAR, Avenida Brasilia, 1449-006 Lisboa (Portugal); Valega, M. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal); Monterroso, P. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal); Duarte, A.C. [Department of Chemistry, University of Aveiro, 3810-193 Aveiro (Portugal)
2005-11-15
Determinations of dissolved reactive and total dissolved mercury, particulate and sedimentary mercury, dissolved organic carbon (DOC), particulate organic carbon (POC) and suspended particulate matter (SPM) have been made in the estuary of river Douro, in northern Portugal. The estuary was stratified by salinity along most of its length, it had low concentrations of SPM, typically <20 mg dm{sup -3}, and concentrations of DOC in the range <1.0-1.8 mg dm{sup -3}. The surface waters had a maximum dissolved concentration of reactive mercury of about 10 ng dm{sup -3}, whereas for the more saline bottom waters it was about 65 ng dm{sup -3}. The surface waters had maximum concentrations of total suspended particulate mercury of {approx}7 {mu}g g{sup -1} and the bottom waters were always <1 {mu}g g{sup -1}. Concentrations of mercury in sediments was low and in the range from 0.06 to 0.18 {mu}g g{sup -1}. The transport of mercury in surface waters was mainly associated with organic-rich particulate matter, while in bottom waters the dissolved phase transport of mercury is more important. Lower particulate organic matter, formation of chlorocomplexes in more saline waters and eventually the presence of colloids appear to explain the difference of mercury partitioning in Douro estuarine waters.
International Nuclear Information System (INIS)
Conley, T.B.; Morris, M.I.; Osborne-Lee, I.W.
1998-03-01
In May 1996, the US Department of Energy (DOE) Mixed Waste Focus Area (MWFA) initiated the Mercury Working Group (HgWG). The HgWG was established to address and resolve the issues associated with mercury contaminated mixed wastes. During the MWFA's initial technical baseline development process, three of the top four technology deficiencies identified were related to the need for amalgamation, stabilization, and separation removal technologies for the treatment of mercury and mercury contaminated mixed waste. The HgWG is assisting the MWFA in soliciting, identifying, initiating, and managing efforts to address these areas. The focus of the HgWG is to better establish the mercury related treatment technologies at the DOE sites, refine the MWFA technical baseline as it relates to mercury treatment, and make recommendations to the MWFA on how to most effectively address these needs. Based on the scope and magnitude of the mercury mixed waste problem, as defined by HgWG, solicitations and contract awards have been made to the private sector to demonstrate both the amalgamation and stabilization processes using actual mixed wastes. Development efforts are currently being funded that will address DOE's needs for separation removal processes. This paper discusses the technology selection process, development activities, and the accomplishments of the HgWG to date through these various activities
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units XIII Appendix XIII to Part 266 Protection of Environment... XIII to Part 266—Mercury Bearing Wastes That May Be Processed in Exempt Mercury Recovery Units These...
International Nuclear Information System (INIS)
Zhou, Jun; Wang, Zhangwei; Sun, Ting; Zhang, Huan; Zhang, Xiaoshan
2016-01-01
Forests are considered a pool of mercury in the global mercury cycle. However, few studies have investigated the distribution of mercury in the forested systems in China. Tieshanping forest catchment in southwest China was impacted by mercury emissions from industrial activities and coal combustions. Our work studied mercury content in atmosphere, soil, vegetation and insect with a view to estimating the potential for mercury release during forest fires. Results of the present study showed that total gaseous mercury (TGM) was highly elevated and the annual mean concentration was 3.51 ± 1.39 ng m"−"2. Of the vegetation tissues, the mercury concentration follows the order of leaf/needle > root > bark > branch > bole wood for each species. Total ecosystem mercury pool was 103.5 mg m"−"2 and about 99.4% of the mercury resides in soil layers (0–40 cm). The remaining 0.6% (0.50 mg m"−"2) of mercury was stored in biomass. The large mercury stocks in the forest ecosystem pose a serious threat for large pluses to the atmospheric mercury during potential wildfires and additional ecological stress to forest insect: dung beetles, cicada and longicorn, with mercury concentration of 1983 ± 446, 49 ± 38 and 7 ± 5 ng g"−"1, respectively. Hence, the results obtained in the present study has implications for global estimates of mercury storage in forests, risks to forest insect and potential release to the atmosphere during wildfires. - Highlights: • Mercury in air, soil, biomass and insect were studied at a subtropical forest. • 99.4% of the total ecosystem mercury pools was resided in soil layers. • High mercury pools were large pulses to the atmosphere during potential wildfires. • High mercury deposition in forest pose an ecological stress to insect. - Large mercury pools in forest pose a serious threat for large pluses to the atmospheric mercury during potential wildfires and ecological stress to insect.
Localized surface plasmon resonance mercury detection system and methods
James, Jay; Lucas, Donald; Crosby, Jeffrey Scott; Koshland, Catherine P.
2016-03-22
A mercury detection system that includes a flow cell having a mercury sensor, a light source and a light detector is provided. The mercury sensor includes a transparent substrate and a submonolayer of mercury absorbing nanoparticles, e.g., gold nanoparticles, on a surface of the substrate. Methods of determining whether mercury is present in a sample using the mercury sensors are also provided. The subject mercury detection systems and methods find use in a variety of different applications, including mercury detecting applications.
