WorldWideScience

Sample records for mercury 201 target

  1. Fabrication of mercury target vessel

    International Nuclear Information System (INIS)

    Wakui, Takashi; Kogawa, Hiroyuki; Haga, Katsuhiro; Futakawa, Masatoshi; Hayashi, Ryoichi; Uchiyama, Naoyoshi; Okamoto, Yoshinao; Nakamura, Koji

    2010-03-01

    The construction of materials and life science experimental facility in J-PARC (Japan Proton Accelerator Complex) project had been completed and accepted pulsed proton beams with low power. Since 2003, the detailed design, fabrication and examination for the mercury target vessel as a pulsed neutron source were carried out by the vender. The mercury target vessel consists of triple-walled structure in order to prevent the leak of mercury to outside at the failure of the mercury vessel and to remove the heat of the safety hull, which covers the mercury vessel, due to the injection of the pulsed proton beams. The high fabrication accuracy is required for the mercury target vessel assembled by the welding, because there are the relationships between the mercury target vessel and other components (target trolley, target storage container, flange of helium vessel, reflector and water-cooled shield). At each fabrication step, the examinations for the mercury target vessel with multi-walled structure were required. In this report, the required specification and basic structure of parts in the mercury target vessel are described and the fabrication procedure of the mercury target vessel by the vender is reported. In the fabrication of the mercury target vessel, there were many troubles such as large deformation due to the welding and then the vender repaired and brought the mercury target vessel to completion. Furthermore, improvements for the design and fabrication of the mercury target are reported. (author)

  2. Studies on the preparation of thallium-201 by irradiating mercury with protons using extraction chromatography technique to separate thallium from mercury

    International Nuclear Information System (INIS)

    Fernandes, L.

    1990-01-01

    Radionuclide sup(201)Tl is used in Nuclear Medicine to identify myocardial ischemia or myocardial infarct. It is a cyclotron-produced radioisotope, obtained indirectly from the decay of sup(202)Pb or directly by irradiating mercury with deuterons or protons. The usual technique to prepare sup(201)Tl makes use of the nuclear reaction: sup(203)(p,3n) → sup(201)Tl, which requires proton energy of around 28 MeV. Due to the limited proton energy of IPEN'S CV-28 cyclotron, studies on the irradiating conditions of natural mercury oxide pellets and drops of natural mercury metal were made in the range of 19 - 24 MeV. At the end of the bombardment of a 6 MeV thickness target of natural mercury metal with 19 MeV protons around 10 MBq sup(201)Tl/μ A h was obtained. (author)

  3. 7 CFR 201.58c - Detection of captan, mercury, or thiram on seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Detection of captan, mercury, or thiram on seed. 201.58c Section 201.58c Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL... Detection of captan, mercury, or thiram on seed. The bioassay method may be used according to the procedure...

  4. Mercury erosion experiments for spallation target system

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro

    2003-01-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a plan to construct the spallation neutron source at the Tokai Research Establishment, JAERI, under the High-Intensity Proton Accelerator Project (J-PARC). A mercury circulation system has been designed so as to supply mercury to the target stably under the rated flow rate of 41 m 3 /hr. Then, it was necessary to confirm a mercury pump performance from the viewpoint of making the mercury circulation system feasible, and more, to investigate erosion rate under the mercury flow as well as an amount of mercury remained on the surface after drain from the viewpoints of mechanical strength relating to the lifetime and remote handling of mercury components. The mercury pump performance was tested under the mercury flow conditions by using an experimental gear pump, which had almost the same structure as a practical mercury pump to be expected in the mercury circulation system, and the erosion rates in a mercury pipeline as well as the amount of mercury remained on the surface were also investigated. The discharged flow rates of the experimental gear pump increased linearly with the rotation speed, so that the gear pump would work as the flow meter. Erosion rates obtained under the mercury velocity less than 1.6 m/s was found to be so small that decrease of pipeline wall thickness would be 390 μm after 30-year operation under the rated mercury velocity of 0.7 m/s. For the amount of remaining mercury on the pipeline, remaining rates of weight and volume were estimated at 50.7 g/m 2 and 3.74 Hg-cm 3 /m 2 , respectively. Applying these remaining rates of weight and volume to the mercury target, the remaining mercury was estimated at about 106.5 g and 7.9 cm 3 . Radioactivity of this remaining mercury volume was found to be three-order lower than that of the target casing. (author)

  5. Radiochemical aspects of liquid mercury spallation targets

    CERN Document Server

    Neuhausen, Joerg; Eichler, Bernd; Eller, Martin; Horn, Susanne; Schumann, Dorothea; Stora, Thierry

    2012-01-01

    Liquid metal spallation targets using mercury as target material are used in state-of-the-art high power pulsed neutron sources that have been constructed in the USA and Japan within the last decade. Similar target concepts were also proposed for next generation ISOL, beta-beam and neutrino facilities. A large amount of radioactivity will be induced in the liquid metal during operation caused by the interaction of the target material with the intense proton beam. This radioactivity - carried by a wide range of radioisotopes of all the elements of the periodic table from hydrogen up to thallium - must be considered for the assessment of safe operation and maintenance procedures as well as for a final disposal of the used target material and components. This report presents an overview on chemical investigations performed in our laboratory that deal with the behavior of radionuclides in proton irradiated mercury samples. The solubility of elements in mercury was calculated using thermodynamical data obtained by...

  6. A self-focusing mercury jet target

    CERN Document Server

    Johnson, C

    2002-01-01

    Mercury jet production targets have been studied in relation to antiproton production and, more recently, pion production for a neutrino factory. There has always been a temptation to include some self-focusing of the secondaries by passing a current through the mercury jet analogous to the already proven lithium lens. However, skin heating of the mercury causes fast vaporization leading to the development of a gliding discharge along the surface of the jet. This external discharge can, nevertheless, provide some useful focusing of the secondaries in the case of the neutrino factory. The technical complications must not be underestimated.

  7. Methods of thallium-201 preparation from proton irradiated thallium targets

    International Nuclear Information System (INIS)

    Kozlova, M.D.; Sevast'yanova, A.S.; Malinin, A.B.; Kurenkov, N.V.

    1989-01-01

    Two methods of thallium-201 preparation from Tl-targets irradiated by protons: oxidation-extraction (1) and extraction (2) - are developed. At first radioactive lead is separated from the target material - thallium macroquantities during ∼32 hours, then thallium-201 was separated from residual activity of lead radioisotopes and transformed it into the necessary chemical formula. The 1st and 2nd methods differ from each other by the 1st stage of target retreatment; only extraction was used to separate radioactive lead in the 2nd method. The target was solved in H 2 SO 4 . The 1st method permits to separate thallium-201 with chemical yield not less than 90 %, the 2nd one - higher than 95 %. Volumetric activity of thallium-201 prepared is more than 55 MBq/ml. 5 refs

  8. Activation calculation of the EURISOL mercury target

    Energy Technology Data Exchange (ETDEWEB)

    Rapp, B.; David, J.C.; Blideanu, V.; Dore, D.; Ridikas, D.; Thiolliere, N

    2006-08-15

    We have used MCNPX coupled to CINDER to estimate the production of radioactive nuclides in the EURISOL 4 MW liquid mercury target during a 40 years'lifetime of the installation. The calculations have been done with different intra-nuclear cascade and fission evaporation model combinations. A benchmark exercise has allowed a better understanding of differences seen between these models for the creation of tritium and fission products. To obtain a realistic production yield for tritium gas in proton induced spallation reactions, we recommend using the ISABEL-RAL model, while both CEM2k and BERTINI-RAL overestimate the production rate above 1 GeV incident proton. The best combinations of models to calculate the residual nuclei production are those using ABLA fission-evaporation model, CEM2k or combinations using RAL model are giving too broad mass distributions when compared to available data. An extensive list of radio-nuclides was obtained and is available on tabular format, we show that the 4 nuclei whose contributions to the total activity of the mercury target (after 40 years of irradiation) are the most important are the following: -) 1 day after shutdown: Y{sup 91} (15%), Y{sup 90} (13%), Hg{sup 197} (6%) and Sr{sup 89} (5%); -) 1 year after shutdown: H{sup 3} (19%), Y{sup 90} (17%), Sr{sup 90} (17%) and Nb{sup 93*} (10%); -) 10 years after shutdown: Y{sup 90} (22%), Sr{sup 90} (22%), H{sup 3} (18%) and Nb{sup 93*} (14%); and -) 100 years after shutdown: Mo{sup 93} (34%), Nb{sup 93*} (32%), Pt{sup 193} (9%) and Y{sup 90} (8%). (A.C.)

  9. Thermal shocks and magnetohydrodynamics in high power mercury jet targets

    CERN Document Server

    Lettry, Jacques; Gilardoni, S S; Benedikt, Michael; Farhat, M; Robert, E

    2003-01-01

    The response of mercury samples submitted to a pulsed proton beam and the magnetohydrodynamic (MHD) effects of a mercury jet injected into a 20 T magnetic field are reported. The experimental conditions differ from those of proposed neutrino factories and the purpose of these measurements is to provide benchmarks for simulation tools of a realistic free mercury jet target. These measurements were completed in June 2002. Analysis is ongoing and the presented results are preliminary. (12 refs).

  10. Evidence of mercury trapping in biofilm-EPS and mer operon-based volatilization of inorganic mercury in a marine bacterium Bacillus cereus BW-201B.

    Science.gov (United States)

    Dash, Hirak R; Basu, Subham; Das, Surajit

    2017-04-01

    Biofilm-forming mercury-resistant marine bacterium Bacillus cereus BW-201B has been explored to evident that the bacterial biofilm-EPS (exopolymers) trap inorganic mercury but subsequently release EPS-bound mercury for induction of mer operon-mediated volatilization of inorganic mercury. The isolate was able to tolerate 50 ppm of mercury and forms biofilm in presence of mercury. mer operon-mediated volatilization was confirmed, and -SH was found to be the key functional group of bacterial EPS responsible for mercury binding. Biofilm-EPS-bound mercury was found to be internalized to the bacterial system as confirmed by reversible conformational change of -SH group and increased expression level of merA gene in a timescale experiment. Biofilm-EPS trapped Hg after 24 h of incubation, and by 96 h, the volatilization process reaches to its optimum confirming the internalization of EPS-bound mercury to the bacterial cells. Biofilm disintegration at the same time corroborates the results.

  11. Solubility of helium in mercury for bubbling technology of the spallation neutron mercury target

    International Nuclear Information System (INIS)

    Hasegawa, S.; Naoe, T.; Futakawa, M.

    2010-01-01

    The pitting damage of mercury target container that originates in the pressure wave excited by the proton beam incidence becomes a large problem to reach the high-power neutron source in JSNS and SNS. The lifetime of mercury container is decreased remarkably by the pitting damage. As one of solutions, the pressure wave is mitigated by injecting the helium micro bubbles in mercury. In order to inject the helium micro bubbles into mercury, it is important to understand the characteristic of micro bubbles in mercury. The solubility of mercury-helium system is a key factor to decide bubbling conditions, because the disappearance behavior, i.e. the lifetime of micro bubbles, depends on the solubility. In addition, the bubble generation method is affected by it. Moreover, the experimental data related to the solubility of helium in mercury hardly exist. In this work, the solubility was obtained experimentally by measuring precisely the pressure drop of the gas that is facing to mercury surface. The pressure drop was attributed to the helium dissolution into mercury. Based on the measured solubility, the lifetime of micro bubbles and the method of the bubble generation is estimated using the solubility data.

  12. Support Facility for a Mercury Target Neutrino Factory

    Energy Technology Data Exchange (ETDEWEB)

    Spampinato, P.T.

    2001-12-06

    A conceptual design for a neutrino-producing facility is presented, including the mercury-jet target system, beam absorber, and facility for the target/capture region. The mercury system is a closed loop that includes a containment structure in the high-magnetic field region, a mercury pool beam absorber, conventional equipment such as magnetic-coupled pumps, valves, a heat exchanger, and a special nozzle insert. The superconducting solenoids in the target region are protected from nuclear heating and radiation damage with water-cooled tungsten-carbide shielding; the decay channel solenoids are protected with water-cooled steel shielding. The target region and decay channel have high-neutron fluxes resulting in components that are highly activated. Therefore, the facility configuration is based on remotely maintaining the target system and the magnets, as well as providing sufficient shielding for personnel. Summaries of cost estimates for the target system, magnet shielding, maintenance equipment, and the facility are also presented.

  13. Off-line tests on pitting damage in mercury target

    CERN Document Server

    Futakawa, M; Ishikura, S; Kogawa, H; Tsai, C C

    2003-01-01

    A liquid-mercury target system for the MW-scale target is being developed in the world. The moment the proton beams bombard the target, stress waves will be imposed on the beam window and pressure waves will be generated in the mercury by the thermally shocked heat deposition. Provided that the negative pressure generates through its propagation in the mercury target and causes cavitation in the mercury, there is the possibility for the cavitation bubbles collapse to form pits on the interface between the mercury and the target vessel wall. In order to estimate the cavitation erosion damage due to pitting, two types of off-line tests were performed: Split Hopkinson Pressure Bar (SHPB), and Magnetic IMpact Testing Machine (MIMTM). The data on the piping damage at the high cycle impacts up to 10 million were given by the MIMTM. Additionally the data obtained were compared with classical vibratory horn tests. As a result, it is confirmed that the mean depth erosion is predictable using a homologous line in the s...

  14. Structural integrity of beam window of mercury target

    International Nuclear Information System (INIS)

    Kogawa, Hiroyuki; Ishikura, Syuichi; Futakawa, Masatoshi; Kaminaga, Masanori; Hino, Ryutaro

    2003-01-01

    The developments of a MW-class spallation neutron source facility are being carried out under the high-intensity proton accelerator project promoted by JAERI and KEK. A mercury target will be used as a neutron source in the facility. The mercury target vessel made of 316LSS will be subjected to pressure wave generated by rapid thermal expansion of mercury due to a pulsed proton beam injection. The pressure wave will make huge dynamic stress on the vessel and will deform the vessel, which would cause cavitation in mercury. To estimate the structural integrity of the mercury target vessel, especially beam window, dynamic stress behaviors due to 1 MW-pulsed proton beam injection were analyzed by using FEM code. In the analyses, two types of the target vessels with semi-cylindrical and flat type windows were used as analytical models. As the results, it has been understood that the stress generated in the beam window by the pressure wave could be treated as the secondary stress. Also it was confirmed that the flat type window would be more advantageous from the structural viewpoint than the semi-cylindrical type window. (author)

  15. Proton induced reactions on natural Pb targets. A potential new cyclotron method for 201Tl production

    International Nuclear Information System (INIS)

    Lagunas-Solar, M.C.; Little, F.E.; Jungerman, J.A.

    1981-01-01

    The basis for a new cyclotron method for production of no-carrier-added 201 Tl, from its grandparent 201 Bi via the Pb(p,xn) 201 Bi → 201 Pb → 201 Tl reaction is presented here. Thick-target yields (μCi/μAh) for the 201 Pb and 200 Pb induced radioactivities were measured over the 65- to 43-MeV proton-energy range. The experimental data indicate that the 201 Tl yields could be optimized by using Pb targets enriched in 206 Pb, 207 Pb, and, or 208 Pb, which are expected to provide greater overall yields than current methods, as well as material of high-chemical, radiochemical and radionuclidic quality for radiopharmaceutical production. (author)

  16. Recovery of 201Tl by ion exchange chromatography from proton bombarded thallium cyclotron targets

    International Nuclear Information System (INIS)

    Walt, T.N. van der; Naidoo, C.

    2000-01-01

    A method based on ion exchange chromatography is presented for the recovery of 201 Tl and its precursor 201 Pb from proton bombarded natural thallium cyclotron targets. After bombardment the target is dissolved in diluted nitric acid. Water, hydrazine and ammonium acetate are added to the solution and the lead radioisotopes separated from the thallium by cation exchange chromatography on a Bio-Rex 70 column. The sorbed lead radioisotopes are eluted with dilute nitric acid and the separation repeated on a second Bio-Rex 70 column. After elution of the remaining thallium the column is left for 32 hours and the 201 Tl formed by decay of 201 Pb is eluted with an ammonium acetate solution. The 201 Tl eluate is acidified with a HNO 3 -HBr-Br 2 mixture and the resulting solution is passed through an AG MP-1 anion exchanger column to remove any remaining lead isotopes. The 201 Tl is eluted with a hydrazine solution, the eluate evaporated to dryness and the 201 Tl finally dissolved in an appropriate solution to produce a 201 TlCl solution suitable for medical use. A high quality 201 Tl product is obtained containing ≤ 0.1 μg of Tl/mCi (37 MBq) 201 Tl. The radionuclidic impurities are less than the maximum values specified by the US Pharmacopoeia and the British Pharmacopoeia. (orig.)

  17. Mercury

    International Nuclear Information System (INIS)

    Vilas, F.; Chapman, C.R.; Matthews, M.S.

    1988-01-01

    Papers are presented on future observations of and missions to Mercury, the photometry and polarimetry of Mercury, the surface composition of Mercury from reflectance spectrophotometry, the Goldstone radar observations of Mercury, the radar observations of Mercury, the stratigraphy and geologic history of Mercury, the geomorphology of impact craters on Mercury, and the cratering record on Mercury and the origin of impacting objects. Consideration is also given to the tectonics of Mercury, the tectonic history of Mercury, Mercury's thermal history and the generation of its magnetic field, the rotational dynamics of Mercury and the state of its core, Mercury's magnetic field and interior, the magnetosphere of Mercury, and the Mercury atmosphere. Other papers are on the present bounds on the bulk composition of Mercury and the implications for planetary formation processes, the building stones of the planets, the origin and composition of Mercury, the formation of Mercury from planetesimals, and theoretical considerations on the strange density of Mercury

  18. Preparation of thallium 201 from enriched thallium targets using U-240 cyclotron

    International Nuclear Information System (INIS)

    Klyuchnikov, A.A.; Ageev, V.A.; Sazhenyuk, A.D.; Odintsov, A.A.; Demekhin, V.L.

    1989-01-01

    Possibility of thallium-201 preparation from enriched thallium targets (thallium-203 and 205) under proton irradiation at isochronous cyclotron U-240 is studied. Excitation functions of nuclear reactions, on which commercial method of thallium-201 preparation is based, are determined experimentally for the given conditions of irardiation. Perspectivity of multilayer targets application under proton irradiation in the energy range from 20 to 55 MeV is shown. Experimental thallium-201 quantities have been prepared by target set irradiation, consisting of lead-206, thallium-205 and thallium-203 with further extracting separation of a product

  19. Optical diagnostics of mercury jet for an intense proton target.

    Science.gov (United States)

    Park, H; Tsang, T; Kirk, H G; Ladeinde, F; Graves, V B; Spampinato, P T; Carroll, A J; Titus, P H; McDonald, K T

    2008-04-01

    An optical diagnostic system is designed and constructed for imaging a free mercury jet interacting with a high intensity proton beam in a pulsed high-field solenoid magnet. The optical imaging system employs a backilluminated, laser shadow photography technique. Object illumination and image capture are transmitted through radiation-hard multimode optical fibers and flexible coherent imaging fibers. A retroreflected illumination design allows the entire passive imaging system to fit inside the bore of the solenoid magnet. A sequence of synchronized short laser light pulses are used to freeze the transient events, and the images are recorded by several high speed charge coupled devices. Quantitative and qualitative data analysis using image processing based on probability approach is described. The characteristics of free mercury jet as a high power target for beam-jet interaction at various levels of the magnetic induction field is reported in this paper.

  20. Estimation of thermochemical behavior of spallation products in mercury target

    International Nuclear Information System (INIS)

    Kobayashi, Kaoru; Kaminaga, Masanori; Haga, Katsuhiro; Kinoshita, Hidetaka; Aso, Tomokazu; Teshigawara, Makoto; Hino, Ryutaro

    2002-02-01

    In order to examine the radiation safety of a spallation mercury target system, especially source term evaluation, it is necessary to clarify the chemical forms of spallation products generated by spallation reaction with proton beam. As for the chemical forms of spallation products in mercury that involves large amounts of spallation products, these forms were estimated by using the binary phase diagrams and the thermochemical equilibrium calculation based on the amounts of spallation product. Calculation results showed that the mercury would dissolve Al, As, B, Be, Bi, C, Co, Cr, Fe, Ga, Ge, Ir, Mo, Nb, Os, Re, Ru, Sb, Si, Ta, Tc, V and W in the element state, and Ag, Au, Ba, Br, Ca, Cd, Ce, Cl, Cs, Cu, Dy, Er, Eu, F, Gd, Hf, Ho, I, In, K, La, Li, Lu, Mg, Mn, Na, Nd, Ni, O, Pb, Pd, Pr, Pt, Rb, Rh, S, Sc, Se, Sm, Sn, Sr, Tb, Te, Ti, Tl, Tm, Y, Yb, Zn and Zr in the form of inorganic mercury compounds. As for As, Be, Co, Cr, Fe, Ge, Ir, Mo, Nb, Os, Pt, Re, Ru, Se, Ta, V, W and Zr, precipitation could be occurred when increasing the amounts of spallation products with operation time of the spallation target system. On the other hand, beryllium-7 (Be-7), which is produced by spallation reaction of oxygen in the cooling water of a safety hull, becomes the main factor of the external exposure to maintain the cooling loop. Based on the thermochemical equilibrium calculation to Be-H 2 O binary system, the chemical forms of Be in the cooling water were estimated. Then the Be could exist in the form of cations such as BeOH + , BeO + and Be 2+ under the condition of less than 10 -8 of the Be mole fraction in the cooling water. (author)

  1. Estimation of thermochemical behavior of spallation products in mercury target

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Kaoru; Kaminaga, Masanori; Haga, Katsuhiro; Kinoshita, Hidetaka; Aso, Tomokazu; Teshigawara, Makoto; Hino, Ryutaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-02-01

    In order to examine the radiation safety of a spallation mercury target system, especially source term evaluation, it is necessary to clarify the chemical forms of spallation products generated by spallation reaction with proton beam. As for the chemical forms of spallation products in mercury that involves large amounts of spallation products, these forms were estimated by using the binary phase diagrams and the thermochemical equilibrium calculation based on the amounts of spallation product. Calculation results showed that the mercury would dissolve Al, As, B, Be, Bi, C, Co, Cr, Fe, Ga, Ge, Ir, Mo, Nb, Os, Re, Ru, Sb, Si, Ta, Tc, V and W in the element state, and Ag, Au, Ba, Br, Ca, Cd, Ce, Cl, Cs, Cu, Dy, Er, Eu, F, Gd, Hf, Ho, I, In, K, La, Li, Lu, Mg, Mn, Na, Nd, Ni, O, Pb, Pd, Pr, Pt, Rb, Rh, S, Sc, Se, Sm, Sn, Sr, Tb, Te, Ti, Tl, Tm, Y, Yb, Zn and Zr in the form of inorganic mercury compounds. As for As, Be, Co, Cr, Fe, Ge, Ir, Mo, Nb, Os, Pt, Re, Ru, Se, Ta, V, W and Zr, precipitation could be occurred when increasing the amounts of spallation products with operation time of the spallation target system. On the other hand, beryllium-7 (Be-7), which is produced by spallation reaction of oxygen in the cooling water of a safety hull, becomes the main factor of the external exposure to maintain the cooling loop. Based on the thermochemical equilibrium calculation to Be-H{sub 2}O binary system, the chemical forms of Be in the cooling water were estimated. Then the Be could exist in the form of cations such as BeOH{sup +}, BeO{sup +} and Be{sup 2+} under the condition of less than 10{sup -8} of the Be mole fraction in the cooling water. (author)

  2. Mercury

    NARCIS (Netherlands)

    de Vries, Irma

    2017-01-01

    Mercury is a naturally occurring metal that exists in several physical and chemical forms. Inorganic mercury refers to compounds formed after the combining of mercury with elements such as chlorine, sulfur, or oxygen. After combining with carbon by covalent linkage, the compounds formed are called

  3. Investigation of flow asymmetry and instability in the liquid mercury target of the Spallation Neutron Source

    International Nuclear Information System (INIS)

    Pointer, D.; Ruggles, A.; Wendel, M.; Crye, J.

    2000-01-01

    The Spallation Neutron Source (SNS) will utilize a liquid mercury target placed in the path of a high-energy proton beam to produce neutrons for research activities. As the high-energy protons interact with the mercury target, the majority of the beam energy is converted to thermal energy. The liquid mercury must provide sufficient heat transfer to maintain the temperature of the target structure within the thermal limits of the structural materials. Therefore, the behavior of the liquid mercury flow must be characterized in sufficient detail to ensure accurate evaluation of heat transfer in the mercury target. A combination of experimental and computational methods is utilized to characterize the flow in these preliminary analyses. Preliminary studies of the liquid mercury flow in the SNS target indicate that the flow in the exit channel may exhibit multiple recirculation zones, flow asymmetries, and possibly large-scale flow instabilities. While these studies are not conclusive, they serve to focus the efforts of subsequent CFD modeling and experimental programs to better characterize the flow patterns in the SNS mercury target

  4. System dynamic analyses on the JKJ mercury target and cold moderator systems

    International Nuclear Information System (INIS)

    Takahashi, Toshio; Kaminaga, Masanori; Kinoshita, Hidetaka; Aso, Tomokazu; Haga, Katsuhiro; Hino, Ryutaro

    2001-01-01

    The temperature responses of major points in a mercury target cooling system and in a cold moderator system of JKJ (JAERI/KEK Joint Project) were simulated by the analytical code MATLAB (SIMULINK). As a result, it was made clear that non-control of mercury temperature is the best way to control the mercury target cooling system. If the mercury temperature of the system is controlled by the PID control system using an outlet temperature of heat exchanger, the PID control system shows the characteristics of an on-off control system, and the temperature cannot be controlled. Analytical results also showed that mercury temperature remained below the boiling point of 356degC under 0.1 MPa during a transient at one cooling pump trip. Analytical results for the cold moderator system showed that the outlet temperature of cold moderator vessels could be kept within a temperature range of 1 k during steady-state conditions. (author)

  5. CALCULATIONS FOR A MERCURY JET TARGET IN A SOLENOID MAGNET CAPTURE SYSTEM

    International Nuclear Information System (INIS)

    GALLARDO, J.; KAHN, S.; PALMER, R.B.; THIEBERGER, P.; WEGGEL, R.J.; MCDONALD, K.

    2001-01-01

    A mercury jet is being considered as the production target for a muon storage ring facility to produce an intense neutrino beam. A 20 T solenoid magnet that captures pions for muon production surrounds the mercury target. As the liquid metal jet enters or exits the field eddy currents are induced. We calculate the effects that a liquid metal jet experiences in entering and exiting the magnetic field for the magnetic configuration considered in the Neutrino Factory Feasibility Study II

  6. Mercury

    Science.gov (United States)

    ... build up in fish, shellfish, and animals that eat fish. The nervous system is sensitive to all forms of mercury. Exposure to high levels can damage the brain and kidneys. Pregnant women can pass the mercury in their bodies to their babies. It is important to protect your family from ...

  7. Mercury

    Science.gov (United States)

    ... has set a limit of 2 parts of mercury per billion parts of drinking water (2 ppb). The Food and Drug Administration (FDA) has set a maximum permissible level of 1 part of methylmercury in a million ... of 0.1 milligram of organic mercury per cubic meter of workplace air (0.1 ...

  8. Mockup experiments to investigate the leak rate correlation between mercury and helium for the mercury target system of J-PARC

    International Nuclear Information System (INIS)

    Haga, Katsuhiro; Naoe, Takashi; Kogawa, Hiroyuki; Wakui, Takashi; Futakawa, Masatoshi

    2009-01-01

    Checking the seal performance of the mercury piping network is very important for the mercury target system operation of J-PARC, and the test method for leaks using the pressure change measurement is preferable for this purpose because it can be carried out easily and precisely by measuring the pressure change, and it is free from the risk of mercury contamination. The piping network is pressurized by helium gas. Thus, the correlation between the helium leak rate and mercury leak flow rate was investigated experimentally by carrying out leak tests for helium and mercury with an identical mockup flange model. The results showed that the mercury leak flow rates of the experimental data were lower than those of the estimated value by 64% on average. It was also found that the threshold of the helium leak rate at which good seal performance for mercury can be obtained exists between 2.18 x 10 -4 and 1.01 x 10 -2 Pa.m 3 /s. This fact confirmed the sufficient safety margin of the mercury target system against the mercury leak, where 1 x 10 -6 Pa.m 3 /s was adopted as the seal performance criterion. (author)

  9. Optimization of a mercury jet target for a neutrino factory or a muon collider

    Directory of Open Access Journals (Sweden)

    X. Ding

    2011-11-01

    Full Text Available A study of target parameters for a mercury jet target for a neutrino factory or muon collider is presented. We simulate particle production initiated by incoming protons with kinetic energies between 2 and 100 GeV. For each proton beam kinetic energy, we maximize production by varying the geometric parameters of the target: the mercury jet radius, the incoming proton beam angle, and the crossing angle between the mercury jet and the proton beam. With an 8-GeV proton beam, we study the variation of meson production with the entry direction of the proton beam relative to the jet. We also examine the influence on the meson production by the focusing of the proton beam. The number of muons surviving through the neutrino factory front end channel is determined as a function of the proton beam kinetic energy.

  10. Study to prepare 201Tl by irradiation of mercury with protons. Application of extraction chromatography technique in separation of thallium and mercury

    International Nuclear Information System (INIS)

    Fernandes, L.; Silva, C.P.G. da

    1986-01-01

    The extraction chromatography technique was used for the lig and 201 Tl separation. It was used glass columns of 5,0 cm height and 1,0 cm diameter filled with Voltalef powder impregnated with TBP/cyclohexane. By the Voltalef columns solutions of 203 Hg 2+ , 201 Tl 1+ and 20 1Te 3 were separately percolated in a nitric environment of 4 to 8 M concentration and in a hydrochloridric environment of 0,5 to 4 M. The separation of Hg and 201 Tl was obtained by the retention of 201 Tl3 + in the column during the elution of all the Hg with HCl 2 M. The 201 Tl 3+ was eluted from the column after its reduction with a hot hydrazine dichloride solution. (Author) [pt

  11. Mercury

    CERN Document Server

    Balogh, André; Steiger, Rudolf

    2008-01-01

    Mercury, the planet closest to the Sun, is different in several respects from the other three terrestrial planets. In appearance, it resembles the heavily cratered surface of the Moon, but its density is high, it has a magnetic field and magnetosphere, but no atmosphere or ionosphere. This book reviews the progress made in Mercury studies since the flybys by Mariner 10 in 1974-75, based on the continued research using the Mariner 10 archive, on observations from Earth, and on increasingly realistic models of its interior evolution.

  12. CFD analysis of a liquid mercury target for the National Spallation Neutron Source

    International Nuclear Information System (INIS)

    Wendel, M.W.; Tov, M.S.

    1997-01-01

    Computational fluid dynamics (CFD) is being used to analyze the design of the National Spallation Neutron Source (NSNS) target. The target is subjected to the neutronic (internal) heat generation that results from the proton collisions with the mercury nuclei. The liquid mercury simultaneously serves as the neutronic target medium, transports away the heat generated within itself, and cools the metallic target structure. Recirculation and stagnation zones within the target are of particular concern because of the likelihood that they will result in local hot spots. These zones exist because the most feasible target designs include a complete U-turn flow redirection. Although the primary concern is that the target is adequately cooled, the pressure drop from inlet to outlet must also be considered because pressure drop directly affects structural loading and required pumping power. Various design options have been considered in an effort to satisfy these design criteria. Significant improvements to the design have been recommended based on the results. Detailed results are presented for the current target design including a comparison with published pressure-drop data. Comparisons are also made with forced convection heat transfer data for liquid mercury flow in circular tubes

  13. The Merit(nTOF-11) High Intensity Liquid Mercury Target Experiment at the CERN PS

    CERN Document Server

    Efthymiopoulos, I; Caretta, O; Carroll, A J; Fabich, A; Graves, V B; Grudiev, A; Haug, F; Kirk, H G; Lettry, Jacques; Loveridge, P; McDonald, K T; Mokhov, N; Palm, M; Park, H; Pernegger, H; Spampinato, P T; Steerenberg, R; Striganov, S; Tsang, T

    2008-01-01

    The MERIT(nTOF-11) experiment is a proof-ofprinciple test of a target system for a high power proton beam to be used as front-end for a neutrino factory or a muon collider. The experiment took data in autumn 2007 with the fast-extracted beam from the CERN Proton Synchrotron (PS) to a maximum intensity of $30 × 10^{12}$ per pulse. The target system, based on a free mercury jet, is capable of intercepting a 4-MW proton beam inside a 15-T magnetic field required to capture the low energy secondary pions as the source for intense muon beams. Partice detectors installed around the target setup measure the secondary particle flux out of the target and can probe cavitation effects in the mercury jet when excited by an intense proton beam.Preliminary results of the data analysis will be presented here.

  14. Production of 201Tl

    International Nuclear Information System (INIS)

    Braghirolli, A.M.S.; Silva, A.G. da; Teixeira, F.C.M.; Costa e Silva, A.; Souza, A.S.F. de

    1981-01-01

    The obtention of 201 Tl, free of charger and impurities, with large target yield of 1,7 mCi/μAh of 201 Pb, precursory of 201 Tl, and with 93% yield for chemical separation of 201 Tl, is related. (E.G.) [pt

  15. Thermal shock analysis of liquid-mercury spallation target

    CERN Document Server

    Ishikura, S; Futakawa, M; Hino, R; Date, H

    2002-01-01

    The developments of the neutron scattering facilities are carried out under the high-intensity proton accelerator project promoted by JAERI and KEK. To estimate the structural integrity of the heavy liquid-metal (Hg) target used as a spallation neutron source in a MW-class neutron scattering facility, dynamic stress behavior due to the incident of a 1 MW-pulsed proton beam was analyzed by using FEM code. Two-type target containers with semi-cylindrical type and flat-plate type window were used as models for analyses. As a result, it is confirmed that the stress (pressure wave) generated by dynamic thermal shock becomes the largest at the center of window, and the flat-plate type window is more advantageous from the structural viewpoint than the semi-cylindrical type window. It has been understood that the stress generated in the window by the pressure wave can be treated as the secondary stress. (author)

  16. Mercury purification in the megawatt liquid metal spallation target of EURISOL-DS

    CERN Document Server

    Neuhausen, Joerg; Eller, Martin; Schumann, Dorothea; Eichler, Bernd; Horn, Susanne

    High power spallation targets are going to be used extensively in future research and technical facilities such as spallation neutron sources, neutrino factories, radioactive beam facilities or accelerator driven systems for the transmutation of long-lived nuclear waste. Within EURISOL-DS, a 4 MW liquid metal spallation target is designed to provide neutrons for a fission target, where neutron rich radionuclides will be produced. For the spallation target, mercury is planned to be used as target material. A large amount of radionuclides ranging from atomic number Z=1 to 81 will be produced in the liquid metal during long term irradiation. It is planned to remove those radionuclides by chemical or physicochemical methods to reduce its radioactivity. For the development of a purification procedure, knowledge about the chemical state of the different elements present in the mixture is required. We present a general concept of applicable separation techniques in a target system and show some results of experiment...

  17. Thermal-hydraulic design of cross-flow type mercury target for JAERI/KEK joint project

    International Nuclear Information System (INIS)

    Kaminaga, Masanori; Terada, Atsuhiko; Haga, Katsuhiro; Kinoshita, Hidetaka; Hino, Ryutaro

    2001-01-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a plan to construct a neutron scattering facility. In the facility, 1 MW pulsed proton beam from a high-intensity proton accelerator will be injected into a mercury target in order to produce high-intensity neutrons for use in the fields of life and material sciences. In the spallation mercury target system design, an integrated structure of target vessel with a safety hull was proposed to ensure the safety and to collect mercury in case of mercury leakage caused by the target beam window failure. The inner structure arrangement of the mercury target vessel was determined based on the thermal hydraulic analytical results of 3 GeV, 1 MW proton beam injection. The safety hull consists of vessels for helium and heavy water. The vessels for mercury target, helium and heavy water will be connected each other by reinforcement ribs mounted on the surface of each vessel. From the structural analyses, the structural integrity of the safety hull would be maintained under the static pressure of 0.5 MPa. (author)

  18. Innovative Waste Management in the Mercury Loop of the EURISOL Multi-MW Converter Target

    CERN Document Server

    PSI: Jörg Neuhausen, Dorothea Schumann, Rugard Dressler, Susanne Horn, Sabrina Lüthi, Stephan Heinitz, Suresh ChirikiCERN: Thierry Stora, Martin Eller

    The choice of mercury as target material imposes various questions concerning the safe operation of such a system that are related to the physical and chemical properties of the target material itself and the nuclear reaction products produced within the target during its life time of several decades. Therefore, a subtask was created within the EURISOL-DS project that is concerned with studying an innovative waste management for the generated radioactivity by chemical means. Such a study strongly depends on the radioactive inventory and its distribution throughout the target and loop system. Radioactive inventory calculations were performed within task 5 [6]. The distribution of nuclear reaction products and their chemical state that can be expected within the target and loop system is one of the topics covered in this report. Based on the results obtained by theoretical studies as well as laboratory scale experiments, the feasibility of waste reduction using chemical methods, both conventional (e.g. leaching...

  19. MERIT - The high intensity liquid mercury target experiment at the CERN PS

    CERN Document Server

    Efthymiopoulos, I

    2009-01-01

    The MERIT experiment is a proof-of-principle test of a target system for high power proton beams to be used as front-end for a Neutrino Factory complex or a Muon Collider. The experiment took data in autumn 2007 with the fast extracted beam from the CERN Proton Synchrotron (PS) to a maximum intensity of about 30 × 1012 protons per pulse. The target system, based on a free mercury jet, allowed investigation of the interseption of a 4-MW proton beam inside a 15-T magnetic field required to capture the low-energy secondary pions as the source of the required intense muon beams. Particle detectors have been installed around the target setup to measure the secondary particle flux out of the target and probe cavitation effects in the mercury jet when exited with a beam of variable intensity. With the analysis of the data ongoing, results will be presented here that demonstrate the validity of the liquid target concept.

  20. Measurement of spectrum for thermal neutrons produced from H2O moderator coupled with mercury target

    International Nuclear Information System (INIS)

    Meigo, S.; Maekawa, F.; Kasugai, Y.; Nakashima, H.; Ikeda, Y.; Watanabe, N.

    2001-01-01

    In order to obtain fundamental data for the design of pulsed spallation neutron source, the slowing-down and thermalized neutrons from an H 2 O moderator coupled with the mercury target were measured using GeV proton beams at AGS (Alternative Gradient Synchrotron) in BNL (Brookhaven National Laboratory) under the ASTE (AGS-Spallation Target Experiment) collaboration. The mercury target (φ 20 cm x L 130 cm) was surrounded by a lead reflector (1 x 1 x 1 m 3 ) was irradiated by 1.94-, 12- and 24-GeV protons. The spectral intensities of thermal neutrons from the moderator are measured by the current-mode time-of-flight technique using enriched 6 Li and 7 Li glass scintillators. By this technique, only several incident pulses were needed to obtain sufficient statistics for incident energy. The results have shown that the neutron spectral intensity per proton integrated over the Maxwellian region was almost proportional to the proton energy. By moving the target along the beam direction within 15 cm, the dependence of the relative moderator position to the target on the neutron flux was also measured. With this position change, the difference with flux was found within 10%. (author)

  1. Mercury-induced hepatotoxicity in zebrafish: in vivo mechanistic insights from transcriptome analysis, phenotype anchoring and targeted gene expression validation

    Directory of Open Access Journals (Sweden)

    Mathavan Sinnakaruppan

    2010-03-01

    Full Text Available Abstract Background Mercury is a prominent environmental contaminant that causes detrimental effects to human health. Although the liver has been known to be a main target organ, there is limited information on in vivo molecular mechanism of mercury-induced toxicity in the liver. By using transcriptome analysis, phenotypic anchoring and validation of targeted gene expression in zebrafish, mercury-induced hepatotoxicity was investigated and a number of perturbed cellular processes were identified and compared with those captured in the in vitro human cell line studies. Results Hepato-transcriptome analysis of mercury-exposed zebrafish revealed that the earliest deregulated genes were associated with electron transport chain, mitochondrial fatty acid beta-oxidation, nuclear receptor signaling and apoptotic pathway, followed by complement system and proteasome pathway, and thereafter DNA damage, hypoxia, Wnt signaling, fatty acid synthesis, gluconeogenesis, cell cycle and motility. Comparative meta-analysis of microarray data between zebrafish liver and human HepG2 cells exposed to mercury identified some common toxicological effects of mercury-induced hepatotoxicity in both models. Histological analyses of liver from mercury-exposed fish revealed morphological changes of liver parenchyma, decreased nucleated cell count, increased lipid vesicles, glycogen and apoptotic bodies, thus providing phenotypic evidence for anchoring of the transcriptome analysis. Validation of targeted gene expression confirmed deregulated gene-pathways from enrichment analysis. Some of these genes responding to low concentrations of mercury may serve as toxicogenomic-based markers for detection and health risk assessment of environmental mercury contaminations. Conclusion Mercury-induced hepatotoxicity was triggered by oxidative stresses, intrinsic apoptotic pathway, deregulation of nuclear receptor and kinase activities including Gsk3 that deregulates Wnt signaling

  2. Investigation of characteristics of 201Tl → 201Hg

    International Nuclear Information System (INIS)

    Kharitonov, V.V.; Gerasimov, V.N.