Hematological Changes Induced by Mercury Ions and Ionizing Radiation in Experimental Animals
International Nuclear Information System (INIS)
Kim, Jin-Kyu; Lee, Yun-Jong; Choi, Dae-Seong; Kim, Ji-Hyang; Cebulska-Wasilewska, Antonina
2006-01-01
Toxic metals such as lead, chromium, cadmium, mercury and arsenic are widely found in our environment. Humans are exposed to these metals from numerous sources, including contaminated air, water, soil and food. Mercury, one of the most diffused and hazardous organ specific environmental contaminants, exists in a wide variety of physical and chemical states, each of which has unique characteristics for a target organ specificity. Although reports indicate that mercury induces deleterious damage, little is known about its effects on living organisms. Ionizing radiation, an extensively used therapeutic modality in oncology, not only eradicates neoplastic cells but also generates inevitable side effects for normal tissues. Such biological effects are made through the production of reactive oxygen species which include a superoxide anion, a hydroxyl radical and a hydrogen peroxide. These reactive species may contribute to the radiation-induced cytotoxicity (e.g., chromosome aberrations, protein oxidation, and muscle injury) and to the metabolic and morphologic changes (e.g., increased muscle proteolysis and changes in the central nervous system) in animals and humans. In the present study, radioimmunoassay of the cortisol in the serum and the analysis of the hematological components and enzymes related to a tissue injury were carried out to evaluate the effects of mercury chloride in comparison with those of ionizing radiation
Hematological Changes Induced by Mercury Ions and Ionizing Radiation in Experimental Animals
Energy Technology Data Exchange (ETDEWEB)
Kim, Jin-Kyu; Lee, Yun-Jong; Choi, Dae-Seong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of); Kim, Ji-Hyang [Biotechnology Research Institute, Seoul (Korea, Republic of); Cebulska-Wasilewska, Antonina [The Henryk Niewodniczanski Institute of Nuclear Physics, Krakow (Poland)
2006-07-01
Toxic metals such as lead, chromium, cadmium, mercury and arsenic are widely found in our environment. Humans are exposed to these metals from numerous sources, including contaminated air, water, soil and food. Mercury, one of the most diffused and hazardous organ specific environmental contaminants, exists in a wide variety of physical and chemical states, each of which has unique characteristics for a target organ specificity. Although reports indicate that mercury induces deleterious damage, little is known about its effects on living organisms. Ionizing radiation, an extensively used therapeutic modality in oncology, not only eradicates neoplastic cells but also generates inevitable side effects for normal tissues. Such biological effects are made through the production of reactive oxygen species which include a superoxide anion, a hydroxyl radical and a hydrogen peroxide. These reactive species may contribute to the radiation-induced cytotoxicity (e.g., chromosome aberrations, protein oxidation, and muscle injury) and to the metabolic and morphologic changes (e.g., increased muscle proteolysis and changes in the central nervous system) in animals and humans. In the present study, radioimmunoassay of the cortisol in the serum and the analysis of the hematological components and enzymes related to a tissue injury were carried out to evaluate the effects of mercury chloride in comparison with those of ionizing radiation.
Estimating threshold limits for mercury in biological material
Energy Technology Data Exchange (ETDEWEB)
Berlin, M H
1963-01-01
A brief historical review of the study of occupational exposure to mercury is presented. Important factors in the determination of the tolerable body burden of mercury are discussed, notably the body distribution of mercury after exposure, and the risk of accumulation in different organs. In acute exposure the kidney and liver accumulate much mercury and are hence liable to injury, while recent findings indicate that in chronic exposure to moderate levels of mercury the brain and possibly testes are the critical organs because of a pronounced tendency to accumulate. The possibility of obtaining an index of mercury retention is explored; it is concluded that urinary mercury excretion does not reflect the level of body retention although it may indicate very recent exposure. It is suggested that mercury concentration in biopsies of skin, liver, kidney and colonic mucosa may serve as an index of body retention of mercury. 37 references, 7 figures.
Mercury concentration in coal - Unraveling the puzzle
Toole-O'Neil, B.; Tewalt, S.J.; Finkelman, R.B.; Akers, D.J.
1999-01-01
Based on data from the US Geological Survey's COALQUAL database, the mean concentration of mercury in coal is approximately 0.2 ??gg-1. Assuming the database reflects in-ground US coal resources, values for conterminous US coal areas range from 0.08 ??gg-1 for coal in the San Juan and Uinta regions to 0.22 ??gg-1 for the Gulf Coast lignites. Recalculating the COALQUAL data to an equal energy basis unadjusted for moisture differences, the Gulf Coast lignites have the highest values (36.4 lb of Hg/1012 Btu) and the Hams Fork region coal has the lowest value (4.8 lb of Hg/1012Btu). Strong indirect geochemical evidence indicates that a substantial proportion of the mercury in coal is associated with pyrite occurrence. This association of mercury and pyrite probably accounts for the removal of mercury with the pyrite by physical coal cleaning procedures. Data from the literature indicate that conventional coal cleaning removes approximately 37% of the mercury on an equal energy basis, with a range of 0% to 78%. When the average mercury reduction value is applied to in-ground mercury values from the COALQUAL database, the resulting 'cleaned' mercury values are very close to mercury in 'as-shipped' coal from the same coal bed in the same county. Applying the reduction fact or for coal cleaning to eastern US bituminous coal, reduces the mercury input load compared to lower-rank non-deaned western US coal. In the absence of analytical data on as-shipped coal, the mercury data in the COALQUAL database, adjusted for deanability where appropriate, may be used as an estimator of mercury contents of as-shipped coal. ?? 1998 Published by Elsevier Science Ltd. All rights reserved.
Risk assessment of mercury contaminated sites
International Nuclear Information System (INIS)
Hempel, M.
1993-01-01
At two sites, highly contaminated with mercury, risk assessment was executed. Methods were developed to determine organomercury compounds in water, air and soil. Toxicity tests demonstrated the high toxicity of organomercury compounds compared to inorganic mercury. Besides highly toxic methylmercury, ethylmercury was found in soils close to a chemical plant in Marktredwitz. In ultrafiltration-experiments mercury showed great affinity to high molecular substances in water. Lysimeter-experiments proved, that organomercury compounds are adsorbed and transformed to inorganic and elemental mercury. (orig.) [de
Control of mercury emissions: policies, technologies, and future trends
Rhee, Seung-Whee
2015-01-01
Seung-Whee Rhee Department of Environmental Engineering, Kyonggi University, Suwon, Republic of Korea Abstract: Owing to the Minamata Convention on Mercury and the Global Mercury Partnership, policies and regulations on mercury management in advanced countries were intensified by a mercury phaseout program in the mercury control strategy. In developing countries, the legislative or regulatory frameworks on mercury emissions are not established specifically, but mercury management is designed...
Recent Advances in Atmospheric Chemistry of Mercury
Directory of Open Access Journals (Sweden)
Lin Si
2018-02-01
Full Text Available Mercury is one of the most toxic metals and has global importance due to the biomagnification and bioaccumulation of organomercury via the aquatic food web. The physical and chemical transformations of various mercury species in the atmosphere strongly influence their composition, phase, transport characteristics and deposition rate back to the ground. Modeling efforts to assess global cycling of mercury require an accurate understanding of atmospheric mercury chemistry. Yet, there are several key uncertainties precluding accurate modeling of physical and chemical transformations. We focus this article on recent studies (since 2015 on improving our understanding of the atmospheric chemistry of mercury. We discuss recent advances in determining the dominant atmospheric oxidant of elemental mercury (Hg0 and understanding the oxidation reactions of Hg0 by halogen atoms and by nitrate radical (NO3—in the aqueous reduction of oxidized mercury compounds (HgII as well as in the heterogeneous reactions of Hg on atmospheric-relevant surfaces. The need for future research to improve understanding of the fate and transformation of mercury in the atmosphere is also discussed.
Urban artisanal gold shops and mercury emissions
International Nuclear Information System (INIS)
Cordy, P.; Veiga, M.; Carrasco, V.H.G.
2008-01-01
Artisanal miners in developing countries use mercury amalgamation processes to extract gold. The amalgams are then refined before being sold on to urban gold shops. The amalgams can often contain between 2 to 40 per cent mercury. Unburned amalgams are also often sold directly to gold shops. There are serious health risks for shop employees and nearby populations when the gold is melted and further purified. Studies have shown that mercury concentrations in the ambient air of gold shops often exceeds World Health Organization (WHO) limits by an order of magnitude or more. This study examined the practices and technologies used to refine gold in Latin America and Indonesia. The study compared and contrasted various refining methods and their resulting mercury emissions. Methods of reducing mercury emissions were also investigated, including a filtration system designed to capture 80 per cent of mercury emissions. Barriers to implementing mercury emissions reduction plans were also investigated. It was concluded that the design of urban gold shops must include condensers, fume hoods, and efficient mercury capture systems. 15 refs
Anthropogenic mercury deposition to arctic lake sediments
Energy Technology Data Exchange (ETDEWEB)
Hermanson, M.H. [Westchester University, Westchester, PA (United States). Dept. of Health
1998-01-01
The history of atmospheric mercury inputs to remote arctic regions can be measured in lake sediment cores using lead-210 chronology. In the investigation, total mercury deposition is measured in sediments from Imitavik and Annak Lakes on the Belcher Islands in southeastern Hudson Bay, an area in the southern Canadian Arctic with no history of local industrial or agricultural sources of contamination. Both lakes received background and atmospheric inputs of mercury while Annak also received mercury from raw domestic sewage from the Hamlet of Sanikiluaq, a growing Inuit community of about 550 established in the late 1960s. Results from Imitavik show that anthropogenic mercury inputs, apparently transported through the atmosphere, began to appear in the mid-eighteenth century, and continued to the 1990s. Annak had a similar mercury history until the late 1960s when disposal of domestic sewage led to increased sediment and contaminant accumulation. The high input of mercury to Annak confirms that Sanikiluaq residents are exposed to mercury through native food sources. 39 refs., 7 figs., 3 tabs.
5 CFR 250.201 - Coverage and purpose.
2010-01-01
....201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.201 Coverage and purpose. The Chief Human... effective and efficient operation of Government. As a part of OPM's overall leadership responsibilities in...
Motts, Jonathan A.; Shirley, Devon L.; Silbergeld, Ellen K.; Nyland, Jennifer F.
2014-01-01
Mercury is an ubiquitous environmental contaminant, causing both neurotoxicity and immunotoxicity. Given its ability to amalgamate gold, mercury is frequently used in small-scale artisanal gold mining. We have previously reported that elevated serum titers of antinuclear autoantibodies (ANA) are associated with mercury exposures of miners in gold mining. The goal of this project was to identify novel serum biomarkers of mercury-induced immunotoxicity and autoimmune dysregulation. We conducted an analysis of serum samples from a cross-sectional epidemiological study on miners working in Amazonian Brazil. In proteomic screening analyses, samples were stratified based on mercury concentrations and ANA titer and a subset of serum samples (N=12) were profiled using Immune Response Biomarker Profiling ProtoArray protein microarray for elevated autoantibodies. Of the up-regulated autoantibodies in the mercury-exposed cohort, potential target autoantibodies were selected based on relevance to pro-inflammatory and macrophage activation pathways. ELISAs were developed to test the entire sample cohort (N=371) for serum titers to the highest of these autoantibodies (anti-glutathione S-transferase alpha, GSTA1) identified in the high mercury/high ANA group. We found positive associations between elevated mercury exposure and up-regulated serum titers of 3760 autoantibodies as identified by ProtoArray. Autoantibodies identified as potential novel biomarkers of mercury-induced immunotoxicity include antibodies to the following proteins: GSTA1, tumor necrosis factor ligand superfamily member 13, linker for activation of T cells, signal peptide peptidase like 2B, stimulated by retinoic acid 13, and interferon induced transmembrane protein. ELISA analyses confirmed that mercury-exposed gold miners had significantly higher serum titers of anti-GSTA1 autoantibody [unadjusted odds ratio = 89.6; 95% confidence interval: 27.2, 294.6] compared to emerald miners (referent population
Quantitative analysis of thallium-201 myocardial scintigraphy
International Nuclear Information System (INIS)
Kanemoto, Nariaki; Hoer, G.; Johost, S.; Maul, F.-D.; Standke, R.