    2002-01-01

    The estimated intensities of transitions on the ground and first-excited levels in the 201 Hg at the decay of 201 Tl and estimated constants lg ft are obtained from the analysis of the relative intensities of the mercury M 4 N 6,7 N 6,7 Auger-electron line, initiated by the e-capture and of the conversion O 3 -mercury line, due to the nuclear transition with the energy 1.56 keV [ru

  3. Normalization of hemoglobin-based oxygen carrier-201 induced vasoconstriction: targeting nitric oxide and endothelin.

    Science.gov (United States)

    Taverne, Yannick J; de Wijs-Meijler, Daphne; Te Lintel Hekkert, Maaike; Moon-Massat, Paula F; Dubé, Gregory P; Duncker, Dirk J; Merkus, Daphne

    2017-05-01

    Hemoglobin-based oxygen carrier (HBOC)-201 is a cell-free modified hemoglobin solution potentially facilitating oxygen uptake and delivery in cardiovascular disorders and hemorrhagic shock. Clinical use has been hampered by vasoconstriction in the systemic and pulmonary beds. Therefore, we aimed to 1 ) determine the possibility of counteracting HBOC-201-induced pressor effects with either adenosine (ADO) or nitroglycerin (NTG); 2 ) assess the potential roles of nitric oxide (NO) scavenging, reactive oxygen species (ROS), and endothelin (ET) in mediating the observed vasoconstriction; and 3 ) compare these effects in resting and exercising swine. Chronically instrumented swine were studied at rest and during exercise after administration of HBOC-201 alone or in combination with ADO. The role of NO was assessed by supplementation with NTG or administration of the eNOS inhibitor N ω -nitro-l-arginine. Alternative vasoactive pathways were investigated via intravenous administration of the ET A /ET B receptor blocker tezosentan or a mixture of ROS scavengers. The systemic and to a lesser extent the pulmonary pressor effects of HBOC-201 could be counteracted by ADO; however, dosage titration was very important to avoid systemic hypotension. Similarly, supplementation of NO with NTG negated the pressor effects but also required titration of the dose. The pressor response to HBOC-201 was reduced after eNOS inhibition and abolished by simultaneous ET A /ET B receptor blockade, while ROS scavenging had no effect. In conclusion, the pressor response to HBOC-201 is mediated by vasoconstriction due to NO scavenging and production of ET. Further research should explore the effect of longer-acting ET receptor blockers to counteract the side effect of hemoglobin-based oxygen carriers. NEW & NOTEWORTHY Hemoglobin-based oxygen carrier (HBOC)-201 can disrupt hemodynamic homeostasis, mimicking some aspects of endothelial dysfunction, resulting in elevated systemic and pulmonary blood

  4. Martensitic/ferritic steels as container materials for liquid mercury target of ESS

    International Nuclear Information System (INIS)

    Dai, Y.

    1996-01-01

    In the previous report, the suitability of steels as the ESS liquid mercury target container material was discussed on the basis of the existing database on conventional austenitic and martensitic/ferritic steels, especially on their representatives, solution annealed 316 stainless steel (SA 316) and Sandvik HT-9 martensitic steel (HT-9). Compared to solution annealed austenitic stainless steels, martensitic/ferritic steels have superior properties in terms of strength, thermal conductivity, thermal expansion, mercury corrosion resistance, void swelling and irradiation creep resistance. The main limitation for conventional martensitic/ferritic steels (CMFS) is embrittlement after low temperature (≤380 degrees C) irradiation. The ductile-brittle transition temperature (DBTT) can increase as much as 250 to 300 degrees C and the upper-shelf energy (USE), at the same time, reduce more than 50%. This makes the application temperature range of CMFS is likely between 300 degrees C to 500 degrees C. For the present target design concept, the temperature at the container will be likely controlled in a temperature range between 180 degrees C to 330 degrees C. Hence, CMFS seem to be difficult to apply. However, solution annealed austenitic stainless steels are also difficult to apply as the maximum stress level at the container will be higher than the design stress. The solution to the problem is very likely to use advanced low-activation martensitic/ferritic steels (LAMS) developed by the fusion materials community though the present database on the materials is still very limited

  5. Measurement of induced radioactivity in a spallation neutron field of a mercury target for GeV-proton bombardment

    Energy Technology Data Exchange (ETDEWEB)

    Kasugai, Y.; Takada, H.; Nakashima, H. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment] [and others

    2001-03-01

    An integral experiment on radioactivity induced in spallation neutron fields was carried out under the ASTE (AGS-Spallation Target Experiment) collaboration using AGS (Alternative Gradient Synchrotron) at BNL (Brookhaven National Laboratory). The spallation neutrons were produced by bombarding a mercury target with protons of 1.6, 12 and 24 GeV. The number of protons was 3 - 4 x 10{sup 13} for each irradiation. The irradiated materials were titanium, nickel, cobalt, yttrium, and bismuth, and placed on the cylindrical surface of the mercury target at the distance of 15 - 16 cm from the beam-incident-surface of the target. Disintegration rates of induced radioactivities were measured at several cooling-time ranging from hours to months. The principal nuclides contributing to the radioactivity were pointed out for each material. The experimental results for bismuth were compared with the calculations with DCAHIN-SP code. (author)

  6. Measurements of activation reaction rate distributions on a mercury target bombarded with high-energy protons at AGS

    Energy Technology Data Exchange (ETDEWEB)

    Takada, Hiroshi; Kasugai, Yoshimi; Nakashima, Hiroshi; Ikeda, Yujiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Ino, Takashi; Kawai, Masayoshi [High Energy Accelerator Research Organization, Tsukuba, Ibaraki (Japan); Jerde, Eric; Glasgow, David [Oak Ridge National Laboratory, Oak Ridge, TN (United States)

    2000-02-01

    A neutronics experiment was carried out using a thick mercury target at the Alternating Gradient Synchrotron (AGS) facility of Brookhaven National Laboratory in a framework of the ASTE (AGS Spallation Target Experiment) collaboration. Reaction rate distributions around the target were measured by the activation technique at incident proton energies of 1.6, 12 and 24 GeV. Various activation detectors such as the {sup 115}In(n,n'){sup 115m}In, {sup 93}Nb(n,2n){sup 92m}Nb, and {sup 209}Bi(n,xn) reactions with threshold energies ranging from 0.3 to 70.5 MeV were employed to obtain the reaction rate data for estimating spallation source neutron characteristics of the mercury target. It was found from the measured {sup 115}In(n,n'){sup 115m}In reaction rate distribution that the number of leakage neutrons becomes maximum at about 11 cm from the top of hemisphere of the mercury target for the 1.6-GeV proton incidence and the peak position moves towards forward direction with increase of the incident proton energy. The similar result was observed in the reaction rate distributions of other activation detectors. The experimental procedures and a full set of experimental data in numerical form are summarized in this report. (author)

  7. Measurements of activation reaction rate distributions on a mercury target bombarded with high-energy protons at AGS

    International Nuclear Information System (INIS)

    Takada, Hiroshi; Kasugai, Yoshimi; Nakashima, Hiroshi; Ikeda, Yujiro; Jerde, Eric; Glasgow, David

    2000-02-01

    A neutronics experiment was carried out using a thick mercury target at the Alternating Gradient Synchrotron (AGS) facility of Brookhaven National Laboratory in a framework of the ASTE (AGS Spallation Target Experiment) collaboration. Reaction rate distributions around the target were measured by the activation technique at incident proton energies of 1.6, 12 and 24 GeV. Various activation detectors such as the 115 In(n,n') 115m In, 93 Nb(n,2n) 92m Nb, and 209 Bi(n,xn) reactions with threshold energies ranging from 0.3 to 70.5 MeV were employed to obtain the reaction rate data for estimating spallation source neutron characteristics of the mercury target. It was found from the measured 115 In(n,n') 115m In reaction rate distribution that the number of leakage neutrons becomes maximum at about 11 cm from the top of hemisphere of the mercury target for the 1.6-GeV proton incidence and the peak position moves towards forward direction with increase of the incident proton energy. The similar result was observed in the reaction rate distributions of other activation detectors. The experimental procedures and a full set of experimental data in numerical form are summarized in this report. (author)

  8. Water flow experiments and analyses on the cross-flow type mercury target model with the flow guide plates

    CERN Document Server

    Haga, K; Kaminaga, M; Hino, R

    2001-01-01

    A mercury target is used in the spallation neutron source driven by a high-intensity proton accelerator. In this study, the effectiveness of the cross-flow type mercury target structure was evaluated experimentally and analytically. Prior to the experiment, the mercury flow field and the temperature distribution in the target container were analyzed assuming a proton beam energy and power of 1.5 GeV and 5 MW, respectively, and the feasibility of the cross-flow type target was evaluated. Then the average water flow velocity field in the target mock-up model, which was fabricated from Plexiglass for a water experiment, was measured at room temperature using the PIV technique. Water flow analyses were conducted and the analytical results were compared with the experimental results. The experimental results showed that the cross-flow could be realized in most of the proton beam path area and the analytical result of the water flow velocity field showed good correspondence to the experimental results in the case w...

  9. Gigacycle fatigue behaviour of austenitic stainless steels used for mercury target vessels

    International Nuclear Information System (INIS)

    Naoe, Takashi; Xiong, Zhihong; Futakawa, Masatoshi

    2016-01-01

    A mercury enclosure vessel for the pulsed spallation neutron source manufactured from a type 316L austenitic stainless steel, a so-called target vessel, suffers the cyclic loading caused by the proton beam induced pressure waves. A design criteria of the JSNS target vessel which is defined based on the irradiation damage is 2500 h at 1 MW with a repetition rate of 25 Hz, that is, the target vessel suffers approximately 10 9 cyclic loading while in operation. Furthermore, strain rate of the beam window of the target vessel reaches 50 s −1 at the maximum, which is much higher than that of the conventional fatigue. Gigacycle fatigue strength up to 10 9 cycles for solution annealed 316L (SA) and cold-worked 316L (CW) were investigated through the ultrasonic fatigue tests. Fatigue tests were performed under room temperature and 250 °C which is the maximum temperature evaluated at the beam window in order to investigate the effect of temperature on fatigue strength of SA and CW 316L. The results showed that the fatigue strength at 250 °C is clearly reduced in comparison with room temperature, regardless of cold work level. In addition, residual strength and microhardness of the fatigue tested specimen were measured to investigate the change in mechanical properties by cyclic loading. Cyclic hardening was observed in both the SA and CW 316L, and cyclic softening was observed in the initial stage of cyclic loading in CW 316L. Furthermore, abrupt temperature rising just before fatigue failure was observed regardless of testing conditions.

  10. Pressure and stress waves in a spallation neutron source mercury target generated by high-power proton pulses

    CERN Document Server

    Futakawa, M; Conrad, H; Stechemesser, H

    2000-01-01

    The international ASTE collaboration has performed a first series of measurements on a spallation neutron source target at the Alternating Gradient Synchrotron (AGS) in Brookhaven. The dynamic response of a liquid mercury target hit by high-power proton pulses of about 40 ns duration has been measured by a laser Doppler technique and compared with finite elements calculations using the ABAQUS code. It is shown that the calculation can describe the experimental results for at least the time interval up to 100 mu s after the pulse injection. Furthermore, it has been observed that piezoelectric pressure transducers cannot be applied in the high gamma-radiation field of a spallation target.

  11. Study and development recuperation of Thallium-203 from bombarded targets of this metal in production of Thallium-201 via addition of Thallium-201 radioisotope as a tracer

    International Nuclear Information System (INIS)

    Shirazi, B.

    2006-01-01

    Thallium-203 is the main material for 201 TlCl 3 radiopharmaceutical. It is very important to recover the remaining enriched Thallium-203 in every stage of the process to be reused in the production loop. In this research, the recuperation of Thallium-203 was studied with Dowex 50 WΧ8 ion exchange resin and Thallium-201 as a tracer. The results based on filling of ( 1 8 X 1.5) cm columns with this resin showed that the best flow rate of eluent is 2 ml/min. Also the most suitable volumes are 200 mL (HNO 3 0.05 M), 400 mL (solution of Thallium-203), 100 mL (H 2 O), 500 mL (Citric acid), 100 mL (H 2 0), 100 mL (EDTA 0.5 M and pH∼12.5). 60 mL (H 2 0), respectively

  12. Foil analysis of 1.5-GeV proton bombardment of a mercury target

    CERN Document Server

    Charlton, L A; Glasgow, D C; Gabriel, T A

    1999-01-01

    The number of reactant nuclei in a series of foils surrounding a container of mercury that has been bombarded by 1.5-GeV protons is calculated and compared with experimental measurements. This procedure is done to aid in the validation of the mercury cross sections used in the design studies of the Spallation Neutron Source (SNS). It is found that the calculations match the measurements to within the uncertainties inherent in the analysis.

  13. Manufacturing and supply of a mercury cooled rotary uranium target for the GELINA accelerator facility of IRMM

    International Nuclear Information System (INIS)

    Febvre, M.

    2009-01-01

    AREVA CERCA is a manufacturer of Uranium fuel elements for Research Reactors, Mechanical Components for nuclear industry and Radioactive Reference Sources for nuclear industry and medicine. The GELINA high-resolution neutron time-of-flight measurements facility of IRMM (Institute for Reference Materials and Measurements) operates with a very special Uranium target. There is no other neutron production target in the world that has the same or even similar characteristics. Over more than two decades, AREVA CERCA developed and manufactured the rotary Uranium targets for the GELINA facility of IRMM. The use of Uranium and the induced activation during operation in GELINA ask for extremely reliable equipment, responding to very high safety demands. For the fabrication of the target, the very high quality control standards applicable for the fabrication of nuclear equipment must be applied. The material of the Uranium-molybdenum disk must fulfill very restrictive conditions. The target core of the target is cooled by a stream of Mercury, pumped by an electromagnetic pump manufactured by AREVA CERCA. Temperatures in the Uranium disk must be measured with thermocouples distributed inside the Uranium core, at the Uranium/cladding interface and at the inlet and outlet of the Mercury. The target has to rotate between an upper and a lower neutron moderator with very severe geometrical tolerances. The very small gap between the Uranium and the cladding must be filled with Helium before sealing. Preparation and installation of the Target at the GELINA linear Accelerator is presented. Performances and reliability of the targets are reported combined with major experiences and results gained by IRMM. (author)

  14. Vaporization of mercury from molten lead droplets doped with mercury: Pb/Hg source term experiment for the APT/SILC target

    International Nuclear Information System (INIS)

    Tutu, N.K.; Greene, G.A.

    1994-09-01

    Experiments were performed to measure the fraction of mercury inventory released when droplets of molten lead, doped with a known concentration of mercury, fall through a controlled environment. The temperature of molten droplets ranged from 335 C to 346 C, and the concentration of mercury in the droplets ranged from 0.2 mass % to 1.0 mass %. The environment consisted of an air stream, at a temperature nominally equal to the melt temperature, and moving vertically upwards at a velocity of 10 cm/s. Direct observations and chemical analysis showed that no mercury was released from the molten droplets. Based upon the experimental results, it is concluded that no mercury vapor is likely to be released from the potentially molten source rod material in the APT-SILC Neutron Source Array to the confinement atmosphere during a postulated Large Break Loss Of Coolant Accident scenario leading to the melting of a fraction of the source rods

  15. Mercury's Messenger

    Science.gov (United States)

    Chapman, Clark R.

    2004-01-01

    Forty years after Mariner 2, planetary exploration has still only just begun, and many more missions are on drawing boards, nearing the launch pad, or even en route across interplanetary space to their targets. One of the most challenging missions that will be conducted this decade is sending the MESSENGER spacecraft to orbit the planet Mercury.…

  16. Water flow experiment using the PIV technique and the thermal hydraulic analysis on the cross-flow type mercury target model

    International Nuclear Information System (INIS)

    Haga, Katsuhiro; Terada, Atsuhiko; Kaminaga, Masanori; Hino, Ryutaro

    2001-01-01

    In this study the effectiveness of the cross-flow type mercury target structure was evaluated experimentally and analytically. The average water flow velocity field in the target mock-up model, which was fabricated with plexiglass, was measured at room temperature using the PIV (Particle Image Velocimetry) technique. The water flow analyses were conducted and the analytical results were compared with the experimental results. The experimental results showed that the cross-flow could be realized in the former part of the proton beam path where the heat load by the spallation reaction is large, and the analytical result of the water flow velocity field showed good correspondence to the experimental result in the case of the Reynolds number of more than 4.83 x 10 5 at the model inlet. With these results, the effectiveness of the cross-flow type mercury target structure and the present analysis code system was demonstrated. Then the mercury flow field and the temperature distribution in the target container were analyzed assuming the proton beam energy and power of 3 GeV and 5 MW. The analytical result showed that the cross-flow field of mercury, which is similar to the water flow field, could also be attained. (author)

  17. Water flow experiment using the PIV technique and the thermal hydraulic analysis on the cross-flow type mercury target model with the blade flow distributors

    International Nuclear Information System (INIS)

    Haga, Katsuhiro; Terada, Atsuhiko; Kaminaga, Masanori; Hino, Ryutaro

    2000-01-01

    The flow patterns in the mock-up model of the cross-flow type mercury target were measured using the PIV (particle image velocimetry) technique under water flow conditions at room temperature. The experimental results were compared with the analytical results conducted with the thermal hydraulic analysis code, STAR-CD. As a result, it was confirmed experimentally that the cross-flow could be realized in most of the proton beam path area, where the removal of the high density heat is important, with the proper flow rate distribution along the proton beam path. The analytical result showed the good correspondence to the experimental result. Then the mercury flow field and the temperature distribution were analyzed taking the volumetric heat generation by the spallation reaction into consideration. The volumetric heat generation calculated for the proton beam energy and power of 1.5 GeV and 5 MW were assumed in the analysis. The mercury flow analysis showed that the maximum mercury temperature less than the design criteria of 300degC can be attained with the inlet mercury velocity of more than 1.1 m/s and that the recirculation flow seen in the rear of the proton beam path is considered to cause no excessive temperature rise. (author)

  18. Measurement of activation reaction rate distribution on a mercury target with a lead-reflector and light-water-moderator for high energy proton bombardment using AGS accelerator

    International Nuclear Information System (INIS)

    Kasugai, Yoshimi; Takada, Hiroshi; Meigo, Shin-ichiro

    2001-02-01

    Characteristic of spallation neutrons driven by GeV protons from a mercury target with a lead-reflector and light-water-moderator was studied experimentally using the Alternating Gradient Synchrotron (AGS) facility of Brookhaven National Laboratory in a framework of the ASTE (AGS Spallation Target Experiment) collaboration. Several reaction rates along with the mercury target were measured with the activation method at incident proton energies of 1.94, 12 and 24 GeV. Indium, niobium, aluminum, cobalt, nickel and bismuth were used as activation detectors to cover the threshold energy of between 0.33 and 40.9 MeV. This report summarizes the experimental procedure with all the measured data. (author)

  19. Adaption and use of a quadcopter for targeted sampling of gaseous mercury in the atmosphere.

    Science.gov (United States)

    Black, Oscar; Chen, Jingjing; Scircle, Austin; Zhou, Ying; Cizdziel, James V

    2018-03-22

    We modified a popular and inexpensive quadcopter to collect gaseous mercury (Hg) on gold-coated quartz cartridges, and analyzed the traps using cold vapor atomic fluorescence spectrometry. Flight times averaged 16 min, limited by battery life, and yielded > 5 pg of Hg, well above the limit of detection (quadcopter, we measured atmospheric Hg near anthropogenic emission sources in the mid-south USA, including a municipal landfill, coal-fired power plant (CFPP), and a petroleum refinery. Average concentrations (± standard deviation) immediately downwind of the landfill were higher at ground level and 30 m compared to 60 and 120 m (5.3 ± 0.5 ng m -3 , 5.4 ± 0.7 ng m -3 , 4.2 ± 0.7 ng m -3 , and 2.5 ± 0.3 ng m -3 , respectively). Concentrations were also higher at an urban/industrial area (Memphis) (3.3 ± 0.9 ng m -3 ) compared with a rural/background area (1.5 ± 0.2 ng m -3 ). Due to airspace flight restrictions near the CFPP and refinery, we were unable to access near-field (stack) plumes and did not observe differences between upwind and downwind locations. Overall, this study demonstrates that highly maneuverable multicopters can be used to probe Hg concentrations aloft, which may be particularly useful for evaluating Hg emissions from remote landscapes and transient sources that are inadequately characterized and leading to uncertainties in ecosystem budgets.

  20. Brain as a critical target of mercury in environmentally exposed fish (Dicentrarchus labrax)--bioaccumulation and oxidative stress profiles.

    Science.gov (United States)

    Mieiro, C L; Pereira, M E; Duarte, A C; Pacheco, M

    2011-06-01

    Although mercury is recognized as a potent neurotoxicant, information regarding its threat to fish brain and underlying mechanisms is still scarce. In accordance, the objective of this work was to assess vulnerability of fish to mercury neurotoxicity by evaluating brain pro-oxidant status in wild European sea bass (Dicentrarchus labrax) captured in an estuarine area affected by chlor-alkali industry discharges (Laranjo Basin, Ria de Aveiro, Portugal). To achieve this goal, brain antioxidant responses such as catalase (CAT), glutathione peroxidase (GPx), glutathione reductase (GR), glutathione S-transferase (GST) activities and total glutathione (GSHt) content were measured. Additionally, damage was determined as lipid peroxidation. To ascertain the influence of seasonal variables on both mercury accumulation and oxidative stress profiles, surveys were conducted in contrasting conditions-warm and cold periods. In the warm period, brain of fish from mercury contaminated sites exhibited ambivalent antioxidant responses, viz. higher GR activity and lower CAT activity regarded, respectively, as possible signs of protective adaptation and increased susceptibility to oxidative stress challenge. Though the risk of an overwhelming ROS production cannot be excluded, brain appeared to possess compensatory mechanisms and was able to avoid lipid peroxidative damage. The warm period was the most critical for the appearance of oxidative damage as no inter-site alterations on oxidative stress endpoints were detected in the cold period. Since seasonal differences were found in oxidative stress responses and not in mercury bioaccumulation, environmental factors affected the former more than the latter. This work increases the knowledge on mercury neurotoxicity in feral fish, highlighting that the definition of critical tissue concentrations depends on environmental variables. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Mercury and Your Health

    Science.gov (United States)

    ... the Risk of Exposure to Mercury Learn About Mercury What is Mercury What is Metallic mercury? Toxicological Profile ToxFAQs Mercury Resources CDC’s National Biomonitoring Program Factsheet on Mercury ...

  2. A method for the production of thallium-201

    International Nuclear Information System (INIS)

    Ageev, V.A.; Kljuchnikov, A.A.; Linev, A.F.; Khalkin, V.A.; Zaitseva, N.G.

    1987-01-01

    For the production of thallium-201 a target of at least 95% enriched pure lead-206 is irradiated by a proton beam of an energy of between 50 and 70 MeV. During irradiation the reaction 206 Pb(p,6n) 201 Bi takes place. The target is kept sufficiently long for the transition 201 Bi- 201 Pb- 201 Tl to take place. The target is then dissolved in acid. The thallium-201 contained in the acid is oxidized to the trivalent state followed by precipitation of the lead. Lead traces remaining in solution are separated from the thallium-201 through cation exchange following which the thallium-201 is eluted using hydrochloric acid

  3. Commercial production of thallium-201 chloride

    International Nuclear Information System (INIS)

    Sokolov, S.V.; Volkova, N.M.; Skokov, V.S.

    1989-01-01

    Thallium-201 chloride pharmaceuticals production practice at the Medradiopreparat factory under USSR Ministry of Public Health is described. The factory is carried out series-produced supplies of the compound prepared according to a new practice from September, 1985. Thallium-201 extraction from cyclotron targets irradiated is carried out by the extraction method

  4. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    International Nuclear Information System (INIS)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J.

    1990-01-01

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared

  5. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J. (Kanazawa Univ. (Japan))

    1990-06-01

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared.

  6. Got Mercury?

    Science.gov (United States)

    Meyers, Valerie E.; McCoy, J. Torin; Garcia, Hector D.; James, John T.

    2009-01-01

    Many of the operational and payload lighting units used in various spacecraft contain elemental mercury. If these devices were damaged on-orbit, elemental mercury could be released into the cabin. Although there are plans to replace operational units with alternate light sources, such as LEDs, that do not contain mercury, mercury-containing lamps efficiently produce high quality illumination and may never be completely replaced on orbit. Therefore, exposure to elemental mercury during spaceflight will remain possible and represents a toxicological hazard. Elemental mercury is a liquid metal that vaporizes slowly at room temperature. However, it may be completely vaporized at the elevated operating temperatures of lamps. Although liquid mercury is not readily absorbed through the skin or digestive tract, mercury vapors are efficiently absorbed through the respiratory tract. Therefore, the amount of mercury in the vapor form must be estimated. For mercury releases from lamps that are not being operated, we utilized a study conducted by the New Jersey Department of Environmental Quality to calculate the amount of mercury vapor expected to form over a 2-week period. For longer missions and for mercury releases occurring when lamps are operating, we conservatively assumed complete volatilization of the available mercury. Because current spacecraft environmental control systems are unable to remove mercury vapors, both short-term and long-term exposures to mercury vapors are possible. Acute exposure to high concentrations of mercury vapors can cause irritation of the respiratory tract and behavioral symptoms, such as irritability and hyperactivity. Chronic exposure can result in damage to the nervous system (tremors, memory loss, insomnia, etc.) and kidneys (proteinurea). Therefore, the JSC Toxicology Group recommends that stringent safety controls and verifications (vibrational testing, etc.) be applied to any hardware that contains elemental mercury that could yield

  7. DEVELOPMENT OF ANALYTICAL METHODS FOR THE QUANTIFICATION OF THE CHEMICAL FORMS OF MERCURY AND OTHER TARGET POLLUTANTS IN COAL-FIRED BOILER FLUE GAS

    Energy Technology Data Exchange (ETDEWEB)

    Terence J. McManus, Ph.D.

    1999-06-30

    Since approximately 55% of the electrical power produced in the U. S. is generated by coal-based power utility plants, there is serious concern about the massive amounts of coal combustion products emitted into the atmosphere annually. Furthermore, Title III of the 1990 Clean Air Act Amendments (CAAA) requires the measurement and inventory of a possible 189 hazardous air pollutants (HAPs) from any stationary source producing more than 10 tons per year of any one pollutant or more than 25 tons per year of total pollutants. Although power utilities are not presently included on the list of source categories, the CAAA requires the U. S. Environmental Protection Agency to carry out a study of emissions from electricity generation using fossil fuels. Since many of these HAPs are known to be present in coal derived flue gas, coal-fired electric power utilities may be subject to regulation following these studies if Congress considers it necessary. In a cooperative effort with the U. S. Environmental Protection Agency (EPA), the U. S. Department of Energy (DOE) through its Federal Energy Technology Center (FETC) initiated such a study in 1991. DOE-FETC commissioned five primary contractors to conduct emission studies at eight different coal-fired electric utilities. The eight sites represented a cross section of feed coal type, boiler designs, and particulate and gaseous pollutant control technologies. The major goal of these studies was to determine the sampling and analytical methodologies that could be used efficiently to perform these emission tests while producing representative and reliable emission data. The successful methodology could then be recommended to the EPA for use in compliance testing in the event the regulation of air toxic emissions from coal-fired power plants is implemented. A secondary purpose of the testing was to determine the effectiveness of the control technologies in reducing target hazardous air pollutants. Advanced Technology Systems, Inc

  8. 201Tl-thallium chloride injections for cardiological applications

    International Nuclear Information System (INIS)

    Kopecky, P.; Zdrazil, K.; Svihla, P.

    1985-01-01

    The production is being prepared by the Nuclear Research Institute at Rez of the cardiovascular diagnostic agent, 201 Tl-thallium chloride. The 201 Tl radionuclide will be produced by irradiating a thallium target in the U-120 M cyclotron at Rez. For this purpose, the 201 Tl production rate was measured in the proton energy range of 27 to 31 MeV, and the production conditions were optimized with respect to parasitic production of radionuclide contaminants 200 Tl and 202 Tl. A method was developed of chemically separating 201 Tl from the irradiated target. This will allow the production of 201 Tl-thallium chloride injections in the required quality. (author)

  9. Basic Information about Mercury

    Science.gov (United States)

    ... Your Environment Contact Us Share Basic Information about Mercury On this page: What is mercury? Emissions of ... Consumer products that traditionally contain mercury What is Mercury? Mercury is a naturally-occurring chemical element found ...

  10. Production of Thallium 201 for medical applications

    International Nuclear Information System (INIS)

    Braghirolli, A.M.S.

    1981-12-01

    With the purpose of producing high purity carrier-free 201 Tl, for medical use, a production and separation method was developed using the CV-28 Cyclotron of the Nuclear Engineering Institute in Rio de Janeiro, Brazil. 201 Pb was produced by 24 MeV proton bombardment of natural Tl and allowed to decay to 201 Tl. In the separation process the target is dissolved in HNO 3 , the 201 Pb produced is separated by Fe(OH) 3 coprecipitation, and the Fe is latter separated by anion exchange. The 201 Pb is permited to decay during 32 hrs. 201 Tl is then separated from remaining Pb by anion exchange. The chemical separation is done in a remote processing cell using manipulators, tongs, electric and pneumatic systems. The thick target yield of 201 Pb is 1.7 mCi/μAhr. At the moment the production is restricted to 4 mCi of 201 Tl for each irradiation. (Author) [pt

  11. A New Trapped Ion Clock Based on Hg-201(+)

    Science.gov (United States)

    Taghavi-Larigani, S.; Burt, E. A.; Lea, S. N.; Prestage, J. D.; Tjoelker, R. L.

    2009-01-01

    There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave clock: Hg-199(+) and Hg-201(+). Virtually all trapped mercury ion clocks to date have used the 199 isotope. We have begun to investigate the viability of a trapped ion clock based on Hg-201(+). We have measured the unperturbed frequency of the (S-2)(sub 1/2) F = 1, m(sub F) = 0 to (S-2)(sub 1/2) F = 2, m(sub F) = 0 clock transition to be 29.9543658211(2) GHz. In this paper we describe initial measurements with Hg-201(+) and new applications to clocks and fundamental physics.

  12. Chemical form matters: differential accumulation of mercury following inorganic and organic mercury exposures in zebrafish larvae.

    Science.gov (United States)

    Korbas, Malgorzata; Macdonald, Tracy C; Pickering, Ingrid J; George, Graham N; Krone, Patrick H

    2012-02-17

    Mercury, one of the most toxic elements, exists in various chemical forms each with different toxicities and health implications. Some methylated mercury forms, one of which exists in fish and other seafood products, pose a potential threat, especially during embryonic and early postnatal development. Despite global concerns, little is known about the mechanisms underlying transport and toxicity of different mercury species. To investigate the impact of different mercury chemical forms on vertebrate development, we have successfully combined the zebrafish, a well-established developmental biology model system, with synchrotron-based X-ray fluorescence imaging. Our work revealed substantial differences in tissue-specific accumulation patterns of mercury in zebrafish larvae exposed to four different mercury formulations in water. Methylmercury species not only resulted in overall higher mercury burdens but also targeted different cells and tissues than their inorganic counterparts, thus revealing a significant role of speciation in cellular and molecular targeting and mercury sequestration. For methylmercury species, the highest mercury concentrations were in the eye lens epithelial cells, independent of the formulation ligand (chloride versusl-cysteine). For inorganic mercury species, in absence of l-cysteine, the olfactory epithelium and kidney accumulated the greatest amounts of mercury. However, with l-cysteine present in the treatment solution, mercuric bis-l-cysteineate species dominated the treatment, significantly decreasing uptake. Our results clearly demonstrate that the common differentiation between organic and inorganic mercury is not sufficient to determine the toxicity of various mercury species.

  13. Chemical Form Matters: Differential Accumulation of Mercury Following Inorganic and Organic Mercury Exposures in Zebrafish Larvae

    Energy Technology Data Exchange (ETDEWEB)

    Korbas, Malgorzata; MacDonald, Tracy C.; Pickering, Ingrid J.; George, Graham N.; Krone, Patrick H. (Saskatchewan)

    2013-04-08

    Mercury, one of the most toxic elements, exists in various chemical forms each with different toxicities and health implications. Some methylated mercury forms, one of which exists in fish and other seafood products, pose a potential threat, especially during embryonic and early postnatal development. Despite global concerns, little is known about the mechanisms underlying transport and toxicity of different mercury species. To investigate the impact of different mercury chemical forms on vertebrate development, we have successfully combined the zebrafish, a well-established developmental biology model system, with synchrotron-based X-ray fluorescence imaging. Our work revealed substantial differences in tissue-specific accumulation patterns of mercury in zebrafish larvae exposed to four different mercury formulations in water. Methylmercury species not only resulted in overall higher mercury burdens but also targeted different cells and tissues than their inorganic counterparts, thus revealing a significant role of speciation in cellular and molecular targeting and mercury sequestration. For methylmercury species, the highest mercury concentrations were in the eye lens epithelial cells, independent of the formulation ligand (chloride versus L-cysteine). For inorganic mercury species, in absence of L-cysteine, the olfactory epithelium and kidney accumulated the greatest amounts of mercury. However, with L-cysteine present in the treatment solution, mercuric bis-L-cysteineate species dominated the treatment, significantly decreasing uptake. Our results clearly demonstrate that the common differentiation between organic and inorganic mercury is not sufficient to determine the toxicity of various mercury species.

  14. Production of thallium 201 for medical use

    International Nuclear Information System (INIS)

    Venikov, N.I.; Konyakhin, N.A.; Kozlova, M.D.; Volkova, N.M.

    1986-01-01

    An important product among the radiopharmaceuticals currently used in cardiology is T1 201 chloride, due to its nuclear-physical properties and its clinical value as a diagnostic tool. The authors explain and discuss the basic characteristics which determine the radiopharmaceutical quality of T1 201: its radiochemical purity and its chemical impurity content, which depend on the target-irradiation conditions - type of nuclear reaction, target material and design, particle energy, irradiation time - and the reprocessing technology. A production flow chart is presented which shows that ions are accelerated within a wide mass and energy range suitable for the production of T1 201 in different nuclear reactions. Cyclotron reconstruction for T1 201 production is discussed

  15. Human Exposure and Health Effects of Inorganic and Elemental Mercury

    Science.gov (United States)

    Zheng, Wei

    2012-01-01

    Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability of 7% to 15% after ingestion; they are also irritants and cause gastrointestinal symptoms. Upon entering the body, inorganic mercury compounds are accumulated mainly in the kidneys and produce kidney damage. In contrast, human exposure to elemental mercury is mainly by inhalation, followed by rapid absorption and distribution in all major organs. Elemental mercury from ingestion is poorly absorbed with a bioavailability of less than 0.01%. The primary target organs of elemental mercury are the brain and kidney. Elemental mercury is lipid soluble and can cross the blood-brain barrier, while inorganic mercury compounds are not lipid soluble, rendering them unable to cross the blood-brain barrier. Elemental mercury may also enter the brain from the nasal cavity through the olfactory pathway. The blood mercury is a useful biomarker after short-term and high-level exposure, whereas the urine mercury is the ideal biomarker for long-term exposure to both elemental and inorganic mercury, and also as a good indicator of body burden. This review discusses the common sources of mercury exposure, skin lightening products containing mercury and mercury release from dental amalgam filling, two issues that happen in daily life, bear significant public health importance, and yet undergo extensive debate on their safety. PMID:23230464

  16. Mercury flow experiments. 4th report: Measurements of erosion rate caused by mercury flow

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Haga, Katsuhiro; Hino, Ryutaro

    2002-06-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be weak by thickness decreasing. This report presents experimental results of wall thickness change by erosion using a mercury experimental loop. In the experiments, an erosion test section and coupons were installed in the mercury experimental loop, and their wall thickness was measured with an ultra sonic thickness gage after every 1000 hours. As a result, under 0.7 m/s of mercury velocity condition which is slightly higher than the practical velocity in mercury pipelines, the erosion is about 3 μm in 1000 hours. The wall thickness decrease during facility lifetime of 30 years is estimated to be less than 0.5 mm. According to the experimental result, it is confirmed that the effect of erosion on component strength is extremely small. Moreover, a measurement of residual mercury on the piping surface was carried out. As a result, 19 g/m 2 was obtained as the residual mercury for the piping surface. According to this result, estimated amount of residual mercury for

  17. Mercury and Pregnancy

    Science.gov (United States)

    ... Home > Pregnancy > Is it safe? > Mercury and pregnancy Mercury and pregnancy E-mail to a friend Please ... vision problems. How can you be exposed to mercury? Mercury has several forms: It can be a ...

  18. Mercury flow experiments. 4th report Measurements of erosion rate caused by mercury flow

    CERN Document Server

    Kinoshita, H; Hino, R; Kaminaga, M

    2002-01-01

    The Japan Atomic Energy Research Institute (JAERI) and the High Energy Accelerator Research Organization (KEK) are promoting a construction plan of the Material-Life Science Facility, which is consisted of a Muon Science Facility and a Neutron Scattering Facility, in order to open up the new science fields. The Neutron Scattering Facility will be utilized for advanced fields of Material and Life science using high intensity neutron generated by the spallation reaction of a 1 MW pulsed proton beam and mercury target. Design of the spallation mercury target system aims to obtain high neutron performance with high reliability and safety. Since the target system is using mercury as the target material and contains large amount of radioactive spallation products, it is necessary to estimate reliability for strength of instruments in a mercury flow system during lifetime of the facility. Piping and components in the mercury flow system would be damaged by erosion with mercury flow, since these components will be we...

  19. Mercury emission from crematories in Japan

    Directory of Open Access Journals (Sweden)

    M. Takaoka

    2010-04-01

    Full Text Available Anthropogenic sources of mercury emissions have a significant impact on global pollution. Therefore, finding uncharacterised sources and assessing the emissions from these sources are important. However, limited data are available worldwide on mercury emissions from crematories. In Japan, 99.9% of dead bodies are cremated, which is the highest percentage in the world, and more than 1600 crematories are in operation. We thus focused on emissions from crematories in Japan. The number of targeted facilities was seven, and we used continuous emission monitoring to measure the mercury concentrations and investigate mercury behaviour. The total mercury concentrations in stack gases were a few μg/Nm3 (normal cubic meters. Considering the time profile of mercury and its species in cremations, the findings confirmed that the mercury in stack gas originated from dental amalgam. The amount of mercury emissions was calculated using the total concentration and gas flow rate. Furthermore, the annual amount of mercury emission from crematories in Japan was estimated by using the total number of corpses. The emission amount was considerably lower than that estimated in the United Kingdom. From statistical analyses on population demographics and measurements, future total emissions from crematories were also predicted. As a result, the amount of mercury emitted by crematories will likely increase by 2.6-fold from 2007 to 2037.

  20. Mercury toxicity and neurodegenerative effects.

    Science.gov (United States)

    Carocci, Alessia; Rovito, Nicola; Sinicropi, Maria Stefania; Genchi, Giuseppe

    2014-01-01

    Mercury is among the most toxic heavy metals and has no known physiological role in humans. Three forms of mercury exist: elemental, inorganic and organic. Mercury has been used by man since ancient times. Among the earliest were the Chinese and Romans, who employed cinnabar (mercury sulfide) as a red dye in ink (Clarkson et al. 2007). Mercury has also been used to purify gold and silver minerals by forming amalgams. This is a hazardous practice, but is still widespread in Brazil's Amazon basin, in Laos and in Venezuela, where tens of thousands of miners are engaged in local mining activities to find and purify gold or silver. Mercury compounds were long used to treat syphilis and the element is still used as an antiseptic,as a medicinal preservative and as a fungicide. Dental amalgams, which contain about 50% mercury, have been used to repair dental caries in the U.S. since 1856.Mercury still exists in many common household products around the world.Examples are: thermometers, barometers, batteries, and light bulbs (Swain et al.2007). In small amounts, some organo mercury-compounds (e.g., ethylmercury tiosalicylate(thimerosal) and phenylmercury nitrate) are used as preservatives in some medicines and vaccines (Ballet al. 2001).Each mercury form has its own toxicity profile. Exposure to Hg0 vapor and MeHg produce symptoms in CNS, whereas, the kidney is the target organ when exposures to the mono- and di-valent salts of mercury (Hg+ and Hg++, respectively)occur. Chronic exposure to inorganic mercury produces stomatitis, erethism and tremors. Chronic MeHg exposure induced symptoms similar to those observed in ALS, such as the early onset of hind limb weakness (Johnson and Atchison 2009).Among the organic mercury compounds, MeHg is the most biologically available and toxic (Scheuhammer et a!. 2007). MeHg is neurotoxic, reaching high levels of accumulation in the CNS; it can impair physiological function by disrupting endocrine glands (Tan et a!. 2009).The most

  1. Mercury Report-Children's exposure to elemental mercury

    Science.gov (United States)

    ... gov . Mercury Background Mercury Report Additional Resources Mercury Report - Children's Exposure to Elemental Mercury Recommend on Facebook ... I limit exposure to mercury? Why was the report written? Children attending a daycare in New Jersey ...

  2. RECOVERY OF MERCURY FROM CONTAMINATED LIQUID WASTES

    Energy Technology Data Exchange (ETDEWEB)

    Robin M. Stewart

    1999-09-29

    Mercury was widely used in U.S. Department of Energy (DOE) weapons facilities, resulting in a broad range of mercury-contaminated wastes and wastewaters. Some of the mercury contamination has escaped to the local environment, particularly at the Y-12 Plant in Oak Ridge, Tennessee, where approximately 330 metric tons of mercury were discharged to the environment between 1953 and 1963 (TN & Associates, 1998). Effective removal of mercury contamination from water is a complex and difficult problem. In particular, mercury treatment of natural waters is difficult because of the low regulatory standards. For example, the Environmental Protection Agency has established a national ambient water quality standard of 12 parts-per-trillion (ppt), whereas the standard is 1.8 ppt in the Great Lakes Region. In addition, mercury in the environment is typically present in several different forms, but sorption processes are rarely effective with more than one or two of these forms. To meet the low regulatory discharge limits, an effective sorption process must be able to address all forms of mercury present in the water. One approach is to apply different sorbents in series depending on the mercury speciation and the regulatory discharge limits. ADA Technologies, Inc. has developed four new sorbents to address the variety of mercury species present in industrial discharges and natural waters. Three of these sorbents have been field tested on contaminated creek water at the Y-12 Plant. Two of these sorbents have been successfully demonstrated very high removal efficiencies for soluble mercury species, reducing mercury concentrations at the outlet of a pilot-scale system to less than 12 ppt for as long as six months. The other sorbent tested at the Y-12 Plant targeted colloidal mercury not removed by standard sorption or filtration processes. At the Y-12 Plant, colloidal mercury appears to be associated with iron, so a sorbent that removes mercury-iron complexes in the presence of a

  3. Mercury Thermal Hydraulic Loop (MTHL) Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Felde, David K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Crye, Jason Michael [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wendel, Mark W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Yoder, Jr, Graydon L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Farquharson, George [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jallouk, Philip A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); McFee, Marshall T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Pointer, William David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ruggles, Art E. [Univ. of Tennessee, Knoxville, TN (United States); Carbajo, Juan J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-03-01

    The Spallation Neutron Source (SNS) is a high-power linear accelerator built at Oak Ridge National Laboratory (ORNL) which incorporates the use of a flowing liquid mercury target. The Mercury Thermal Hydraulic Loop (MTHL) was constructed to investigate and verify the heat transfer characteristics of liquid mercury in a rectangular channel. This report provides a compilation of previously reported results from the water-cooled and electrically heated straight and curved test sections that simulate the geometry of the window cooling channel in the target nose region.