1981-01-01
The method of quantitative analysis of thallium-201 myocardial scintigraphy using computer assisted technique was described. Calculated indices are washout factor, vitality index and redistribution factor. Washout factor is the ratio of counts at certain period of time after exercise and immediately after exercise. This value is neccessary for the evaluation of redistribution to the ischemic areas in serial imagings to correct the Tl-201 washout from the myocardium under the assumption that the washout is constant in the whole myocardium. Vitality index is the ratio between the Tl-201 uptake in the region of interest and that of the maximum. Redistribution factor is the ratio of the redistribution in the region of interest in serial imagings after exercise to that of immediately after exercise. Four examples of exercise Tl-201 myocardial scintigrams and the quantitative analyses before and after the percutaneous transluminal coronary angioplasty were presented. (author)
21 CFR 872.3700 - Dental mercury.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Dental mercury. 872.3700 Section 872.3700 Food and... DENTAL DEVICES Prosthetic Devices § 872.3700 Dental mercury. (a) Identification. Dental mercury is a... dental cavity or a broken tooth. (b) Classification. Class I. ...
International Nuclear Information System (INIS)
Adachi, Junichi; Kaminaga, Masanori; Sasaki, Shinobu; Haga, Katsuhiro; Aso, Tomokazu; Kinoshita, Hidetaka; Hino, Ryutaro
2002-01-01
In designing the neutron scattering facility, a spent target vessel should be replaced with remote handling devices in order to protect radioactive exposure, since it would be highly activated through the high energy neutron irradiation caused by the spallation reaction between mercury of the target material and the MW-class proton beam. In the storage of the spent target vessel, it is necessary to consider decay heat of the target vessel and mercury contamination caused by vaporization of the residual mercury in the vessel. A conceptual design has been carried out to establish basic concept and to clarify its specification of main equipments on handling and storage systems for the spent target vessel. This report presents the basic concept and a system plot plan based on latest design works of remote handling devices such as a spent target vessel storage cask and a target vessel exchange trolley, which aim at reasonability and simplification. In addition, storage systems for the spent moderator vessel, the spent proton beam window and the spent reflector vessel are also investigated based on the plot plan. (author)
Origin and composition of Mercury
International Nuclear Information System (INIS)
Lewis, J.S.
1988-01-01
The predictions of the expected range of composition of Mercury at the time of its formation made on the basis of a suite of condensation-accretion models of Mercury spanning a range of condensation temperature and accretion sampling functions appropriate to Mercury are examined. It is concluded that these compositonal models can, if modified to take into account the nonselective loss of most of the silicate component of the planet during accretion, provide compositional predictions for the Weidenschilling (1978, 1980) mechanism for the accretion of a metal-rich Mercury. The silicate portion would, in this case, contain 3.6 to 4.5 percent alumina, roughly 1 percent of alkali oxides, and between 0.5 and 6 percent FeO
Energy Technology Data Exchange (ETDEWEB)
Roach, P.J.; Janicek, M.J.; Kaplan, W.D. [Dana-Farber Cancer Institute and Harvard Medical School, Boston, MA (United States)
1998-03-01
Full text: The role of {sup 201}TI scintigraphy in the assessment of bone Iymphoma is unknown {sup 201}TI may more accurately reflect tumour burden than bone scan ({sup 99m}Tc MDP) or {sup 67}Ga and may better demonstrate both response to therapy and tumour recurrence. We compared planar {sup 67}Ga (320-400 MBq) and {sup 201}TI ((80-120 MBq)) scintigraphy (18 studies) in 5 patients (age 23-56 years) with NHL involving bone (4 intermediate grade, 1 high grade) to evaluate 19 clinical or radiographically positive sites. Pairs of studies were compared to {sup 99m}Tc-MDP in two patients (5 studies). A mean of four days (range 0-20 days) intervened between studies. Site intensity was scored with respect to cardiac ({sup 201}Tl) and sternal ({sup 67}Ga) uptake and sequential changes recorded by two physicians blinded to clinical history and results of other investigations. Except for one patient, lesions were {sup 201}TI avid on baseline studies. In all patients (12 sites; 11 studies) with clinical and radiographic evidence of remission, response was demonstrated earlier and sites became normal sooner with {sup 201}TI than {sup 67}Ga. In the one patient (1 site) with biopsy-proven recurrence, thallium-201 showed recurrence earlier than {sup 67}Ga or {sup 99m}Tc-MDP. Tumour recurrence was demonstrated only by {sup 67}Ga in the one patient (3 studies; 7 sites) with high grade NHL which was {sup 201}TI negative at baseline. This small series suggests that in patients with NHL involving bone (i) {sup 201}Tl scintigraphy is more useful than {sup 67}Ga in showing response to treatment; (ii) {sup 201}TI may predict recurrence earlier than {sup 67}Ga; and (iii) {sup 201}TI may not be of use in follow-up studies if lesions are {sup 201}TI negative on baseline studies.
Studies on the tumor and organ affinity of /sup 201/Tl
Energy Technology Data Exchange (ETDEWEB)
Mori, H; Ando, I; Takeuchi, T [Kanazawa Univ. (Japan). School of Medicine; Ando, A; Hiraki, T
1980-01-01
In order to evaluate the tumor and organ affinity of /sup 201/Tl, using the Yoshida sarcoma bearing rats, the distribution of /sup 201/Tl/sup +/ in tissues and tumor was examined and compared to /sup 22/Na/sup +/, /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs/sup +/, and /sup 67/Ga-citrate. /sup 201/Tl/sup +/ showed almost same organ accumulation and kinetics as /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs, whereas /sup 201/Tl/sup +/ and /sup 22/Na/sup +/ had completely different organ distribution. These results suggest that organ affinity of /sup 201/Tl/sup +/ might be related to active transport, namely Na/sup +/-K/sup +/-ATPase pump mechanism as well as blood flow. However, it appeared to be taken into account the other factors such as different accumulation and clearance rate due to different substrates of organs. Kidney accumulation rate of /sup 201/Tl/sup +/ was much higher than /sup 42/K/sup +/, /sup 86/Rb/sup +/, /sup 134/Cs/sup +/ and about 10 times as /sup 42/K/sup +/. Macroautoradiograms of rat kidneys showed that /sup 201/Tl/sup +/ exhibited an initial high accumulation in the cortex and appeared in the outer cortex, as the cortex cleared of radioactivity. /sup 201/Tl might be interchangeable with K/sup +/ in the tubular system, reabsorbed with more affinity and cleared more slowly than K/sup +/. The tumor accumulation /sup 201/Tl/sup +/ might be related to Na/sup +/-K/sup +/-ATPase pump mechanism as well as other organs. However, in terms of tumor accumulation and concentration ratio to other organs, /sup 201/Tl/sup +/ was inferior to /sup 67/Ga-citrate, although the tumor to blood ratio was identical to that of /sup 67/Ga-citrate. Since /sup 201/Tl/sup + + +/ showed almost same distribution as /sup 201/Tl/sup +/, /sup 201/Tl/sup + + +/ might change into /sup 201/Tl/sup +/ in vivo.