  4. Environmental mercury problem

    Energy Technology Data Exchange (ETDEWEB)

    D' Itri, F.M.

    1972-01-01

    The urgent need to eliminate or greatly reduce the discharge of mercury into the environment is paramount to the health and well being of man. That all forms of mercury are hazardous is widely recognized, but what is more devastating to our society is that all forms of mercury appear to have the potential to be converted in to highly toxic monomethylmercury, or dimethylmercury. This paper examined the historical uses of mercury, the background concentrations of mercury, the analytical methods for the determination of mercury, the contamination of the food chain by mercury, the biological methylation of mercury, the decontamination and restoration of mercury polluted areas, the epidemiology and toxicology of mercury, and the chronology of the world's mercury poisoning problem.

  5. Dependence of quality of Thallium-201 on irradiation data

    International Nuclear Information System (INIS)

    Sattari, I.; Aslani, G.; Dehghan, M. K.; Shirazi, B.; Shafie, M.; Shadanpour, N.; Winkel, P. V.

    2003-01-01

    Background: Thallium-201 is produced through 203 Tl (p,3 n) 201 pb 201 Tl reaction by cyclotron. This radioisotope has known as one of the cyclotron radioisotopes which is used for myocardial perfusion in the coronary artery disease, Ti-201 after chemical purification and quality control in the form of 201 Tl-chloride is ready to send the hospitals. Materials and methods: In this work the effect of the proton energy on quality of a Ti-201, was studied. Radionuclidic purity was determined by high purity Ge (H P Ge) detector Gamma spectrometer, in production time and after one half-life (73 h). The targets were coated with Enriched Thallium-203 (97%). Results: The variation of thickness of targets was 18.3±1.3μm. The different energies of bombardment on quality of Tl-201 and Tl-200, Tl-202, and Pb-203 (as impurity) were studied. The results have been that optimum energy for proton was 28.5 MeV. Conclusion: The variation energy of bombardment can change the purity of Tl-201 but all results were in standard range according to the United States Pharmacopoeia (USP) and European Pharmacopoeia

  6. Mercury contamination extraction

    Science.gov (United States)

    Fuhrmann, Mark [Silver Spring, MD; Heiser, John [Bayport, NY; Kalb, Paul [Wading River, NY

    2009-09-15

    Mercury is removed from contaminated waste by firstly applying a sulfur reagent to the waste. Mercury in the waste is then permitted to migrate to the reagent and is stabilized in a mercury sulfide compound. The stable compound may then be removed from the waste which itself remains in situ following mercury removal therefrom.

  7. Main: SAD201 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available method Diversification of protein structural analysis technologies by the SAIL method Masatsune Kainosho Graduate School of Science, Nagoya University SAD201.csml ... ...SAD201 SAD2 Diversification of protein structural analysis technologies by the SAIL

  8. Rethinking mercury: the role of selenium in the pathophysiology of mercury toxicity.

    Science.gov (United States)

    Spiller, Henry A

    2018-05-01

    There is increasing evidence that the pathophysiological target of mercury is in fact selenium, rather than the covalent binding of mercury to sulfur in the body's ubiquitous sulfhydryl groups. The role of selenium in mercury poisoning is multifaceted, bidirectional, and central to understanding the target organ toxicity of mercury. An initial search was performed using Medline/PubMed, Toxline, Google Scholar, and Google for published work on mercury and selenium. These searches yielded 2018 citations. Publications that did not evaluate selenium status or evaluated environmental status (e.g., lake or ocean sediment) were excluded, leaving approximately 500 citations. This initial selection was scrutinized carefully and 117 of the most relevant and representative references were selected for use in this review. Binding of mercury to thiol/sulfhydryl groups: Mercury has a lower affinity for thiol groups and higher affinity for selenium containing groups by several orders of magnitude, allowing for binding in a multifaceted way. The established binding of mercury to thiol moieties appears to primarily involve the transport across membranes, tissue distribution, and enhanced excretion, but does not explain the oxidative stress, calcium dyshomeostasis, or specific organ injury seen with mercury. Effects of mercury on selenium and the role this plays in the pathophysiology of mercury toxicity: Mercury impairs control of intracellular redox homeostasis with subsequent increased intracellular oxidative stress. Recent work has provided convincing evidence that the primary cellular targets are the selenoproteins of the thioredoxin system (thioredoxin reductase 1 and thioredoxin reductase 2) and the glutathione-glutaredoxin system (glutathione peroxidase). Mercury binds to the selenium site on these proteins and permanently inhibits their function, disrupting the intracellular redox environment. A number of other important possible target selenoproteins have been identified

  9. Experimental cross-sections for proton induced nuclear reactions on mercury up to 65 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Hermanne, A., E-mail: aherman@vub.ac.be [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Brussels (Belgium); Tárkányi, F.; Takács, S.; Ditrói, F.; Szücs, Z.; Brezovcsik, K. [Institute of Nuclear Research, Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary)

    2016-07-01

    Cross-sections for formation of activation products induced by protons on natural mercury targets were measured. Results for {sup 196m,196g,197g}(cum), {sup 198m,198g,199g}(cum), {sup 200g}(cum), {sup 201,202}Tl, {sup 194g}(cum), {sup 195g}(cum), {sup 196g}(cum), {sup 198m,199g}(cum) Au and {sup 195m,197m,203}Hg are presented up to 65 MeV incident particle energy, many of these for the first time. The experimental data are compared with literature values and with the predictions of the TALYS 1.6 code (results taken from TENDL-2015 on-line library), thick target yields were derived and possible applications in biomedical sciences are discussed.

  10. Mercury Quick Facts: Health Effects of Mercury Exposure

    Science.gov (United States)

    Mercury Quick Facts Health Effects of Mercury Exposure What is Elemental Mercury? Elemental (metallic) mercury is the shiny, silver-gray metal found in thermometers, barometers, and thermostats and other ...

  11. WE-DE-201-06: Impact of Temporal Image Coregistration Methods On 3D Internal Dose Calculations in Targeted Radionuclide Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Besemer, A; Marsh, I; Bednarz, B [University of Wisconsin, Madison, WI (United States)

    2016-06-15

    Purpose: The calculation of 3D internal dose calculations in targeted radionuclide therapy requires the acquisition and temporal coregistration of a serial PET/CT or SPECT/CT images. This work investigates the dosimetric impact of different temporal coregistration methods commonly used for 3D internal dosimetry. Methods: PET/CT images of four mice were acquired at 1, 24, 48, 72, 96, 144 hrs post-injection of {sup 124}I-CLR1404. The therapeutic {sup 131}I-CLR1404 absorbed dose rate (ADR) was calculated at each time point using a Geant4-based MC dosimetry platform using three temporal image coregistration Methods: (1) no coregistration (NC), whole body sequential CT-CT affine coregistration (WBAC), and individual sequential ROI-ROI affine coregistration (IRAC). For NC, only the ROI mean ADR was integrated to obtain ROI mean doses. For WBAC, the CT at each time point was coregistered to a single reference CT. The CT transformations were applied to the corresponding ADR images and the dose was calculated on a voxel-basis within the whole CT volume. For IRAC, each individual ROI was isolated and sequentially coregistered to a single reference ROI. The ROI transformations were applied to the corresponding ADR images and the dose was calculated on a voxel-basis within the ROI volumes. Results: The percent differences in the ROI mean doses were as large as 109%, 88%, and 32%, comparing the WBAC vs. IRAC, NC vs. IRAC, and NC vs. WBAC methods, respectively. The CoV in the mean dose between the all three methods ranged from 2–36%. The pronounced curvature of the spinal cord was not adequately coregistered using WBAC which resulted in large difference between the WBAC and IRAC. Conclusion: The method used for temporal image coregistration can result in large differences in 3D internal dosimetry calculations. Care must be taken to choose the most appropriate method depending on the imaging conditions, clinical site, and specific application. This work is partially funded by

  12. Selected case histories and epidemiologic examples of human mercury poisoning

    Energy Technology Data Exchange (ETDEWEB)

    Gerstner, H.B.; Huff, J.E.

    1977-01-01

    Clinical aspects of mercury poisoning are described for elemental mercury, inorganic mercury compounds, and organic mercury compounds. Critical targets of poisoning by elemental mercury are the lungs and the central nervous system. A case of acute pulmonary injury and a case of chronic brain injury are described. The effects of inorganic mercury compounds are chiefly injuries to the alimentary canal and kidneys. Two cases of acute intoxication from these compounds are described. An epidemiologic study on Africans suffering from the nephrotic syndrome showed that aminomercuric chloride was the causative agent. Organic mercury compounds are discussed with regard to the following: individual cases of the methylmercury syndrome in adults; individual cases of prenatal methylmercury intoxication; epidemic outbreaks of methylmercury poisoning; epidemiology of methylmercury poisoning through dressed seed grain; and epidemic outbreaks of poisonings by organomercurials other than methylmercury. (HLW)

  13. Mercury speciation analysis in marine samples by HPLC-ICPMS

    DEFF Research Database (Denmark)

    Rasmussen, Rie Romme; Svendsen, Maja Erecius; Herbst, M. Birgitte Koch

    Mercury (Hg) is a naturally occurring element, which is found in the earth’s crust and can be released into the environment through both natural and anthropogenic processes. Mercury exists as elemental mercury (metallic), inorganic mercury and organic mercury (primarily methylmercury......). Methylmercury is highly toxic, particularly to the nervous system, and the developing brain is thought to be the most sensitive target organ for methylmercury toxicity. Methylmercury bioaccumulates and biomagnifies along the food chain and it is the most common mercury species in fish and seafood. Human...... hydrochloric acid by sonication. Hereby the protein-bound mercury species are released. The extracts were then centrifuged (10 min at 3170 x g) and the supernatant decanted (extraction step was repeated twice). The combined extracts were added 10 M sodium hydroxide to increase pH, following further dilution...

  14. Thallium 201 scintigraphy

    International Nuclear Information System (INIS)

    Thallium-201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The main clinical application of 201 Tl scintigraphy has been in myocardial imaging. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 to 95% though computer processing of the images may be necessary to achieve the higher figure. The main clinical value of 201 Tl myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most patients with suspected or established acute myocardial infarction. Imaging of organs other than the heart with 201 Tl has received much less attention but has been reported in patients with peripheral vascular disease and various primary and secondary neoplasms

  15. Thallium 201 scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    McKillop, J.H.

    1980-07-01

    Thallium-201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The main clinical application of /sup 201/Tl scintigraphy has been in myocardial imaging. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 to 95% though computer processing of the images may be necessary to achieve the higher figure. The main clinical value of /sup 201/Tl myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most patients with suspected or established acute myocardial infarction. Imaging of organs other than the heart with /sup 201/Tl has received much less attention but has been reported in patients with peripheral vascular disease and various primary and secondary neoplasms.

  16. Thallium 201 Scintigraphy

    OpenAIRE

    McKillop, James H.

    1980-01-01

    The radioactive isotope thallium 201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The radionuclide emits 80 keV x-rays which are suitable for scintillation camera imaging.

  17. Thallium 201 Scintigraphy

    Science.gov (United States)

    McKillop, James H.

    1980-01-01

    The radioactive isotope thallium 201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The radionuclide emits 80 keV x-rays which are suitable for scintillation camera imaging. The main clinical application of 201TI scintigraphy has been in myocardial imaging. Abnormal uptake of the isotope results in a cold spot on the myocardial image. In patients with coronary artery disease, the differentiation of ischemic and infarcted myocardium is made by comparing images obtained after injecting the radionuclide at the peak of a maximal exercise test with those obtained after injection at rest. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. Some investigators believe that redistribution images obtained four to six hours after stress injection (without administering further 201TI) give the same information as a separate rest study. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 percent to 95 percent, though computer processing of the images may be necessary to achieve the higher figure. The prediction of the extent of coronary disease from 201TI images is less reliable. An abnormal 201TI image is not entirely specific for coronary artery disease and the likelihood of an abnormal image being due to this diagnosis varies according to the clinical circumstances. The main clinical value of 201TI myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most

  18. Metallic mercury use by South African traditional health practitioners: perceptions and practices

    OpenAIRE

    Street, Ren?e A.; Kabera, Ga?tan M.; Connolly, Catherine

    2015-01-01

    Background Mercury is a toxic metal however its use in traditional healthcare systems remains widespread. The aim of this study was to determine the prevalence of mercury use by South African Traditional Health Practitioners (THP) and to document reasons for use and administration methods. Methods A cross-sectional study design was employed. A total of 201 THPs were enrolled from two main metropolitan areas of KwaZulu-Natal (South Africa), and 198 were included in the final analysis. Informat...

  19. Minamata Convention on Mercury

    Science.gov (United States)

    On November 6, 2013 the United States signed the Minamata Convention on Mercury, a new multilateral environmental agreement that addresses specific human activities which are contributing to widespread mercury pollution

  20. Mercury in Your Environment

    Science.gov (United States)

    Basic information about mercury, how it gets in the air, how people are exposed to it and health effects associated with exposure; what EPA and other organizations are doing to limit exposures; what citizens should know to minimize exposures and to reduce mercury in the environment; and information about products that contain mercury.

  1. Intentional intravenous mercury injection

    African Journals Online (AJOL)

    Three forms of mercury exist: elemental, inorganic and organic, all of which may be toxic with clinical consequences, depending on the type of exposure. Elemental mercury poisoning usually occurs via vapour inhalation, as mercury is well absorbed through the lungs. The central nervous system is then the major site of ...

  2. Process for producing thallium-201

    International Nuclear Information System (INIS)

    Ageev, V.A.; Kljucnikov, A.A.; Linev, A.F.; Chalkin, V.A.; Zajceva, N.G.

    1985-01-01

    A storage plate of pure Pb-206 enriched up to 95% is irradiated with a 50 to 70 MeV proton beam. The plate is then dissolved in acid, and the Th-201 contained in the solution is oxydated and precipitated from the Pb solution. Traces of Pb retained in the solution are separated from the Th-201 by cation exchange, and the Th-201 is eluated using hydrochloric acid. (orig./PW) [de

  3. 18 CFR 385.201 - Applicability (Rule 201).

    Science.gov (United States)

    2010-04-01

    ...). 385.201 Section 385.201 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION..., Notices of Tariff or Rate Examination, Orders To Show Cause, Intervention, and Summary Disposition § 385... tariff or rate examination, order to show cause, intervention, or summary disposition. ...

  4. Mercury evaporation from amalgams with varied mercury contents.

    Science.gov (United States)

    Ohmoto, K; Nakajima, H; Ferracane, J L; Shintani, H; Okabe, T

    2000-09-01

    This study examined the relationship between mercury content and mercury evaporation from amalgams during setting. Two different types of commercial high-copper amalgams (single composition and admixed types) were used. Cylindrical specimens of each amalgam were prepared with five different mercury contents according to ADA Specification No.1. Specimens were also prepared by hand condensation. Mercury evaporation from amalgam specimens maintained at 37 degrees C was measured using a gold film mercury analyzer from 10 min after the end of trituration until the mercury concentration in air reached an undetectable level. The mercury content more clearly influenced the mercury evaporation from the admixed type amalgam specimens when the mercury content decreased below the manufacturers' recommended trituration conditions. Triturating with less mercury than the manufacturers' recommended amount cannot lower the evaporation of mercury from freshly made amalgam. Proper condensing procedures can minimize the mercury evaporation from the amalgam surface.

  5. Isolation of radioactive thallium from lead targets

    International Nuclear Information System (INIS)

    Kozlova, M.D.; Sevast'yanova, A.S.; Malinin, A.B.; Kurenkov, N.V.

    1989-01-01

    Two methods of thallium-201 preperation from Pb-targets irradiated with protons: precipitation-extraction (1) and extraction (2) - are developed. When the target irraiated is extracted during the time necessary for bismuth-201 transformation into lead-201, lead macroquantity containing lead-201 was separated from undesirable thallium radionuclides, which are formed in direct nuclear reactions. The lead fraction was extracted to accumulate thallium-201, and it was separated from lead mocroquantity. The target was dissolved in the nitric acid. The 1st method differs from the 2nd one by the fact that before thallium-201 extraction, lead was precipitaed by the nitric acid. The 1st method permits to separate thallium-201 with chemical yield not less than 90 %, the 2nd one - ≥95 %. 2 refs

  6. Mercury balance analysis

    International Nuclear Information System (INIS)

    Maag, J.; Lassen, C.; Hansen, E.

    1996-01-01

    A detailed assessment of the consumption of mercury, divided into use areas, was carried out. Disposal and emissions to the environment were also qualified. The assessment is mainly based on data from 1992 - 1993. The most important source of emission of mercury to air is solid waste incineration which is assessed in particular to be due to the supply of mercury in batteries (most likely mercury oxide batteries from photo equipment) and to dental fillings. The second most important source of mercury emission to air is coal-fired power plants which are estimated to account for 200-500 kg of mercury emission p.a. Other mercury emissions are mainly related to waste treatment and disposal. The consumption of mercury is generally decreasing. During the period from 1982/83 - 1992-93, the total consumption of mercury in Denmark was about halved. This development is related to the fact that consumption with regard to several important use areas (batteries, dental fillings, thermometers etc.) has been significantly reduced, while for other purposes the use of mercury has completely, or almost disappeared, i.e. (fungicides for seed, tubes etc.). (EG)

  7. Metallic mercury use by South African traditional health practitioners: perceptions and practices.

    Science.gov (United States)

    Street, Renée A; Kabera, Gaëtan M; Connolly, Catherine

    2015-08-15

    Mercury is a toxic metal however its use in traditional healthcare systems remains widespread. The aim of this study was to determine the prevalence of mercury use by South African Traditional Health Practitioners (THP) and to document reasons for use and administration methods. A cross-sectional study design was employed. A total of 201 THPs were enrolled from two main metropolitan areas of KwaZulu-Natal (South Africa), and 198 were included in the final analysis. Information on demographic characteristics, reasons for using or not using mercury as well as mercury administration methods were collected. Of the 198 THPs, 78 (39%) used mercury for healing purposes and 74 (95%) of the mercury users stated that they were taught to use it by another THP. The two main routes of administration were oral and sub-cutaneous implantations (ukugcaba) at 85% (n = 66) and 59% (n = 46), respectively. The most common responses for mercury administration were for child birth (n = 70; 90%) and protection against guns (n = 39; 50%). This is the first study to describe the prevalence and practice of mercury use in South African traditional medicine. Socio-cultural mercury use is a potential source of exposure to both THPs and their patients. In light of such findings, public education messages and regulatory measures need to be effected.

  8. Process for low mercury coal

    Science.gov (United States)

    Merriam, Norman W.; Grimes, R. William; Tweed, Robert E.

    1995-01-01

    A process for producing low mercury coal during precombustion procedures by releasing mercury through discriminating mild heating that minimizes other burdensome constituents. Said mercury is recovered from the overhead gases by selective removal.

  9. Historical variations in the stable isotope composition of mercury in a sediment core from a riverine lake: Effects of dams, pulp and paper mill wastes, and mercury from a chlor-alkali plant

    International Nuclear Information System (INIS)

    Jackson, Togwell A.

    2016-01-01

    The Wabigoon River (Ontario, Canada) was affected by dams starting in 1898 and was polluted with pulp and paper mill wastes starting in 1913 and mercury from a chlor-alkali plant from 1962 to 1975. A dated sediment core from a riverine lake was analysed to investigate resultant changes in the biogeochemistry of mercury as revealed by variations in mercury isotope ratios and sediment chemistry. A total mercury maximum formed by the mercury pollution coincided with minimums in the δ-values of the 198 Hg/ 202 Hg, 199 Hg/ 202 Hg, 200 Hg/ 202 Hg, and 201 Hg/ 202 Hg ratios, and the δ-values decreased in the order δ 201 Hg > δ 200 Hg > δ 199 Hg > δ 198 Hg. Thus, mass-dependent fractionation caused depletion in lighter isotopes, implying evaporation of Hg(0) and pollution of the atmosphere as well as the river-lake system. Concurrently, mass-independent fractionation caused 199 Hg enrichment, possibly reflecting an independently documented upsurge in methylmercury production, and 201 Hg depletion, suggesting removal of methylmercury with anomalously high 201 Hg/ 199 Hg ratios by aquatic organisms and accumulation of 201 Hg-depleted inorganic Hg(II) in sediments. The δ 201 Hg/δ 199 Hg ratio rose abruptly when mercury pollution began, reflecting the resultant increase in methylmercury production, and remained high but gradually declined as the pollution abated, paralleling trends shown by methylmercury in aquatic organisms. The δ 201 Hg/δ 199 Hg ratio of pre-1962 background mercury increased ca. 1898 and ca. 1913–1929, suggesting accelerated methylmercury production due to stimulation of microbial activities by the damming of the river and the input of pulp and paper mill wastes, respectively. Other variations were linked to economic and technological factors that affected pulp and paper manufacture. - Highlights: • A core from a lake polluted by Hg and organic wastes was analysed for Hg isotopes. • Hg from a chlor-alkali plant was depleted in lighter

  10. Mercury is Moon's brother

    International Nuclear Information System (INIS)

    Ksanfomalifi, L.V.

    1976-01-01

    The latest information on Mercury planet is presented obtained by studying the planet with the aid of radar and space vehicles. Rotation of Mercury about its axis has been discovered; within 2/3 of its year it executes a complete revolution about its axis. In images obtained by the ''Mariner-10'' Mercurys surface differs little from that of the Moon. The ''Mariner-10'' has also discovered the Mercurys atmosphere, which consists of extremely rarefied helium. The helium is continuously supplied to the planet by the solar wind. The Mercury's magnetic field has been discovered, whose strength is 35 x 10 -4 at the Equator and 70 x 10 -4 E at the poles. The inclination of the dipole axis to the Mercury's rotation axis is 7 deg

  11. Peru Mercury Inventory 2006

    Science.gov (United States)

    Brooks, William E.; Sandoval, Esteban; Yepez, Miguel A.; Howard, Howell

    2007-01-01

    In 2004, a specific need for data on mercury use in South America was indicated by the United Nations Environmental Programme-Chemicals (UNEP-Chemicals) at a workshop on regional mercury pollution that took place in Buenos Aires, Argentina. Mercury has long been mined and used in South America for artisanal gold mining and imported for chlor-alkali production, dental amalgam, and other uses. The U.S. Geological Survey (USGS) provides information on domestic and international mercury production, trade, prices, sources, and recycling in its annual Minerals Yearbook mercury chapter. Therefore, in response to UNEP-Chemicals, the USGS, in collaboration with the Economic Section of the U.S. Embassy, Lima, has herein compiled data on Peru's exports, imports, and byproduct production of mercury. Peru was selected for this inventory because it has a 2000-year history of mercury production and use, and continues today as an important source of mercury for the global market, as a byproduct from its gold mines. Peru is a regional distributor of imported mercury and user of mercury for artisanal gold mining and chlor-alkali production. Peruvian customs data showed that 22 metric tons (t) of byproduct mercury was exported to the United States in 2006. Transshipped mercury was exported to Brazil (1 t), Colombia (1 t), and Guyana (1 t). Mercury was imported from the United States (54 t), Spain (19 t), and Kyrgyzstan (8 t) in 2006 and was used for artisanal gold mining, chlor-alkali production, dental amalgam, or transshipment to other countries in the region. Site visits and interviews provided information on the use and disposition of mercury for artisanal gold mining and other uses. Peru also imports mercury-containing batteries, electronics and computers, fluorescent lamps, and thermometers. In 2006, Peru imported approximately 1,900 t of a wide variety of fluorescent lamps; however, the mercury contained in these lamps, a minimum of approximately 76 kilograms (kg), and in

  12. RECOVERY OF MERCURY FROM CONTAMINATED PRIMARY AND SECONDARY WASTES

    International Nuclear Information System (INIS)

    A. Faucette; J. Bognar; T. Broderick; T. Battaglia

    2000-01-01

    Effective removal of mercury contamination from water is a complex and difficult problem. In particular, mercury treatment of natural waters is difficult because of the low regulatory standards. For example, the Environmental Protection Agency has established a national ambient water quality standard of 12 parts-per-trillion (ppt), whereas the standard is 1.8 ppt in the Great Lakes Region. In addition, mercury is typically present in several different forms, but sorption processes are rarely effective with more than one or two of these forms. To meet the low regulatory discharge limits, a sorption process must be able to address all forms of mercury present in the water. One approach is to apply different sorbents in series depending on the mercury speciation and the regulatory discharge limits. Four new sorbents have been developed to address the variety of mercury species present in industrial discharges and natural waters. Three of these sorbents have been field tested on contaminated creek water at the Y-12 Plant. Two of these sorbents have demonstrated very high removal efficiencies for soluble mercury species, with mercury concentrations at the outlet of a pilot-scale system less than 12 ppt for as long as six months. The other sorbent tested at the Y-12 Plant is targeted at colloidal mercury that is not removed by standard sorption or filtration processes. At the Y-12 Plant, colloidal mercury appears to be associated with iron, so a sorbent that removes mercury-iron complexes in the presence of a magnetic field was evaluated. Field results indicate good removal of this mercury fraction from the Y-12 waters. In addition, this sorbent is easily regenerated by simply removing the magnetic field and flushing the columns with water. The fourth sorbent is still undergoing laboratory development, but results to date indicate exceptionally high mercury sorption capacity. The sorbent is capable of removing all forms of mercury typically present in natural and

  13. Conductometric Sensors for Detection of Elemental Mercury Vapor

    Science.gov (United States)

    Ryan, M. A.; Homer, M. L.; Shevade, A. V.; Lara, L. M.; Yen, S.-P. S.; Kisor, A. K.; Manatt, K. S.

    2008-01-01

    Several organic and inorganic materials have been tested for possible incorporation into a sensing array in order to add elemental mercury vapor to the suite of chemical species detected. Materials have included gold films, treated gold films, polymer-carbon composite films, gold-polymer-carbon composite films and palladium chloride sintered films. The toxicity of mercury and its adverse effect on human and animal health has made environmental monitoring of mercury in gas and liquid phases important (1,2). As consumer products which contain elemental mercury, such as fluorescent lighting, become more widespread, the need to monitor environments for the presence of vapor phase elemental mercury will increase. Sensors in use today to detect mercury in gaseous streams are generally based on amalgam formation with gold or other metals, including noble metals and aluminum. Recently, NASA has recognized a need to detect elemental mercury vapor in the breathing atmosphere of the crew cabin in spacecraft and has requested that such a capability be incorporated into the JPL Electronic Nose (3). The detection concentration target for this application is 10 parts-per-billion (ppb), or 0.08 mg/m3. In order to respond to the request to incorporate mercury sensing into the JPL Electronic Nose (ENose) platform, it was necessary to consider only conductometric methods of sensing, as any other transduction method would have required redesign of the platform. Any mercury detection technique which could not be incorporated into the existing platform, such as an electrochemical technique, could not be considered.

  14. MESSENGER at Mercury: Early Orbital Operations

    Science.gov (United States)

    McNutt, Ralph L., Jr; Solomon, Sean C.; Bedini, Peter D.; Anderson, Brian J.; Blewett, David T.; Evans, Larry G.; Gold, Robert E.; Krimigis, Stamatios M.; Murchie, Scott L.; Nittler, Larry R.; hide

    2013-01-01

    The MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft, launched in August 2004 under NASA's Discovery Program, was inserted into orbit about the planet Mercury in March 2011. MESSENGER's three flybys of Mercury in 2008-2009 marked the first spacecraft visits to the innermost planet since the Mariner 10 flybys in 1974-1975. The unprecedented orbital operations are yielding new insights into the nature and evolution of Mercury. The scientific questions that frame the MESSENGER mission led to the mission measurement objectives to be achieved by the seven payload instruments and the radio science experiment. Interweaving the full set of required orbital observations in a manner that maximizes the opportunity to satisfy all mission objectives and yet meet stringent spacecraft pointing and thermal constraints was a complex optimization problem that was solved with a software tool that simulates science observations and tracks progress toward meeting each objective. The final orbital observation plan, the outcome of that optimization process, meets all mission objectives. MESSENGER's Mercury Dual Imaging System is acquiring a global monochromatic image mosaic at better than 90% coverage and at least 250 m average resolution, a global color image mosaic at better than 90% coverage and at least 1 km average resolution, and global stereo imaging at better than 80% coverage and at least 250 m average resolution. Higher-resolution images are also being acquired of targeted areas. The elemental remote sensing instruments, including the Gamma-Ray and Neutron Spectrometer and the X-Ray Spectrometer, are being operated nearly continuously and will establish the average surface abundances of most major elements. The Visible and Infrared Spectrograph channel of MESSENGER's Mercury Atmospheric and Surface Composition Spectrometer is acquiring a global map of spectral reflectance from 300 to 1450 nm wavelength at a range of incidence and emission

  15. 7 CFR 201.42 - Small containers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container or...

  16. Modeling Mercury in Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Jeremy C [ORNL; Parks, Jerry M [ORNL

    2016-01-01

    Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively non-toxic, other forms such as Hg2+ and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg2+ can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg2+ to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed picture and circumvent issues associated with toxicity. Here we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intra-protein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confers mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multi-scale model of environmental mercury cycling.

  17. Intentional intravenous mercury injection

    African Journals Online (AJOL)

    In this case report, intravenous complications, treatment strategies and possible ... Mercury toxicity is commonly associated with vapour inhalation or oral ingestion, for which there exist definite treatment options. Intravenous mercury ... personality, anxiousness, irritability, insomnia, depression and drowsi- ness.[1] However ...

  18. International mercury conference

    CSIR Research Space (South Africa)

    Leaner, J

    2006-10-01

    Full Text Available Mercury (Hg) affects human health and the environment, it calls for immediate action. Action is needed at local, regional and international level to reduce the risk associated with mercury, which is a global international problem, as it is a...

  19. Mercury's shifting, rolling past

    OpenAIRE

    Trulove, Susan

    2008-01-01

    Patterns of scalloped-edged cliffs or lobate scarps on Mercury's surface are thrust faults that are consistent with the planet shrinking and cooling with time. However, compression occurred in the planet's early history and Mariner 10 images revealed decades ago that lobate scarps are among the youngest features on Mercury. Why don't we find more evidence of older compressive features?

  20. MESSENGER: Exploring Mercury's Magnetosphere

    Science.gov (United States)

    Slavin, James A.

    2008-01-01

    The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. Mercury's magnetosphere is unique in many respects. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only - 1000 to 2000 km above the surface. For this reason there are no closed dri-fi paths for energetic particles and, hence, no radiation belts; the characteristic time scales for wave propagation and convective transport are short possibly coupling kinetic and fluid modes; magnetic reconnection at the dayside magnetopause may erode the subsolar magnetosphere allowing solar wind ions to directly impact the dayside regolith; inductive currents in Mercury's interior should act to modify the solar In addition, Mercury's magnetosphere is the only one with its defining magnetic flux tubes rooted in a planetary regolith as opposed to an atmosphere with a conductive ionosphere. This lack of an ionosphere is thought to be the underlying reason for the brevity of the very intense, but short lived, approx. 1-2 min, substorm-like energetic particle events observed by Mariner 10 in Mercury's magnetic tail. In this seminar, we review what we think we know about Mercury's magnetosphere and describe the MESSENGER science team's strategy for obtaining answers to the outstanding science questions surrounding the interaction of the solar wind with Mercury and its small, but dynamic magnetosphere.

  1. Global Mercury Assessment 2013

    International Development Research Centre (IDRC) Digital Library (Canada)

    mercury pollution. This summary report and the accompanying. Technical Background Report for the Global. Mercury Assessment 2013 are developed in response to Decision 25/5, paragraph ... The use of different pollution control technologies in different ...... vegetation, snow, freshwater, and seawater. One of the largest ...

  2. Mercury in canned tuna: white versus light and temporal variation

    International Nuclear Information System (INIS)

    Burger, Joanna; Gochfeld, Michael

    2004-01-01

    mercury. These data indicate that people who eat canned tuna frequently can choose light tuna and reduce their mercury intake. Canned mackerel had much lower levels of mercury than tuna. Since cans of white tuna frequently exceed the FDA's original action level of 0.5 ppm, it would be prudent to continue some systematic monitoring of the nation's canned fish supply, particularly as the targets of commercial fisheries inevitably change as certain stocks become depleted

  3. Trace-level mercury removal from surface water

    International Nuclear Information System (INIS)

    Klasson, K.T.; Bostick, D.T.

    1998-01-01

    Many sorbents have been developed for the removal of mercury and heavy metals from waters; however, most of the data published thus far do not address the removal of mercury to the target levels represented in this project. The application to which these sorbents are targeted for use is the removal of mercury from microgram-per-liter levels to low nanogram-per-liter levels. Sorbents with thiouronium, thiol, amine, sulfur, and proprietary functional groups were selected for these studies. Mercury was successfully removed from surface water via adsorption onto Ionac SR-4 and Mersorb resins to levels below the target goal of 12 ng/L in batch studies. A thiol-based resin performed the best, indicating that over 200,000 volumes of water could be treated with one volume of resin. The cost of the resin is approximately $0.24 per 1,000 gal of water

  4. Municipal actions to reduce mercury

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-03-15

    This paper presented proper management practices for products containing mercury. The measures can help reduce mercury releases, occupational exposure and mercury spills, thereby preventing impacts on human health and the environment. Despite mercury's toxic nature, many common products that contain mercury are commercially available. These include thermostats, thermometers, fluorescent lamps, pressure measuring devices, electrical switches and relays, and dental amalgam. Mercury emissions are also associated with base metal smelting, waste incineration and coal-fired power generation. Mercury in the environment is a global issue, because it can travel in the atmosphere on wind currents. The actions taken by municipalities to address the issue include reducing or eliminating mercury releases from internal municipal operations and sources within the community. This document provided guidance on how to develop a Municipal Mercury Elimination Policy and Plan that will help reduce mercury releases. It presented information and case studies that will help municipalities manage mercury-containing products found in municipal buildings and street lighting. Information on sources of mercury from within the community was presented along with case studies that can help municipalities determine where community action is needed to reduce mercury releases. The 5 modules of this document were intended to help municipalities identify priorities, timelines and budget requirements for mercury initiatives. It was emphasized that municipalities that adopt a Municipal Mercury Elimination Policy and Plan formally commit to reducing and eliminating mercury from the environment. tabs., figs.

  5. Getting Mercury out of Schools.

    Science.gov (United States)

    1999

    This guide was prepared while working with many Massachusetts schools to remove items that contain mercury and to find suitable alternatives. It contains fact sheets on: mercury in science laboratories and classrooms, mercury in school buildings and maintenance areas, mercury in the medical office and in medical technology classrooms in vocational…

  6. Effects of wettability on forced convective and gas-liquid two-phase flow heat transfer of mercury

    International Nuclear Information System (INIS)

    Nakagawa, Yusuke; Kawakita, Keisuke; Takenaka, Nobuyuki

    2003-01-01

    High-energy proton beam is irradiated to a target made of high atomic number materials to initiate nuclear spallation reaction to obtain neutron source. A mercury target is now a candidate of the target for the intense proton beam. It is important to study thermal hydraulics of the mercury target. In this study, mercury was used as a working fluid in a stainless steel tube heated by direct electrical current in similar thermal hydraulic situation to the actual target. The effects of mercury wettability on forced convective heat transfer and gas-liquid two-phase flow heat transfer were verified. (author)

  7. Mercury's Dynamic Magnetic Tail

    Science.gov (United States)

    Slavin, James A.

    2010-01-01

    The Mariner 10 and MESSENGER flybys of Mercury have revealed a magnetosphere that is likely the most responsive to upstream interplanetary conditions of any in the solar system. The source of the great dynamic variability observed during these brief passages is due to Mercury's proximity to the Sun and the inverse proportionality between reconnection rate and solar wind Alfven Mach number. However, this planet's lack of an ionosphere and its small physical dimensions also contribute to Mercury's very brief Dungey cycle, approx. 2 min, which governs the time scale for internal plasma circulation. Current observations and understanding of the structure and dynamics of Mercury's magnetotail are summarized and discussed. Special emphasis will be placed upon such questions as: 1) How much access does the solar wind have to this small magnetosphere as a function of upstream conditions? 2) What roles do heavy planetary ions play? 3) Do Earth-like substorms take place at Mercury? 4) How does Mercury's tail respond to extreme solar wind events such coronal mass ejections? Prospects for progress due to advances in the global magnetohydrodynamic and hybrid simulation modeling and the measurements to be taken by MESSENGER after it enters Mercury orbit on March 18, 2011 will be discussed.

  8. Direct determination of mercury in cosmetic samples by isotope dilution inductively coupled plasma mass spectrometry after dissolution with formic acid

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Ying; Shi, Zeming; Zong, Qinxia; Wu, Peng; Su, Jing [Sichuan Provincial Key Laboratory of Nuclear Technology in Geology, College of Nuclear Technology and Automation Engineering, Chengdu University of Technology, Chengdu 610059 (China); Liu, Rui, E-mail: liur.ray@gmail.com [Mineral Resources Chemistry Key Laboratory of Sichuan Higher Education Institutions, College of Materials and Chemistry and Chemical Engineering, Chengdu University of Technology, Chengdu 610059 (China)

    2014-02-17

    Graphical abstract: -- Highlights: •Simple, sensitive, and accurate method is established for mercury determination in cosmetics. •The sample preparation procedure is highly simplified. •Isotope dilution efficiently eliminates matrix effect. •First report of using formic acid based method in combination with PVG-ID-ICP MS for mercury quantitation in cosmetics. -- Abstract: A new method was proposed for the accurate determination of mercury in cosmetic samples based on isotopic dilution (ID)-photochemical vapor generation (PVG)-inductively coupled plasma mass spectrometry (ICP MS) measurement. Cosmetic samples were directly dissolved in formic acid solution and subsequently subjected to PVG for the reduction of mercury into vapor species following by ICP MS detection. Therefore, the risks of analyte contamination and loss were avoided. Highly enriched {sup 201}Hg isotopic spike is added to cosmetics and the isotope ratios of {sup 201}Hg/{sup 202}Hg were measured for the quantitation of mercury. With ID calibration, the influences originating from sample matrixes for the determination of mercury in cosmetic samples have been efficiently eliminated. The effects of several experimental parameters, such as the concentration of the formic acid, and the flow rates of carrier gas and sample were investigated. The method provided good reproducibility and the detection limits were found to be 0.6 pg mL{sup −1}. Finally, the developed method was successfully applied for the determination of mercury in six cosmetic samples and a spike test was performed to verify the accuracy of the method.

  9. Direct determination of mercury in cosmetic samples by isotope dilution inductively coupled plasma mass spectrometry after dissolution with formic acid

    International Nuclear Information System (INIS)

    Gao, Ying; Shi, Zeming; Zong, Qinxia; Wu, Peng; Su, Jing; Liu, Rui

    2014-01-01

    Graphical abstract: -- Highlights: •Simple, sensitive, and accurate method is established for mercury determination in cosmetics. •The sample preparation procedure is highly simplified. •Isotope dilution efficiently eliminates matrix effect. •First report of using formic acid based method in combination with PVG-ID-ICP MS for mercury quantitation in cosmetics. -- Abstract: A new method was proposed for the accurate determination of mercury in cosmetic samples based on isotopic dilution (ID)-photochemical vapor generation (PVG)-inductively coupled plasma mass spectrometry (ICP MS) measurement. Cosmetic samples were directly dissolved in formic acid solution and subsequently subjected to PVG for the reduction of mercury into vapor species following by ICP MS detection. Therefore, the risks of analyte contamination and loss were avoided. Highly enriched 201 Hg isotopic spike is added to cosmetics and the isotope ratios of 201 Hg/ 202 Hg were measured for the quantitation of mercury. With ID calibration, the influences originating from sample matrixes for the determination of mercury in cosmetic samples have been efficiently eliminated. The effects of several experimental parameters, such as the concentration of the formic acid, and the flow rates of carrier gas and sample were investigated. The method provided good reproducibility and the detection limits were found to be 0.6 pg mL −1 . Finally, the developed method was successfully applied for the determination of mercury in six cosmetic samples and a spike test was performed to verify the accuracy of the method

  10. Inorganic: the other mercury.

    Science.gov (United States)

    Risher, John F; De Rosa, Christopher T

    2007-11-01

    There is a broad array of mercury species to which humans may be exposed. While exposure to methylmercury through fish consumption is widely recognized, the public is less aware of the sources and potential toxicity of inorganic forms of mercury. Some oral and laboratory thermometers, barometers, small batteries, thermostats, gas pressure regulators, light switches, dental amalgam fillings, cosmetic products, medications, cultural/religious practices, and gold mining all represent potential sources of exposure to inorganic forms of mercury. The route of exposure, the extent of absorption, the pharmacokinetics, and the effects all vary with the specific form of mercury and the magnitude and duration of exposure. If exposure is suspected, a number of tissue analyses can be conducted to confirm exposure or to determine whether an exposure might reasonably be expected to be biologically significant. By contrast with determination of exposure to methylmercury, for which hair and blood are credible indicators, urine is the preferred biological medium for the determination of exposure to inorganic mercury, including elemental mercury, with blood normally being of value only if exposure is ongoing. Although treatments are available to help rid the body of mercury in cases of extreme exposure, prevention of exposure will make such treatments unnecessary. Knowing the sources of mercury and avoiding unnecessary exposure are the prudent ways of preventing mercury intoxication. When exposure occurs, it should be kept in mind that not all unwanted exposures will result in adverse health consequences. In all cases, elimination of the source of exposure should be the first priority of public health officials.

  11. Comparison of damage induced by mercury chloride and ionizing radiation in the susceptible rat model

    International Nuclear Information System (INIS)

    Kim, Ji Hyang; Yoon, Yong Dal; Kim, Jin Kyu

    2003-01-01

    Mercury (Hg), one of the most diffused and hazardous organ-specific environmental contaminants, exists in a wide variety of physical and chemical states. Although the reports indicate that mercury induces a deleterious damage, little has been reported from the investigations of mercury effects in living things. The purpose of this study is to evaluate the effects of mercury chloride and ionizing radiation. Prepubertal male F-344 rats were administered mercury chloride in drinking water throughout the experimental period. Two weeks after whole body irradiation, organs were collected for measuring the induced injury. Serum levels of GOT, GPT, ALP, and LDH were checked in the experimental groups and the hematological analysis was accomplished in plasma. In conclusion, the target organ of mercury chloride seems to be urinary organs and the pattern of damage induced by mercury differs from that of the irradiated group

  12. Recovery of mercury from mercury compounds via electrolytic methods

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1988-01-01

    A process for electrolytically recovering mercury from mercury compounds is provided. In one embodiment, Hg is recovered from Hg.sub.2 Cl.sub.2 employing as the electrolyte solution a mixture of HCl and H.sub.2 O. In another embodiment, Hg is electrolytically recovered from HgO wherein the electrolyte solution is comprised of glacial acetic acid and H.sub.2 O. Also provided is an apparatus for producing isotopically enriched mercury compounds in a reactor and then transporting the dissolved compounds into an electrolytic cell where mercury ions are electrolytically reduced and elemental mercury recovered from the mercury compounds.

  13. The tectonics of Mercury

    International Nuclear Information System (INIS)

    Melosh, H.J.; Mckinnon, W.B.

    1988-01-01

    The probable tectonic history of Mercury and the relative sequence of events are discussed on the basis of data collected by the Mariner-10 spacecraft. Results indicate that Mercury's tectonic activity was confined to its early history; its endogenic activity was principally due to a small change in the shape of its lithosphere, caused by tidal despinning, and a small change in area caused by shrinkage due to cooling. Exogenic processes, in particular the impact activity, have produced more abundant tectonic features. Many features associated with the Caloris basin are due to loading of Mercury's thick lithosphere by extrusive lavas or subsidence due to magma withdrawal. It is emphasized that tectonic features observed on Mercury yield insight into the earliest tectonic events on planets like Mars and, perhaps, the earth, where subsequent events obscured or erased the most ancient tectonic records

  14. Mercury CEM Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John F. Schabron; Joseph F. Rovani; Susan S. Sorini

    2007-03-31

    The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005, requires that calibration of mercury continuous emissions monitors (CEMs) be performed with NIST-traceable standards. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The traceability protocol will be written by EPA. Traceability will be based on the actual analysis of the output of each calibration unit at several concentration levels ranging from about 2-40 ug/m{sup 3}, and this analysis will be directly traceable to analyses by NIST using isotope dilution inductively coupled plasma/mass spectrometry (ID ICP/MS) through a chain of analyses linking the calibration unit in the power plant to the NIST ID ICP/MS. Prior to this project, NIST did not provide a recommended mercury vapor pressure equation or list mercury vapor pressure in its vapor pressure database. The NIST Physical and Chemical Properties Division in Boulder, Colorado was subcontracted under this project to study the issue in detail and to recommend a mercury vapor pressure equation that the vendors of mercury vapor pressure calibration units can use to calculate the elemental mercury vapor concentration in an equilibrium chamber at a particular temperature. As part of this study, a preliminary evaluation of calibration units from five vendors was made. The work was performed by NIST in Gaithersburg, MD and Joe Rovani from WRI who traveled to NIST as a Visiting Scientist.

  15. Mercury in human hair

    International Nuclear Information System (INIS)

    Kapauan, P.A.; Cruz, C.C.; Verceluz, F.P.

    1980-10-01

    The analysis of mercury (Hg) in scalp hair obtained from individuals residing in five different localities in the Philippines - Metro Manila, Naga City in Bicol, Bataan, Oriental Mindoro, and Palawan is presented. An overall mean of 1.46 ug/g of hair was obtained for all samples excluding those from Palawan and represents a baseline value.'' In terms of the mercury levels found in hair, the Honda Bay area in Palawan is, relatively, a ''contaminated area.'' (author)

  16. Mercury Isotopic Evidence for Contrasting Mercury Transport Pathways to Coastal versus Open Ocean Fisheries (Invited)

    Science.gov (United States)

    Blum, J. D.; Senn, D. B.; Chesney, E. J.; Bank, M. S.; Maage, A.; Shine, J. P.

    2009-12-01

    Mercury stable isotopes provide a new method for tracing the sources and chemical transformations of Hg in the environment. In this study we used Hg isotopes to investigate Hg sources to coastal versus migratory open-ocean species of fish residing in the northern Gulf of Mexico (nGOM). We report Hg isotope ratios as δ202Hg (mass dependent fractionation relative to NIST 3133) and Δ201Hg (mass independent fractionation of odd isotopes). In six coastal and two open ocean species (blackfin and yellowfin tuna), Hg isotopic compositions fell into two non-overlapping ranges. The tuna had significantly higher δ202Hg (0.1 to 0.7‰) and Δ201Hg (1.0 to 2.2‰) than the coastal fish (δ202Hg = 0 to -1.0‰; Δ201Hg = 0.4 to 0.5‰). The observations can be best explained by largely disconnected food webs with isotopically distinct MeHg sources. The ratio Δ199Hg/Δ201Hg in nGOM fish is 1.30±0.10 which is consistent with laboratory studies of photochemical MeHg degradation and with ratios measured in freshwater fish (Bergquist and Blum, 2007). The magnitude of mass independent fractionation of Hg in the open-ocean fish suggests that this source of MeHg was subjected to extensive photodegradation (~50%) before entering the base of the open-ocean food web. Given the Mississippi River’s large, productive footprint in the nGOM and the potential for exporting prey and MeHg to the adjacent oligotrophic GOM, the different MeHg sources are noteworthy and consistent with recent evidence in other systems of important open-ocean MeHg sources. Bergquist, B. A. and Blum, J. D., 2007. Mass-dependent and -independent fractionation of Hg isotopes by photoreduction in aquatic systems. Science 318, 417-420.

  17. Evaluation of a sequential extraction process used for determining mercury binding mechanisms to coal combustion byproducts.

    Science.gov (United States)

    Noel, James D; Biswas, Pratim; Giammar, Daniel E

    2007-07-01

    Leaching of mercury from coal combustion byproducts is a concern because of the toxicity of mercury. Leachability of mercury can be assessed by using sequential extraction procedures. Sequential extraction procedures are commonly used to determine the speciation and mobility of trace metals in solid samples and are designed to differentiate among metals bound by different mechanisms and to different solid phases. This study evaluated the selectivity and effectiveness of a sequential extraction process used to determine mercury binding mechanisms to various materials. A six-step sequential extraction process was applied to laboratory-synthesized materials with known mercury concentrations and binding mechanisms. These materials were calcite, hematite, goethite, and titanium dioxide. Fly ash from a full-scale power plant was also investigated. The concentrations of mercury were measured using inductively coupled plasma (ICP) mass spectrometry, whereas the major elements were measured by ICP atomic emission spectrometry. The materials were characterized by X-ray powder diffraction and scanning electron microscopy with energy dispersive spectroscopy. The sequential extraction procedure provided information about the solid phases with which mercury was associated in the solid sample. The procedure effectively extracted mercury from the target phases. The procedure was generally selective in extracting mercury. However, some steps in the procedure extracted mercury from nontarget phases, and others resulted in mercury redistribution. Iron from hematite and goethite was only leached in the reducible and residual extraction steps. Some mercury associated with goethite was extracted in the ion exchangeable step, whereas mercury associated with hematite was extracted almost entirely in the residual step. Calcium in calcite and mercury associated with calcite were primarily removed in the acid-soluble extraction step. Titanium in titanium dioxide and mercury adsorbed onto

  18. Method and apparatus for monitoring mercury emissions

    Science.gov (United States)

    Durham, Michael D.; Schlager, Richard J.; Sappey, Andrew D.; Sagan, Francis J.; Marmaro, Roger W.; Wilson, Kevin G.

    1997-01-01

    A mercury monitoring device that continuously monitors the total mercury concentration in a gas. The device uses the same chamber for converting speciated mercury into elemental mercury and for measurement of the mercury in the chamber by radiation absorption techniques. The interior of the chamber is resistant to the absorption of speciated and elemental mercury at the operating temperature of the chamber.

  19. 42 CFR 50.201 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 50.201 Section 50.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY... Public Health Service. ...

  20. Double spike with isotope pattern deconvolution for mercury speciation

    International Nuclear Information System (INIS)

    Castillo, A.; Rodriguez-Gonzalez, P.; Centineo, G.; Roig-Navarro, A.F.; Garcia Alonso, J.I.

    2009-01-01

    Full text: A double-spiking approach, based on an isotope pattern deconvolution numerical methodology, has been developed and applied for the accurate and simultaneous determination of inorganic mercury (IHg) and methylmercury (MeHg). Isotopically enriched mercury species ( 199 IHg and 201 MeHg) are added before sample preparation to quantify the extent of methylation and demethylation processes. Focused microwave digestion was evaluated to perform the quantitative extraction of such compounds from solid matrices of environmental interest. Satisfactory results were obtained in different certificated reference materials (dogfish liver DOLT-4 and tuna fish CRM-464) both by using GC-ICPMS and GC-MS, demonstrating the suitability of the proposed analytical method. (author)

  1. Mercury pollution in Malaysia.

    Science.gov (United States)

    Hajeb, Parvaneh; Jinap, S; Ismail, Ahmad; Mahyudin, Nor Ainy

    2012-01-01

    Although several studies have been published on levels of mercury contamination of the environment, and of food and human tissues in Peninsular Malaysia, there is a serious dearth of research that has been performed in East Malaysia (Sabah and Sarawak). Industry is rapidly developing in East Malaysia, and, hence, there is a need for establishing baseline levels of mercury contamination in environmental media in that part of the country by performing monitoring studies. Residues of total mercury and inorganic in food samples have been determined in nearly all previous studies that have been conducted; however, few researchers have analyzed samples for the presence of methlymercury residues. Because methylmercury is the most toxic form of mercury, and because there is a growing public awareness of the risk posed by methylmercury exposure that is associated with fish and seafood consumption, further monitoring studies on methylmercury in food are also essential. From the results of previous studies, it is obvious that the economic development in Malaysia, in recent years, has affected the aquatic environment of the country. Primary areas of environmental concern are centered on the rivers of the west Peninsular Malaysian coast, and the coastal waters of the Straits of Malacca, wherein industrial activities are rapidly expanding. The sources of existing mercury input to both of these areas of Malaysia should be studied and identified. Considering the high levels of mercury that now exists in human tissues, efforts should be continued, and accelerated in the future, if possible, to monitor mercury contamination levels in the coastal states, and particularly along the west Peninsular Malaysian coast. Most studies that have been carried out on mercury residues in environmental samples are dated, having been conducted 20-30 years ago; therefore, the need to collect much more and more current data is urgent. Furthermore, establishing baseline levels of mercury exposure to

  2. 19 CFR 201.43 - Program.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Program. 201.43 Section 201.43 Customs Duties... Information § 201.43 Program. The Director of Administration is designated as the official of the Commission who is responsible for implementation and oversight of information security programs and procedures...

  3. 49 CFR 384.201 - Testing program.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Testing program. 384.201 Section 384.201... COMMERCIAL DRIVER'S LICENSE PROGRAM Minimum Standards for Substantial Compliance by States § 384.201 Testing program. The State shall adopt and administer a program for testing and ensuring the fitness of persons to...

  4. 50 CFR 300.201 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Definition. 300.201 Section 300.201... Definition of Illegal, Unreported, or Unregulated Fishing § 300.201 Definition. Illegal, unreported, or... fish stocks shared by the United States, for which there are no applicable international conservation...

  5. 28 CFR 31.201 - Audit.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit. 31.201 Section 31.201 Judicial Administration DEPARTMENT OF JUSTICE OJJDP GRANT PROGRAMS Formula Grants General Requirements § 31.201 Audit. The State must assure that it adheres to the audit requirements enumerated in the “Financial and...

  6. 46 CFR 201.51 - Computation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Computation. 201.51 Section 201.51 Shipping MARITIME... (Rule 5) § 201.51 Computation. In computing any period of time under these Rules, the time begins with... seven (7) days, intermediate Saturdays, Sundays, and holidays shall be excluded from the computation. ...

  7. 42 CFR 441.201 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Definition. 441.201 Section 441.201 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS SERVICES: REQUIREMENTS AND LIMITS APPLICABLE TO SPECIFIC SERVICES Abortions § 441.201...

  8. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

  9. 49 CFR 382.201 - Alcohol concentration.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Alcohol concentration. 382.201 Section 382.201... ALCOHOL USE AND TESTING Prohibitions § 382.201 Alcohol concentration. No driver shall report for duty or... concentration of 0.04 or greater. No employer having actual knowledge that a driver has an alcohol concentration...

  10. 17 CFR 201.57 - Commission review.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission review. 201.57 Section 201.57 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.57 Commission review. In accordance with the...

  11. 19 CFR 201.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employment. 201.140 Section 201.140 Customs Duties... Commission § 201.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  12. 18 CFR 706.201 - Proscribed actions.

    Science.gov (United States)

    2010-04-01

    ... economy; (d) Losing complete independence or impartiality; (e) Making a Government decision outside....201 Section 706.201 Conservation of Power and Water Resources WATER RESOURCES COUNCIL EMPLOYEE RESPONSIBILITIES AND CONDUCT Conduct and Responsibilities of Employees § 706.201 Proscribed actions. An employee...

  13. 21 CFR 201.105 - Veterinary drugs.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Veterinary drugs. 201.105 Section 201.105 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.105 Veterinary drugs. A drug subject to the...

  14. 49 CFR 393.201 - Frames.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Frames. 393.201 Section 393.201 Transportation... SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.201 Frames. (a) The frame or chassis of each commercial motor vehicle shall not be cracked, loose, sagging or...

  15. 7 CFR 201.3 - Administrator.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administrator. 201.3 Section 201.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Administration § 201.3 Administrator. The Administrator of the Agricultural Marketing Service may...

  16. 32 CFR 724.201 - Authority.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Authority. 724.201 Section 724.201 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.201 Authority. The Naval Discharge Review Board...

  17. 48 CFR 24.201 - Authority.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 24.201 Section 24.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS PROTECTION OF PRIVACY AND FREEDOM OF INFORMATION Freedom of Information Act 24.201 Authority. The Freedom of...

  18. 7 CFR 201.63 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.63 Section 201.63 Agriculture... REGULATIONS Tolerances § 201.63 Germination. The following tolerances are applicable to the percentage of germination and also to the sum of the germination plus the hard seed when 400 or more seeds are tested. Mean...

  19. 7 CFR 201.6 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.6 Section 201.6 Agriculture... REGULATIONS Records for Agricultural and Vegetable Seeds § 201.6 Germination. The complete record shall include the records of all laboratory tests for germination and hard seed for each lot of seed offered for...

  20. 7 CFR 201.20 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.20 Section 201.20 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.20 Germination. The label shall show the percentage of germination each kind, or kind and variety, or kind and type, or kind and hybrid of agricultural seed present...

  1. 7 CFR 1260.201 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1260.201 Section 1260.201 Agriculture... Promotion and Research Order Reports, Books and Records § 1260.201 Reports. Each importer, person marketing... shall report to the Board periodically information required by regulations prescribed by the Board and...

  2. 7 CFR 201.30 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.30 Section 201.30 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.30 Hard seed. The label shall show the percentage of hard seed, if...

  3. 7 CFR 201.21 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.21 Section 201.21 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.21 Hard seed. The label shall show the percentage of hard seed...

  4. 47 CFR 201.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... joint industry-government telecommunications entity established by the NCS pursuant to Executive Order... 47 Telecommunication 5 2010-10-01 2010-10-01 false Definitions. 201.2 Section 201.2 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL EXECUTIVE POLICY § 201.2...

  5. Thymic scintigraphy using 201Tl-chloride

    International Nuclear Information System (INIS)

    Fukuda, Teruo; Itami, Michimasa; Sawa, Hisashi; Furukawa, Takashi; Harada, Shigeru

    1980-01-01

    Thymic scintigraphy using Thallium-201 Chloride ( 201 TlCl) was performed on 3 cases of thymoma (2 malignant mediastinal thymomas and 1 benign cervical thymoma). All of the 3 cases exhibited high abnormal activities corresponding to the tumor on the scintigram. Thus it is useful to perform the scintigraphy using 201 TlCl for the detection of thymoma. (author)

  6. 43 CFR 17.201 - Application.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 17.201 Section 17.201 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN FEDERALLY ASSISTED PROGRAMS OF THE DEPARTMENT OF THE INTERIOR Nondiscrimination on the Basis of Handicap § 17.201 Application...

  7. 7 CFR 201.59 - Application.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Application. 201.59 Section 201.59 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Tolerances § 201.59 Application. Tolerances shall be recognized between the percentages or rates...

  8. 46 CFR 16.201 - Application.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Application. 16.201 Section 16.201 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN CHEMICAL TESTING Required Chemical Testing § 16.201 Application. (a) Chemical testing of personnel must be conducted as required by this...

  9. 7 CFR 201.50 - Weed seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seed. 201.50 Section 201.50 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or tubers) of plants shall be considered weed seeds when recognized as weed seeds by the law or rules and...

  10. 7 CFR 201.15 - Weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation or...

  11. 31 CFR 800.201 - Business day.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through Friday...

  12. 17 CFR 201.104 - Business hours.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission, at...

  13. Mercury Emissions: The Global Context

    Science.gov (United States)

    Mercury emissions are a global problem that knows no national or continental boundaries. Mercury that is emitted to the air can travel thousands of miles in the atmosphere before it is eventually deposited back to the earth.

  14. Helium Pressure Shift of the Hyperfine Clock Transition in Hg-201(+)

    Science.gov (United States)

    Larigani, S. Taghavi; Burt, E. A.; Tjoelker, R. L.

    2010-01-01

    There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave atomic clock: Hg-199(+) and Hg-201(+). We are investigating the viability of a trapped ion clock based on Hg-201(+) in a configuration that uses a buffer gas to increase ion loading efficiency and counter ion heating from rf trapping fields. Traditionally, either helium or neon is used as the buffer gas at approx. 10(exp -5) torr to confine mercury ions near room temperature. In addition to the buffer gas, other residual background gasses such as H2O, N2, O2, CO, CO2, and CH2 may be present in trace quantities. Collisions between trapped ions and buffer gas or background gas atoms/molecules produce a momentary shift of the ion clock transition frequency and constitute one of the largest systematic effects in this type of clock. Here we report an initial measurement of the He pressure shift in Hg-201(+) and compare this to Hg-199(+).

  15. Mercury's magnetic field and interior

    International Nuclear Information System (INIS)

    Connerney, J.E.P.; Ness, N.F.

    1988-01-01

    The magnetic-field data collected on Mercury by the Mariner-10 spacecraft present substantial evidence for an intrinsic global magnetic field. However, studies of Mercury's thermal evolution show that it is most likely that the inner core region of Mercury solidified or froze early in the planet's history. Thus, the explanation of Mercury's magnetic field in the framework of the traditional planetary dynamo is less than certain

  16. Reference Atmosphere for Mercury

    Science.gov (United States)

    Killen, Rosemary M.

    2002-01-01

    We propose that Ar-40 measured in the lunar atmosphere and that in Mercury's atmosphere is due to current diffusion into connected pore space within the crust. Higher temperatures at Mercury, along with more rapid loss from the atmosphere will lead to a smaller column abundance of argon at Mercury than at the Moon, given the same crustal abundance of potassium. Because the noble gas abundance in the Hermean atmosphere represents current effusion, it is a direct measure of the crustal potassium abundance. Ar-40 in the atmospheres of the planets is a measure of potassium abundance in the interiors, since Ar-40 is a product of radiogenic decay of K-40 by electron capture with the subsequent emission of a 1.46 eV gamma-ray. Although the Ar-40 in the Earth's atmosphere is expected to have accumulated since the late bombardment, Ar-40 in the atmospheres of Mercury and the Moon is eroded quickly by photoionization and electron impact ionization. Thus, the argon content in the exospheres of the Moon and Mercury is representative of current effusion rather than accumulation over the lifetime of the planet.

  17. Mercury content of edible mushrooms

    Energy Technology Data Exchange (ETDEWEB)

    Woidich, H.; Pfannhauser, W.

    1975-05-01

    The mercury content of edible fungi is different. Relatively high burdened are Boletus and Agaricus campestris. A minimum of mercury is found in Russula, Agaricus bisporus and Cantharellus cibarius. The possibilities of mercury uptake and the potential cumulation mechanism is discussed. 8 references, 3 tables.

  18. Mercury (Environmental Health Student Portal)

    Science.gov (United States)

    ... Water Waterborne Diseases & Illnesses Water Cycle Water Treatment Mercury The Basics Mercury — sometimes called quicksilver — is a natural metal. It’s ... to breathe it in without knowing it. When mercury combines with other chemical elements, it creates compounds, ...

  19. Sensing Mercury for Biomedical and Environmental Monitoring

    Directory of Open Access Journals (Sweden)

    Julia Xiaojun Zhao

    2009-07-01

    Full Text Available Mercury is a very toxic element that is widely spread in the atmosphere, lithosphere, and surface water. Concentrated mercury poses serious problems to human health, as bioaccumulation of mercury within the brain and kidneys ultimately leads to neurological diseases. To control mercury pollution and reduce mercury damage to human health, sensitive determination of mercury is important. This article summarizes some current sensors for the determination of both abiotic and biotic mercury. A wide array of sensors for monitoring mercury is described, including biosensors and chemical sensors, while piezoelectric and microcantilever sensors are also described. Additionally, newly developed nanomaterials offer great potential for fabricating novel mercury sensors. Some of the functional fluorescent nanosensors for the determination of mercury are covered. Afterwards, the in vivo determination of mercury and the characterization of different forms of mercury are discussed. Finally, the future direction for mercury detection is outlined, suggesting that nanomaterials may provide revolutionary tools in biomedical and environmental monitoring of mercury.

  20. Water displacement mercury pump

    Science.gov (United States)

    Nielsen, M.G.

    1984-04-20

    A water displacement mercury pump has a fluid inlet conduit and diffuser, a valve, a pressure cannister, and a fluid outlet conduit. The valve has a valve head which seats in an opening in the cannister. The entire assembly is readily insertable into a process vessel which produces mercury as a product. As the mercury settles, it flows into the opening in the cannister displacing lighter material. When the valve is in a closed position, the pressure cannister is sealed except for the fluid inlet conduit and the fluid outlet conduit. Introduction of a lighter fluid into the cannister will act to displace a heavier fluid from the cannister via the fluid outlet conduit. The entire pump assembly penetrates only a top wall of the process vessel, and not the sides or the bottom wall of the process vessel. This insures a leak-proof environment and is especially suitable for processing of hazardous materials.

  1. Mercury CEM Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John Schabron; Joseph Rovani; Mark Sanderson

    2008-02-29

    Mercury continuous emissions monitoring systems (CEMS) are being implemented in over 800 coal-fired power plant stacks. The power industry desires to conduct at least a full year of monitoring before the formal monitoring and reporting requirement begins on January 1, 2009. It is important for the industry to have available reliable, turnkey equipment from CEM vendors. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor generators. The generators are used to calibrate mercury CEMs at power plant sites. The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005 requires that calibration be performed with NIST-traceable standards (Federal Register 2007). Traceability procedures will be defined by EPA. An initial draft traceability protocol was issued by EPA in May 2007 for comment. In August 2007, EPA issued an interim traceability protocol for elemental mercury generators (EPA 2007). The protocol is based on the actual analysis of the output of each calibration unit at several concentration levels ranging initially from about 2-40 {micro}g/m{sup 3} elemental mercury, and in the future down to 0.2 {micro}g/m{sup 3}, and this analysis will be directly traceable to analyses by NIST. The document is divided into two separate sections. The first deals with the qualification of generators by the vendors for use in mercury CEM calibration. The second describes the procedure that the vendors must use to certify the generator models that meet the qualification specifications. The NIST traceable certification is performance based, traceable to analysis using isotope dilution inductively coupled plasma/mass spectrometry performed by NIST in Gaithersburg, MD. The

  2. Removal of Elemental Mercury from a Gas Stream Facilitated by a Non-Thermal Plasma Device

    Energy Technology Data Exchange (ETDEWEB)

    Charles Mones

    2006-12-01

    Mercury generated from anthropogenic sources presents a difficult environmental problem. In comparison to other toxic metals, mercury has a low vaporization temperature. Mercury and mercury compounds are highly toxic, and organic forms such as methyl mercury can be bio-accumulated. Exposure pathways include inhalation and transport to surface waters. Mercury poisoning can result in both acute and chronic effects. Most commonly, chronic exposure to mercury vapor affects the central nervous system and brain, resulting in neurological damage. The CRE technology employs a series of non-thermal, plasma-jet devices to provide a method for elemental mercury removal from a gas phase by targeting relevant chemical reactions. The technology couples the known chemistry of converting elemental mercury to ionic compounds by mercury-chlorine-oxygen reactions with the generation of highly reactive species in a non-thermal, atmospheric, plasma device. The generation of highly reactive metastable species in a non-thermal plasma device is well known. The introduction of plasma using a jet-injection device provides a means to contact highly reactive species with elemental mercury in a manner to overcome the kinetic and mass-transfer limitations encountered by previous researchers. To demonstrate this technology, WRI has constructed a plasma test facility that includes plasma reactors capable of using up to four plasma jets, flow control instrumentation, an integrated control panel to operate the facility, a mercury generation system that employs a temperature controlled oven and permeation tube, combustible and mercury gas analyzers, and a ductless fume hood designed to capture fugitive mercury emissions. Continental Research and Engineering (CR&E) and Western Research Institute (WRI) successfully demonstrated that non-thermal plasma containing oxygen and chlorine-oxygen reagents could completely convert elemental mercury to an ionic form. These results demonstrate potential the

  3. Assessment of Mercury in Fish Tissue from Select Lakes of Northeastern Oregon

    Science.gov (United States)

    A fish tissue study was conducted in five northeastern Oregon reservoirs to evaluate mercury concentrations in an area where elevated atmospheric mercury deposition had been predicted by a national EPA model, but where tissue data were sparse. The study targeted resident predator...

  4. Method and apparatus for sampling atmospheric mercury

    Science.gov (United States)

    Trujillo, Patricio E.; Campbell, Evan E.; Eutsler, Bernard C.

    1976-01-20

    A method of simultaneously sampling particulate mercury, organic mercurial vapors, and metallic mercury vapor in the working and occupational environment and determining the amount of mercury derived from each such source in the sampled air. A known volume of air is passed through a sampling tube containing a filter for particulate mercury collection, a first adsorber for the selective adsorption of organic mercurial vapors, and a second adsorber for the adsorption of metallic mercury vapor. Carbon black molecular sieves are particularly useful as the selective adsorber for organic mercurial vapors. The amount of mercury adsorbed or collected in each section of the sampling tube is readily quantitatively determined by flameless atomic absorption spectrophotometry.

  5. Transient analysis of mercury experimental loop using the RELAP5 code. 3rd report. Transient analysis using mercury properties

    International Nuclear Information System (INIS)

    Kinoshita, Hidetaka; Kaminaga, Masanori; Hino, Ryutaro

    2000-02-01

    In order to promote the Neutron Science Project of JAERI, the design of a 5MW-spallation target system is in progress with the purpose of producing a practical neutron application while at the same time adhering to the highest levels of safety. To establish the safety of the target system, it is important to understand the transient behaviors during anticipated operational events of the system, and to design the safety protection systems for the safe termination of the transients. This report presents the analytical results of transient behaviors in the mercury experimental loop using mercury properties. At first, the analytical pressure distributions were compared with experimental data measured with the mercury experimental loop. The modeling data were modified to reproduce the actual pressure distributions of the mercury experimental loop. Then a loss of forced convection and a loss of coolant accident were analyzed. In the case of the pump trip, the transient analysis was conducted using two types of mercury pumps, the mechanical type pump with moment of inertia, and the electrical-magnetic type pump without moment of inertia. The results show there was no clear difference in the two analyses, since the mercury had a large inertia, which was 13.5 times that of the water. Moreover, in the case of a pipe rupture at the pump exit, a moderate pressure decrease was confirmed when a small breakage area existed in which the coolant flowed out gradually. Based on these results, it was appeared that the transient fluctuation of pressure in the mercury loop would not become large and accidents would have to be detected by small fluctuations in pressure. Based on these analyses, we plan to conduct a simulation test to verify the RELAP5 code, and then the analysis of a full-scale mercury system will be performed. (author)

  6. Evaluation of Sorbent Injection for Mercury Control

    Energy Technology Data Exchange (ETDEWEB)

    Sharon Sjostrom

    2006-04-30

    The power industry in the U.S. is faced with meeting new regulations to reduce the emissions of mercury compounds from coal-fired plants. These regulations are directed at the existing fleet of nearly 1,100 boilers. These plants are relatively old with an average age of over 40 years. Although most of these units are capable of operating for many additional years, there is a desire to minimize large capital expenditures because of the reduced (and unknown) remaining life of the plant to amortize the project. Injecting a sorbent such as powdered activated carbon into the flue gas represents one of the simplest and most mature approaches to controlling mercury emissions from coal-fired boilers. This is the final site report for tests conducted at DTE Energy's Monroe Power Plant, one of five sites evaluated in this DOE/NETL program. The overall objective of the test program was to evaluate the capabilities of activated carbon injection at five plants: Sunflower Electric's Holcomb Station Unit 1, AmerenUE's Meramec Station Unit 2, Missouri Basin Power Project's Laramie River Station Unit 3, Detroit Edison's Monroe Power Plant Unit 4, and AEP's Conesville Station Unit 6. These plants have configurations that together represent 78% of the existing coal-fired generation plants. The goals for the program established by DOE/NETL were to reduce the uncontrolled mercury emissions by 50 to 70% at a cost 25 to 50% lower than the target established by DOE of $60,000/lb mercury removed. The results from Monroe indicate that using DARCO{reg_sign} Hg would result in higher mercury removal (80%) at a sorbent cost of $18,000/lb mercury, or 70% lower than the benchmark. These results demonstrate that the goals established by DOE/NETL were exceeded during this test program. The increase in mercury removal over baseline conditions is defined for this program as a comparison in the outlet emissions measured using the Ontario Hydro method during the baseline

  7. Mercury isotope fractionation during transfer from post-desulfurized seawater to air.

    Science.gov (United States)

    Huang, Shuyuan; Lin, Kunning; Yuan, Dongxing; Gao, Yaqin; Sun, Lumin

    2016-12-15

    Samples of dissolved gaseous mercury (DGM) in the post-desulfurized seawater discharged from a coal-fired power plant together with samples of gaseous elemental mercury (GEM) over the post-desulfurized seawater surface were collected and analyzed to study the mercury isotope fractionation during transfer from post-desulfurized seawater to air. Experimental results showed that when DGM in the seawater was converted to GEM in the air, the δ 202 Hg and Δ 199 Hg values were changed, ranging from -2.98 to -0.04‰ and from -0.31 to 0.64‰, respectively. Aeration played a key role in accelerating the transformation of DGM to GEM, and resulted in light mercury isotopes being more likely to be enriched in the GEM. The ratio Δ 199 Hg/Δ 201 Hg was 1.626 in all samples, suggesting that mercury mass independent fractionation occurred owing to the nuclear volume effect during the transformation. In addition, mass independent fractionation of mercury even isotopes was found in the GEM above the post-desulfurized seawater surface in the aeration pool. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Mercury in soils and microbial biomass of the South Kirgizstan subregion of the biosphere

    Science.gov (United States)

    Vadim, Ermakov; Valentina, Danilova; Ul'yana, Gulyaeva

    2016-04-01

    negative correlation between the levels of the gross mercury and the mercury as extracted with hydrochloric acid is found. References 1. Danilova V.N., Khushvakhtova S.D., Ermakov V.V. Interaction of mercury with humic acids. Nowaday Problems of Soil Pollution. M.V. Lomonosov Moscow State University, 2010. P. 201-204 (in Russian). 2. Ermakov V.V., Danilova V.N. Bioaccumulation and destoxication of mercury/ Problems of Biogeochemistry and Geochemical Ecology, 2011. № 1 (15). P. 3-16 (in Russian).

  9. Blood mercury concentration, fish consumption and anthropometry in Chinese children: A national study.

    Science.gov (United States)

    Gao, Zhen-Yan; Li, Min-Ming; Wang, Ju; Yan, Jin; Zhou, Can-Can; Yan, Chong-Huai

    2018-01-01

    This study sought to obtain national cross-sectional data for blood mercury levels and risk factors for mercury exposure in Chinese children aged 0 to 6years to provide evidence to support preventive measures for reducing childhood blood mercury levels. A multi-stage, stratified, clustered random sampling survey was conducted May 2013-Mar 2015. Shanghai, Jilin, Shanxi, Guangdong, Qinghai, Yunnan and Hubei, which are located in seven different geographical regions in China, were selected as the study field. A total of 14,202 children aged 0-6years participated in the study. Whole-blood venous samples (3ml) were collected from the subjects for mercury exposure assessment. The DMA-80 was applied for mercury detection, and a health questionnaire gathering information on related confounders was completed by the subjects' parents of the subjects after they received guidance from the investigators. A general linear model was used for the primary descriptive statistical analysis. Odds ratios (ORs) and 95%CIs for the risk factors were estimated using unconditional logistic regression. A total of 14,202 eligible samples were collected. The mean mercury level was 1.39μg/L. Other results were as follows: median 1.23μg/L, p25 0.86μg/L, p75 1.73μg/L, and GM 1.10μg/L. Of the seven geographical regions, Qinghai, in northwestern China, had a median mercury level of 0.37μg/L, which was significantly lower than the mercury level in Guangdong, in southeastern China (2.01μg/L). The median blood mercury level of children in suburban areas was 1.34μg/L, which was remarkably higher than that of children in rural areas (1.09μg/L). Dichotomous subgroups were generated using the median mercury concentration. Unconditional logistic regression analysis revealed that fish consumption may contribute to increased blood mercury levels (pmercury concentrations and the children's anthropometric characteristics (BMI; pmercury concentrations among Chinese children aged 0-6years were

  10. Mercury analysis in hair

    DEFF Research Database (Denmark)

    Esteban, Marta; Schindler, Birgit Karin; Jiménez, José Antonio

    2015-01-01

    laboratories. Training sessions were organized for field workers and four external quality-assessment exercises (ICI/EQUAS), followed by the corresponding web conferences, were organized between March 2011 and February 2012. ICI/EQUAS used native hair samples at two mercury concentration ranges (0...

  11. Mercury exposure in Ireland

    DEFF Research Database (Denmark)

    Cullen, Elizabeth; Evans, David S; Davidson, Fred

    2014-01-01

    of a study to Coordinate and Perform Human Biomonitoring on a European Scale (DEMOCOPHES) pilot biomonitoring study. METHODS: Hair mercury concentrations were determined from a convenience sample of 120 mother/child pairs. Mothers also completed a questionnaire. Rigorous quality assurance within DEMOCOPHES...

  12. Metabolic models for methyl and inorganic mercury

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, S.R.; Purdue, P.

    1984-03-01

    Following the outbreak of mercury poisoning in Minimata, Japan (1953-60), much work has been done on the toxicology of mercury - in particular methyl mercury. In this paper, the authors derive two compartmental models for the metabolism of methyl mercury and inorganic mercury based upon the data which have been collected since 1960.

  13. [Mercury in vaccines].

    Science.gov (United States)

    Hessel, Luc

    2003-01-01

    Thiomersal, also called thimerosal, is an ethyl mercury derivative used as a preservative to prevent bacterial contamination of multidose vaccine vials after they have been opened. Exposure to low doses of thiomersal has essentially been associated with hypersensitivity reactions. Nevertheless there is no evidence that allergy to thiomersal could be induced by thiomersal-containing vaccines. Allergy to thiomersal is usually of delayed-hypersensitivity type, but its detection through cutaneous tests is not very reliable. Hypersensitivity to thiomersal is not considered as a contraindication to the use of thiomersal-containing vaccines. In 1999 in the USA, thiomersal was present in approximately 30 different childhood vaccines, whereas there were only 2 in France. Although there were no evidence of neurological toxicity in infants related to the use of thiomersal-containing vaccines, the FDA considered that the cumulative dose of mercury received by young infants following vaccination was high enough (although lower than the FDA threshold for methyl mercury) to request vaccine manufacturers to remove thiomersal from vaccine formulations. Since 2002, all childhood vaccines used in Europe and the USA are thiomersal-free or contain only minute amounts of thiomersal. Recently published studies have shown that the mercury levels in the blood, faeces and urine of children who had received thiomersal-containing vaccines were much lower than those accepted by the American Environmental Protection Agency. It has also been demonstrated that the elimination of mercury in children was much faster than what was expected on the basis of studies conducted with methyl mercury originating from food. Recently, the hypothesis that mercury contained in vaccines could be the cause of autism and other neurological developmental disorders created a new debate in the medical community and the general public. To date, none of the epidemiological studies conducted in Europe and elsewhere

  14. Mercury Information Clearinghouse

    Energy Technology Data Exchange (ETDEWEB)

    Chad A. Wocken; Michael J. Holmes; Dennis L. Laudal; Debra F. Pflughoeft-Hassett; Greg F. Weber; Nicholas V. C. Ralston; Stanley J. Miller; Grant E. Dunham; Edwin S. Olson; Laura J. Raymond; John H. Pavlish; Everett A. Sondreal; Steven A. Benson

    2006-03-31

    The Canadian Electricity Association (CEA) identified a need and contracted the Energy & Environmental Research Center (EERC) to create and maintain an information clearinghouse on global research and development activities related to mercury emissions from coal-fired electric utilities. With the support of CEA, the Center for Air Toxic Metals{reg_sign} (CATM{reg_sign}) Affiliates, and the U.S. Department of Energy (DOE), the EERC developed comprehensive quarterly information updates that provide a detailed assessment of developments in the various areas of mercury monitoring, control, policy, and research. A total of eight topical reports were completed and are summarized and updated in this final CEA quarterly report. The original quarterly reports can be viewed at the CEA Web site (www.ceamercuryprogram.ca). In addition to a comprehensive update of previous mercury-related topics, a review of results from the CEA Mercury Program is provided. Members of Canada's coal-fired electricity generation sector (ATCO Power, EPCOR, Manitoba Hydro, New Brunswick Power, Nova Scotia Power Inc., Ontario Power Generation, SaskPower, and TransAlta) and CEA, have compiled an extensive database of information from stack-, coal-, and ash-sampling activities. Data from this effort are also available at the CEA Web site and have provided critical information for establishing and reviewing a mercury standard for Canada that is protective of environment and public health and is cost-effective. Specific goals outlined for the CEA mercury program included the following: (1) Improve emission inventories and develop management options through an intensive 2-year coal-, ash-, and stack-sampling program; (2) Promote effective stack testing through the development of guidance material and the support of on-site training on the Ontario Hydro method for employees, government representatives, and contractors on an as-needed basis; (3) Strengthen laboratory analytical capabilities through

  15. Small Mercury Relativity Orbiter

    Science.gov (United States)

    Bender, Peter L.; Vincent, Mark A.

    1989-01-01

    The accuracy of solar system tests of gravitational theory could be very much improved by range and Doppler measurements to a Small Mercury Relativity Orbiter. A nearly circular orbit at roughly 2400 km altitude is assumed in order to minimize problems with orbit determination and thermal radiation from the surface. The spacecraft is spin-stabilized and has a 30 cm diameter de-spun antenna. With K-band and X-band ranging systems using a 50 MHz offset sidetone at K-band, a range accuracy of 3 cm appears to be realistically achievable. The estimated spacecraft mass is 50 kg. A consider-covariance analysis was performed to determine how well the Earth-Mercury distance as a function of time could be determined with such a Relativity Orbiter. The minimum data set is assumed to be 40 independent 8-hour arcs of tracking data at selected times during a two year period. The gravity field of Mercury up through degree and order 10 is solved for, along with the initial conditions for each arc and the Earth-Mercury distance at the center of each arc. The considered parameters include the gravity field parameters of degree 11 and 12 plus the tracking station coordinates, the tropospheric delay, and two parameters in a crude radiation pressure model. The conclusion is that the Earth-Mercury distance can be determined to 6 cm accuracy or better. From a modified worst-case analysis, this would lead to roughly 2 orders of magnitude improvement in the knowledge of the precession of perihelion, the relativistic time delay, and the possible change in the gravitational constant with time.

  16. Mercury Phase II Study - Mercury Behavior in Salt Processing Flowsheet

    Energy Technology Data Exchange (ETDEWEB)

    Jain, V. [Savannah River Remediation, LLC., Aiken, SC (United States); Shah, H. [Savannah River Remediation, LLC., Aiken, SC (United States). Sludge and Salt Planning; Bannochie, C. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Wilmarth, W. R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-07-25

    Mercury (Hg) in the Savannah River Site Liquid Waste System (LWS) originated from decades of canyon processing where it was used as a catalyst for dissolving the aluminum cladding of reactor fuel. Approximately 60 metric tons of mercury is currently present throughout the LWS. Mercury has long been a consideration in the LWS, from both hazard and processing perspectives. In February 2015, a Mercury Program Team was established at the request of the Department of Energy to develop a comprehensive action plan for long-term management and removal of mercury. Evaluation was focused in two Phases. Phase I activities assessed the Liquid Waste inventory and chemical processing behavior using a system-by-system review methodology, and determined the speciation of the different mercury forms (Hg+, Hg++, elemental Hg, organomercury, and soluble versus insoluble mercury) within the LWS. Phase II activities are building on the Phase I activities, and results of the LWS flowsheet evaluations will be summarized in three reports: Mercury Behavior in the Salt Processing Flowsheet (i.e. this report); Mercury Behavior in the Defense Waste Processing Facility (DWPF) Flowsheet; and Mercury behavior in the Tank Farm Flowsheet (Evaporator Operations). The evaluation of the mercury behavior in the salt processing flowsheet indicates, inter alia, the following: (1) In the assembled Salt Batches 7, 8 and 9 in Tank 21, the total mercury is mostly soluble with methylmercury (MHg) contributing over 50% of the total mercury. Based on the analyses of samples from 2H Evaporator feed and drop tanks (Tanks 38/43), the source of MHg in Salt Batches 7, 8 and 9 can be attributed to the 2H evaporator concentrate used in assembling the salt batches. The 2H Evaporator is used to evaporate DWPF recycle water. (2) Comparison of data between Tank 21/49, Salt Solution Feed Tank (SSFT), Decontaminated Salt Solution Hold Tank (DSSHT), and Tank 50 samples suggests that the total mercury as well as speciated

  17. Mercury Phase II Study - Mercury Behavior in Salt Processing Flowsheet

    International Nuclear Information System (INIS)

    Jain, V.; Shah, H.; Wilmarth, W. R.