Mercury migration into ground water, a literature study
Energy Technology Data Exchange (ETDEWEB)
Carlton, W.H.; Carden, J.L.; Kury, R.; Eichholz, G.G.
1994-11-01
This report presents a broad review of the technical literature dealing with mercury migration in the soil. The approach followed was to identify relevant articles by searching bibliographic data bases, obtaining the promising articles and searching these articles for any additional relevant citations. Eight catagories were used to organize the literature, with a review and summary of each paper. Catagories used were the following: chemical states of mercury under environmental conditions; diffusion of mercury vapor through soil; solubility and stability of mercury in environmental waters; transport of mercury on colloids; models for mercury migration through the environment; analytical techniques; retention of mercury by soil components; formation of organomecurials.
Global Mercury Assessment 2013
International Development Research Centre (IDRC) Digital Library (Canada)
mercury pollution. This summary report and the accompanying. Technical Background Report for the Global. Mercury Assessment 2013 are developed in response to Decision 25/5, paragraph ... The use of different pollution control technologies in different ...... vegetation, snow, freshwater, and seawater. One of the largest ...
The 1:3M geologic map of Mercury: progress and updates
Galluzzi, Valentina; Guzzetta, Laura; Mancinelli, Paolo; Giacomini, Lorenza; Malliband, Christopher C.; Mosca, Alessandro; Wright, Jack; Ferranti, Luigi; Massironi, Matteo; Pauselli, Cristina; Rothery, David A.; Palumbo, Pasquale
2017-04-01
After the end of Mariner 10 mission a 1:5M geologic map of seven of the fifteen quadrangles of Mercury [Spudis and Guest, 1988] was produced. The NASA MESSENGER mission filled the gap by imaging 100% of the planet with a global average resolution of 200 m/pixel and this led to the production of a global 1:15M geologic map of the planet [Prockter et al., 2016]. Despite the quality gap between Mariner 10 and MESSENGER images, no global geological mapping project with a scale larger than 1:5M has been proposed so far. Here we present the status of an ongoing project for the geologic mapping of Mercury at an average output scale of 1:3M based on the available MESSENGER data. This project will lead to a fuller grasp of the planet's stratigraphy and surface history. Completing such a product for Mercury is an important goal in preparation for the forthcoming ESA/JAXA BepiColombo mission to aid selection of scientific targets and to provide context for interpretation of new data. At the time of this writing, H02 Victoria [Galluzzi et al., 2016], H03 Shakespeare [Guzzetta et al., 2016] and H04 Raditladi [Mancinelli et al., 2016] have been completed and H05 Hokusai [Rothery et al., 2017], H06 Kuiper [Giacomini et al., 2017], H07 Beethoven and H10 Derain [Malliband et al., 2017] are being mapped. The produced geologic maps were merged using the ESRI ArcGIS software adjusting discontinuous contacts along the quadrangle boundaries. Contact discrepancies were reviewed and discussed among the mappers of adjoining quadrangles in order to match the geological interpretation and provide a unique consistent stratigraphy. At the current stage, more than 20% of Mercury has now a complete 1:3M map and more than 40% of the planet will be covered soon by the maps that are being prepared. This research was supported by the Italian Space Agency (ASI) within the SIMBIOSYS project (ASI-INAF agreement no. I/022/10/0). References Galluzzi V. et al. (2016). Geology of the Victoria Quadrangle (H
19 CFR 201.203 - Delegation of authority.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Delegation of authority. 201.203 Section 201.203 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt... accordance with the policies contained herein and as otherwise provided by law. ...
7 CFR 201.52 - Noxious-weed seeds.
2010-01-01
... 64499, Dec. 14, 1994] germination tests in the administration of the act ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT...
Energy Technology Data Exchange (ETDEWEB)
Terence J. McManus, Ph.D.
1999-06-30
Since approximately 55% of the electrical power produced in the U. S. is generated by coal-based power utility plants, there is serious concern about the massive amounts of coal combustion products emitted into the atmosphere annually. Furthermore, Title III of the 1990 Clean Air Act Amendments (CAAA) requires the measurement and inventory of a possible 189 hazardous air pollutants (HAPs) from any stationary source producing more than 10 tons per year of any one pollutant or more than 25 tons per year of total pollutants. Although power utilities are not presently included on the list of source categories, the CAAA requires the U. S. Environmental Protection Agency to carry out a study of emissions from electricity generation using fossil fuels. Since many of these HAPs are known to be present in coal derived flue gas, coal-fired electric power utilities may be subject to regulation following these studies if Congress considers it necessary. In a cooperative effort with the U. S. Environmental Protection Agency (EPA), the U. S. Department of Energy (DOE) through its Federal Energy Technology Center (FETC) initiated such a study in 1991. DOE-FETC commissioned five primary contractors to conduct emission studies at eight different coal-fired electric utilities. The eight sites represented a cross section of feed coal type, boiler designs, and particulate and gaseous pollutant control technologies. The major goal of these studies was to determine the sampling and analytical methodologies that could be used efficiently to perform these emission tests while producing representative and reliable emission data. The successful methodology could then be recommended to the EPA for use in compliance testing in the event the regulation of air toxic emissions from coal-fired power plants is implemented. A secondary purpose of the testing was to determine the effectiveness of the control technologies in reducing target hazardous air pollutants. Advanced Technology Systems, Inc
Mercury removal from solid mixed waste
International Nuclear Information System (INIS)
Gates, D.D.; Morrissey, M.; Chava, K.K.; Chao, K.