    2016-01-01

    Mercury (Hg) in the Savannah River Site Liquid Waste System (LWS) originated from decades of canyon processing where it was used as a catalyst for dissolving the aluminum cladding of reactor fuel. Approximately 60 metric tons of mercury is currently present throughout the LWS. Mercury has long been a consideration in the LWS, from both hazard and processing perspectives. In February 2015, a Mercury Program Team was established at the request of the Department of Energy to develop a comprehensive action plan for long-term management and removal of mercury. Evaluation was focused in two Phases. Phase I activities assessed the Liquid Waste inventory and chemical processing behavior using a system-by-system review methodology, and determined the speciation of the different mercury forms (Hg+, Hg++, elemental Hg, organomercury, and soluble versus insoluble mercury) within the LWS. Phase II activities are building on the Phase I activities, and results of the LWS flowsheet evaluations will be summarized in three reports: Mercury Behavior in the Salt Processing Flowsheet (i.e. this report); Mercury Behavior in the Defense Waste Processing Facility (DWPF) Flowsheet; and Mercury behavior in the Tank Farm Flowsheet (Evaporator Operations). The evaluation of the mercury behavior in the salt processing flowsheet indicates, inter alia, the following: (1) In the assembled Salt Batches 7, 8 and 9 in Tank 21, the total mercury is mostly soluble with methylmercury (MHg) contributing over 50% of the total mercury. Based on the analyses of samples from 2H Evaporator feed and drop tanks (Tanks 38/43), the source of MHg in Salt Batches 7, 8 and 9 can be attributed to the 2H evaporator concentrate used in assembling the salt batches. The 2H Evaporator is used to evaporate DWPF recycle water. (2) Comparison of data between Tank 21/49, Salt Solution Feed Tank (SSFT), Decontaminated Salt Solution Hold Tank (DSSHT), and Tank 50 samples suggests that the total mercury as well as speciated

  18. A mercury transport and fate model (LM2-mercury) for mass budget assessment of mercury cycling in Lake Michigan

    Science.gov (United States)

    LM2-Mercury, a mercury mass balance model, was developed to simulate and evaluate the transport, fate, and biogeochemical transformations of mercury in Lake Michigan. The model simulates total suspended solids (TSS), disolved organic carbon (DOC), and total, elemental, divalent, ...

  19. FINAL REPORT ON THE AQUATIC MERCURY ASSESSMENT STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Halverson, N

    2008-09-30

    . Methylmercury ranged from 0.002 ng/l in Upper Three Runs to 2.60 ng/l in Tims Branch. Total mercury in the Savannah River ranged from 0.62 ng/l to 43.9 ng/l, and methylmercury ranged from 0.036 ng/l to 7.54 ng/l. Both total and methylmercury concentrations were consistently high in the river near the mouth of Steel Creek. Total mercury was positively correlated with methylmercury (r = 0.88). Total mercury bound to particulates ranged from 41% to 57% in the river and from 28% to 90% in the streams. Particulate methylmercury varied from 9% to 37% in the river and from 6% to 79% in the streams. Small temporary pools in the Savannah River swamp area near and around Fourmile Branch had the highest concentrations observed in the Savannah River watershed, reaching 1,890 ng/l for total mercury and 34.0 ng/l for methylmercury. The second study developed a mercury bioaccumulation factor (BAF) for the Savannah River near SRS. A BAF is the ratio of the concentration of mercury in fish flesh to the concentration of mercury in the water. BAFs are important in the TMDL process because target concentrations for mercury in water are computed from BAFs. Mercury BAFs are known to differ substantially among fish species, water bodies, and possibly seasons. Knowledge of such variation is needed to determine a BAF that accurately represents average and extreme conditions in the water body under study. Analysis of fish tissue and aqueous methylmercury samples collected at a number of locations and over several seasons in a 110 km (68 mile) reach of the Savannah River demonstrated that BAFs for each species under study varied by factors of three to eight. Influences on BAF variability were location, habitat and season-related differences in fish mercury levels and seasonal differences in methylmercury levels in the water. Overall (all locations, habitats, and seasons) average BAFs were 3.7 x 10{sup 6} for largemouth bass, 1.4 x 10{sup 6} for sunfishes, and 2.5 x 10{sup 6} for white catfish. This study

  20. Mercury Exposure and Heart Diseases.

    Science.gov (United States)

    Genchi, Giuseppe; Sinicropi, Maria Stefania; Carocci, Alessia; Lauria, Graziantonio; Catalano, Alessia

    2017-01-12

    Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.

  1. Mercury Exposure and Heart Diseases

    Directory of Open Access Journals (Sweden)

    Giuseppe Genchi

    2017-01-01

    Full Text Available Environmental contamination has exposed humans to various metal agents, including mercury. It has been determined that mercury is not only harmful to the health of vulnerable populations such as pregnant women and children, but is also toxic to ordinary adults in various ways. For many years, mercury was used in a wide variety of human activities. Nowadays, the exposure to this metal from both natural and artificial sources is significantly increasing. Recent studies suggest that chronic exposure, even to low concentration levels of mercury, can cause cardiovascular, reproductive, and developmental toxicity, neurotoxicity, nephrotoxicity, immunotoxicity, and carcinogenicity. Possible biological effects of mercury, including the relationship between mercury toxicity and diseases of the cardiovascular system, such as hypertension, coronary heart disease, and myocardial infarction, are being studied. As heart rhythm and function are under autonomic nervous system control, it has been hypothesized that the neurotoxic effects of mercury might also impact cardiac autonomic function. Mercury exposure could have a long-lasting effect on cardiac parasympathetic activity and some evidence has shown that mercury exposure might affect heart rate variability, particularly early exposures in children. The mechanism by which mercury produces toxic effects on the cardiovascular system is not fully elucidated, but this mechanism is believed to involve an increase in oxidative stress. The exposure to mercury increases the production of free radicals, potentially because of the role of mercury in the Fenton reaction and a reduction in the activity of antioxidant enzymes, such as glutathione peroxidase. In this review we report an overview on the toxicity of mercury and focus our attention on the toxic effects on the cardiovascular system.

  2. 7 CFR 201.11a - Hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The percentage...

  3. 7 CFR 201.41 - Bags.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Bags. 201.41 Section 201.41 Agriculture Regulations of... Sampling in the Administration of the Act § 201.41 Bags. (a) For lots of six bags or less, each bag shall be sampled. A total of at least five trierfuls shall be taken. (b) For lots of more than six bags...

  4. Thallium-201 for oncological imaging in children.

    Science.gov (United States)

    Nadel, H R

    1993-07-01

    Many pediatric centers are beginning to accumulate a large experience in the use of thallium-201 (201Tl) imaging with 201Tl requires a state-of-the-art high-resolution gamma camera computer system with single photon emission computed tomography (SPECT) capability and a physician-directed tailored examination. Tumor imaging with 201Tl, with its multifactorial localization mechanisms that are different from those for gallium-67, offers a distinct advantage over gallium tumor imaging with a short total imaging time. Tumors are variable in avidity and intensity of thallium uptake. Primary and metastatic disease can be detected with 201Tl scintigraphy. Baseline pretreatment determination of thallium avidity is crucial to its efficacy in therapeutic response assessment. Adjunctive SPECT imaging provides greater sensitivity for lesion detection and direct comparison of physiology (thallium uptake) with anatomy (computed tomography and magnetic resonance imaging). The sensitivity and specificity for detection of pediatric brain tumors has been reported as 77% and 93%, respectively. Thallium-201 brain SPECT also provides a less expensive and more readily available alternative to positron emission tomography for assessing the functional state of pediatric brain tumors. Extremity osteogenic sarcoma and Ewing's sarcoma have 100% sensitivity for 201Tl uptake pretreatment. Early results confirm an association between 201Tl uptake and histological tumor response. The determination of residual/recurrent disease versus thymic rebound and other nonneoplastic change in thallium-avid lymphoma, rhabdomyosarcoma, and germ cell tumors that involve the thorax can be confirmed with a 201Tl SPECT examination. Soft-tissue tumors elsewhere in the body may be detected with 201Tl scintigraphy. Thallium-201 does not exhibit 100% specificity for tumors. False-positive 201Tl uptake has been seen in histiocytosis X, benign bone tumors, stress fractures, and inflammation.

  5. Mercury's exosphere: observations during MESSENGER's First Mercury flyby.

    Science.gov (United States)

    McClintock, William E; Bradley, E Todd; Vervack, Ronald J; Killen, Rosemary M; Sprague, Ann L; Izenberg, Noam R; Solomon, Sean C

    2008-07-04

    During MESSENGER's first Mercury flyby, the Mercury Atmospheric and Surface Composition Spectrometer measured Mercury's exospheric emissions, including those from the antisunward sodium tail, calcium and sodium close to the planet, and hydrogen at high altitudes on the dayside. Spatial variations indicate that multiple source and loss processes generate and maintain the exosphere. Energetic processes connected to the solar wind and magnetospheric interaction with the planet likely played an important role in determining the distributions of exospheric species during the flyby.

  6. Micro pit formation by mercury-sphere collision

    International Nuclear Information System (INIS)

    Ishikura, Syuichi; Kogawa, Hiroyuki; Futakawa, Masatoshi; Kaminaga, Masanori; Hino, Ryutaro

    2004-01-01

    The development of a MW-class spallation neutron source facility is being carried out under the Japan Proton Accelerator Research Complex (J-PARC) Project promoted by JAERI and KEK. A mercury target working as the spallation neutron source will be subjected to pressure waves generated by rapid thermal expansion of mercury due to a pulsed proton beam injection. The pressure wave will impose dynamic stress on the vessel and deform the vessel, which would cause cavitation in mercury. To evaluate the effect of mercury micro jets, driven by cavitation bubble collapse, on the micro-pit formation, analyses on mercury sphere collision were carried out: single bubble dynamics and collision behavior on interface between liquid and solid, which take the nonlinearity due to shock wave in mercury and the strain rate dependency of yield stress in solid metal into account. Analytical results give a good explanation to understand relationship between the micro-pit formation and material properties: the pit size could decrease with increasing the yield strength of materials. (author)

  7. Recovery of mercury from acid waste residues

    Science.gov (United States)

    Greenhalgh, Wilbur O.

    1989-12-05

    Mercury can be recovered from nitric acid-containing fluids by reacting the fluid with aluminum metal to produce mercury metal, and then quenching the reactivity of the nitric acid prior to nitration of the mercury metal.

  8. Mercury Poisoning Linked to Skin Products

    Science.gov (United States)

    ... Products For Consumers Home For Consumers Consumer Updates Mercury Poisoning Linked to Skin Products Share Tweet Linkedin ... and, in some situations, criminal prosecution. Dangers of Mercury Exposure to mercury can have serious health consequences. ...

  9. Radiometric measurement of lead-201 and thallium-201 activity in industrial production of thallium chlorides

    International Nuclear Information System (INIS)

    Skokov, V.S.; Azbel', G.A.

    1989-01-01

    The spectrometric methods and equipment for 201 Pb and 201 Tl activity control in the prepared thallium chloride in industrial production are described. Estimation of thallium-201 activity is carried out in accord with the square of summary photopeak caused by γ-quanta at 167 keV energy. Attenuation is paid to spectrometer calibration. 5 refs.; 2 figs.; 2 tabs

  10. Evaluation of mercury cycling and hypolimnetic oxygenation in mercury-impacted seasonally stratified reservoirs in the Guadalupe River watershed, California

    Science.gov (United States)

    McCord, Stephen A.; Beutel, Marc W.; Dent, Stephen R.; Schladow, S. G.

    2016-10-01

    Surface water reservoirs trap inorganic mercury delivered from their watersheds, create conditions that convert inorganic mercury to highly toxic methylmercury (MeHg), and host sportfish in which MeHg bioaccumulates. The Santa Clara Valley Water District (District) actively manages and monitors four mercury-impaired reservoirs that help to serve communities in South San Francisco Bay, California. The Guadalupe River watershed, which contains three of those reservoirs, also includes the New Almaden mercury-mining district, the largest historic mercury producer in North America. Monthly vertical profiles of field measurements and grab samples in years 2011-2013 portray annual cycling of density stratification, dissolved oxygen (DO), and MeHg. Monitoring results highlight the role that hypolimnetic hypoxia plays in MeHg distribution in the water column, as well as the consistent, tight coupling between MeHg in ecological compartments (water, zooplankton, and bass) across the four reservoirs. Following the 2011-2013 monitoring period, the District designed and installed hypolimnetic oxygenation systems (HOS) in the four reservoirs in an effort to repress MeHg buildup in bottom waters and attain regulatory targets for MeHg in water and fish tissue. Initial HOS operation in Calero Reservoir in 2014 enhanced bottom water DO and depressed hypolimnetic buildup of MeHg, but did not substantially decrease mercury levels in zooplankton or small fish.

  11. Predicting the extent and location of coronary artery disease during the early postinfarction period by quantitative thallium-201 scintigraphy

    International Nuclear Information System (INIS)

    Gibson, R.S.; Taylor, G.J.; Watson, D.D.; Stebbins, P.T.; Martin, R.P.; Crampton, R.S.; Beller, G.A.

    1981-01-01

    The ability of quantitative thallium-201 scintigraphy to predict the extent and location of coronary artery disease before hospital discharge after acute myocardial infarction was evaluated in 52 patients. All patients underwent coronary angiography and serial thallium-201 imaging either at rest (10 patients) or after submaximal exercise stress (42 patients; target heart rate 120 beats/min). Two or three vessel disease was designated if abnormal thallium-201 uptake or washout patterns, or both, were seen in two or three vascular segments, respectively. Thus, 2 weeks after myocardial infarction, exercise thallium-201 scintigraphy is useful for predicting the extent and location of coronary artery disease, particularly stenoses in the left anterior descending and right coronary arteries. Moreover, thallium-201 imaging at rest is reliable in assessing the extent of coronary disease in hospitalized patients who cannot undergo exercise testing because of unstable angina, uncompensated heart failure, poorly controlled arrhythmias or physical limitations

  12. Mercury, Vaccines, and Autism

    Science.gov (United States)

    Baker, Jeffrey P.

    2008-01-01

    The controversy regarding the once widely used mercury-containing preservative thimerosal in childhood vaccines has raised many historical questions that have not been adequately explored. Why was this preservative incorporated in the first place? Was there any real evidence that it caused harm? And how did thimerosal become linked in the public mind to the “autism epidemic”? I examine the origins of the thimerosal controversy and their legacy for the debate that has followed. More specifically, I explore the parallel histories of three factors that converged to create the crisis: vaccine preservatives, mercury poisoning, and autism. An understanding of this history provides important lessons for physicians and policymakers seeking to preserve the public’s trust in the nation’s vaccine system. PMID:18172138

  13. Mercury in Canadian crude oil

    International Nuclear Information System (INIS)

    Hollebone, B.P.

    2005-01-01

    Estimates for average mercury concentrations in crude oil range widely from 10 ng/g of oil to 3,500 ng/g of oil. With such a broad range of estimates, it is difficult to determine the contributions of the petroleum sector to the total budget of mercury emissions. In response to concerns that the combustion of petroleum products may be a major source of air-borne mercury pollution, Environment Canada and the Canadian Petroleum Products Institute has undertaken a survey of the average total mercury concentration in crude oil processed in Canadian refineries. In order to calculate the potential upper limit of total mercury in all refined products, samples of more than 30 different types of crude oil collected from refineries were measured for their concentration of mercury as it enters into a refinery before processing. High temperature combustion, cold vapour atomic absorption and cold vapour atomic fluorescence were the techniques used to quantify mercury in the samples. The results of the study provide information on the total mass of mercury present in crude oil processed in Canada each year. Results can be used to determine the impact of vehicle exhaust emissions to the overall Canadian mercury emission budget. 17 refs., 2 tabs., 2 figs

  14. Method for mercury refinement

    Science.gov (United States)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-04-09

    The effluent from mercury collected during the photochemical separation of the [sup 196]Hg isotope is often contaminated with particulate mercurous chloride, Hg[sub 2]Cl[sub 2]. The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg[sub 2]Cl[sub 2] contaminant. The present invention is particularly directed to such filtering. 5 figures.

  15. Apparatus for mercury refinement

    Science.gov (United States)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-07-16

    The effluent from mercury collected during the photochemical separation of the [sup 196]Hg isotope is often contaminated with particulate mercurous chloride, Hg[sub 2]Cl[sub 2]. The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg[sub 2]Cl[sub 2] contaminant. The present invention is particularly directed to such filtering. 5 figures.

  16. Apparatus for mercury refinement

    International Nuclear Information System (INIS)

    Grossman, M.W.; Speer, R.; George, W.A.

    1991-01-01

    The effluent from mercury collected during the photochemical separation of the 196 Hg isotope is often contaminated with particulate mercurous chloride, Hg 2 Cl 2 . The use of mechanical filtering via thin glass tubes, ultrasonic rinsing with acetone (dimethyl ketone) and a specially designed cold trap have been found effective in removing the particulate (i.e., solid) Hg 2 Cl 2 contaminant. The present invention is particularly directed to such filtering. 5 figures

  17. Method for scavenging mercury

    Science.gov (United States)

    Chang, Shih-ger [El Cerrito, CA; Liu, Shou-heng [Kaohsiung, TW; Liu, Zhao-rong [Beijing, CN; Yan, Naiqiang [Berkeley, CA

    2009-01-20

    Disclosed herein is a method for removing mercury from a gas stream comprising contacting the gas stream with a getter composition comprising bromine, bromochloride, sulphur bromide, sulphur dichloride or sulphur monochloride and mixtures thereof. In one preferred embodiment the getter composition is adsorbed onto a sorbent. The sorbent may be selected from the group consisting of flyash, limestone, lime, calcium sulphate, calcium sulfite, activated carbon, charcoal, silicate, alumina and mixtures thereof. Preferred is flyash, activated carbon and silica.

  18. Magnetic field of Mercury

    International Nuclear Information System (INIS)

    Jackson, D.J.; Beard, D.B.

    1977-01-01

    The geomagnetic field, suitably scaled down and parameterized, is shown to give a very good fit to the magnetic field measurements taken on the first and third passes of the Mariner 10 space probe past Mercury. The excellence of the fit to a reliable planetary magnetospheric model is good evidence that the Mercury magnetosphere is formed by a simple, permanent, intrinsic planetary magnetic field distorted by the effects of the solar wind. The parameters used for a best fit to all the data are (depending slightly on the choice of data) 2.44--2.55 for the ratio of Mercury's magnetic field strength at the subsolar point to that of the earth's subsolar point field (this results in a dipole moment of 170 γR/sub M/ 3 (R/sub M/ is Mercury Radius), i.e., 2.41 x 10 22 G cm 3 in the same direction as the earth's dipole), approx.-113 γR/sub M/ 4 for the planetary quadrupole moment parallel to the dipole moment, 10degree--17degree for the tilt of the planet dipole toward the sun, 4.5degree for the tilt of the dipole toward dawn, and 2.5degree--7.6degree aberration angle for the shift in the tail axis from the planet-sun direction because of the planet's orbital velocity. The rms deviation overall for the entire data set compared with the theoretical fitted model for the magnetic field strength was 17 γ (approx.4% of the maximum field measured). If the data from the first pass that show presumed strong time variations are excluded, the overall rms deviation for the field magnitude is only 10 γ

  19. The planet Mercury (1971)

    Science.gov (United States)

    1972-01-01

    The physical properties of the planet Mercury, its surface, and atmosphere are presented for space vehicle design criteria. The mass, dimensions, mean density, and orbital and rotational motions are described. The gravity field, magnetic field, electromagnetic radiation, and charged particles in the planet's orbit are discussed. Atmospheric pressure, temperature, and composition data are given along with the surface composition, soil mechanical properties, and topography, and the surface electromagnetic and temperature properties.

  20. Ultralow Level Mercury Treatment Using Chemical Reduction and Air Stripping: Scoping Report

    International Nuclear Information System (INIS)

    Looney, B.B.

    2000-01-01

    Data collected during the first stage of a Savannah River Technology Center (SRTC) Strategic Research and Development Project confirmed the efficacy of chemical reduction and air stripping/sparging as an ultralow level mercury treatment concept for waters containing Hg(II). The process consists of dosing the water with low levels of stannous chloride to convert the mercury to Hg. This form of mercury can easily be removed from the water by air stripping or sparging. Samples of Savannah River Site (SRS) groundwater containing approximately 130 ng/L of total mercury (as Hg(II)) were used for the study. In undosed samples, sparging removed 0 percent of the initial mercury. In the dosed samples, all of the removals were greater than 94 percent, except in one water type at one dose. This sample, which was saturated with dissolved oxygen, showed a 63 percent reduction in mercury following treatment at the lowest dose. Following dosing at minimally effective levels and sparging, treated water contained less than 10 ng/L total mercury. In general, the data indicate that the reduction of mercury is highly favored and that stannous chloride reagent efficiently targets the Hg(II) contaminant in the presence of competing reactions. Based on the results, the authors estimated that the costs of implementing and operating an ultralow level mercury treatment process based on chemical reduction and stripping/sparging are 10 percent to 20 percent of traditional treatment technologies

  1. Low-Cost Options for Moderate Levels of Mercury Control

    Energy Technology Data Exchange (ETDEWEB)

    Sharon Sjostrom

    2006-03-31

    On March 15, 2005, EPA issued the Clean Air Mercury Rule, requiring phased-in reductions of mercury emissions from electric power generators. ADA-ES, Inc., with support from DOE/NETL and industry partners, is conducting evaluations of EPRI's TOXECON II{trademark} process and of high-temperature reagents and sorbents to determine the capabilities of sorbent/reagent injection, including activated carbon, for mercury control on different coals and air emissions control equipment configurations. DOE/NETL targets for total mercury removal are {ge}55% (lignite), {ge}65% (subbituminous), and {ge}80% (bituminous). Based on work done to date at various scales, meeting the removal targets appears feasible. However, work needs to progress to more thoroughly document and test these promising technologies at full scale. This is the final site report for tests conducted at MidAmerican's Louisa Station, one of three sites evaluated in this DOE/NETL program. The other two sites in the program are MidAmerican's Council Bluff Station and Entergy's Independence Station. MidAmerican's Louisa Station burns Powder River Basin (PRB) coal and employs hot-side electrostatic precipitators with flue gas conditioning for particulate control. This part of the testing program evaluated the effect of reagents used in the existing flue gas conditioning on mercury removal.

  2. Mercury removal sorbents

    Science.gov (United States)

    Alptekin, Gokhan

    2016-03-29

    Sorbents and methods of using them for removing mercury from flue gases over a wide range of temperatures are disclosed. Sorbent materials of this invention comprise oxy- or hydroxyl-halogen (chlorides and bromides) of manganese, copper and calcium as the active phase for Hg.sup.0 oxidation, and are dispersed on a high surface porous supports. In addition to the powder activated carbons (PACs), this support material can be comprised of commercial ceramic supports such as silica (SiO.sub.2), alumina (Al.sub.2O.sub.3), zeolites and clays. The support material may also comprise of oxides of various metals such as iron, manganese, and calcium. The non-carbon sorbents of the invention can be easily injected into the flue gas and recovered in the Particulate Control Device (PCD) along with the fly ash without altering the properties of the by-product fly ash enabling its use as a cement additive. Sorbent materials of this invention effectively remove both elemental and oxidized forms of mercury from flue gases and can be used at elevated temperatures. The sorbent combines an oxidation catalyst and a sorbent in the same particle to both oxidize the mercury and then immobilize it.

  3. 17 CFR 201.160 - Time computation.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Time computation. 201.160... Rules of Practice General Rules § 201.160 Time computation. (a) Computation. In computing any period of... legal holidays shall be excluded from the computation when the period of time prescribed or allowed is...

  4. 24 CFR 201.31 - Insurance charge.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance charge. 201.31 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Insurance of Loans § 201.31 Insurance charge. (a...

  5. Brain SPECT with Tl-201 DDC

    International Nuclear Information System (INIS)

    Bruine, J.F. de.

    1988-01-01

    The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs

  6. 7 CFR 201.51 - Inert matter.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inert matter. 201.51 Section 201.51 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... other sclerotia. (2) Soil particles, sand, stone, chaff, stems, leaves, flowers, loose coating material...

  7. 24 CFR 201.24 - Security requirements.

    Science.gov (United States)

    2010-04-01

    ... manufactured home. (c) Recording and perfection of security. The lender shall assure that the legal description... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Security requirements. 201.24... TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Eligibility and Disbursement Requirements § 201...

  8. 31 CFR 0.201 - Political activity.

    Science.gov (United States)

    2010-07-01

    ... EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.201 Political activity. (a) Employees may: (1) Take an active part in political management or in political campaigns to the extent permitted by law (5 U.S.C... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Political activity. 0.201 Section 0...

  9. 48 CFR 50.201 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.201 Definitions. Act of terrorism means any act determined to have met the following... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 50.201...

  10. 19 CFR 201.206 - Administrative offset.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Administrative offset. 201.206 Section 201.206 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt...; (iii) That the agency has prescribed regulations for the exercise of administrative offset; and (iv...

  11. 18 CFR 154.201 - Filing requirements.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Filing requirements. 154.201 Section 154.201 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... progressive calculations, any discontinuity between one working paper and another must be explained. [Order...

  12. 22 CFR 1203.735-201 - General.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true General. 1203.735-201 Section 1203.735-201 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE RESPONSIBILITIES AND... this part, which might result in, or create the appearance of: (1) Using public office for private gain...

  13. 49 CFR 179.201-11 - Insulation.

    Science.gov (United States)

    2010-10-01

    ...) Insulation shall be of sufficient thickness so that the thermal conductance at 60 °F. is not more than 0.075... 49 Transportation 2 2010-10-01 2010-10-01 false Insulation. 179.201-11 Section 179.201-11 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY...

  14. 9 CFR 205.201 - System operator.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false System operator. 205.201 Section 205.201 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM PRODUCTS...

  15. 24 CFR 201.16 - Default provision.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Default provision. 201.16 Section... PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.16 Default provision. The... default by the borrower. ...

  16. 9 CFR 201.3 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 201.3 Section 201.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS....3 Authority. The Administrator shall perform such duties as the Secretary may require in enforcing...

  17. 21 CFR 155.201 - Canned mushrooms.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned mushrooms. 155.201 Section 155.201 Food and... mushrooms. (a) Identity—(1) Definition. Canned mushrooms is the food properly prepared from the caps and stems of succulent mushrooms conforming to the characteristics of the species Agaricus (Psalliota...

  18. 46 CFR 199.201 - Survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.201 Section 199.201 Shipping COAST... craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be... addition to the survival craft required in paragraph (b)(1) of this section, additional liferafts must be...

  19. 17 CFR 242.201 - Price test.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Price test. 242.201 Section...-Regulation of Short Sales § 242.201 Price test. Link to an amendment published at 75 FR 11323, Mar. 10, 2010. (a) No short sale price test, including any short sale price test of any self-regulatory organization...

  20. 33 CFR 135.201 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Applicability. 135.201 Section 135.201 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND...

  1. 13 CFR 105.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 105.201 Section 105.201 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION STANDARDS OF CONDUCT AND EMPLOYEE..., grant, managerial or other aid, including size determinations, section 8(a) participation, licensing...

  2. 48 CFR 2030.201-5 - Waiver.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS COST ACCOUNTING STANDARDS CAS Program Requirements 2030.201-5 Waiver. Requests to waive Cost Accounting Standards (CAS) requirements must be submitted to the Chairman, CAS Board by the Competition... supporting documentation and rationale in accordance with FAR 30.201-5. ...

  3. 48 CFR 419.201-73 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reports. 419.201-73... SMALL BUSINESS PROGRAMS Policies 419.201-73 Reports. The Director, OSDBU, shall be responsible for submitting reports concerning USDA's progress and achievements in the procurement preference program. ...

  4. 42 CFR 93.201 - Allegation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Allegation. 93.201 Section 93.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

  5. 49 CFR 179.201-4 - Material.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Material. 179.201-4 Section 179.201-4 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS...

  6. 17 CFR 201.222 - Prehearing submissions.

    Science.gov (United States)

    2010-04-01

    ....222 Section 201.222 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice Initiation of Proceedings and Prehearing Rules § 201.222 Prehearing submissions... qualifications, a listing of other proceedings in which the expert has given expert testimony, and a list of...

  7. 7 CFR 1430.201 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice President...

  8. 17 CFR 201.221 - Prehearing conference.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Prehearing conference. 201.221... Rules of Practice Initiation of Proceedings and Prehearing Rules § 201.221 Prehearing conference. (a) Purposes of conference. The purposes of a prehearing conference include, but are not limited to: (1...

  9. Mercury's Magnetic Field

    Science.gov (United States)

    Johnson, C. L.

    2014-12-01

    Mercury is the only inner solar system body other than Earth to possess an active core dynamo-driven magnetic field and the only planet with a small, highly dynamic magnetosphere. Measurements made by the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft have provided a wealth of data on Mercury's magnetic field environment. Mercury's weak magnetic field was discovered 40 years ago by the Mariner 10 spacecraft, but its large-scale geometry, strength and origin could not be definitively established. MESSENGER data have shown that the field is dynamo-generated and can be described as an offset axisymmetric dipole field (hereafter OAD): the magnetic equator lies ~0.2 RM (RM = 2440 km) north of the geographic equator and the dipole moment is 2.8 x1019 Am2 (~0.03% that of Earth's). The weak internal field and the high, but variable, solar wind ram pressure drive vigorous magnetospheric dynamics and result in an average distance from the planet center to the sub-solar magnetopause of only 1.42 RM. Magnetospheric models developed with MESSENGER data have allowed re-analysis of the Mariner 10 observations, establishing that there has been no measureable secular variation in the internal field over 40 years. Together with spatial power spectra for the OAD, this provides critical constraints for viable dynamo models. Time-varying magnetopause fields induce secondary core fields, the magnitudes of which confirm the core radius estimated from MESSENGER gravity and Earth-based radar data. After accounting for large-scale magnetospheric fields, residual signatures are dominated by additional external fields that are organized in the local time frame and that vary with magnetospheric activity. Birkeland currents have been identified, which likely close in the planetary interior at depths below the base of the crust. Near-periapsis magnetic field measurements at altitudes greater than 200 km have tantalizing hints of crustal fields, but crustal

  10. Mechanisms of thallium-201 myocardial accumulation

    International Nuclear Information System (INIS)

    Wackers, F.J.Th.; Samson, G.

    1980-01-01

    The practical advantages of 201 Tl over other suitable myocardial imaging agents such as potassium-43 ( 43 K), rubidium-81 ( 81 Rb), and cesium-129 ( 129 Cs), are its relatively low energy photons which makes it possible to employ high-resolution low-energy collimators and its physical half-life of 73 hr which provides sufficiently long shelf-life for practical clinical imaging. Toxicological considerations do not play a role using 201 Tl as thallous chloride. The concentration of thallous chloride in a dose of 2 mCi of 201 Tl is less than 4μg. The LD 50 of thallous chloride is a factor 10 4 more. The minimal lethal dose in man is reported to be 12 mg/kg. The kinetics of 201 Tl, its tissue distributions and radiation doses are assessed, and the effect of cardiac drugs on thallium-201 uptake are discussed. (Auth.)

  11. Binary mixtures of mercury/ selenium, and lead/selenium

    African Journals Online (AJOL)

    Physiologically-based biokinetic models have been developed for predicting simultaneously the Absorption, Distribution, Metabolism and Elimination (ADME) properties of lead (Pb) and selenium (Se), and mercury (Hg) and selenium in a number of target tissues of humans. This was done for three population groups, ...

  12. Mercury flow tests (first report). Wall friction factor measurement tests and future tests plan

    International Nuclear Information System (INIS)

    Kaminaga, Masanori; Kinoshita, Hidetaka; Haga, Katsuhiro; Hino, Ryutaro; Sudo, Yukio

    1999-07-01

    In the neutron science project at JAERI, we plan to inject a pulsed proton beam of a maximum power of 5 MW from a high intense proton accelerator into a mercury target in order to produce high energy neutrons of a magnitude of ten times or more than existing facilities. The neutrons produced by the facility will be utilized for advanced field of science such as the life sciences etc. An urgent issue in order to accomplish this project is the establishment of mercury target technology. With this in mind, a mercury experimental loop with the capacity to circulate mercury up to 15 L/min was constructed to perform thermal hydraulic tests, component tests and erosion characteristic tests. A measurement of the wall friction factor was carried out as a first step of the mercury flow tests, while testing the characteristic of components installed in the mercury loop. This report presents an outline of the mercury loop and experimental results of the wall friction factor measurement. From the wall friction factor measurement, it was made clear that the wettability of the mercury was improved with an increase of the loop operation time and at the same time the wall friction factors were increased. The measured wall friction factors were much lower than the values calculated by the Blasius equation at the beginning of the loop operation because of wall slip caused by a non-wetted condition. They agreed well with the values calculated by the Blasius equation within a deviation of 10% when the sum of the operation time increased more than 11 hours. This report also introduces technical problems with a mercury circulation and future tests plan indispensable for the development of the mercury target. (author)

  13. Mercury Specie and Multi-Pollutant Control

    Energy Technology Data Exchange (ETDEWEB)

    Rob James; Virgil Joffrion; John McDermott; Steve Piche

    2010-05-31

    This project was awarded to demonstrate the ability to affect and optimize mercury speciation and multi-pollutant control using non-intrusive advanced sensor and optimization technologies. The intent was to demonstrate plant-wide optimization systems on a large coal fired steam electric power plant in order to minimize emissions, including mercury (Hg), while maximizing efficiency and maintaining saleable byproducts. Advanced solutions utilizing state-of-the-art sensors and neural network-based optimization and control technologies were proposed to maximize the removal of mercury vapor from the boiler flue gas thereby resulting in lower uncontrolled releases of mercury into the atmosphere. Budget Period 1 (Phase I) - Included the installation of sensors, software system design and establishment of the as-found baseline operating metrics for pre-project and post-project data comparison. Budget Period 2 (Phase II) - Software was installed, data communications links from the sensors were verified, and modifications required to integrate the software system to the DCS were performed. Budget Period 3 (Phase III) - Included the validation and demonstration of all control systems and software, and the comparison of the optimized test results with the targets established for the project site. This report represents the final technical report for the project, covering the entire award period and representing the final results compared to project goals. NeuCo shouldered 61% of the total project cost; while DOE shouldered the remaining 39%. The DOE requires repayment of its investment. This repayment will result from commercial sales of the products developed under the project. NRG's Limestone power plant (formerly owned by Texas Genco) contributed the host site, human resources, and engineering support to ensure the project's success.

  14. WE-DE-201-01: BEST IN PHYSICS (THERAPY): A Fast Multi-Target Inverse Treatment Planning Strategy Optimizing Dosimetric Measures for High-Dose-Rate (HDR) Brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Guthier, C [Brigham and Women’s Hospital, Boston, MA (United States); University Medical Center Mannheim, Mannheim (Germany); Harvard Medical School, Boston, MA (United States); Damato, A; Viswanathan, A; Cormack, R [Dana Farber Cancer Institut/Brigham and Women’s Hospital, Boston, MA (United States); Harvard Medical School, Boston, MA (United States); Hesser, J [University Medical Center Mannheim, Mannheim (Germany)

    2016-06-15

    Purpose: Inverse treatment planning (ITP) for interstitial HDR brachytherapy of gynecologic cancers seeks to maximize coverage of the clinical target volumes (tumor and vagina) while respecting dose-volume-histogram related dosimetric measures (DMs) for organs at risk (OARs). Commercially available ITP tools do not support DM-based planning because it is computationally too expensive to solve. In this study we present a novel approach that allows fast ITP for gynecologic cancers based on DMs for the first time. Methods: This novel strategy is an optimization model based on a smooth DM-based objective function. The smooth approximation is achieved by utilizing a logistic function for the evaluation of DMs. The resulting nonconvex and constrained optimization problem is then optimized with a BFGS algorithm. The model was evaluated using the implant geometry extracted from 20 patient treatment plans under an IRB-approved retrospective study. For each plan, the final DMs were evaluated and compared to the original clinical plans. The CTVs were the contoured tumor volume and the contoured surface of the vagina. Statistical significance was evaluated with a one-sided paired Wilcoxon signed-rank test. Results: As did the clinical plans, all generated plans fulfilled the defined DMs for OARs. The proposed strategy showed a statistically significant improvement (p<0.001) in coverage of the tumor and vagina, with absolute improvements of related DMs of (6.9 +/− 7.9)% and (28.2 +/− 12.0)%, respectively. This was achieved with a statistically significant (p<0.01) decrease of the high-dose-related DM for the tumor. The runtime of the optimization was (2.3 +/− 2.0) seconds. Conclusion: We demonstrated using clinical data that our novel approach allows rapid DM-based optimization with improved coverage of CTVs with fewer hot spots. Being up to three orders of magnitude faster than the current clinical practice, the method dramatically shortens planning time.

  15. Mercury: Exploration of a Planet

    Science.gov (United States)

    1976-01-01

    The flight of the Mariner 10 spacecraft to Venus and Mercury is detailed in animation and photography. Views of Mercury are featured. Also included is animation on the origin of the solar system. Dr. Bruce C. Murray, director of the Jet Propulsion Laboratory, comments on the mission.

  16. Rotation of the planet mercury.

    Science.gov (United States)

    Jefferys, W H

    1966-04-08

    The equations of motion for the rotation of Mercury are solved for the general case by an asymptotic expansion. The findings of Liu and O'Keefe, obtained by numerical integration of a special case, that it is possible for Mercury's rotation to be locked into a 2:3 resonance with its revolution, are confirmed in detail. The general solution has further applications.

  17. 49 CFR 173.164 - Mercury (metallic and articles containing mercury).

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Mercury (metallic and articles containing mercury... Than Class 1 and Class 7 § 173.164 Mercury (metallic and articles containing mercury). (a) For transportation by aircraft, mercury must be packaged in packagings which meet the requirements of part 178 of...

  18. Mercury emissions from South Africa’s coal-fired power stations

    Directory of Open Access Journals (Sweden)

    Belinda L. Garnham

    2016-12-01

    can be achieved as a co-benefit of installing other emission abatement technologies. At the very least, more accurate calculations of mercury emissions per power station should be obtained by measuring the mercury content of more recent coal samples, and developing power station-specific ERF’s before mercury emission regulations are established or an investment into targeted mercury emission reduction technology is made.

  19. Experimental determination of cavitation thresholds in liquid water and mercury

    International Nuclear Information System (INIS)

    Taleyarkhan, R.P.; West, C.D.; Moraga, F.

    1998-01-01

    An overview is provided on cavitation threshold measurement experiments for water and mercury. Various aspects to be considered that affect onset determination are discussed along with design specifications developed for construction of appropriate apparatus types. Both static and transient-cavitation effects were studied using radically different apparatus designs. Preliminary data are presented for cavitation thresholds for water and mercury over a range of temperatures in static and high-frequency environments. Implications and issues related to spallation neutron source target designs and operation are discussed

  20. Mercury Emission Control Technologies for PPL Montana-Colstrip Testing

    Energy Technology Data Exchange (ETDEWEB)

    John P. Kay; Michael L. Jones; Steven A. Benson

    2007-04-01

    technique at Colstrip is not seen. All the additives injected resulted in some reduction in mercury emissions. However, the target reduction of 55% was not achieved. The primary reason for the lower removal rates is because of the lower levels of mercury in the flue gas stream and the lower capture level of fine particles by the scrubbers (relative to that for larger particles). The reaction and interaction of the SEA materials is with the finer fraction of the fly ash, because the SEA materials are vaporized during the combustion or reaction process and condense on the surfaces of entrained particles or form very small particles. Mercury will have a tendency to react and interact with the finer fraction of entrained ash and sorbent as a result of the higher surface areas of the finer particles. The ability to capture the finer fraction of fly ash is the key to controlling mercury. Cost estimates for mercury removal based on the performance of each sorbent during this project are projected to be extremely high. When viewed on a dollar-per-pound-of-mercury removed basis activated carbon was projected to cost nearly $1.2 million per pound of mercury removed. This value is roughly six times the cost of other sorbent-enhancing agents, which were projected to be closer to $200,000 per pound of mercury removed.

  1. Mercury concentration in bivalve molluscs

    Directory of Open Access Journals (Sweden)

    Szkoda Józef

    2015-09-01

    Full Text Available A total of 85 mussel samples of eight species were examined. Analysis of mercury in the freeze-dried samples was carried out by atomic absorption spectrometry method using direct mercury analyser AMA 254. The analytical procedure for determination of mercury was covered by the quality assurance programme of research and participation in national and international proficiency tests. Concentrations of total mercury in all investigated samples were found to be generally low, in the range of 0.033-0.577 mg/kg of dry weight and of 0.003-0.045 mg/kg of wet weight. The results indicate that obtained levels of mercury in bivalve molluscs are not likely to pose a risk to the health of consumers.

  2. Mercury: Beethoven Quadrangle, H-7

    Science.gov (United States)

    2000-01-01

    Mercury: Computer Photomosaic of the Beethoven Quadrangle, H-7 The Beethoven Quadrangle, named for the 19th century classical German composer, lies in Mercury's Equatorial Mercator located between longitude 740 to 1440. The Mariner 10 spacecraft imaged the region during its initial flyby of the planet. The Image Processing Lab at NASA's Jet Propulsion Laboratory produced this photomosaic using computer software and techniques developed for use in processing planetary data. The images used to construct the Beethoven Quadrangle were taken as Mariner 10 flew passed Mercury. The Mariner 10 spacecraft was launched in 1974. The spacecraft took images of Venus in February 1974 on the way to three encounters with Mercury in March and September 1974 and March 1975. The spacecraft took more than 7,000 images of Mercury, Venus, the Earth and the Moon during its mission. The Mariner 10 Mission was managed by the Jet Propulsion Laboratory for NASA's Office of Space Science in Washington, D.C.

  3. Human Exposure and Health Effects of Inorganic and Elemental Mercury

    OpenAIRE

    Park, Jung-Duck; Zheng, Wei

    2012-01-01

    Mercury is a toxic and non-essential metal in the human body. Mercury is ubiquitously distributed in the environment, present in natural products, and exists extensively in items encountered in daily life. There are three forms of mercury, i.e., elemental (or metallic) mercury, inorganic mercury compounds, and organic mercury compounds. This review examines the toxicity of elemental mercury and inorganic mercury compounds. Inorganic mercury compounds are water soluble with a bioavailability o...

  4. Methods for dispensing mercury into devices

    Science.gov (United States)

    Grossman, Mark W.; George, William A.

    1987-04-28

    A process for dispensing mercury into devices which requires mercury. Mercury is first electrolytically separated from either HgO or Hg.sub.2 Cl.sub.2 and plated onto a cathode wire. The cathode wire is then placed into a device requiring mercury.

  5. 21 CFR 872.3700 - Dental mercury.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Dental mercury. 872.3700 Section 872.3700 Food and... DENTAL DEVICES Prosthetic Devices § 872.3700 Dental mercury. (a) Identification. Dental mercury is a device composed of mercury intended for use as a component of amalgam alloy in the restoration of a...

  6. Recent Approaches to Modeling Transport of Mercury in Surface Water and Groundwater - Case Study in Upper East Fork Poplar Creek, Oak Ridge, TN - 13349

    International Nuclear Information System (INIS)

    Bostick, Kent; Daniel, Anamary; Tachiev, Georgio; Malek-Mohammadi, Siamak

    2013-01-01

    below a target industrial groundwater concentration beneath the source and would not influence concentrations in surface water at Station 17. This analysis addressed only shallow concentrations in soil and the shallow groundwater flow path in soil and unconsolidated sediments to UEFPC. Other mercury sources may occur in bedrock and transport though bedrock to UEFPC may contribute to the mercury flux at Station 17. Generally mercury in the source areas adjacent to the stream and in sediment that is eroding can contribute to the flux of mercury in surface water. Because colloidally adsorbed mercury can be transported in surface water, actions that trap colloids and or hydrologically isolate surface water runoff from source areas would reduce the flux of mercury in surface water. Mercury in soil is highly adsorbed and transport in the groundwater system is very limited under porous media conditions. (authors)

  7. Fluorescent sensor for mercury

    Science.gov (United States)

    Wang, Zidong [Urbana, IL; Lee, Jung Heon [Evanston, IL; Lu, Yi [Champaign, IL

    2011-11-22

    The present invention provides a sensor for detecting mercury, comprising: a first polynucleotide, comprising a first region, and a second region, a second polynucleotide, a third polynucleotide, a fluorophore, and a quencher, wherein the third polynucleotide is optionally linked to the second region; the fluorophore is linked to the first polynucleotide and the quencher is linked to the second polynucleotide, or the fluorophore is linked to the second polynucleotide and the quencher is linked to the first polynucleotide; the first region and the second region hybridize to the second polynucleotide; and the second region binds to the third polynucleotide in the presence of Hg.sup.2+ ions.

  8. 4 CFR 201.7 - Timing of responses to requests.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Timing of responses to requests. 201.7 Section 201.7 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.7 Timing of... letter or an e-mail confirming the requestor's agreement to pay fees under § 201.8 and providing a...

  9. 41 CFR 50-201.4 - Statutory exemptions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Statutory exemptions. 50-201.4 Section 50-201.4 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.4 Statutory exemptions...

  10. 41 CFR 50-201.101 - Employees affected.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Employees affected. 50-201.101 Section 50-201.101 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.101 Employees...

  11. Increased mercury emissions from modern dental amalgams

    OpenAIRE

    Bengtsson, Ulf G.; Hylander, Lars D.

    2017-01-01

    All types of dental amalgams contain mercury, which partly is emitted as mercury vapor. All types of dental amalgams corrode after being placed in the oral cavity. Modern high copper amalgams exhibit two new traits of increased instability. Firstly, when subjected to wear/polishing, droplets rich in mercury are formed on the surface, showing that mercury is not being strongly bonded to the base or alloy metals. Secondly, high copper amalgams emit substantially larger amounts of mercury vapor ...

  12. Dicty_cDB: VHO201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  13. Mercury kinetics in marine zooplankton

    International Nuclear Information System (INIS)

    Fowler, S.W.; Heyraud, M.; LaRosa, J.

    1976-01-01

    Mercury, like many other heavy metals, is potentially available to marine animals by uptake directly from water and/or through the organisms food. Furthermore, bioavailability, assimilation and subsequent retention in biota may be affected by the chemical species of the element in sea water. While mercury is known to exist in the inorganic form in sea water, recent work has indicated that, in certain coastal areas, a good portion of the total mercury appears to be organically bound; however, the exact chemical nature of the organic fraction has yet to be determined. Methyl mercury may be one constituent of the natural organically bound fraction since microbial mechanisms for in situ methylation of mercury have been demonstrated in the aquatic environment. Despite the fact that naturally produced methyl mercury probably comprises only a small fraction of an aquatic ecosystem, the well-documented toxic effects of this organo-mercurial, caused by man-made introductions into marine food chains, make it an important compound to study

  14. Atmospheric mercury footprints of nations.

    Science.gov (United States)

    Liang, Sai; Wang, Yafei; Cinnirella, Sergio; Pirrone, Nicola

    2015-03-17

    The Minamata Convention was established to protect humans and the natural environment from the adverse effects of mercury emissions. A cogent assessment of mercury emissions is required to help implement the Minamata Convention. Here, we use an environmentally extended multi-regional input-output model to calculate atmospheric mercury footprints of nations based on upstream production (meaning direct emissions from the production activities of a nation), downstream production (meaning both direct and indirect emissions caused by the production activities of a nation), and consumption (meaning both direct and indirect emissions caused by final consumption of goods and services in a nation). Results show that nations function differently within global supply chains. Developed nations usually have larger consumption-based emissions than up- and downstream production-based emissions. India, South Korea, and Taiwan have larger downstream production-based emissions than their upstream production- and consumption-based emissions. Developed nations (e.g., United States, Japan, and Germany) are in part responsible for mercury emissions of developing nations (e.g., China, India, and Indonesia). Our findings indicate that global mercury abatement should focus on multiple stages of global supply chains. We propose three initiatives for global mercury abatement, comprising the establishment of mercury control technologies of upstream producers, productivity improvement of downstream producers, and behavior optimization of final consumers.

  15. Method for removal and stabilization of mercury in mercury-containing gas streams

    Science.gov (United States)

    Broderick, Thomas E.

    2005-09-13

    The present invention is directed to a process and apparatus for removing and stabilizing mercury from mercury-containing gas streams. A gas stream containing vapor phase elemental and/or speciated mercury is contacted with reagent, such as an oxygen-containing oxidant, in a liquid environment to form a mercury-containing precipitate. The mercury-containing precipitate is kept or placed in solution and reacts with one or more additional reagents to form a solid, stable mercury-containing compound.

  16. Exploring Mercury: The Iron Planet

    OpenAIRE

    Stevenson, David J.

    2004-01-01

    Planet Mercury is both difficult to observe and difficult to reach by spacecraft. Just one spacecraft, Mariner 10, flew by the planet 30 years ago. An upcoming NASA mission, MESSENGER, will be launched this year and will go into orbit around Mercury at the end of this decade. A European mission is planned for the following decade. It's worth going there because Mercury is a strange body and the history of planetary exploration has taught us that strangeness gives us insight into planetary ori...

  17. MESSENGER'S First Flyby of Mercury

    Science.gov (United States)

    Slavin, James A.

    2008-01-01

    The MESSENGER mission to Mercury offers our first opportunity to explore this planet's miniature magnetosphere since Mariner 10's brief fly-bys in 1974-5. The magnetosphere of Mercury is the smallest in the solar system with its magnetic field typically standing off the solar wind only - 1000 to 2000 km above the surface. An overview of the MESSENGER mission and its January 14th close flyby of Mercury will be provided. Primary science objectives and the science instrumentation will be described. Initial results from MESSENGER'S first flyby on January 14th, 2008 will be discussed with an emphasis on the magnetic field and charged particle measurements.

  18. Quantitative analysis of thallium-201 myocardial scintigraphy

    International Nuclear Information System (INIS)

    Kanemoto, Nariaki; Hoer, G.; Johost, S.; Maul, F.-D.; Standke, R.

    1981-01-01

    The method of quantitative analysis of thallium-201 myocardial scintigraphy using computer assisted technique was described. Calculated indices are washout factor, vitality index and redistribution factor. Washout factor is the ratio of counts at certain period of time after exercise and immediately after exercise. This value is neccessary for the evaluation of redistribution to the ischemic areas in serial imagings to correct the Tl-201 washout from the myocardium under the assumption that the washout is constant in the whole myocardium. Vitality index is the ratio between the Tl-201 uptake in the region of interest and that of the maximum. Redistribution factor is the ratio of the redistribution in the region of interest in serial imagings after exercise to that of immediately after exercise. Four examples of exercise Tl-201 myocardial scintigrams and the quantitative analyses before and after the percutaneous transluminal coronary angioplasty were presented. (author)

  19. 48 CFR 430.201-5 - Waiver.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION CAS Program Requirements 430.201-5 Waiver. The Senior... Accounting Standards Board to waive the application of the Cost Accounting Standards (CAS). Contracting...

  20. 5 CFR 412.201 - Management succession.

    Science.gov (United States)

    2010-01-01

    ..., MANAGEMENT, AND EXECUTIVE DEVELOPMENT Succession Planning § 412.201 Management succession. The head of each... learning experiences throughout an employee's career, such as details, mentoring, coaching, learning groups...

  1. 48 CFR 3019.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... meet public policy objectives concerning small business participation in departmental procurements. The... ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 3019.201 General policy. (d) DHS is committed to a unified team approach involving senior management, small business...

  2. Vaporization of elemental mercury from pools of molten lead at low concentrations

    International Nuclear Information System (INIS)

    Greene, G.A.; Finfrock, C.C.

    2000-01-01

    Should coolant accidentally be lost to the APT (Accelerator Production of Tritium) blanket and target, and the decay heat in the target be deposited in the surrounding blanket by thermal radiation, temperatures in the blanket modules could exceed structural limits and cause a physical collapse of the blanket modules into a non-coolable geometry. Such a sequence of unmitigated events could result in some melting of the APT blanket and create the potential for the release of mercury into the target-blanket cavity air space. Experiments were conducted which simulate such hypothetical accident conditions in order to measure the rate of vaporization of elemental mercury from pools of molten lead to quantify the possible severe accident source term for the APT blanket region. Molten pools of from 0.01% to 0.10% mercury in lead were prepared under inert conditions. Experiments were conducted, which varied in duration from several hours to as long as a month, to measure the mercury vaporization from the lead pools. The melt pools and gas atmospheres were held fixed at 340 C during the tests. Parameters which were varied in the tests included the mercury concentration, gas flow rate over the melt and agitation of the melt, gas atmosphere composition and the addition of aluminum to the melt. The vaporization of mercury was found to scale roughly linearly with the concentration of mercury in the pool. Variations in the gas flow rates were not found to have any effect on the mass transfer, however agitation of the melt by a submerged stirrer did enhance the mercury vaporization rate. The rate of mercury vaporization with an argon (inert) atmosphere was found to exceed that for an air (oxidizing) atmosphere by as much as a factor of from ten to 20; the causal factor in this variation was the formation of an oxide layer over the melt pool with the air atmosphere which served to retard mass transfer across the melt-atmosphere interface. Aluminum was introduced into the melt to

  3. Distribution and retention of organic and inorganic mercury in methyl mercury-treated neonatal rats

    International Nuclear Information System (INIS)

    Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Hall, L.L.; Mushak, P.

    1988-01-01

    Seven-day-old Long Evans rats received one mumol of 203 Hg-labeled methyl mercury/kg sc and whole body retention and tissue distribution of organic and inorganic mercury were examined for 32 days postdosing. Neonates cleared mercury slowly until 10 days postdosing when the clearance rate abruptly increased. During the interval when whole body clearance of mercury was extremely slow, methyl mercury was metabolized to inorganic mercury. Peak concentration of mercury in kidney occurred at 2 days postdosing. At 32 days postdosing, 8% of mercury in kidney was in an organic from. Liver mercury concentration peaked at 2 days postdosing and organic mercury accounted for 38% at 32 days postdosing. Brain concentrations of mercury peaked at 2 days postdosing. At 10 days postdosing, organic mercury accounted for 86% of the brain mercury burden, and, at 32 days postdosing, for 60%. The percentage of mercury body burden in pelt rose from 30 to 70% between 1 and 10 days postdosing. At 32 days postdosing pelt contained 85% of the body burden of mercury. At all time points, about 95% of mercury in pelt was in an organic form. Compartmental analysis of these data permitted development of a model to describe the distribution and excretion of organic and inorganic mercury in methyl mercury-treated neonatal rats

  4. Value of thyroid scintigraphy using thallium 201

    International Nuclear Information System (INIS)

    Hermans, J.; Parmentier, S.; Beauduin, M.; Schmitz, A.; Therasse, G.

    1986-01-01

    The value of thallium-201 scintigraphy in the differential diagnosis of cold thyroid nodules demonstrated on the thyroid scan with technetium-99m was emphasized. From the clinical results it can be deduced that if a cold nodule is positive with thallium-201 the lesion has a high percentage of being a high risk of malignancy. This information might be quite valuable in selecting patients for operation [fr

  5. 24 CFR 982.201 - Eligibility and targeting.

    Science.gov (United States)

    2010-04-01

    ... the family is income eligible. (c) Family composition. (1) A “family” may be a single person or a... only eligible families to the program. To be eligible, an applicant must be a “family;” must be income... family in any of the following categories: (i) A “very low income” family; (ii) A low-income family that...

  6. Disposal strategy of proton irradiated mercury from high power spallation sources

    International Nuclear Information System (INIS)

    Chiriki, Suresh

    2010-01-01

    Large spallation sources are intended to be constructed in Europe (EURISOL: nuclear physics research facility and ESS: European Spallation Source). These facilities would accumulate more than 20 metric tons of irradiated mercury in the target, which has to be treated as highly radioactive and chemo-toxic waste. Liquid waste cannot be tolerated in European repositories. As part of this work on safety/decommissioning of high-power spallation sources, our investigations were focused mainly to study experimentally and theoretically the solidification of liquid mercury waste (selection of an adequate solid mercury form and of an immobilization matrix, chemical engineering process studies on solidification/stabilization and on encapsulating in a matrix). Based on experimental results and supported by literature Hg-chalcogens (HgS, HgSe) will be more stable in repositories than amalgams. Our irradiation experimental studies on mercury waste revealed that mercury sulfide is a reasonable solid for disposal and shows larger stability in possible accidents with water ingress in a repository. Additionally immobilization of mercury in a cement matrix and polysiloxane matrix were tested. HgS formation from liquid target mercury by a wet process is identified as a suitable formation procedure. These investigations reveal that an almost 99.9% elementary Hg conversion can be achieved and that wet process can be reasonably handled under hot cell conditions. (orig.)

  7. Disposal strategy of proton irradiated mercury from high power spallation sources

    Energy Technology Data Exchange (ETDEWEB)

    Chiriki, Suresh

    2010-07-01

    Large spallation sources are intended to be constructed in Europe (EURISOL: nuclear physics research facility and ESS: European Spallation Source). These facilities would accumulate more than 20 metric tons of irradiated mercury in the target, which has to be treated as highly radioactive and chemo-toxic waste. Liquid waste cannot be tolerated in European repositories. As part of this work on safety/decommissioning of high-power spallation sources, our investigations were focused mainly to study experimentally and theoretically the solidification of liquid mercury waste (selection of an adequate solid mercury form and of an immobilization matrix, chemical engineering process studies on solidification/stabilization and on encapsulating in a matrix). Based on experimental results and supported by literature Hg-chalcogens (HgS, HgSe) will be more stable in repositories than amalgams. Our irradiation experimental studies on mercury waste revealed that mercury sulfide is a reasonable solid for disposal and shows larger stability in possible accidents with water ingress in a repository. Additionally immobilization of mercury in a cement matrix and polysiloxane matrix were tested. HgS formation from liquid target mercury by a wet process is identified as a suitable formation procedure. These investigations reveal that an almost 99.9% elementary Hg conversion can be achieved and that wet process can be reasonably handled under hot cell conditions. (orig.)

  8. Thallium-201 stress imaging in hypertensive patients

    International Nuclear Information System (INIS)

    Schulman, D.S.; Francis, C.K.; Black, H.R.; Wackers, F.J.

    1987-01-01

    To assess the potential effect of hypertension on the results of thallium-201 stress imaging in patients with chest pain, 272 thallium-201 stress tests performed in 133 hypertensive patients and 139 normotensive patients over a 1-year period were reviewed. Normotensive and hypertensive patients were similar in age, gender distribution, prevalence of cardiac risk factors (tobacco smoking, hyperlipidemia, and diabetes mellitus), medications, and clinical symptoms of coronary disease. Electrocardiographic criteria for left ventricular hypertrophy were present in 16 hypertensive patients. Stepwise probability analysis was used to determine the likelihood of coronary artery disease for each patient. In patients with mid to high likelihood of coronary disease (greater than 25% probability), abnormal thallium-201 stress images were present in 54 of 60 (90%) hypertensive patients compared with 51 of 64 (80%) normotensive patients. However, in 73 patients with a low likelihood of coronary disease (less than or equal to 25% probability), abnormal thallium-201 stress images were present in 21 patients (29%) of the hypertensive group compared with only 5 of 75 (7%) of the normotensive patients (p less than 0.001). These findings suggest that in patients with a mid to high likelihood of coronary artery disease, coexistent hypertension does not affect the results of thallium-201 exercise stress testing. However, in patients with a low likelihood of coronary artery disease, abnormal thallium-201 stress images are obtained more frequently in hypertensive patients than in normotensive patients

  9. Mercury and Selenium in Muscle and Target Organs of Scalloped Hammerhead Sharks Sphyrna lewini of the SE Gulf of California: Dietary Intake, Molar Ratios, Loads, and Human Health Risks.

    Science.gov (United States)

    Bergés-Tiznado, Magdalena E; Márquez-Farías, Fernando; Lara-Mendoza, Raúl E; Torres-Rojas, Yassir E; Galván-Magaña, Felipe; Bojórquez-Leyva, Humberto; Páez-Osuna, Federico

    2015-11-01

    Selenium and mercury were evaluated in muscle, liver, kidney, brain, and the stomach contents of juvenile scalloped hammerhead shark Sphyrna lewini. Se:Hg molar ratios were calculated. The average Hg levels in muscle ranged from 0.12 to 1.17 μg/g (wet weight); Hg was 1. Correlations were found for Hg in muscle with size, age, and weight, and also for Hg in liver with size, age, and weight. Hg in muscle was significantly positive correlated to Hg in brain as well as Hg in liver was correlated to Hg in kidney. The highest Hg in preys was for carangid fishes; scombrid and carangid fishes contributed with the highest Se levels. Results suggest that more than 98 % of the total Hg and 62 % of Se end up in muscle and might be affected by factors, such as geographical area, age, size, and feeding habits. The muscle of S. lewini should be consumed by people cautiously so as not to exceed the recommended intake per week.

  10. Elimination of mercury in health care facilities.

    Science.gov (United States)

    2000-03-01

    Mercury is a persistent, bioaccumulative toxin that has been linked to numerous health effects in humans and wildlife. It is a potent neurotoxin that may also harm the brain, kidneys, and lungs. Unborn children and young infants are at particular risk for brain damage from mercury exposure. Hospitals' use of mercury in chemical solutions, thermometers, blood pressure gauges, batteries, and fluorescent lamps makes these facilities large contributors to the overall emission of mercury into the environment. Most hospitals recognize the dangers of mercury. In a recent survey, four out of five hospitals stated that they have policies in place to eliminate the use of mercury-containing products. Sixty-two percent of them require vendors to disclose the presence of mercury in chemicals that the hospitals purchase. Only 12 percent distribute mercury-containing thermometers to new parents. Ninety-two percent teach their employees about the health and environmental effects of mercury, and 46 percent teach all employees how to clean up mercury spills. However, the same study showed that many hospitals have not implemented their policies. Forty-two percent were not aware whether they still purchased items containing mercury. In addition, 49 percent still purchase mercury thermometers, 44 percent purchase mercury gastrointestinal diagnostic equipment, and 64 percent still purchase mercury lab thermometers.

  11. NZG 201 portable spectrometric unit

    International Nuclear Information System (INIS)

    Jursa, P.; Novakova, O.; Slezak, V.

    The NZG 201 spectrometric unit is a portable single-channel processing unit supplied from the mains or a battery which allows the qualitative and quantitative measurement of different types of ionizing radiation when connected to a suitable detection unit. The circuit layout and the choice of control elements makes the spectrometric unit suitable for use with scintillation detector units. The spectrometric unit consists of a pulse amplifier, an amplitude pulse analyzer, a pulse counter, a pulse rate counter with an output for a recorder, a high voltage source and a low voltage source. The block diagram is given. All circuits are modular and are mounted on PCB's. The apparatus is built in a steel cabinet with a raised edge which protects the control elements. The linear pulse amplifier has a maximum gain of 1024, the pulse counter has a maximum capacity of 10 6 -1 imp and time resolution better than 0.5 μs. The temperature interval at which the apparatus is operational is 0 to 45 degC, its weight is 12.5 kg and dimensions 36x280x310 mm, energy range O.025 to 2.5 MeV, for 137 Cs the energy resolution is 8 to 10%. The spectrometric unit NZG 2O1 may, with regard to its parameters, number and range of control elements, be used as a universal measuring unit. (J.P.)

  12. Mercury pollution: a transdisciplinary treatment

    National Research Council Canada - National Science Library

    Zuber, Sharon L; Newman, Michael C

    2012-01-01

    .... Also included are smaller case studies, such as the Minamata tragedy, fish consumption, and international treaties"-- "Mercury is the gravest chemical pollutant problem of our time, and this is...

  13. Origin and composition of Mercury

    International Nuclear Information System (INIS)

    Lewis, J.S.

    1988-01-01

    The predictions of the expected range of composition of Mercury at the time of its formation made on the basis of a suite of condensation-accretion models of Mercury spanning a range of condensation temperature and accretion sampling functions appropriate to Mercury are examined. It is concluded that these compositonal models can, if modified to take into account the nonselective loss of most of the silicate component of the planet during accretion, provide compositional predictions for the Weidenschilling (1978, 1980) mechanism for the accretion of a metal-rich Mercury. The silicate portion would, in this case, contain 3.6 to 4.5 percent alumina, roughly 1 percent of alkali oxides, and between 0.5 and 6 percent FeO

  14. Mercury bioremediation by mercury resistance transposon-mediated in situ molecular breeding.

    Science.gov (United States)

    Matsui, Kazuaki; Endo, Ginro

    2018-04-01

    Mercury-resistant (Hg R ) bacteria occur in various bacterial species from a wide variety of environmental sources. Resistance is conferred by a set of operon genes termed the mer operon. Many Hg R bacteria have been isolated from diverse environments and clinical samples, and it is recognized that mer operons are often localized on transposons. Previous research reports have suggested that Hg R transposons participate in the horizontal gene transfer of mer operons among bacteria. This was confirmed by a study that found that mer operons were distributed worldwide in Bacilli with dissemination of TnMERI1-like transposons. In this mini review, possible strategies for transposon-mediated in situ molecular breeding (ISMoB) of Hg R bacteria in their natural habitat are discussed. In ISMoB, the target microorganisms for breeding are indigenous bacteria that are not Hg R but that are dominant and robust in their respective environments. Additionally, we propose a new concept of bioremediation technology for environmental mercury pollution by applying transposon-mediated ISMoB for environmental mercury pollution control.

  15. Localized surface plasmon resonance mercury detection system and methods

    Science.gov (United States)

    James, Jay; Lucas, Donald; Crosby, Jeffrey Scott; Koshland, Catherine P.

    2016-03-22

    A mercury detection system that includes a flow cell having a mercury sensor, a light source and a light detector is provided. The mercury sensor includes a transparent substrate and a submonolayer of mercury absorbing nanoparticles, e.g., gold nanoparticles, on a surface of the substrate. Methods of determining whether mercury is present in a sample using the mercury sensors are also provided. The subject mercury detection systems and methods find use in a variety of different applications, including mercury detecting applications.

  16. Mercury Toolset for Spatiotemporal Metadata

    Science.gov (United States)

    Devarakonda, Ranjeet; Palanisamy, Giri; Green, James; Wilson, Bruce; Rhyne, B. Timothy; Lindsley, Chris

    2010-06-01

    Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily)harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.

  17. Mercury Toolset for Spatiotemporal Metadata

    Science.gov (United States)

    Wilson, Bruce E.; Palanisamy, Giri; Devarakonda, Ranjeet; Rhyne, B. Timothy; Lindsley, Chris; Green, James

    2010-01-01

    Mercury (http://mercury.ornl.gov) is a set of tools for federated harvesting, searching, and retrieving metadata, particularly spatiotemporal metadata. Version 3.0 of the Mercury toolset provides orders of magnitude improvements in search speed, support for additional metadata formats, integration with Google Maps for spatial queries, facetted type search, support for RSS (Really Simple Syndication) delivery of search results, and enhanced customization to meet the needs of the multiple projects that use Mercury. It provides a single portal to very quickly search for data and information contained in disparate data management systems, each of which may use different metadata formats. Mercury harvests metadata and key data from contributing project servers distributed around the world and builds a centralized index. The search interfaces then allow the users to perform a variety of fielded, spatial, and temporal searches across these metadata sources. This centralized repository of metadata with distributed data sources provides extremely fast search results to the user, while allowing data providers to advertise the availability of their data and maintain complete control and ownership of that data. Mercury periodically (typically daily) harvests metadata sources through a collection of interfaces and re-indexes these metadata to provide extremely rapid search capabilities, even over collections with tens of millions of metadata records. A number of both graphical and application interfaces have been constructed within Mercury, to enable both human users and other computer programs to perform queries. Mercury was also designed to support multiple different projects, so that the particular fields that can be queried and used with search filters are easy to configure for each different project.

  18. The Mercury Laser Advances Laser Technology for Power Generation

    Energy Technology Data Exchange (ETDEWEB)

    Ebbers, C A; Caird, J; Moses, E

    2009-01-21

    The National Ignition Facility (NIF) at Lawrence Livermore Laboratory is on target to demonstrate 'breakeven' - creating as much fusion-energy output as laser-energy input. NIF will compress a tiny sphere of hydrogen isotopes with 1.8 MJ of laser light in a 20-ns pulse, packing the isotopes so tightly that they fuse together, producing helium nuclei and releasing energy in the form of energetic particles. The achievement of breakeven will culminate an enormous effort by thousands of scientists and engineers, not only at Livermore but around the world, during the past several decades. But what about the day after NIF achieves breakeven? NIF is a world-class engineering research facility, but if laser fusion is ever to generate power for civilian consumption, the laser will have to deliver pulses nearly 100,000 times faster than NIF - a rate of perhaps 10 shots per second as opposed to NIF's several shots a day. The Mercury laser (named after the Roman messenger god) is intended to lead the way to a 10-shots-per-second, electrically-efficient, driver laser for commercial laser fusion. While the Mercury laser will generate only a small fraction of the peak power of NIF (1/30,000), Mercury operates at higher average power. The design of Mercury takes full advantage of the technology advances manifest in its behemoth cousin (Table 1). One significant difference is that, unlike the flashlamp-pumped NIF, Mercury is pumped by highly efficient laser diodes. Mercury is a prototype laser capable of scaling in aperture and energy to a NIF-like beamline, with greater electrical efficiency, while still running at a repetition rate 100,000 times greater.

  19. Targeted Therapies in Endometrial Cancer

    Directory of Open Access Journals (Sweden)

    Selen Dogan

    2014-04-01

    Full Text Available Endometrial cancer is the most common genital cancer in developed world. It is generally diagnosed in early stage and it has a favorable prognosis. However, advanced staged disease and recurrences are difficult to manage. There are some common genetic alterations related to endometrial carcinogenesis in similar fashion to other cancers. Personalized medicine, which means selection of best suited treatment for an individual, has gain attention in clinical care of patients in recent years. Targeted therapies were developed as a part of personalized or %u201Ctailored%u201D medicine and specifically acts on a target or biologic pathway. There are quite a number of molecular alteration points in endometrial cancer such as PTEN tumor suppressor genes, DNA mismatch repair genes, PI3K/AKT/mTOR pathway and p53 oncogene which all might be potential candidates for tailored targeted therapy. In recent years targeted therapies has clinical application in ovarian cancer patients and in near future with the advent of new agents these %u201Ctailored%u201D drugs will be in market for routine clinical practice in endometrial cancer patients, in primary disease and recurrences as well.

  20. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2005-06-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to

  1. Autometallographic tracing of mercury in frog liver

    International Nuclear Information System (INIS)

    Loumbourdis, N.S.; Danscher, G.

    2004-01-01

    The distribution of mercury in the liver of the frog Rana ridibunda with the autometallographic method was investigated. The mercury specific autometallographic (HgS/Se AMG ) technique is a sensitive histochemical approach for tracing mercury in tissues from mercury-exposed organisms. Mercury accumulates in vivo as mercury sulphur/mercury selenium nanocrystals that can be silver-enhanced. Thus, only a fraction of the Hg can be visualized. Six animals were exposed for one day and another group of six animals for 6 days in 1 ppm mercury (as HgCI 2 ) dissolved in fresh water. A third group of six animals, served as controls, were sacrificed the day of arrival at the laboratory. First, mercury appears in the blood plasma and erythrocytes. Next, mercury moves to hepatocytes and in the apical part of the cells, that facing bile canaliculi. In a next step, mercury appears in the endothelial and Kupffer cells. It seems likely that, the mercury of hepatocytes moves through bile canaliculi to the gut, most probably bound to glutathione and/or other similar ligands. Most probably, the endothelial and Kupffer cells comprise the first line of defense against metal toxicity. - Frogs can be good bioindicators of mercury

  2. Mercury: Aspects of its ecology and environmental toxicity. [physiological effects of mercury compound contamination of environment

    Science.gov (United States)

    Siegel, S. M.

    1973-01-01

    A study was conducted to determine the effects of mercury pollution on the environment. The possible sources of mercury contamination in sea water are identified. The effects of mercury on food sources, as represented by swordfish, are analyzed. The physiological effects of varying concentrations of mercury are reported. Emphasis is placed on the situation existing in the Hawaiian Islands.

  3. Groundwater Modeling Of Mercury Pollution At A Former Mercury Cell Chlor Alkali Facility In Pavoldar, Kazakhstan

    Science.gov (United States)

    In Kazakhstan, there is a serious case of mercury pollution near the city of Pavlodar from an old mercury cell chlor-alkali plant. The soil, sediment, and water is severly contaminated with mercury and mercury compounds as a result of the industrial activity of this chemical pla...

  4. Bayesian analysis of stress thallium-201 scintigraphy

    International Nuclear Information System (INIS)

    The variation of the diagnostic value of stress T1-201 scintigraphy with prevalence of coronary heart disease (CHD) in the population has been investigated using Bayesian reasoning. From scintigraphic and arteriographic data obtained in 100 consecutive patients presenting with chest pain, the sensitivity of stress T1-201 scintigraphy for the detection of significant CHD was 90% and the specificity was 88%. From Bayes' Theorem, the posterior probability of having CHD for a given test result was calculated for prevalences of CHD ranging from 1% to 99%. the discriminant value of stress T1-201 scintigraphy was best when the prevalence of CHD lay between 30% and 70% and maximum for a prevalence of 52%. Thus, stress T1-201 scintigraphy would be an unsuitable diagnostic test where the prior probability of CHD is low, e.g., population screening programmes, and would add little where the clinical probability of having CHD is intermediate stress T1-201 scintigraphy may provide valuable diagnostic information. (orig.)

  5. Evaluation of Energy Consumption in the Mercury Treatment of Phosphor Powder from Spent Fluorescent Lamps Using a Thermal Process

    Directory of Open Access Journals (Sweden)

    Yong Choi

    2017-11-01

    Full Text Available In a pilot-plant-scale thermal mercury treatment of phosphor powder from spent fluorescent lamps, energy consumption was estimated to control mercury content by the consideration of reaction kinetics. Mercury content was analyzed as a function of treatment temperature and time. The initial mercury content of the phosphor powder used in the thermal process was approximately 3500 mg/kg. The target mercury content in the phosphor powder thermal process of the phosphor powder was 5 mg/kg or less at 400 °C or higher because the target mercury content was recommended by Minamata Convention and Basel Convention. During thermal processing, the reaction rate was represented by a first order reaction with the Arrhenius equation. The reaction rate constant increased with temperature from 0.0112 min−1 at 350 °C to 0.0558 min−1 at 600 °C. The frequency factor was 2.51 min−1, and the activation energy was 6509.11 kcal/kg. Reaction rate constants were used to evaluate the treatment time required to reduce mercury content in phosphor powder to be less than 5 mg/kg. The total energy consumption in a pilot-plant-scale thermal process was evaluated to determine the optimal temperature for removing mercury in phosphor powder.

  6. Sorption of mercury on chemically synthesized polyaniline

    International Nuclear Information System (INIS)

    Remya Devi, P.S.; Verma, R.; Sudersanan, M.

    2006-01-01

    Sorption of inorganic mercury (Hg 2+ ) and methyl mercury, on chemically synthesized polyaniline, in 0.1-10N HCl solutions has been studied. Hg 2+ is strongly sorbed at low acidities and the extent of sorption decreases with increase in acidity. The sorption of methyl mercury is very low in the HCl concentration range studied. Sorption of Hg 2+ on polyaniline in 0.1-10N LiCl and H 2 SO 4 solutions has also been studied. The analysis of the data indicates that the sorption of Hg 2+ depends on the degree of protonation of polyaniline and the nature of mercury(II) chloride complexes in solution. X-ray photoelectron spectroscopy analysis (XPS) of polyaniline sorbed with mercury show that mercury is bound as Hg 2+ . Sorbed mercury is quantitatively eluted from polyaniline with 0.5N HNO 3 . Polyaniline can be used for separation and pre-concentration of inorganic mercury from aqueous samples. (author)

  7. EPA Leadership in the Global Mercury Partnership

    Science.gov (United States)

    The Global Mercury Partnership is a voluntary multi-stakeholder partnership initiated in 2005 to take immediate actions to protect human health and the environment from the releases of mercury and its compounds to the environment.

  8. Mercury-Containing Devices and Demolition

    Science.gov (United States)

    Some items inside residential buildings contain mercury, which poses a persistent and toxic human health and environmental threat. These materials should be carefully salvaged for proper recycling to prevent mercury contamination prior to demolition.

  9. Health Effects of Exposures to Mercury

    Science.gov (United States)

    ... Mercury in Your Environment Contact Us Share Health Effects of Exposures to Mercury Related Health Information for ... About PDF ; discussion starts on page 20) Methylmercury Effects Effects on People of All Ages Exposure to ...

  10. The effect of longterm exposure to mercury on the bacterial community in marine sediment

    DEFF Research Database (Denmark)

    Rasmussen, Lasse Dam; Sørensen, Søren Johannes

    1998-01-01

    Mercury pollution, bacteria, diversity, mercury resistance, antibiotic resistance, plasmid abundance......Mercury pollution, bacteria, diversity, mercury resistance, antibiotic resistance, plasmid abundance...

  11. Method for the removal and recovery of mercury

    Science.gov (United States)

    Easterly, Clay E.; Vass, Arpad A.; Tyndall, Richard L.

    1997-01-01

    The present invention is an enhanced method for the removal and recovery of mercury from mercury-contaminated matrices. The method involves contacting a mercury-contaminated matrix with an aqueous dispersant solution derived from specific intra-amoebic isolates to release the mercury from the mercury-contaminated matrix and emulsify the mercury; then, contacting the matrix with an amalgamating metal from a metal source to amalgamate the mercury to the amalgamating metal; removing the metallic source from the mercury-contaminated matrix; and heating the metallic source to vaporize the mercury in a closed system to capture the mercury vapors.

  12. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2004-12-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems.

  13. Mercury Continuous Emmission Monitor Calibration

    Energy Technology Data Exchange (ETDEWEB)

    John Schabron; Eric Kalberer; Ryan Boysen; William Schuster; Joseph Rovani

    2009-03-12

    Mercury continuous emissions monitoring systems (CEMs) are being implemented in over 800 coal-fired power plant stacks throughput the U.S. Western Research Institute (WRI) is working closely with the Electric Power Research Institute (EPRI), the National Institute of Standards and Technology (NIST), and the Environmental Protection Agency (EPA) to facilitate the development of the experimental criteria for a NIST traceability protocol for dynamic elemental mercury vapor calibrators/generators. These devices are used to calibrate mercury CEMs at power plant sites. The Clean Air Mercury Rule (CAMR) which was published in the Federal Register on May 18, 2005 and vacated by a Federal appeals court in early 2008 required that calibration be performed with NIST-traceable standards. Despite the vacature, mercury emissions regulations in the future will require NIST traceable calibration standards, and EPA does not want to interrupt the effort towards developing NIST traceability protocols. The traceability procedures will be defined by EPA. An initial draft traceability protocol was issued by EPA in May 2007 for comment. In August 2007, EPA issued a conceptual interim traceability protocol for elemental mercury calibrators. The protocol is based on the actual analysis of the output of each calibration unit at several concentration levels ranging initially from about 2-40 {micro}g/m{sup 3} elemental mercury, and in the future down to 0.2 {micro}g/m{sup 3}, and this analysis will be directly traceable to analyses by NIST. The EPA traceability protocol document is divided into two separate sections. The first deals with the qualification of calibrator models by the vendors for use in mercury CEM calibration. The second describes the procedure that the vendors must use to certify the calibrators that meet the qualification specifications. The NIST traceable certification is performance based, traceable to analysis using isotope dilution inductively coupled plasma

  14. Mercury detection with thermal neutrons

    International Nuclear Information System (INIS)

    Bell, Z.W.

    1994-01-01

    This report describes the work performed to design a gauge to detect mercury concealed within walls, floors, pipes, and equipment inside a building. The project arose out of a desire to decontaminate and decommission (D ampersand D) a building in which mercury had been used as part of a chemical process. The building contains plumbing and equipment, some with residual mercury even after draining, sumps, and hollow walls. So that releases of mercury to the environment might be minimized during D ampersand D activities, it was considered advisable to locate pockets of mercury that may have collected in concealed spaces so that they might be drained in a controlled fashion prior to the application of the wrecking ball or sledge hammer. The detection of such pockets within a building presents some problems not ordinarily encountered in a laboratory environment. Often, only a single side of a wall or pipe is accessible. This condition disqualifies transmission gauges (such as conventional x radiography) in which a probe is sent through the volume under test (VUT) from one side and its passage or attenuation is detected on the opposite side. A robust, one-sided system was needed

  15. Mercury bioaccumulation in the Mediterranean

    Directory of Open Access Journals (Sweden)

    Cinnirella S.

    2013-04-01

    Full Text Available This study details mercury pollution within the food chain of the Mediterranean by analysing the most comprehensive mercury dataset available for biota and water measurements. In this study we computed a bioaccumulation factor (BAF for datasets in the existing mercury-related scientific literature, in on-going programs, and in past measurement campaigns. Preliminary results indicate a major lack of information, making the outcome of any assessment very uncertain. Importantly, not all marine eco-regions are (or have ever been covered by measurement campaigns. Most lacking is information associated with the South-Eastern part of the Mediterranean, and in several eco-regions it is still impossible to reconstruct a trophic net, as the required species were not accounted for when mercury measurements were taken. The datasets also have additional temporal sampling problems, as species were often not sampled systematically (but only sporadically during any given sampling period. Moreover, datasets composed of mercury concentrations in water also suffer from similar geographic limitations, as they are concentrated in the North-Western Mediterranean. Despite these concerns, we found a very clear bioaccumulation trend in 1999, the only year where comprehensive information on both methylmercury concentrations in water and biota was available.

  16. Studies on 201Th myocardial scintiscanning

    International Nuclear Information System (INIS)

    Buchner, U.

    1979-01-01

    The diagnostical evidence of myocardial scintiscanning with thallium-201 was tested on 98 patients with coronary heart disease. 2 mCi thallium-201 were injected into an arm vene and then scintigrams of the heart were registered partly with a scanner, partly with a gamma camera in several views. The healthy myocardium was found in the thallium-201-scintigram to be a rather homogeneous, horeshoe-shaped activity pattern with intramyocardial activity differences of up to 20% of the maximal thallium-201-activity above the myocard which can be declared to be physiological. In dependency on the local blood flow conditions, thallium-201 is stored only in the healthy, but not in the ischaemic or infarcted myocardium. In the scintigram, these regions are seen as regions with reduced radioactivity. A comparison of the localisation of the infarction in the scintigram with those in the electrocardiagram and coronary angiogram showed a good congrucucy. Scintigrams taken at different times after the infarction brought a decrease in the number of diagnosed storage failures, from 90% to 68% in infarctions older than 6 weeks. A scintigraphical differentiation between fresh and old infarctions was not possible. In cases of angiographically established coronary heart disease without infarction, pathological storage reductions were observed. By comparing the findings obtained by scintiscanning with the results of laevocardiography it was seen that hypokinetic regions in the thallium-201-myocardial scintigram showed in only 6% of the cases a pathological storage defect; akinetic, dyskinetic, and aneurysmatic regions, however, were seen in 65% of the cases as clear activity reductions or failures. (orig./MG) [de

  17. Mineral resource of the month: mercury

    Science.gov (United States)

    ,

    2012-01-01

    The article offers information on mercury, a mineral commodity used in industrial and small-scale gold mining applications. Mercury has been reported to be used for amalgamation with gold since the Roman times. Mercury from cinnabar from Almadén, Spain has been used by Romans and has been continued to be used through the Middle Ages and the Colonial era.

  18. 40 CFR 721.10068 - Elemental mercury.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Elemental mercury. 721.10068 Section... Substances § 721.10068 Elemental mercury. (a) Definitions. The definitions in § 721.3 apply to this section... elemental mercury (CAS. No. 7439-97-6) is subject to reporting under this section for the significant new...

  19. 47 CFR 2.201 - Emission, modulation, and transmission characteristics.

    Science.gov (United States)

    2010-10-01

    ... characteristics. 2.201 Section 2.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL FREQUENCY..., and transmission characteristics. The following system of designating emission, modulation, and transmission characteristics shall be employed. (a) Emissions are designated according to their classification...