1994-01-01
The removal of mercury from mixed wastes is an essential step in eliminating the temporary storage of large inventories of mixed waste throughout the Department of Energy (DOE) complex. Currently thermal treatment has been identified as a baseline technology and is being developed as part of the DOE Mixed Waste Integrated Program (MWIP). Since thermal treatment will not be applicable to all mercury containing mixed waste and the removal of mercury prior to thermal treatment may be desirable, laboratory studies have been initiated at Oak Ridge National Laboratory (ORNL) to develop alternative remediation technologies capable of removing mercury from certain mixed waste. This paper describes laboratory investigations of the KI/I 2 leaching processes to determine the applicability of this process to mercury containing solid mixed waste
Coal fired flue gas mercury emission controls
Wu, Jiang; Pan, Weiguo; Pan, Weiping
2015-01-01
Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of
Thallium-201 scintigraphy in unstable angina pectoris
International Nuclear Information System (INIS)
Wackers, F.J.T.; Lie, K.I.; Liem, K.L.; Sokole, E.B.; Samson, G.; Van Der Schoot, J.B.; Durrer, D.
1978-01-01
Thallium-201 scintigraphy was performed during the pain free period in 98 patients with unstable angina. Scintiscans were positive in 39 patients, questionable in 27 patients and normal in 32 patients. Eighty-one patients responded favorably to treatment (group I). Seventeen patients had complicated courses (group II) and despite maximal treatment with propranolol either developed infarction (six patients) or continued to have angina necessitating coronary surgery (11 patients). In group I during the pain free period 26 of 81 patients had positive thallium-201 scans, whereas 20 patients had an abnormal ECG at that time; during angina 18 patients had transient ECG changes. In group II during the pain free period 13 of 17 patients had positive scans, whereas two patients had abnormal ECG at that time; during angina 12 patients showed transient ECG changes. The sensitivity to recognize group II was 76% for thallium-201 scintigraphy, 11% for ECG during the pain free period; 70% for ECG during angina; 94% for the combination of either positive scans or abnormal ECG. Thus, positive thallium-201 scans occur in patients with unstable angina, positive scans can be obtained during the pain free period, thallium-201 scans are more frequently positive in patients with complicated course
Technical report: mercury in the environment: implications for pediatricians.
Goldman, L R; Shannon, M W
2001-07-01
Mercury is a ubiquitous environmental toxin that causes a wide range of adverse health effects in humans. Three forms of mercury (elemental, inorganic, and organic) exist, and each has its own profile of toxicity. Exposure to mercury typically occurs by inhalation or ingestion. Readily absorbed after its inhalation, mercury can be an indoor air pollutant, for example, after spills of elemental mercury in the home; however, industry emissions with resulting ambient air pollution remain the most important source of inhaled mercury. Because fresh-water and ocean fish may contain large amounts of mercury, children and pregnant women can have significant exposure if they consume excessive amounts of fish. The developing fetus and young children are thought to be disproportionately affected by mercury exposure, because many aspects of development, particularly brain maturation, can be disturbed by the presence of mercury. Minimizing mercury exposure is, therefore, essential to optimal child health. This review provides pediatricians with current information on mercury, including environmental sources, toxicity, and treatment and prevention of mercury exposure.
Action of mercury as a soil fungicide
Energy Technology Data Exchange (ETDEWEB)
Booer, J R
1951-01-01
Metallic mercury and mercury compounds in the soil retard the growth of plants. The development of mosses and lichens is inhibited, and experimental evidence shows that the growth of toadstools on turf and the activity of ascomycetes is retarded by mercury. In vitro, mercury has no fungicidal action but the rate of growth of hyphae is reduced by mercury vapour. The lack of fungicial properties of mercury and its good performance in controlling certain soil-borne diseases are reconciled by assuming that a differential retardation disturbs the relationships necessary for infection. This assumption is supported by diagrams which treat the rates of growth of the parasite and the host as population characteristics normally distributed. 21 references, 10 figures, 5 tables.
7 CFR 201.54 - Number of seeds for germination.
2010-01-01
... REGULATIONS Germination Tests in the Administration of the Act § 201.54 Number of seeds for germination. At least 400 seeds shall be tested for germination; except that in mixtures, 200 seeds of each of those... 7 Agriculture 3 2010-01-01 2010-01-01 false Number of seeds for germination. 201.54 Section 201.54...
Antimicrobial activity and mechanism of the human milk-sourced peptide Casein201
International Nuclear Information System (INIS)
Zhang, Fan; Cui, Xianwei; Fu, Yanrong; Zhang, Jun; Zhou, Yahui; Sun, Yazhou; Wang, Xing; Li, Yun; Liu, Qianqi; Chen, Ting
2017-01-01
Introduction: Casein201 is one of the human milk sourced peptides that differed significantly in preterm and full-term mothers. This study is designed to demonstrate the biological characteristics, antibacterial activity and mechanisms of Casein201 against common pathogens in neonatal infection. Methodology: The analysis of biological characteristics was done by bioinformatics. Disk diffusion method and flow cytometry were used to detect the antimicrobial activity of Casein201. Killing kinetics of Casein201 was measured using microplate reader. The antimicrobial mechanism of Casein201 was studied by electron microscopy and electrophoresis. Results: Bioinformatics analysis indicates that Casein201 derived from β-casein and showed significant sequence overlap. Antibacterial assays showed Casein201 inhibited the growth of S taphylococcus aureus and Y ersinia enterocolitica. Ultrastructural analyses revealed that the antibacterial activity of Casein201 is through cytoplasmic structures disintegration and bacterial cell envelope alterations but not combination with DNA. Conclusion: We conclude the antimicrobial activity and mechanism of Casein201. Our data demonstrate that Casein201 has potential therapeutic value for the prevention and treatment of pathogens in neonatal infection.