  20. Current and future levels of mercury atmospheric pollution on a global scale

    Science.gov (United States)

    Pacyna, Jozef M.; Travnikov, Oleg; De Simone, Francesco; Hedgecock, Ian M.; Sundseth, Kyrre; Pacyna, Elisabeth G.; Steenhuisen, Frits; Pirrone, Nicola; Munthe, John; Kindbom, Karin

    2016-10-01

    research instrument for supporting the scientific justification for the Minamata Convention and monitoring of the implementation of targets of this convention, as well as the EU Mercury Strategy. This project provided the state of the art with regard to the development of the latest emission inventories for mercury, future emission scenarios, dispersion modelling of atmospheric mercury on a global and regional scale, and source-receptor techniques for mercury emission apportionment on a global scale.

  1. Current and future levels of mercury atmospheric pollution on a global scale

    Directory of Open Access Journals (Sweden)

    J. M. Pacyna

    2016-10-01

    proved to be a very important research instrument for supporting the scientific justification for the Minamata Convention and monitoring of the implementation of targets of this convention, as well as the EU Mercury Strategy. This project provided the state of the art with regard to the development of the latest emission inventories for mercury, future emission scenarios, dispersion modelling of atmospheric mercury on a global and regional scale, and source–receptor techniques for mercury emission apportionment on a global scale.

  2. How Tiny Collisions Shape Mercury

    Science.gov (United States)

    Kohler, Susanna

    2017-07-01

    If space rocks are unpleasant to encounter, space dust isnt much better. Mercurys cratered surface tells of billions of years of meteoroid impacts but its thin atmosphere is what reveals its collisional history with smaller impactors. Now new research is providing a better understanding of what were seeing.Micrometeoroids Ho!The inner solar system is bombarded by micrometeoroids, tiny particles of dust (on the scale of a tenth of a millimeter) emitted by asteroids and comets as they make their closest approach to the Sun. This dust doesnt penetrateEarths layers of atmosphere, but the innermost planet of our solar system, Mercury, doesnt have this convenient cushioning.Just as Mercury is affected by the impacts of large meteoroids, its also shaped by the many smaller-scale impacts it experiences. These tiny collisions are thought to vaporize atoms and molecules from the planets surface, which quickly dissociate. This process adds metals to Mercurys exosphere, the planets extremely tenuous atmosphere.Modeling PopulationsDistribution of the directions from which meteoroids originate before impacting Mercurys surface, as averaged over its entire orbit. Local time of 12 hr corresponds to the Sun-facing side. A significant asymmetry is seen between the dawn (6 hrs) and dusk (18 hrs) rates. [Pokorn et al. 2017]The metal distribution in the exosphere provides a way for us to measure the effect of micrometeoroid impacts on Mercury but this only works if we have accurate models of the process. A team of scientists led by Petr Pokorn (The Catholic University of America and NASA Goddard SFC) has now worked to improve our picture of micrometeoroid impact vaporization on Mercury.Pokorn and collaborators argue that two meteoroid populations Jupiter-family comets (short-period) and Halley-type comets (long-period) contribute the dust for the majority of micrometeoroid impacts on Mercury. The authors model the dynamics and evolution of these two populations, reproducing the

  3. Control of mercury emissions: policies, technologies, and future trends

    OpenAIRE

    Rhee, Seung-Whee

    2015-01-01

    Seung-Whee Rhee Department of Environmental Engineering, Kyonggi University, Suwon, Republic of Korea Abstract: Owing to the Minamata Convention on Mercury and the Global Mercury Partnership, policies and regulations on mercury management in advanced countries were intensified by a mercury phaseout program in the mercury control strategy. In developing countries, the legislative or regulatory frameworks on mercury emissions are not established specifically, but mercury management is designed...

  4. Canadian mercury inventories: the missing pieces

    Energy Technology Data Exchange (ETDEWEB)

    Hagreen, L.A.; Lourie, B.A. [Summerhill Group, Toronto, ON (Canada)

    2004-07-01

    Research was conducted to determine the significance of the deliberate use of mercury in products in Canada and the associated releases from these sources. Through a combination of literature review and new calculations, the reservoir, flux, and releases of mercury from eight product sources were calculated, and these results compared to historical Canadian inventories. Mercury contributions from the waste sector were also assessed and compared to total Canadian mercury releases and to mercury releases from coal-fired generating stations. Results suggest the use and release of mercury associated with its use in products is 4.5 times what previous inventories indicate. Including dental amalgam and sewage sludge, the total releases of mercury to all environmental compartments in Canada totals 20 tonnes per year. This accounts for less than one-half of the 44 tonnes per year of mercury released from mercury waste disposal each year in Canada. Waste mercury contributions from hazardous waste imports, unknown product sources, and incomplete information on the use of mercury in known products may account for this discrepancy. Waste-related mercury releases and transfers for disposal and recycling are 11 times greater than that of electricity generation in Canada. Results indicate that Canadian inventories have underestimated the significance of mercury use and release associated with products, calling into question the current priorities for mercury management. This paper was developed as part of a panel session at the International Joint Commission 'Mercury in the Ecosystem' workshop, February 26-27, 2003, Windsor, ON, Canada, as a complement to the information on Canadian Inventories presented by Luke Trip (Senes Consulting, Ottawa, ON, Canada).

  5. Global Sources and Pathways of Mercury in the Context of Human Health

    Science.gov (United States)

    Sundseth, Kyrre; Pacyna, Jozef M.; Pacyna, Elisabeth G.; Pirrone, Nicola; Thorne, Rebecca J.

    2017-01-01

    This paper reviews information from the existing literature and the EU GMOS (Global Mercury Observation System) project to assess the current scientific knowledge on global mercury releases into the atmosphere, on global atmospheric transport and deposition, and on the linkage between environmental contamination and potential impacts on human health. The review concludes that assessment of global sources and pathways of mercury in the context of human health is important for being able to monitor the effects from implementation of the Minamata Convention targets, although new research is needed on the improvement of emission inventory data, the chemical and physical behaviour of mercury in the atmosphere, the improvement of monitoring network data, predictions of future emissions and speciation, and on the subsequent effects on the environment, human health, as well as the economic costs and benefits of reducing these aspects. PMID:28117743

  6. Global Sources and Pathways of Mercury in the Context of Human Health

    Directory of Open Access Journals (Sweden)

    Kyrre Sundseth

    2017-01-01

    Full Text Available This paper reviews information from the existing literature and the EU GMOS (Global Mercury Observation System project to assess the current scientific knowledge on global mercury releases into the atmosphere, on global atmospheric transport and deposition, and on the linkage between environmental contamination and potential impacts on human health. The review concludes that assessment of global sources and pathways of mercury in the context of human health is important for being able to monitor the effects from implementation of the Minamata Convention targets, although new research is needed on the improvement of emission inventory data, the chemical and physical behaviour of mercury in the atmosphere, the improvement of monitoring network data, predictions of future emissions and speciation, and on the subsequent effects on the environment, human health, as well as the economic costs and benefits of reducing these aspects.

  7. Sodium Velocity Maps on Mercury

    Science.gov (United States)

    Potter, A. E.; Killen, R. M.

    2011-01-01

    The objective of the current work was to measure two-dimensional maps of sodium velocities on the Mercury surface and examine the maps for evidence of sources or sinks of sodium on the surface. The McMath-Pierce Solar Telescope and the Stellar Spectrograph were used to measure Mercury spectra that were sampled at 7 milliAngstrom intervals. Observations were made each day during the period October 5-9, 2010. The dawn terminator was in view during that time. The velocity shift of the centroid of the Mercury emission line was measured relative to the solar sodium Fraunhofer line corrected for radial velocity of the Earth. The difference between the observed and calculated velocity shift was taken to be the velocity vector of the sodium relative to Earth. For each position of the spectrograph slit, a line of velocities across the planet was measured. Then, the spectrograph slit was stepped over the surface of Mercury at 1 arc second intervals. The position of Mercury was stabilized by an adaptive optics system. The collection of lines were assembled into an images of surface reflection, sodium emission intensities, and Earthward velocities over the surface of Mercury. The velocity map shows patches of higher velocity in the southern hemisphere, suggesting the existence of sodium sources there. The peak earthward velocity occurs in the equatorial region, and extends to the terminator. Since this was a dawn terminator, this might be an indication of dawn evaporation of sodium. Leblanc et al. (2008) have published a velocity map that is similar.

  8. 27 CFR 26.201 - Products exempt from tax.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Products exempt from tax. 26.201 Section 26.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Coming Into the United States From the Virgin Islands § 26.201 Products exempt from tax. (a) General...

  9. 46 CFR 201.117 - Inclusion in record.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...

  10. 7 CFR 1494.201 - Definitions of terms.

    Science.gov (United States)

    2010-01-01

    ... high value agricultural product. For purposes of this definition, fish entirely produced in the United... 7 Agriculture 10 2010-01-01 2010-01-01 false Definitions of terms. 1494.201 Section 1494.201... Program Operations § 1494.201 Definitions of terms. Terms used in this subpart, Invitations issued...

  11. 5 CFR 250.201 - Coverage and purpose.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Coverage and purpose. 250.201 Section 250.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.201 Coverage and purpose. The Chief Human...

  12. 14 CFR 1203.201 - Information security objectives.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Information security objectives. 1203.201 Section 1203.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM NASA Information Security Program § 1203.201 Information security objectives. The objectives of...

  13. 7 CFR 201.13 - Lot number or other identification.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Lot number or other identification. 201.13 Section 201... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.13 Lot number or other identification. The lot number or other identification shall be shown on the label and shall be the same as that...

  14. 7 CFR 868.201 - Definition of rough rice.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of rough rice. 868.201 Section 868.201... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Rough Rice Terms Defined § 868.201 Definition of rough rice. Rice (Oryza sativa L.) which consists of 50 percent or more of paddy kernels (see...

  15. 46 CFR 201.6 - Documents in foreign languages.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Documents in foreign languages. 201.6 Section 201.6... PRACTICE AND PROCEDURE General Information (Rule 1) § 201.6 Documents in foreign languages. Every document, exhibit, or other paper written in a language other than English and filed with the Administration or...

  16. 17 CFR 201.460 - Record before the Commission.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Record before the Commission. 201.460 Section 201.460 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice Appeal to the Commission and Commission Review § 201.460 Record before the...

  17. 21 CFR 201.61 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms of...

  18. 45 CFR 201.11 - Personnel merit system review.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Personnel merit system review. 201.11 Section 201... STATES FOR PUBLIC ASSISTANCE PROGRAMS Review and Audits § 201.11 Personnel merit system review. A personnel merit system review is carried out by the Office of State Merit Systems of the Office of the...

  19. 27 CFR 20.201 - Liability and responsibility of carrier.

    Science.gov (United States)

    2010-04-01

    ... Losses § 20.201 Liability and responsibility of carrier. (a) A person or carrier transporting specially... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Liability and responsibility of carrier. 20.201 Section 20.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX...

  20. 7 CFR 766.201 - Shared Appreciation Agreement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Shared Appreciation Agreement. 766.201 Section 766.201 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN SERVICING-SPECIAL Servicing Shared Appreciation Agreements and Net Recovery Buyout Agreements § 766.201...

  1. 49 CFR 179.201-9 - Gauging device.

    Science.gov (United States)

    2010-10-01

    ... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.201-9 Gauging device. A gauging device of an approved design must be applied to permit determining the liquid level of the lading... 49 Transportation 2 2010-10-01 2010-10-01 false Gauging device. 179.201-9 Section 179.201-9...

  2. 19 CFR 201.5 - Attendance fees and mileage.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Attendance fees and mileage. 201.5 Section 201.5 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Miscellaneous § 201.5 Attendance fees and mileage. (a) Deponents and witnesses. Any person compelled to appear...

  3. 46 CFR 201.8 - Use of gender and number.

    Science.gov (United States)

    2010-10-01

    ... PROCEDURE General Information (Rule 1) § 201.8 Use of gender and number. Words importing the singular number may extend and be applied to several persons or things; words importing the plural number may include... 46 Shipping 8 2010-10-01 2010-10-01 false Use of gender and number. 201.8 Section 201.8 Shipping...

  4. 37 CFR 201.25 - Visual Arts Registry.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Visual Arts Registry. 201.25 Section 201.25 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.25 Visual Arts Registry. (a) General. This section prescribes the procedures relating to the submission...

  5. 46 CFR 201.144 - Offer of proof.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof. ...

  6. 49 CFR 234.201 - Location of plans.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Location of plans. 234.201 Section 234.201..., Inspection, and Testing Maintenance Standards § 234.201 Location of plans. Plans required for proper maintenance and testing shall be kept at each highway-rail grade crossing warning system location. Plans shall...

  7. 46 CFR 201.183 - Ex parte communications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Ex parte communications. 201.183 Section 201.183... PRACTICE AND PROCEDURE Judicial Standards of Practice (Rule 19) § 201.183 Ex parte communications. (a) Requests for expeditious treatment of matters pending with the Administration are deemed communications on...

  8. 30 CFR 77.201 - Methane content in surface installations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Methane content in surface installations. 77.201 Section 77.201 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL... UNDERGROUND COAL MINES Surface Installations § 77.201 Methane content in surface installations. The methane...

  9. 48 CFR 450.201 - Delegation of authority.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Delegation of authority. 450.201 Section 450.201 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE CONTRACT MANAGEMENT EXTRAORDINARY CONTRACTUAL ACTIONS Delegation of and Limitations on Exercise of Authority 450.201 Delegation of authority. The Assistant...

  10. 33 CFR 401.201 - Delegation of authority.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Delegation of authority. 401.201 Section 401.201 Navigation and Navigable Waters SAINT LAWRENCE SEAWAY DEVELOPMENT CORPORATION, DEPARTMENT OF TRANSPORTATION SEAWAY REGULATIONS AND RULES Assessment, Mitigation or Remission of Penalties § 401.201 Delegation of authority. (a) The...

  11. 7 CFR 201.54 - Number of seeds for germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Number of seeds for germination. 201.54 Section 201.54... REGULATIONS Germination Tests in the Administration of the Act § 201.54 Number of seeds for germination. At least 400 seeds shall be tested for germination; except that in mixtures, 200 seeds of each of those...

  12. 7 CFR 201.53 - Source of seeds for germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Source of seeds for germination. 201.53 Section 201.53... REGULATIONS Germination Tests in the Administration of the Act § 201.53 Source of seeds for germination. (a) When both purity and germination tests are required, seeds for germination shall be taken from the...

  13. 7 CFR 201.31a - Labeling treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling treated seed. 201.31a Section 201.31a..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling in General § 201.31a Labeling treated seed. (a) Contents of label. Any agricultural seed...

  14. 7 CFR 201.69 - Classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Classes of certified seed. 201.69 Section 201.69..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.69 Classes of certified seed. (a) Classes of certified seed are as follows...

  15. 7 CFR 201.64 - Pure live seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pure live seed. 201.64 Section 201.64 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.64 Pure live seed. The tolerance for pure live seed shall be determined by...

  16. 7 CFR 201.49 - Other crop seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Other crop seed. 201.49 Section 201.49 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.49 Other crop seed. (a) Seeds of plants...

  17. 7 CFR 201.47a - Seed unit.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed unit. 201.47a Section 201.47a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.47a Seed unit. The seed unit is the...

  18. 7 CFR 201.7a - Treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Treated seed. 201.7a Section 201.7a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Records for Agricultural and Vegetable Seeds § 201.7a Treated seed. The complete record for any...

  19. 7 CFR 201.24a - Inoculated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inoculated seed. 201.24a Section 201.24a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.24a Inoculated seed. Seed claimed to be inoculated shall be...

  20. SPET brain imaging with 201 diethyldithiocarbamate in acute ischaemic stroke

    NARCIS (Netherlands)

    de Bruïne, J. F.; Limburg, M.; van Royen, E. A.; Hijdra, A.; Hill, T. C.; van der Schoot, J. B.

    1990-01-01

    Thirty-five patients with acute ischaemic stroke were studied within 24 h after hospital admission with thallium 201 diethyldithiocarbamate single photon emission tomography (201Tl-DDC SPET) and X-ray computed tomography (CT). 201Tl-DDC is a non-redistributing agent that allows postponed imaging

  1. 21 CFR 201.60 - Principal display panel.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Principal display panel. 201.60 Section 201.60...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.60 Principal display panel. The term principal display panel, as it applies to over-the-counter drugs in package form and as used in...

  2. 7 CFR 201.52 - Noxious-weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit weight...

  3. 41 CFR 50-201.1101 - Minimum wages.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201... Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.1101 Minimum wages. Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by the...

  4. 17 CFR 201.67 - Applications by legal guardians.

    Science.gov (United States)

    2010-04-01

    ... guardians. 201.67 Section 201.67 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES... Securities Exchange Act of 1934 § 201.67 Applications by legal guardians. An application pursuant to this... information that may be subject to a bounty payment, or by the parent or guardian of such a person if that...

  5. 22 CFR 201.31 - Suppliers of commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suppliers of commodities. 201.31 Section 201.31 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO COMMODITY TRANSACTIONS FINANCED BY USAID Responsibilities of Suppliers § 201.31 Suppliers of commodities. (a) Performance...

  6. 22 CFR 201.11 - Eligibility of commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Eligibility of commodities. 201.11 Section 201... COMMODITY TRANSACTIONS FINANCED BY USAID Conditions Governing the Eligibility of Procurement Transactions for USAID Financing § 201.11 Eligibility of commodities. To qualify for USAID financing, a commodity...

  7. Apparatus for control of mercury

    Science.gov (United States)

    Downs, William; Bailey, Ralph T.

    2001-01-01

    A method and apparatus for reducing mercury in industrial gases such as the flue gas produced by the combustion of fossil fuels such as coal adds hydrogen sulfide to the flue gas in or just before a scrubber of the industrial process which contains the wet scrubber. The method and apparatus of the present invention is applicable to installations employing either wet or dry scrubber flue gas desulfurization systems. The present invention uses kraft green liquor as a source for hydrogen sulfide and/or the injection of mineral acids into the green liquor to release vaporous hydrogen sulfide in order to form mercury sulfide solids.

  8. Decommissioning and safety issues of liquid-mercury waste generated from high power spallation sources with particle accelerators

    CERN Document Server

    Chiriki, S; Odoj, R; Moormann, R; Hinssen, H. K; Bukaemskiy, A

    2009-01-01

    Large spallation sources are intended to be constructed in Europe (EURISOL nuclear physics facility and ESS-European Spallation Source). These facilities accumulate more than 20 metric tons of irradiated mercury in the target, which has to be treated as highly radioactive and chemo-toxic waste. Because solids are the only appropriate (immobile) form for this radiotoxic and toxic type of waste solidification is required for irradiated mercury. Our irradiation experimental studies on mercury waste revealed that mercury sulfide is a reasonable solid for disposal and shows larger stability in assumed accidents with water ingress in a repository compared to amalgams. For preparation of mercury sulfide a wet process is more suitable than a dry one. It is easier to perform under hot cell conditions and allows complete Hg-conversion. Embedding HgS in a cementitious matrix increases its stability.

  9. Coal fired flue gas mercury emission controls

    CERN Document Server

    Wu, Jiang; Pan, Weiguo; Pan, Weiping

    2015-01-01

    Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of

  10. Marine biogeochemistry of mercury

    International Nuclear Information System (INIS)

    Gill, G.A.

    1986-01-01

    Noncontaminating sample collection and handling procedures and accurate and sensitive analysis methods were developed to measure sub-picomolar Hg concentrations in seawater. Reliable and diagnostic oceanographic Hg distributions were obtained, permitting major processes governing the marine biogeochemistry of Hg to be identified. Mercury concentrations in the northwest Atlantic, central Pacific, southeast Pacific, and Tasman Sea ranged from 0.5 to 12 pM. Vertical Hg distributions often exhibited a maximum within or near the main thermocline. At similar depths, Hg concentrations in the northwest Atlantic Ocean were elevated compared to the N. Pacific Ocean. This pattern appears to result from a combination of enhanced supply of Hg to the northwest Atlantic by rainfall and scavenging removal along deep water circulation pathways. These observations are supported by geochemical steady-state box modelling which predicts a relatively short mean residence time for Hg in the oceans; demonstrating the reactive nature of Hg in seawater and precluding significant involvement in nutrient-type recyclic. Evidence for the rapid removal of Hg from seawater was obtained at two locations. Surface seawater Hg measurements along 160 0 W (20 0 N to 20 0 S) showed a depression in the equatorial upwelling area which correlated well with the transect region exhibiting low 234 Th/ 238 U activity ratios. This relationship implies that Hg will be scavenged and removed from surface seawater in biologically productive oceanic zones. Further, a broad minimum in the vertical distribution of Hg was observed to coincide with the intense oxygen minimum zone in the water column in coastal waters off Peru

  11. Natural stable isotopic compositions of mercury in aerosols and wet precipitations around a coal-fired power plant in Xiamen, southeast China

    Science.gov (United States)

    Huang, Shuyuan; Sun, Lumin; Zhou, Tingjin; Yuan, Dongxing; Du, Bing; Sun, Xiuwu

    2018-01-01

    In this study, samples of 18 wet precipitations (WPs) and 38 aerosols were collected around a coal-fired power plant (CFPP) located in Xiamen, southeast China, which was equipped with a seawater flue gas desulfurization system. Total particulate mercury (TPM) in aerosol samples, and total mercury (WP-TM), dissolved mercury (WP-DM) and particulate mercury (WP-PM) in WP samples were analyzed for the natural isotopic compositions of mercury. For the first time, both mass dependent fractionation (MDF) and mass independent fractionation of odd (odd-MIF) and even (even-MIF) isotopes of WP-DM and WP-PM were reported and discussed. Both WP-TM and TPM displayed negative MDF and slightly positive even-MIF. Negative odd-MIF was observed in TPM and WP-PM, whereas positive odd-MIF was observed in WP-TM and WP-DM. It was found that the mercury budget in WP-PM samples was mainly controlled by atmospheric particles. Potential sources of mercury in samples were identified via analysis of mercury isotopic signatures and meteorological data with the NOAA HYSPLIT model. The results showed that TPM and WP-PM in solid samples were homologous and the isotopic compositions of WP-TM depended on those of WP-DM. The ratios of Δ199Hg/Δ201Hg resulting from photochemical reactions and positive Δ200Hg values (from -0.06‰ to 0.27‰) in all samples indicated that the mercury coming from local emission of the CFPP together with long-distance transportation were the two main contributing sources.

  12. 41 CFR 50-201.102 - Overtime.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Overtime. 50-201.102... computed and paid under section 7 of the Fair Labor Standards Act of 1938, as amended. The basic hourly... the case of any employee employed as provided in section 7(b) of the Fair Labor Standards Act of 1938...

  13. 47 CFR 201.3 - Policy.

    Science.gov (United States)

    2010-10-01

    ... OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL EXECUTIVE POLICY § 201.3 Policy. (a..., disaster or national emergency or a need to preserve the neutrality of the U.S.) and (2) Wire... and recovery. (g) The Director of the Office of Science and Technology Policy will serve as the...

  14. 48 CFR 419.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... SMALL BUSINESS PROGRAMS Policies 419.201 General policy. It is the policy of USDA to provide maximum practicable contracting and subcontracting opportunities to small business (SB), small disadvantaged business (SDB), HUBZone small business, women-owned business (WOB), veteran-owned small business (VOSB), and...

  15. 48 CFR 1313.201 - General.

    Science.gov (United States)

    2010-10-01

    ... 1313.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACTING METHODS AND CONTRACT... General. DOC employees, other than warranted contracting officers, must be delegated micro-purchase authority by the designee set forth in CAM 1301.70 according to FAR 1.603-3(b), and must be trained pursuant...

  16. 7 CFR 1901.201 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... PROGRAM-RELATED INSTRUCTIONS Civil Rights Compliance Requirements § 1901.201 Purpose. This subpart... pursuant to Title VI of the Civil Rights Act of 1964, title VIII of the Civil Rights Act of 1968, Executive Order 11246 and the Equal Credit Opportunity Act of 1974, as they relate to the Farmers Home...

  17. 48 CFR 49.201 - General.

    Science.gov (United States)

    2010-10-01

    ....201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT... compensation is a matter of judgment and cannot be measured exactly. In a given case, various methods may be... strict accounting principles, is the heart of a settlement. (b) The primary objective is to negotiate a...

  18. 5 CFR 295.201 - General prohibition.

    Science.gov (United States)

    2010-01-01

    ... EMPLOYEES RELATING TO OFFICIAL INFORMATION AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 295.201 General prohibition. No employee may produce... demand or request without the prior, written approval of the General Counsel. ...

  19. 5 CFR 2608.201 - General prohibition.

    Science.gov (United States)

    2010-01-01

    ... OGE EMPLOYEES RELATING TO OFFICIAL INFORMATION AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 2608.201 General prohibition. No employee may produce... demand or request without the prior, written approval of the General Counsel. ...

  20. 10 CFR 1707.201 - General prohibition.

    Science.gov (United States)

    2010-01-01

    ... DEFENSE NUCLEAR FACILITIES SAFETY BOARD TESTIMONY BY DNFSB EMPLOYEES AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 1707.201 General prohibition. No... information in response to a demand or request without the prior, written approval of the General Counsel. ...

  1. 5 CFR 591.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Cost-of-Living Allowance and Post Differential-Nonforeign Areas § 591.201 Definitions. In this subpart... the BLS survey of the change of consumer prices over time. Cost-of-living allowance (COLA) means an... nonforeign area where living costs are substantially higher than in the Washington, DC, area. Cost-of-living...

  2. 48 CFR 241.201 - Policy.

    Science.gov (United States)

    2010-10-01

    ..., practices, and decisions of independent regulatory bodies as a matter of comity is not a substitute for the....201 Policy. (1) DoD, as a matter of comity, generally complies with the current regulations, practices, and decisions of independent regulatory bodies. This policy does not extend to nonindependent...

  3. 23 CFR 650.201 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS BRIDGES, STRUCTURES, AND HYDRAULICS Erosion and Sediment Control on Highway Construction Projects § 650.201 Purpose..., abatement of water pollution, and prevention of damage by sediment deposition from all construction projects...

  4. 48 CFR 2419.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ...-owned small businesses. (d) Each head of a contracting activity shall designate a small business...; (6) Advise such businesses with respect to the financial assistance available under existing laws and... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 2419.201 General policy. (c) The Director, Office of...

  5. 40 CFR 201.10 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... level emitted by rail cars and locomotives operated under the conditions specified, including the sound produced by refrigeration and air conditioning units which are an integral element of such equipment. The... Standards § 201.10 Applicability. The provisions of this subpart apply to all rail cars and all locomotives...

  6. 48 CFR 201.301 - Policy.

    Science.gov (United States)

    2010-10-01

    ... significant effect beyond the internal operating procedures of DoD or a significant cost or administrative... Logistics) (USD (AT&L)) approval for use of the policy, procedure, clause, or form (see 201.304(1)) must include an analysis of the public comments in the request for approval. ...

  7. 40 CFR 60.201 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...-Process Phosphoric Acid Plants § 60.201 Definitions. As used in this subpart, all terms not defined herein shall have the meaning given them in the Act and in subpart A of this part. (a) Wet-process phosphoric acid plant means any facility manufacturing phosphoric acid by reacting phosphate rock and acid. (b...

  8. 14 CFR 415.201 - General.

    Science.gov (United States)

    2010-01-01

    ... TRANSPORTATION LICENSING LAUNCH LICENSE Environmental Review § 415.201 General. An applicant shall provide the FAA with information for the FAA to analyze the environmental impacts associated with a proposed... Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA, 40 CFR parts 1500-1508...

  9. 7 CFR 97.201 - Protest proceedings.

    Science.gov (United States)

    2010-01-01

    ... PLANT VARIETY AND PROTECTION Protest Proceedings § 97.201 Protest proceedings. (a) Opposition shall be... affidavits and shall show the reason or reasons for opposing the application or certificate. The petition and accompanying papers shall be filed in duplicate. If it appears to an examiner that a variety involved in a...

  10. 24 CFR 100.201 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... definition: (a) Physical or mental impairment includes: (1) Any physiological disorder or condition, cosmetic... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Definitions. 100.201 Section 100... DISCRIMINATORY CONDUCT UNDER THE FAIR HOUSING ACT Prohibition Against Discrimination Because of Handicap § 100...

  11. 48 CFR 23.201 - Authorities.

    Science.gov (United States)

    2010-10-01

    ... PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Energy and Water Efficiency and Renewable Energy 23.201 Authorities. (a) Energy... U.S.C. 6901, et seq.). (b) National Energy Conservation Policy Act (42 U.S.C. 8253, 8259b, 8262g...

  12. 24 CFR 880.201 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) OFFICE OF THE ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND... SUPPORTIVE HOUSING FOR THE ELDERLY PROGRAM AND SECTION 811 SUPPORTIVE HOUSING FOR PERSONS WITH DISABILITIES... Requirements § 880.201 Definitions. Annual Contributions Contract (ACC). As defined in part 5 of this title...

  13. 5 CFR 630.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., examination, or treatment, or to the period of disability while the patient was receiving professional... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ABSENCE AND LEAVE Definitions and General Provisions for Annual and Sick Leave § 630.201 Definitions. (a) In section 6301(2)(iii) of...

  14. 48 CFR 201.404 - Class deviations.

    Science.gov (United States)

    2010-10-01

    ..., and the Defense Logistics Agency, may approve any class deviation, other than those described in 201...) Diminish any preference given small business concerns by the FAR or DFARS; or (D) Extend to requirements imposed by statute or by regulations of other agencies such as the Small Business Administration and the...

  15. 30 CFR 75.201 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.201 Definitions. Automated temporary roof support (ATRS) system. A device to provide temporary roof support from a location where the equipment operator is protected from roof falls. Pillar recovery. Any reduction in pillar size during retreat mining. ...

  16. Environmental contamination and risk assessment of mercury from a historic mercury mine located in southwestern China.

    Science.gov (United States)

    Li, Yonghua

    2013-02-01

    A field survey of mercury pollution in environmental media and human hair samples obtained from residents living in the area surrounding the Chatian mercury mine (CMM) of southwestern China was conducted to evaluate the health risks of mercury to local residents. The results showed that mine waste, and tailings in particular, contained high levels of mercury and that the maximum mercury concentration was 88.50 μg g(-1). Elevated mercury levels were also found in local surface water, paddy soil, and paddy grain, which may cause severe health problems. The mercury concentration of hair samples from the inhabitants of the CMM exceeded 1.0 μg g(-1), which is the limit recommended by the US EPA. Mercury concentrations in paddy soil were positively correlated with mercury concentrations in paddy roots, stalks, and paddy grains, which suggested that paddy soil was the major source of mercury in paddy plant tissue. The average daily dose (ADD) of mercury for local adults and preschool children via oral exposure reached 0.241 and 0.624 μg kg(-1) body weight per day, respectively, which is approaching or exceeds the provisional tolerable daily intake. Among the three oral exposure routes, the greatest contributor to the ADD of mercury was the ingestion of rice grain. Open-stacked mine tailings have resulted in heavy mercury contamination in the surrounding soil, and the depth of appreciable soil mercury concentrations exceeded 100 cm.

  17. Mercury accumulation plant Cyrtomium macrophyllum and its potential for phytoremediation of mercury polluted sites.

    Science.gov (United States)

    Xun, Yu; Feng, Liu; Li, Youdan; Dong, Haochen

    2017-12-01

    Cyrtomium macrophyllum naturally grown in 225.73 mg kg -1 of soil mercury in mining area was found to be a potential mercury accumulator plant with the translocation factor of 2.62 and the high mercury concentration of 36.44 mg kg -1 accumulated in its aerial parts. Pot experiments indicated that Cyrtomium macrophyllum could even grow in 500 mg kg -1 of soil mercury with observed inhibition on growth but no obvious toxic effects, and showed excellent mercury accumulation and translocation abilities with both translocation and bioconcentration factors greater than 1 when exposed to 200 mg kg -1 and lower soil mercury, indicating that it could be considered as a great mercury accumulating species. Furthermore, the leaf tissue of Cyrtomium macrophyllum showed high resistance to mercury stress because of both the increased superoxide dismutase activity and the accumulation of glutathione and proline induced by mercury stress, which favorited mercury translocation from the roots to the aerial parts, revealing the possible reason for Cyrtomium macrophyllum to tolerate high concentration of soil mercury. In sum, due to its excellent mercury accumulation and translocation abilities as well as its high resistance to mercury stress, the use of Cyrtomium macrophyllum should be a promising approach to remediating mercury polluted soils. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Mercury emission monitoring on municipal waste combustion

    International Nuclear Information System (INIS)

    Braun, H.; Gerig, A.

    1991-01-01

    In waste incineration, mercury is the only heavy metal to be released as a gas, mostly as mercury(II) chloride, because of its high volatility. Continuous emission monitoring is possible only when mercury occurs in its elemental form. This paper reports on various possibilities of converting Hg(II) into Hg(0) that has been studied and tested on a laboratory scale and in the TAMARA refuse incineration pilot facility. Continuous mercury emission measurement appears to be possible, provided mercury is converted in the flue gas condensate precipitated. The measuring results obtained on two municipal solid waste and on one sewage treatment sludge incineration plants show that the mercury monitor is a highly sensitive and selective continuously working instrument for mercury emission monitoring

  19. Fate of mercury in the Arctic (FOMA)

    DEFF Research Database (Denmark)

    Skov, H.; Christensen, J.; Asmund, G.

    This report is the final reporting of the project FONA, funded by the Danish Environmental Protection Agency with means from the MIKA/DANCEA funds for Environmental Support to the Arctic Region. The aim of the project is to study the intercompartment mercury transport chain in the arctic area. From...... atmospheric deposition of mercury on sea surfaces to uptake in marine organisms, bio-accumulation, and finally mercury levels in mammals. The studies in the project are focused on the behaviour of mercury during the spring period where special phenomena lead to an enhanced deposition of mercury in the Arctic...... environment, at a time where the marine ecosystem is particularly active. The studies also include a comprehensive time trend study of mercury in top carnivore species. Each of these studies contributes towards establishing the knowledge necessary to develop a general model for transport and uptake of mercury...

  20. Mercury in the environment : a review

    International Nuclear Information System (INIS)

    Goodarzi, F.

    2000-01-01

    Both geogenic and anthropogenic sources are responsible for the input of mercury into the environment. However, mercury comes mostly from geogenic sources and is found naturally in air, water and soil. Crustal degassing results in emission of mercury into the atmosphere. Mercury in water and soil is due mostly to input from sedimentary rocks. Mercury in lake sediments is related mainly to input by country rock and anthropogenic activities such as agriculture. The mercury content of coal is similar to or less than the amount found in the earths crust. Natural charcoal is also able to capture mercury at low temperature combustion. The amount of mercury emitted from the stack of coal-fired power plants is related to the nature of the milled coal and its mineralogical and elemental content. Mercury emissions originating from the combustion of coal from electric utility power plants are considered to be among the greatest contributors to global mercury air emissions. In order to quantify the impact the electric power industry has on the environment, information regarding mercury concentrations in coal and their speciation is needed. For this reason the author examined the behaviour of mercury in three coal samples ashed at increasing temperatures. Mercury removal from coal-fired power plants ranges from 10 to 50 per cent by fabric filters and 20 to 95 per cent by FGD systems. This data will help in regulating emissions of hazardous air pollutants from electric utility steam generating units and will potentially provide insight into the industry's contribution to the global mercury burden. 50 refs

  1. Mercury contamination in Khramulia (Capoeta capoeta) from the Cheshme Kile and Zarrin Gol Rivers in Iran and human health risk assessment.

    Science.gov (United States)

    Malvandi, Hassan; Sari, Abbas Esmaili; Aliabadian, Mansour

    2014-10-01

    Total mercury concentrations were determined in muscle tissue of Khramulia (Capoeta capoeta) captured in the Cheshme Kile and Zarrin Gol Rivers, Iran. In Cheshme Kile River, 49 fish samples were collected. The mean total mercury concentration in the muscles of C. capoeta from this area was 249 ng g(-1) dw. In Zarrin Gol River, where 62 fish samples were collected, the total mercury in muscles averaged 164 ng g(-1) dw. A significant difference was found between means of mercury in the rivers (p < 0.001). All samples from the two rivers had mean mercury concentrations below the maximum allowable limits for mercury set by the Food and Agriculture Organization, World Health Organization, Standardization Administration of China and Environmental Protection Agency. The results of this study indicate that the values of hazard target quotient and estimated weekly intake are low and represent a negligible risk for human health.

  2. Mercury biogeochemistry: Paradigm shifts, outstanding issues and research needs

    Science.gov (United States)

    Sonke, Jeroen E.; Heimbürger, Lars-Eric; Dommergue, Aurélien

    2013-05-01

    Half a century of mercury research has provided scientists and policy makers with a detailed understanding of mercury toxicology, biogeochemical cycling and past and future impacts on human exposure. The complexity of the global biogeochemical mercury cycle has led to repeated and ongoing paradigm shifts in numerous mercury-related disciplines and outstanding questions remain. In this review, we highlight some of the paradigm shifts and questions on mercury toxicity, the risks and benefits of seafood consumption, the source of mercury in seafood, and the Arctic mercury cycle. We see a continued need for research on mercury toxicology and epidemiology, for marine mercury dynamics and ecology, and for a closer collaboration between observational mercury science and mercury modeling in general. As anthropogenic mercury emissions are closely tied to the energy cycle (in particular coal combustion), mercury exposure to humans and wildlife are likely to persist unless drastic emission reductions are put in place.

  3. Novel methodology for the study of mercury methylation and reduction in sediments and water using 197Hg radiotracer

    International Nuclear Information System (INIS)

    Ribeiro Guevara, Sergio; Perez Catan, Soledad; Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena

    2007-01-01

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H 2 SO 4 or HCl were evaluated in freshwater sediments using 197 Hg radiotracer. Values obtained for the 197 Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of 197 Hg 2+ into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg 2+ contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg 2+ contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H 2 SO 4 method is recommended, since it is free from these interferences. 197 Hg radiotracer (T 1/2 = 2.673 d) has a production rate that is about 50 times higher than that of 203 Hg (T 1/2 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to 203 Hg when it is used it in short-term experiments and produced by the irradiation of 196 Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the 196 Hg isotope is increased, the specific activity of the 197 Hg tracer can be significantly improved. In the present work, 197 Hg tracer was produced from mercury 51.58% enriched in the 196 Hg

  4. Novel biomarkers of mercury-induced autoimmune dysfunction: a Cross-sectional study in Amazonian Brazil

    Science.gov (United States)

    Motts, Jonathan A.; Shirley, Devon L.; Silbergeld, Ellen K.; Nyland, Jennifer F.

    2014-01-01

    Mercury is an ubiquitous environmental contaminant, causing both neurotoxicity and immunotoxicity. Given its ability to amalgamate gold, mercury is frequently used in small-scale artisanal gold mining. We have previously reported that elevated serum titers of antinuclear autoantibodies (ANA) are associated with mercury exposures of miners in gold mining. The goal of this project was to identify novel serum biomarkers of mercury-induced immunotoxicity and autoimmune dysregulation. We conducted an analysis of serum samples from a cross-sectional epidemiological study on miners working in Amazonian Brazil. In proteomic screening analyses, samples were stratified based on mercury concentrations and ANA titer and a subset of serum samples (N=12) were profiled using Immune Response Biomarker Profiling ProtoArray protein microarray for elevated autoantibodies. Of the up-regulated autoantibodies in the mercury-exposed cohort, potential target autoantibodies were selected based on relevance to pro-inflammatory and macrophage activation pathways. ELISAs were developed to test the entire sample cohort (N=371) for serum titers to the highest of these autoantibodies (anti-glutathione S-transferase alpha, GSTA1) identified in the high mercury/high ANA group. We found positive associations between elevated mercury exposure and up-regulated serum titers of 3760 autoantibodies as identified by ProtoArray. Autoantibodies identified as potential novel biomarkers of mercury-induced immunotoxicity include antibodies to the following proteins: GSTA1, tumor necrosis factor ligand superfamily member 13, linker for activation of T cells, signal peptide peptidase like 2B, stimulated by retinoic acid 13, and interferon induced transmembrane protein. ELISA analyses confirmed that mercury-exposed gold miners had significantly higher serum titers of anti-GSTA1 autoantibody [unadjusted odds ratio = 89.6; 95% confidence interval: 27.2, 294.6] compared to emerald miners (referent population

  5. Touchstones and mercury at Hedeby

    Czech Academy of Sciences Publication Activity Database

    Ježek, Martin; Holub, M.

    2014-01-01

    Roč. 89, č. 1 (2014), s. 193-204 ISSN 0079-4848 Institutional support: RVO:67985912 Keywords : Hedeby * Viking Age * grave goods * touchstone * precious metal * mercury * chemical microanalysis * archaeometallurgy Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.278, year: 2014

  6. PERCEPTION OF MERCURY RISK INFORMATION

    Science.gov (United States)

    Approximately 8% of American women have blood Mercury levels exceeding the EPA reference dose (a dose below which symptoms would be unlikely). The children of these women are at risk of neurological deficits (lower IQ scores) primarily because of the mother's consumption of conta...

  7. A downstream voyage with mercury

    Science.gov (United States)

    Heinz, Gary

    2016-01-01

    Retrospective essay for the Bulletin of Environmental Contamination and Toxicology.As I look back on my paper, “Effects of Low Dietary Levels of Methyl Mercury on Mallard Reproduction,” published in 1974 in the Bulletin of Environmental Contamination and Toxicology, a thought sticks in my mind. I realize just how much my mercury research was not unlike a leaf in a stream, carried this way and that, sometimes stalled in an eddy, restarted, and carried downstream at a pace and path that was not completely under my control. I was hired in 1969 by the Patuxent Wildlife Research Center to study the effects of environmental pollutants on the behavior of wildlife. A colleague was conducting a study on the reproductive effects of methylmercury on mallards (Anas platyrhynchos), and he offered to give me some of the ducklings. I conducted a pilot study, testing how readily ducklings approached a tape-recorded maternal call. Sample sizes were small, but the results suggested that ducklings from mercury-treated parents behaved differently than controls. That’s how I got into mercury research—pretty much by chance.