Directory of Open Access Journals (Sweden)
Seong-Ah Kim
2016-09-01
Full Text Available From a public health perspective, there is growing concern about dietary mercury intake as the most important source of mercury exposure. This study was performed to estimate dietary mercury exposure and to analyze the association between mercury intake and blood mercury levels in Koreans. The study subjects were 553 adults, comprising a 10% representative subsample of the Korean National Environmental Health Survey (KoNEHS 2012–2014, who completed a health examination, a face-to-face interview, and a three-day food record. Dietary mercury and methylmercury intakes were assessed from the three-day food record, and blood mercury concentration was measured using a mercury analyzer. The association between dietary mercury intake and blood mercury levels was analyzed by comparing the odds ratios for the blood mercury levels above the Human BioMonitoring (HBM I value (5 μg/L among the three groups with different mercury intakes. The average total mercury intake was 4.74 and 3.07 μg/day in males and females, respectively. The food group that contributed most to mercury intake was fish and shellfish, accounting for 77.8% of total intake. The geometric mean of the blood mercury concentration significantly and linearly increased with the mercury and methylmercury intakes (p < 0.001. The odds ratios for blood mercury levels above the HBM I value in the highest mercury and methyl mercury intake group were 3.27 (95% Confidence Interval (CI 1.79–5.95 and 3.20 (95% CI 1.77–5.79 times higher than that of the lowest intake group, respectively. Our results provide compelling evidence that blood mercury level has a strong positive association with dietary intake, and that fish and shellfish contribute most to the dietary mercury exposure.
Kim, Seong-Ah; Kwon, YoungMin; Kim, Suejin; Joung, Hyojee
2016-01-01
From a public health perspective, there is growing concern about dietary mercury intake as the most important source of mercury exposure. This study was performed to estimate dietary mercury exposure and to analyze the association between mercury intake and blood mercury levels in Koreans. The study subjects were 553 adults, comprising a 10% representative subsample of the Korean National Environmental Health Survey (KoNEHS) 2012–2014, who completed a health examination, a face-to-face interview, and a three-day food record. Dietary mercury and methylmercury intakes were assessed from the three-day food record, and blood mercury concentration was measured using a mercury analyzer. The association between dietary mercury intake and blood mercury levels was analyzed by comparing the odds ratios for the blood mercury levels above the Human BioMonitoring (HBM) I value (5 μg/L) among the three groups with different mercury intakes. The average total mercury intake was 4.74 and 3.07 μg/day in males and females, respectively. The food group that contributed most to mercury intake was fish and shellfish, accounting for 77.8% of total intake. The geometric mean of the blood mercury concentration significantly and linearly increased with the mercury and methylmercury intakes (p mercury levels above the HBM I value in the highest mercury and methyl mercury intake group were 3.27 (95% Confidence Interval (CI) 1.79–5.95) and 3.20 (95% CI 1.77–5.79) times higher than that of the lowest intake group, respectively. Our results provide compelling evidence that blood mercury level has a strong positive association with dietary intake, and that fish and shellfish contribute most to the dietary mercury exposure. PMID:27598185
Human Exposure and Health Effects of Inorganic and Elemental Mercury
Park, Jung-Duck; Zheng, Wei
2012-01-01
Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability o...
47 CFR 54.201 - Definition of eligible telecommunications carriers, generally.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Definition of eligible telecommunications carriers, generally. 54.201 Section 54.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... § 54.201 Definition of eligible telecommunications carriers, generally. (a) Carriers eligible to...
20 CFR 726.201 - Insurance contracts-generally.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Insurance contracts-generally. 726.201 Section 726.201 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED BLACK LUNG BENEFITS; REQUIREMENTS FOR COAL MINE OPERATOR...
20 CFR 718.201 - Definition of pneumoconiosis.
2010-04-01
... purposes of this definition, “pneumoconiosis” is recognized as a latent and progressive disease which may... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Definition of pneumoconiosis. 718.201 Section... DEATH DUE TO PNEUMOCONIOSIS Determining Entitlement to Benefits § 718.201 Definition of pneumoconiosis...
5 CFR 294.201 - Public information policy.
2010-01-01
... Office. (b) The Assistant Director for Public Affairs carries out the public information policy of the... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Public information policy. 294.201... AVAILABILITY OF OFFICIAL INFORMATION The Public Information Function § 294.201 Public information policy. (a...
Mercury emission, control and measurement from coal combustion
Energy Technology Data Exchange (ETDEWEB)
Pan, Wei-Ping [North China Electric Power Univ., Beijing (China). School of Energy and Power Engineering; Western Kentucky Univ., Bowling Green, KY (United States). Inst. for Combustion Science and Environmental Technology; Cao, Yan [Western Kentucky Univ., Bowling Green, KY (United States). Inst. for Combustion Science and Environmental Technology; Zhang, Kai [North China Electric Power Univ., Beijing (China). School of Energy and Power Engineering
2013-07-01
Coal-fired electric power generation accounts for 65% of U.S. emissions of sulfur dioxide (SO2), 22% of nitrogen oxides (NOx), and 37% of mercury (Hg). The proposed Clear Air Interstate Rule (CAIR) and Clean Air Mercury Rule (CAMR) will attempt to regulate these emissions using a cap-and-trade program to replace a number of existing regulatory requirements that will impact this industry over the next decade. Mercury emissions remain the largest source that has not yet been efficiently controlled, in part because this is one of the most expensive to control. Mercury is a toxic, persistent pollutant that accumulates in the food chain. During the coal combustion process, when both sampling and accurate measurements are challenging, we know that mercury is present in three species: elemental, oxidized and particulate. There are three basic types of mercury measurement methods: Ontario Hydro Method, mercury continuous emission monitoring systems (CEMS) and sorbent-based monitoring. Particulate mercury is best captured by electrostatic precipitators (ESP). Oxidized mercury is best captured in wet scrubbers. Elemental mercury is the most difficult to capture, but selective catalytic reduction units (SCRs) are able to convert elemental mercury to oxidized mercury allowing it to be captured by wet flue gas desulfurization (FGD). This works well for eastern coals with high chlorine contents, but this does not work well on the Wyoming Powder River Basin (PRB) coals. However, no good explanation for its mechanism, correlations of chlorine content in coal with SCR performance, and impacts of higher chlorine content in coal on FGD re-emission are available. The combination of SCR and FGD affords more than an 80% reduction in mercury emissions in the case of high chlorine content coals. The mercury emission results from different coal ranks, boilers, and the air pollution control device (APCD) in power plant will be discussed. Based on this UAEPA new regulation, most power plants
A thin, dense crust for Mercury
Sori, Michael M.
2018-05-01
Crustal thickness is a crucial geophysical parameter in understanding the geology and geochemistry of terrestrial planets. Recent development of mathematical techniques suggests that previous studies based on assumptions of isostasy overestimated crustal thickness on some of the solid bodies of the solar system, leading to a need to revisit those analyses. Here, I apply these techniques to Mercury. Using MESSENGER-derived elemental abundances, I calculate a map of grain density (average 2974 ± 89 kg/m3) which shows that Pratt isostasy is unlikely to be a major compensation mechanism of Mercury's topography. Assuming Airy isostasy, I find the best fit value for Mercury's mean crustal thickness is 26 ± 11 km, 25% lower than the most recently reported and previously thinnest number. Several geological implications follow from this relatively low value for crustal thickness, including showing that the largest impacts very likely excavated mantle material onto Mercury's surface. The new results also show that Mercury and the Moon have a similar proportion of their rocky silicates composing their crusts, and thus Mercury is not uniquely efficient at crustal production amongst terrestrial bodies. Higher resolution topography and gravity data, especially for the southern hemisphere, will be necessary to refine Mercury's crustal parameters further.
40 CFR 721.10068 - Elemental mercury.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Elemental mercury. 721.10068 Section... Substances § 721.10068 Elemental mercury. (a) Definitions. The definitions in § 721.3 apply to this section... elemental mercury (CAS. No. 7439-97-6) is subject to reporting under this section for the significant new...
Thallium 201 thyroid scan: differential diagnosis of benign and malignant nodules
International Nuclear Information System (INIS)
Oh, Jong Sub; Kim, Byong Geun; Park, Byung Ran; Kim, Se Jong; Ko, Kang Seok; Kim, Min Joong; Ji, Joo Yun
1995-01-01
To evaluate useful findings and diagnostic value of TI-201 thyroid scan in differentiating benign from malignant nodules. We studied 77 cold thyroid nodules proven histologically(27 malignant and 50 benign). Early (5-15 min) and delayed images(3-5 hours) were obtained after intravenous injection of thallium 201. In these nodules, we retrospectively analyzed the degree of TI-201 uptake in early and delayed images, histopathologic type, size, and presence or absence of cystic change in the sonograms of 22 malignant nodules. Useful finding for diagnosis of malignant nodules was strong uptake of TI-201 in early and delayed images(specificity: 98%, sensitivity: 63%, positive predictive value: 94.4%). Useful finding for benign nodules was no uptake of TI-201 in delayed image(specificity: 88.9%, sensitivity: 68%, positive predictive value: 91.9%). The accuracy of TI-201 thyroid scan in differentiating benign from malignant nodules was 66.2%. The nodules with strong TI-201 uptake in early image and low TI-201 uptake in delayed image were malignant in 29.4%. Cystic changes were found in 40% of malignant nodules with atypical TI-201 uptake. TI-201 thyroid scan showed high specificity in follicular neoplasm and adenomatous goiter in which differentiation of benignancy and malignancy is difficult with only cytologic examination. We consider that TI-201 thyroid scan is valuable in differentiating benign from malignant nodules and when combined with fine needle aspiration and ultrasound examination, it will enable more accurate differential diagnosis between benign and malignant thyroid nodules
Studies of a Target System for a 4-MW, 24-GeV Proton Beam
2002-01-01
We propose to perform a proof-of-principle test of a target station suitable for a Neutrino Factory or Muon Collider source using a 24-GeV proton beam incident on a target consisting of a free mercury jet that is inside a 15- T capture solenoid magnet. This test could be performed in the TT2A tunnel of the nTOF proton line (upstream of the spallation target). The tests would require only $\\approx$ 100 fast-extracted pulses of full PS intensity, delivered in a pulse-on-demand mode of operation over about 2 weeks. The main piece of apparatus is the LN2-precooled, 15- T copper magnet of total volume slightly over 1 m$^{3}$ with a 15-cm-diameter warm bore. The principle diagnostic is a high-speed optical camera. The mercury jet is part of a closed mercury loop that includes an insert into the bore of the magnet.
International Nuclear Information System (INIS)
Nicolardi, Valentina; Cai, Giampiero; Parrotta, Luigi; Puglia, Michele; Bianchi, Laura; Bini, Luca; Gaggi, Carlo
2012-01-01
Lichens are an excellent model to study the bioaccumulation of heavy metals but limited information is available on the molecular mechanisms occurring during bioaccumulation. We investigated the changes of the lichen proteome during exposure to constant concentrations of mercury. We found that most of changes involves proteins of the photosynthetic pathway, such as the chloroplastic photosystem I reaction center subunit II, the oxygen-evolving protein and the chloroplastic ATP synthase β-subunit. This suggests that photosynthesis is a target of the toxic effects of mercury. These findings are also supported by changes in the content of photosynthetic pigments (chlorophyll a and b, and β-carotene). Alterations to the photosynthetic machinery also reflect on the structure of thylakoid membranes of algal cells. Response of lichens to mercury also involves stress-related proteins (such as Hsp70) but not cytoskeletal proteins. Results suggest that lichens adapt to mercury exposure by changing the metabolic production of energy. - Highlights: ► Lichens exposed to Hg° vapors accumulate this metal irreversibly. ► Hg° interferes with physiological processes of the epiphytic lichen Evernia prunastri. ► Hg° promotes changes in the concentration of photosynthetic pigments. ► Hg° treatment causes changes in the ultrastructure of the photobiont plastids. ► Hg° induces changes in the protein machinery involved in the photosynthesis pathway. - Mercury affects the photosynthetic protein machinery of lichens.