  8. Venus and Mercury as Planets

    Science.gov (United States)

    1974-01-01

    A general evolutionary history of the solar planetary system is given. The previously observed characteristics of Venus and Mercury (i.e. length of day, solar orbit, temperature) are discussed. The role of the Mariner 10 space probe in gathering scientific information on the two planets is briefly described.

  9. Venus and Mercury as planets

    International Nuclear Information System (INIS)

    1974-01-01

    A general evolutionary history of the solar planetary system is given. The previously observed characteristics of Venus and Mercury (i.e. length of day, solar orbit, temperature) are discussed. The role of the Mariner 10 space probe in gathering scientific information on the two planets is briefly described

  10. EURISOL-DS MULTI-MW TARGET ISSUES: BEAM WINDOW AND TRANSVERSE FILM TARGET

    CERN Document Server

    Adonai Herrera-Martínez, Yacine Kadi

    The analysis of the EURISOL-DS Multi_MW target precise geometry (Fig.1) has proved that large fission yields can be achieved with a 4 MW, providing a technically feasible design to evacuate the power deposited in the liquid mercury. Different designs for the mercury flow have been proposed, which maintain its temperature below the boiling point with moderate flow speeds (maximum 4 m/s).

  11. Multi-MW target station: Beam Window Issues and Transverse Film Target

    CERN Document Server

    Herrera-Martinez, A

    The analysis of the EURISOL-DS Multi_MW target precise geometry has proved that large fission yields can be achieved with a 4 MW, providing a technically feasible design to evacuate the power deposited in the liquid mercury. Different designs for the mercury flow have been proposed, which maintain its temperature below the boiling point with moderate flow speeds (maximum 4 m/s).

  12. 76 FR 75446 - Amendment of Class E Airspace; Mercury, NV

    Science.gov (United States)

    2011-12-02

    ...-0894; Airspace Docket No. 11-AWP-14] Amendment of Class E Airspace; Mercury, NV AGENCY: Federal... Mercury, Desert Rock Airport, Mercury, NV. Decommissioning of the Mercury Non-Directional Beacon (NDB) at Mercury, Desert Rock Airport has made this action necessary for the safety and management of Instrument...

  13. The Plasma Environment at Mercury

    Science.gov (United States)

    Raines, James M.; Gershman, Daniel J.; Zurbuchen, Thomas H.; Gloeckler, George; Slavin, James A.; Anderson, Brian J.; Korth, Haje; Krimigis, Stamatios M.; Killen, Rosemary M.; Sarantos, Menalos; hide

    2011-01-01

    Mercury is the least explored terrestrial planet, and the one subjected to the highest flux of solar radiation in the heliosphere. Its highly dynamic, miniature magnetosphere contains ions from the exosphere and solar wind, and at times may allow solar wind ions to directly impact the planet's surface. Together these features create a plasma environment that shares many features with, but is nonetheless very different from, that of Earth. The first in situ measurements of plasma ions in the Mercury space environment were made only recently, by the Fast Imaging Plasma Spectrometer (FIPS) during the MESSENGER spacecraft's three flybys of the planet in 2008-2009 as the probe was en route to insertion into orbit about Mercury earlier this year. Here. we present analysis of flyby and early orbital mission data with novel techniques that address the particular challenges inherent in these measurements. First. spacecraft structures and sensor orientation limit the FIPS field of view and allow only partial sampling of velocity distribution functions. We use a software model of FIPS sampling in velocity space to explore these effects and recover bulk parameters under certain assumptions. Second, the low densities found in the Mercury magnetosphere result in a relatively low signal-to-noise ratio for many ions. To address this issue, we apply a kernel density spread function to guide removal of background counts according to a background-signature probability map. We then assign individual counts to particular ion species with a time-of-flight forward model, taking into account energy losses in the carbon foil and other physical behavior of ions within the instrument. Using these methods, we have derived bulk plasma properties and heavy ion composition and evaluated them in the context of the Mercury magnetosphere.

  14. Multi-weight isotherm results for mercury removal in upper East Fork Popular Creek water

    International Nuclear Information System (INIS)

    Bostick, D.A.; Klasson, K.T.

    1998-02-01

    Many sorbents have been developed for the removal of mercury and heavy metals from waters; however, the majority of data published to date do not address the removal of mercury to the target levels represented in this project. The application to which these sorbents are targeted for use is the removal of mercury from microgram-per-liter levels to low nanogram-per-liter levels. Sorbents with thiouronium, thiol, amine, sulfur, and proprietary functional groups were selected for these studies. The initial mercury content in the majority of the batch samples was significantly augmented so that the equilibrium concentration was similar to that found in the original stream sample for at least one sample. Mercury was successfully removed from actual water via adsorption onto Ionac SR-4 (by Sybron Chemicals, Inc.), Keyle:X (by SolmeteX), and Mersorb (by Nucon International, Inc.) resins to levels below the target goal of 12 ng/L. A thiol-based resin (Ionac SR-4) performed the best, indicating that over 200,000 volumes of water could be treated with one volume of resin. The cost of the resin is approximately $0.24 per 1000 gal of water

  15. Environmental Mercury and Its Toxic Effects

    Directory of Open Access Journals (Sweden)

    Kevin M. Rice

    2014-03-01

    Full Text Available Mercury exists naturally and as a man-made contaminant. The release of processed mercury can lead to a progressive increase in the amount of atmospheric mercury, which enters the atmospheric-soil-water distribution cycles where it can remain in circulation for years. Mercury poisoning is the result of exposure to mercury or mercury compounds resulting in various toxic effects depend on its chemical form and route of exposure. The major route of human exposure to methylmercury (MeHg is largely through eating contaminated fish, seafood, and wildlife which have been exposed to mercury through ingestion of contaminated lower organisms. MeHg toxicity is associated with nervous system damage in adults and impaired neurological development in infants and children. Ingested mercury may undergo bioaccumulation leading to progressive increases in body burdens. This review addresses the systemic pathophysiology of individual organ systems associated with mercury poisoning. Mercury has profound cellular, cardiovascular, hematological, pulmonary, renal, immunological, neurological, endocrine, reproductive, and embryonic toxicological effects.

  16. Mercury Toxicity on Sodium Pump and Organoseleniums Intervention: A Paradox

    Directory of Open Access Journals (Sweden)

    Ige Joseph Kade

    2012-01-01

    Full Text Available Mercury is an environmental poison, and the damage to living system is generally severe. The severity of mercury poisoning is consequent from the fact that it targets the thiol-containing enzymes, irreversibly oxidizing their critical thiol groups, consequently leading to an inactivation of the enzyme. The Na+/K+-ATPase is a sulfhydryl protein that is sensitive to Hg2+ assault. On the other hand, organoseleniums are a class of pharmacologically promising compounds with potent antioxidant effects. While Hg2+ oxidizes sulfhydryl groups of Na+/K+-ATPase under in vitro and in vivo conditions, the organoselenium compounds inhibit Na+/K+-ATPase in vitro but enhance its activities under in vivo conditions with concomitant increase in the level of endogenous thiols. Paradoxically, it appears that these two thiol oxidants can be used to counteract one another under in vivo conditions, and this hypothesis serves as the basis for this paper.

  17. Mercury emissions from municipal solid waste combustors

    Energy Technology Data Exchange (ETDEWEB)

    1993-05-01

    This report examines emissions of mercury (Hg) from municipal solid waste (MSW) combustion in the United States (US). It is projected that total annual nationwide MSW combustor emissions of mercury could decrease from about 97 tonnes (1989 baseline uncontrolled emissions) to less than about 4 tonnes in the year 2000. This represents approximately a 95 percent reduction in the amount of mercury emitted from combusted MSW compared to the 1989 mercury emissions baseline. The likelihood that routinely achievable mercury emissions removal efficiencies of about 80 percent or more can be assured; it is estimated that MSW combustors in the US could prove to be a comparatively minor source of mercury emissions after about 1995. This forecast assumes that diligent measures to control mercury emissions, such as via use of supplemental control technologies (e.g., carbon adsorption), are generally employed at that time. However, no present consensus was found that such emissions control measures can be implemented industry-wide in the US within this time frame. Although the availability of technology is apparently not a limiting factor, practical implementation of necessary control technology may be limited by administrative constraints and other considerations (e.g., planning, budgeting, regulatory compliance requirements, etc.). These projections assume that: (a) about 80 percent mercury emissions reduction control efficiency is achieved with air pollution control equipment likely to be employed by that time; (b) most cylinder-shaped mercury-zinc (CSMZ) batteries used in hospital applications can be prevented from being disposed into the MSW stream or are replaced with alternative batteries that do not contain mercury; and (c) either the amount of mercury used in fluorescent lamps is decreased to an industry-wide average of about 27 milligrams of mercury per lamp or extensive diversion from the MSW stream of fluorescent lamps that contain mercury is accomplished.

  18. Mercury exposure from interior latex paint.

    Science.gov (United States)

    Agocs, M M; Etzel, R A; Parrish, R G; Paschal, D C; Campagna, P R; Cohen, D S; Kilbourne, E M; Hesse, J L

    1990-10-18

    Many paint companies have used phenylmercuric acetate as a preservative to prolong the shelf life of interior latex paint. In August 1989, acrodynia, a form of mercury poisoning, occurred in a child exposed to paint fumes in a home recently painted with a brand containing 4.7 mmol of mercury per liter (at that time the Environmental Protection Agency's recommended limit was 1.5 mmol or less per liter). To determine whether the recent use of that brand of paint containing phenylmercuric acetate was associated with elevated indoor-air and urinary mercury concentrations, we studied 74 "exposed" persons living in 19 homes recently painted with the brand and 28 "unexposed" persons living in 10 homes not recently painted with paint containing mercury. The paint samples from the homes of exposed persons contained a median of 3.8 mmol of mercury per liter, and air samples from the homes had a median mercury content of 10.0 nmol per cubic meter (range, less than 0.5 to 49.9). No mercury was detected in paint or air samples from the homes of unexposed persons. The median urinary mercury concentration was higher in the exposed persons (4.7 nmol of mercury per millimole of creatinine; range, 1.4 to 66.5) than in the unexposed persons (1.1 nmol per millimole; range, 0.02 to 3.9; P less than 0.001). Urinary mercury concentrations within the range that we found in exposed persons have been associated with symptomatic mercury poisoning. We found that potentially hazardous exposure to mercury had occurred among persons whose homes were painted with a brand of paint containing mercury at concentrations approximately 2 1/2 times the Environmental Protection Agency's recommended limit.

  19. JV Task 122 - Assessment of Mercury Control Options for the San Miguel Electric Cooperative Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Nicholas Lentz; Brandon Pavlish; John Kay; Michael Jones

    2009-02-01

    In the United States, testing has been under way at electric coal-fired power plants to find viable and economical mercury control strategies to meet pending regulations. San Miguel Electric Cooperative (SMEC) engaged the Energy & Environmental Research Center (EERC) through a request for proposal (RFP) to perform research tests to evaluate sorbent-based technologies at its coal-fired San Miguel Generating Station to identify possible technology options that could be used by SMEC to meet the mercury reduction requirements of future U.S. federal standards. The goal of the testing was to target a mercury removal of {ge}90%. The EERC has successfully field-tested several sorbent-based technologies in previous projects that offer promise and potential to achieve a target removal of {ge}90%. Based on these field test results, yet recognizing that fuel type and plant operating conditions affect mercury capture significantly, the EERC proposed research tests to evaluate potential sorbent-based technologies provided by Norit Americas and the EERC that could potentially meet SMEC's mercury control objectives. Over the period of May through mid-June 2008, the EERC tested injection of both treated and nontreated activated carbon (AC) provided by Norit Americas and sorbent enhancement additives (SEAs) provided by the EERC. Tests were performed at San Miguel Unit 1 (450 MW) and included injection at the inlet of the air heater (AH) (temperature of 720 F). The test coal was a Texas lignite fuel with an average moisture content of 31.19%, an ash content of 26.6%, a heating value of 5,094 Btu/lb, a sulfur content of 2.7%, and a mercury concentration of 0.182 ppm, all reported on an as-received basis. Pilot-scale testing results identified DARCO{reg_sign} Hg-LH, SEA2 + DARCO{reg_sign} Hg, and the ChemMod sorbents as technologies with the potential to achieve the target mercury removal of {ge}90% at the full-scale test. Mercury concentrations were tracked with continuous

  20. An Epidemiological Study of Mercury Sensitization

    Directory of Open Access Journals (Sweden)

    Kazuhiro Sato

    1997-01-01

    Full Text Available Mercury sensitization has been historically in question and may be related to recent increases of type I allergic diseases. To clarify the epidemiological factors of mercury sensitization, we investigated factors relating to mercury sensitization in 215 medical students. Their allergic symptoms, family histories and lifestyles were studied by questionnaire. Patch tests were performed with HgCI2 (0.05% aq. and NiS04 (5% aq.. Anti- Dermatophagoides and anti-Crypfomeria pollen IgE antibodies in sera were also measured. Urinary mercury concentrations were measured in 25 mercury sensitized and 44 non-sensitized subjects (controls. Hair mercury concentrations were also measured in 19 sensitized and 22 non-sensitized subjects. While the positive rate of nickel was 6.0% (13/215, that of mercury was high (13.0%; 28/215. The subjects' individual histories of allergic rhinitis, eczema, urticaria and allergic conjunctivitis were significantly associated with family histories of these conditions (P<0.01, P<0.005 and P<0.005, respectively, as reported in the literature. However, no allergen- specific antibody positivity or past history of allergic disease was associated with mercury sensitization. Mercury sensitized subjects had experienced eczema caused by cosmetics, shampoos, soaps and haircreams significantly more frequently (P<0.05. The history of mercurochrome usage was not associated with mercury sensitization. The number of teeth treated with metals in mercury sensitized subjects was significantly higher than that in the control group (6.8±4.3 vs 4.8±1; P<0.05. There were significant differences in urinary mercury concentrations (specific gravity adjusted levels between mercury sensitized subjects and non-sensitized subjects (2.0±0.9 and 1.3±0.6 (xg/L, respectively; P<0.001. There were also significant differences in hair mercury concentrations between mercury sensitized and non-sensitized subjects (2.0±0.9 and 1.2±0.5 μg/g, respectively; P<0

  1. Mercury Phase II Study - Mercury Behavior across the High-Level Waste Evaporator System

    Energy Technology Data Exchange (ETDEWEB)

    Bannochie, C. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Crawford, C. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jackson, D. G. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Shah, H. B. [Savannah River Remediation, LLC., Aiken, SC (United States); Jain, V. [Savannah River Remediation, LLC., Aiken, SC (United States); Occhipinti, J. E. [Savannah River Remediation, LLC., Aiken, SC (United States); Wilmarth, W. R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-06-17

    The Mercury Program team’s effort continues to develop more fundamental information concerning mercury behavior across the liquid waste facilities and unit operations. Previously, the team examined the mercury chemistry across salt processing, including the Actinide Removal Process/Modular Caustic Side Solvent Extraction Unit (ARP/MCU), and the Defense Waste Processing Facility (DWPF) flowsheets. This report documents the data and understanding of mercury across the high level waste 2H and 3H evaporator systems.

  2. Assessing Mercury and Methylmercury Bioavailability in Sediment Pore Water Using Mercury-Specific Hydrogels

    Science.gov (United States)

    2015-06-01

    FINAL REPORT Assessing Mercury and Methylmercury Bioavailability in Sediment Pore Water Using Mercury -Specific Hydrogels SERDP Project ER-1771...From - To) 2010-2015 4. TITLE AND SUBTITLE Assessing Mercury and Methylmercury Bioavailability in 5a. CONTRACT NUMBER W912HQ-10-C-0069 Sediment...Using Mercury -Specific DGTs 5b. GRANT NUMBER ER-1771 5c. PROGRAM ELEMENT NUMBER NA 6. AUTHOR(S) Magar, Victor S.*, Steenhaut, Nicholas

  3. Mercury concentrations at a historically mercury-contaminated site in KwaZulu-Natal, South Africa

    CSIR Research Space (South Africa)

    Williams, CR

    2011-02-01

    Full Text Available . Biogeochem., 43:237?257 Barrat GJ, Combrink J (2002) An Assessment of the degree of mercury (Hg) bio-transformation in two river systems following discharges from a mercury recovery plant. Water SA Special Edition: WISA Proceedings 2002 Benoit JM... in mercury and methylmercury biogeochemical cycling and bioaccumulation within shallow estuaries. PhD thesis, University of Maryland, College Park Kim E-H, Mason RP, Porter ET, Soulen HL (2006) The impact of resuspension on sediment mercury dynamics...

  4. Amended Silicated for Mercury Control

    Energy Technology Data Exchange (ETDEWEB)

    James Butz; Thomas Broderick; Craig Turchi

    2006-12-31

    Amended Silicates{trademark}, a powdered, noncarbon mercury-control sorbent, was tested at Duke Energy's Miami Fort Station, Unit 6 during the first quarter of 2006. Unit 6 is a 175-MW boiler with a cold-side electrostatic precipitator (ESP). The plant burns run-of-the-river eastern bituminous coal with typical ash contents ranging from 8-15% and sulfur contents from 1.6-2.6% on an as-received basis. The performance of the Amended Silicates sorbent was compared with that for powdered activated carbon (PAC). The trial began with a period of baseline monitoring during which no sorbent was injected. Sampling during this and subsequent periods indicated mercury capture by the native fly ash was less than 10%. After the baseline period, Amended Silicates sorbent was injected at several different ratios, followed by a 30-day trial at a fixed injection ratio of 5-6 lb/MMACF. After this period, PAC was injected to provide a comparison. Approximately 40% mercury control was achieved for both the Amended Silicates sorbent and PAC at injection ratios of 5-6 lbs/MMACF. Higher injection ratios did not achieve significantly increased removal. Similar removal efficiencies have been reported for PAC injection trials at other plants with cold-side ESPs, most notably for plants using medium to high sulfur coal. Sorbent injection did not detrimentally impact plant operations and testing confirmed that the use of Amended Silicates sorbent does not degrade fly ash quality (unlike PAC). The cost for mercury control using either PAC or Amended Silicates sorbent was estimated to be equivalent if fly ash sales are not a consideration. However, if the plant did sell fly ash, the effective cost for mercury control could more than double if those sales were no longer possible, due to lost by-product sales and additional cost for waste disposal. Accordingly, the use of Amended Silicates sorbent could reduce the overall cost of mercury control by 50% or more versus PAC for locations where

  5. 7 CFR 201.10 - Variety.

    Science.gov (United States)

    2010-01-01

    ... labeled as to variety and shall be labeled to show the variety name or the words “Variety Not Stated... with or without the words “kind and variety.” The percentage in such case, which may be shown as “pure... § 201.11a. If separate percentages for the kind and the variety or hybrid are shown, the name of the...

  6. Thallium-201 myocardial imaging in children.

    Science.gov (United States)

    Sty, J R; Starshak, R J

    1985-01-01

    The clinical applications of thallium-201 scintigraphy are less well defined in children than in adults. However, the published data indicate several potential applications including assessment of: 1) deficit in left ventricular myocardial perfusion, 2) early right ventricular volume or pressure overload, or both, and 3) the right ventricle in both cyanotic and acyanotic congenital heart disease. In this report, the applications of thallium imaging to pediatric diseases are described and the advantages and disadvantages of the procedure are enumerated.

  7. Percolation of cadmium across a mercury film

    International Nuclear Information System (INIS)

    Malek, K.; Gobal, F.

    2003-01-01

    Electrodeposition/dissolution of cadmium onto a film of mercury shows some deviations from the natural liquidity of mercury caused by the reduction of Cd onto it. Percolation and fractal analyzes were done on the surface and the bulk of the mercury film during diffusion of Cd species (atoms). These show that the fractal dimensions of the Cd-inserted mercury film are about 2.11 and 2.54 near the surface of the mercury film and at deeper points inside the film, respectively. The insertion process has a negligible effect on the surface morphology of the mercury film and there is a phase transition in the bulk, as well as a geometrical transition during the Cd-insertion (de-insertion) process. This corresponds to a percolation threshold of about 0.2 mol l -1 Cd content

  8. Mercury in dated Greenland marine sediments

    DEFF Research Database (Denmark)

    Asmund, G.; Nielsen, S.P.

    2000-01-01

    Twenty marine sediment cores from Greenland were analysed for mercury, and dated by the lead-210 method. In general the cores exhibit a mercury profile with higher mercury concentrations in the upper centimetres of the core. The cores were studied by linear regression of In Hg vs, age...... of the sediment for the youngest 100 years. As a rule the mercury decreased with depth in the sediment with various degrees of significance. The increase of the mercury flux during the last 100 years is roughly a doubling. The increase may be of anthropogenic origin as it is restricted to the last 100 years....... In four cores the concentration of manganese was found also to increase in the top layers indicating diagenesis. In the other cases the higher concentrations were not accompanied by higher manganese concentrations. The mercury flux to the sediment surface was generally proportional to the Pb-210 flux...

  9. Human accumulation of mercury in Greenland

    DEFF Research Database (Denmark)

    Johansen, P.; Mulvad, G.; Pedersen, H. S.

    2007-01-01

    In the Arctic, the traditional diet exposes its people to a high intake of mercury especially from marine mammals. To determine whether the mercury is accumulated in humans, we analyzed autopsy samples of liver, kidney and spleen from adult ethnic Greenlanders who died between 1990 and 1994 from...... a wide range of causes, natural and violent. Liver, kidney and spleen samples from between 33 and 71 case subjects were analyzed for total mercury and methylmercury, and liver samples also for selenium. Metal levels in men and women did not differ and were not related to age except in one case, i.......e. for total mercury in liver, where a significant declining concentration with age was observed. The highest total mercury levels were found in kidney followed by liver and spleen. Methylmercury followed the same pattern, but levels were much lower, constituting only 19% of the total mercury concentration...

  10. Acclimation of subsurface microbial communities to mercury

    DEFF Research Database (Denmark)

    de Lipthay, Julia R; Rasmussen, Lasse D; Øregaard, Gunnar

    2008-01-01

    We studied the acclimation to mercury of bacterial communities of different depths from contaminated and noncontaminated floodplain soils. The level of mercury tolerance of the bacterial communities from the contaminated site was higher than those of the reference site. Furthermore, the level...... of mercury tolerance and functional versatility of bacterial communities in contaminated soils initially were higher for surface soil, compared with the deeper soils. However, following new mercury exposure, no differences between bacterial communities were observed, which indicates a high adaptive potential...... of the subsurface communities, possibly due to differences in the availability of mercury. IncP-1 trfA genes were detected in extracted community DNA from all soil depths of the contaminated site, and this finding was correlated to the isolation of four different mercury-resistance plasmids, all belonging...

  11. Mercury and selenium in European catfish (Silurus glanis) from Northern Italian Rivers: can molar ratio be a predictive factor for mercury toxicity in a top predator?

    Science.gov (United States)

    Squadrone, S; Benedetto, A; Brizio, P; Prearo, M; Abete, M C

    2015-01-01

    The study of mercury and selenium bioaccumulation in fish is crucially important for evaluating the extent of contamination in freshwater environments, and the possible health risk posed for humans when the antagonistic interactions of these two elements are considered. Several factors affect the risk of mercury intake from fish consumption, including mercury levels, human consumption patterns, and sensitive populations (e.g., pregnant women, foetuses, young children and unknown genetic factors). The protective effects of selenium on mercury toxicity have been extensively publicised in recent years, particularly targeting fish consumers. In this study, mercury (Hg) and selenium (Se) concentrations were determined in the muscle of European catfish (Silurus glanis) collected from North Italian Rivers. Differences in mercury and selenium levels, as a function of size, gender and location were investigated. Hg was strongly related to length, gender and location, while Se levels are not dependent on fish size or location. The mean Se/Hg molar ratio was strongly affected by location, and significantly related to length and age. Selenium was in molar excess of mercury in all sites, with a rank order of mean Se/Hg molar ratio of the Parma River (2.55)>Po River (1.71)>Tanaro River (1.66)>Bormida River (1.36). However, in 37% of analyzed samples, Hg exceeded the maximum level set by 1881/2006/EC and 629/2008/EC in fish muscle. The molar ratio of Se/Hg was 0.5mg/kg), and therefore the mean molar ratio cannot be considered as a safety criterion in top predator fish. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. Assessing the Behavior of Typically Lithophile Elements Under Highly Reducing Conditions Relevant to the Planet Mercury

    Science.gov (United States)

    Rowland, Rick, II; Vander Kaaden, Kathleen E.; McCubbin, Francis M.; Danielson, Lisa R.

    2017-01-01

    With the data returned from the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) mission, there are now numerous constraints on the physical and chemical properties of Mercury, including its surface composition (e.g., Evans et al. 2012; Nittler et al. 201 l; Peplowski et al. 2012; Weider et al. 2012). The high Sand low FeO contents observed from MESSENGER on the planet's surface suggests a low oxygen fugacity of the present planetary materials. Estimates of the oxygen fugacity for Mercurian magmas are approximately 3- 7 log units below the Iron-Wiistite (Fe-FeO) oxygen buffer (McCubbin et al. 2012; Zolotov et al. 2013), several orders of magnitude more reducing than other terrestrial bodies we have data from such as the Earth, Moon, or Mars (Herd 2008; Sharp, McCubbin, and Shearer 2013; Wadhwa 2008). Most of our understanding of elemental partitioning behavior comes from observations made on terrestrial rocks, but Mercury's oxygen fugacity is far outside the conditions of those samples. With limited oxygen available, lithophile elements may instead exhibit chalcophile, halophile, or siderophile behaviors. Furthermore, very few natural samples of rocks that formed under reducing conditions are available in our collections (e.g., enstatite chondrites, achondrites, aubrites). The goal of this study is to conduct experiments at high pressure and temperature conditions to determine the elemental partitioning behavior of typically lithophile elements as a function of decreasing oxygen fugacity.

  13. Reproducibility of 201Tl myocardial imaging

    International Nuclear Information System (INIS)

    McLaughlin, P.R.; Martin, R.P.; Doherty, P.; Daspit, S.; Goris, M.; Haskell, W.; Lewis, S.; Kriss, J.P.; Harrison, D.C.

    1977-01-01

    Seventy-six thallium-201 myocardial perfusion studies were performed on twenty-five patients to assess their reproducibility and the effect of varying the level of exercise on the results of imaging. Each patient had a thallium-201 study at rest. Fourteen patients had studies on two occasions at maximum exercise, and twelve patients had studies both at light and at maximum exercise. Of 70 segments in the 14 patients assessed on each of two maximum exercise tests, 64 (91 percent) were reproducible. Only 53 percent (16/30) of the ischemic defects present at maximum exercise were seen in the light exercise study in the 12 patients assessed at two levels of exercise. Correlation of perfusion defects with arteriographically proven significant coronary stenosis was good for the left anterior descending and right coronary arteries, but not as good for circumflex artery disease. Thallium-201 myocardial imaging at maximum exercise is reproducible within acceptable limits, but careful attention to exercise technique is essential for valid comparative studies

  14. Demonstration of ATG Process for Stabilizing Mercury (<260 ppm) Contaminated Mixed Waste. Mixed Waste Focus Area. OST Reference # 2407

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    1999-09-01

    Mercury contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. Based on efforts led by the Mixed Waste Focus Area (MWFA) and its Mercury Working Group (HgWG), the inventory of wastes contaminated with <260 ppm mercury and with radionuclides stored at various DOE sites is estimated to be approximately 6,000 m3). At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities. Extraction methods are required to remove mercury from waste containing >260 ppm levels, but below 260 ppm Hg contamination levels the U. S. Environmental Protection Agency (EPA) does not require removal of mercury from the waste. Steps must still be taken, however, to ensure that the final waste form does not leach mercury in excess of the limit for mercury prescribed in the Resource Conservation and Recovery Act (RCRA) when subjected to the Toxicity Characteristic Leaching Procedure (TCLP). At this time, the limit is 0.20 mg/L. However, in the year 2000, the more stringent Universal Treatment Standard (UTS) of 0.025 mg/L will be used as the target endpoint. Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris, as well as in different chemical species of mercury. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards. It must also be proven feasible in terms of economics, operability, and safety. To date, no standard method of stabilization has been developed and proven for such varying waste types as those within the DOE complex.

  15. Thiosulphate assisted phytoextraction of mercury contaminated soils at the Wanshan Mercury Mining District, Southwest China

    Directory of Open Access Journals (Sweden)

    J. Wang

    2013-10-01

    Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively

  16. Blood Mercury Levels of Zebra Finches Are Heritable: Implications for the Evolution of Mercury Resistance.

    Directory of Open Access Journals (Sweden)

    Kenton A Buck

    Full Text Available Mercury is a ubiquitous metal contaminant that negatively impacts reproduction of wildlife and has many other sub-lethal effects. Songbirds are sensitive bioindicators of mercury toxicity and may suffer population declines as a result of mercury pollution. Current predictions of mercury accumulation and biomagnification often overlook possible genetic variation in mercury uptake and elimination within species and the potential for evolution in affected populations. We conducted a study of dietary mercury exposure in a model songbird species, maintaining a breeding population of zebra finches (Taeniopygia guttata on standardized diets ranging from 0.0-2.4 μg/g methylmercury. We applied a quantitative genetics approach to examine patterns of variation and heritability of mercury accumulation within dietary treatments using a method of mixed effects modeling known as the 'animal model'. Significant variation in blood mercury accumulation existed within each treatment for birds exposed at the same dietary level; moreover, this variation was highly repeatable for individuals. We observed substantial genetic variation in blood mercury accumulation for birds exposed at intermediate dietary concentrations. Taken together, this is evidence that genetic variation for factors affecting blood mercury accumulation could be acted on by selection. If similar heritability for mercury accumulation exists in wild populations, selection could result in genetic differentiation for populations in contaminated locations, with possible consequences for mercury biomagnification in food webs.

  17. Radioactive mercury distribution in biological fluids and excretion in human subjects after inhalation of mercury vapor

    International Nuclear Information System (INIS)

    Cherian, M.G.; Hursh, J.B.; Clarkson, T.W.; Allen, J.

    1978-01-01

    The distribution of mercury in red blood cells (RBCs) and plasma, and its excretion in urine and feces are described in five human subjects during the first 7 days following inhalation of radioactive mercury vapor. A major portion (98%) of radioactive mercury in whole blood is initially accumulated in the RBCs and is transferred partly to the plasma compartment until the ratio of mercury in RBCs to plasma is about 2 within 20 h. The cumulative urinary and fecal excretion of mercury for 7 days is about 11.6% of the retained dose, and is closely related to the percent decline in body burden of mercury. There is little correlation between either the urinary excretion and plasma radioactivity of mercury, or the specific activities of urine and plasma mercury, suggesting a mechanism other than a direct glomerular filtration involved in the urinary excretion of recently exposed mercury. These studies suggest that blood mercury levels can be used as an index of recent exposure, while urinary levels may be an index of renal concentration of mercury. However, there is no reliable index for mercury concentration in the brain

  18. Thiosulphate assisted phytoextraction of mercury contaminated soils at the Wanshan Mercury Mining District, Southwest China

    Directory of Open Access Journals (Sweden)

    J Wang

    2013-10-01

    Full Text Available Wanshan, known as the “Mercury Capital” of China, is located in the Southwest of China. Due to the extensive mining and smelting works in the Wanshan area, the local ecosystem has been serious contaminated with mercury. In the present study, a number of soil samples were taken from the Wanshan mercury mining area and the mercury fractionations in soils were analyzed using sequential extraction procedure technique. The obtained results showed that the dominate mercury fractions (represent 95% of total mercury were residual and organic bound mercury. A field trial was conducted in a mercury polluted farmland at the Wanshan mercury mine. Four plant species Brassica juncea Czern. et Coss.var. ASKYC (ASKYC, Brassica juncea Czern. et Coss.var.DPDH (DPDH, Brassica juncea Czern. et Coss.var.CHBD(CHBD, Brassica juncea Czern. et Coss.var.LDZY (LDZY were tested their ability to extract mercury from soil with thiosulphate amendment. The results indicated that the mercury concentration in the roots and shoots of the four plants were significantly increased with thiosulphate treatment. The mercury phytoextraction yield of ASKYC, DPDH, CHBD and LDZY were 92, 526, 294 and 129 g/ha, respectively.

  19. Fractionation of mercury stable isotopes during coal combustion and seawater flue gas desulfurization

    International Nuclear Information System (INIS)

    Huang, Shuyuan; Yuan, Dongxing; Lin, Haiying; Sun, Lumin; Lin, Shanshan

    2017-01-01

    In the current study, fractionation of mercury isotopes during coal combustion and seawater flue gas desulfurization (SFGD) in a coal-fired power plant using a SFGD system was investigated. Fourteen samples were collected from the power plant. The samples were pretreated with a combustion-trapping method and were analyzed with a multi-collector inductively coupled plasma mass spectrometer (MC-ICP-MS). Compared with the raw coal, the bottom ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −0.45 to −0.03‰. The fly ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −1.49 to −0.73‰ for Chinese coal and from −1.47 to −0.62‰ for Indonesian coal. The δ 202 Hg of fresh seawater and desulfurized seawater was found to be −1.32 and −0.32‰ respectively. These δ 202 Hg values indicated that the desulfurized seawater was enriched with heavier mercury isotopes. Based upon the calculated results obtained from the mass balance equation, it was suggested that the stack emissions were enriched with lighter mercury isotopes. Mass independent fractionation was observed in most of the samples with a Δ 199 Hg/Δ 201 Hg ratio of approximately 0.96. The results help in improving the understanding of mercury isotope fractionation during coal combustion and SFGD, and are also useful in tracing the mercury emissions from coal fired power plants. - Highlights: • Spread of 1.5‰ was observed in δ 202 Hg values of raw coals and coal related samples. • The δ 202 Hg values were more negative in fly ash than those in the raw coal. • The flue gas had a significant Hg fractionation after desulfurization. • The stack emissions were enriched with lighter isotopes compared with the raw coal.

  20. STRESS SENSITIVITY OF MERCURY INJECTION MEASUREMENTS

    OpenAIRE

    Guise, P; Grattoni, C; Allshorn, S; Fisher, QJ; Schiffer, A

    2017-01-01

    Many petrophysical properties (e.g. permeability, electrical resistivity etc.) of tight rocks are very stress sensitive. However, most mercury injection measurements are made using an instrument that does not apply a confining pressure to the samples. Here we further explore the implications of the use and analysis of data from mercury injection porosimetry or mercury capillary pressure measurements (MICP). Two particular aspects will be discussed. First, the effective stress acting on sample...

  1. Mercury in polar bears from Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Lentfer, J.W.; Galster, W.A.

    1987-04-01

    Alaskan polar bear (Ursus maritimus) muscle and liver samples collected in 1972 were analyzed for total mercury. Bears north of Alaska had more mercury than bears west of Alaska. The only difference between young and adult animals was in the northern area where adults had more mercury in liver tissue than young animals. Levels were probably not high enough to be a serious threat to bears.

  2. Process for removing mercury from aqueous solutions

    Science.gov (United States)

    Googin, John M.; Napier, John M.; Makarewicz, Mark A.; Meredith, Paul F.

    1986-01-01

    A process for removing mercury from water to a level not greater than two parts per billion wherein an anion exchange material that is insoluble in water is contacted first with a sulfide containing compound and second with a compound containing a bivalent metal ion forming an insoluble metal sulfide. To this treated exchange material is contacted water containing mercury. The water containing not more than two parts per billion of mercury is separated from the exchange material.

  3. Surface composition of Mercury from reflectance spectrophotometry

    Science.gov (United States)

    Vilas, Faith

    1988-01-01

    The controversies surrounding the existing spectra of Mercury are discussed together with the various implications for interpretations of Mercury's surface composition. Special attention is given to the basic procedure used for reducing reflectance spectrophotometry data, the factors that must be accounted for in the reduction of these data, and the methodology for defining the portion of the surface contributing the greatest amount of light to an individual spectrum. The application of these methodologies to Mercury's spectra is presented.

  4. Accumulation of mercury in selected plant species grown in soils contaminated with different mercury compounds

    International Nuclear Information System (INIS)

    Su, Yi; Han, Fengxiang; Shiyab, Safwan; Chen, Jian; Monts, David L.

    2007-01-01

    The objective of our research is to screen and search for suitable plant species for phyto-remediation of mercury-contaminated soil. Currently our effort is specifically focused on mercury removal from the U.S. Department of Energy (DOE) sites, where mercury contamination is a major concern. In order to cost effectively implement mercury remediation efforts, it is necessary now to obtain an improved understanding of biological means of removing mercury and mercury compounds.. Phyto-remediation is a technology that uses various plants to degrade, extract, contain, or immobilize contaminants from soil and water. In particular, phyto-extraction is the uptake of contaminants by plant roots and translocation within the plants to shoots or leaves. Contaminants are generally removed by harvesting the plants. We have investigated phyto-extraction of mercury from contaminated soil by using some of the known metal-accumulating plants since no natural plant species with mercury hyper-accumulating properties has yet been identified. Different natural plant species have been studied for mercury uptake, accumulation, toxicity and overall mercury removal efficiency. Various mercury compounds, such as HgS, HgCl 2 , and Hg(NO 3 ) 2 , were used as contaminant sources. Different types of soil were examined and chosen for phyto-remediation experiments. We have applied microscopy and diffuse reflectance spectrometry as well as conventional analytical chemistry to monitor the phyto-remediation processes of mercury uptake, translocation and accumulation, and the physiological impact of mercury contaminants on selected plant species. Our results indicate that certain plant species, such as beard grass (Polypogon monospeliensis), accumulated a very limited amount of mercury in the shoots ( 2 powder, respectively; no visual stress symptoms were observed. We also studied mercury phyto-remediation using aged soils that contained HgS, HgCl 2 , or Hg(NO 3 ) 2 . We have found that up to hundreds

  5. Analysis of the health risk of exposure to breast milk mercury in infants in Taiwan.

    Science.gov (United States)

    Chien, Ling-Chu; Han, Bor-Cheng; Hsu, Chun-Sen; Jiang, Cheun-Bin; You, Hung-Jiun; Shieh, Ming-Jer; Yeh, Ching-Ying

    2006-06-01

    The aim of this study was to assess the total concentration and health risk to infants of breast milk mercury in urban mothers and mothers married to fishermen in relation to fish intake in Taiwan. A total of sixty-eight healthy mothers were recruited for the study. The breast milk mercury geometric mean concentration was 2.02 microgl(-1) (n=56, range: 0.24-9.45 microgl(-1)) for the city group and 2.04 microgl(-1) (n=12, range: 0.26-8.62 microgl(-1)) for the fishermen's group. Of the three sources of mercury exposure (i.e., ingestion (breast milk), inhalation (ambient air), and dermal exposure (shower)), breast-feeding was found to be the largest (96.3-99.6% of the total). From a Monte Carlo simulation, in which methyl mercury accounted for about 50% of total mercury, the hazard quotient (exposure estimate/oral minimal risk level or target organ toxicity dose) exceeded 1.0 for 12.9% of urban babies and 18.8% of fishermen's babies (chronic oral minimal risk level and target organ toxicity dose: 3 x 10(-4)mgkg(-1)d(-1)). The calculated mercury exposure was 3.02 x 10(-1) microgkg(-1)d(-1) for a 3.49 kg urban baby boy and 3.06 x 10(-1) microgkg(-1)d(-1) for a 3.44 kg urban baby girl. These results suggest the life style of mothers (eating raw fish and shellfish such as used in "Sashimi" and "Sushi," and vitamin supplementation) may influence the mercury concentration in breast milk.

  6. The Messenger Mission to Mercury

    CERN Document Server

    Domingue, D. L

    2007-01-01

    NASA’s MESSENGER mission, launched on 3 August, 2004 is the seventh mission in the Discovery series. MESSENGER encounters the planet Mercury four times, culminating with an insertion into orbit on 18 March 2011. It carries a comprehensive package of geophysical, geological, geochemical, and space environment experiments to complete the complex investigations of this solar-system end member, which begun with Mariner 10. The articles in this book, written by the experts in each area of the MESSENGER mission, describe the mission, spacecraft, scientific objectives, and payload. The book is of interest to all potential users of the data returned by the MESSENGER mission, to those studying the nature of the planet Mercury, and by all those interested in the design and implementation of planetary exploration missions.

  7. Augustus as Mercury at last

    Directory of Open Access Journals (Sweden)

    Paulo Martins

    2017-07-01

    Full Text Available My purpose in this paper is to investigate and to analyse the representation of Augustus as Mercury, and what this association may suggest and mean to the Romans from both the urbs and the prouinciae, focusing the epigraphy, the numismatic, and the literature. Furthermore, I review three researches that someway work this problem: Bandinelli, Zanker and Martins. Even though the associations between divinities and rulers were very common – Augustus represented as Apollo, Jupiter or Neptune; Tiberius as Apollo; Claudius as Jupiter; or Commodus as Hercules –, the discussion on the relationship between Augustus and Mercury is very rare in recent bibliography. The latest relevant research on this subject dates back to the first half of the twentieth century. Chittenden’s work on numismatic and Grether’s article on epigraphy are both very important. Thus, new evidences must be considered, so that we can further investigate these representations in the Roman world.

  8. Mercury dosing solutions for fluorescent lamps

    Energy Technology Data Exchange (ETDEWEB)

    Corazza, A; Boffito, C [SAES Getters S.p.A., Viale Italia 77, Lainate (MI) 20020 (Italy)], E-mail: alessio_corazza@saes-group.com

    2008-07-21

    A review of the different technologies used to dose mercury in fluorescent lamps is presented. Conventional liquid mercury dosing is gradually being replaced with more reliable and environmentally friendly solutions that enable a significant reduction of the amount of mercury introduced in the lamp, so as to cope with more stringent regulations issued to minimize the environmental impact of exhausted lamps. This paper will review the most advanced novel methods to assure an accurate and fine dosing of mercury in fluorescent lamps, especially focusing on solutions based on the use of solid alloys.

  9. Sorbents for mercury removal from flue gas

    Energy Technology Data Exchange (ETDEWEB)

    Granite, Evan J.; Hargis, Richard A.; Pennline, Henry W.

    1998-01-01

    A review of the various promoters and sorbents examined for the removal of mercury from flue gas is presented. Commercial sorbent processes are described along with the chemistry of the various sorbent-mercury interactions. Novel sorbents for removing mercury from flue gas are suggested. Since activated carbons are expensive, alternate sorbents and/or improved activated carbons are needed. Because of their lower cost, sorbent development work can focus on base metal oxides and halides. Additionally, the long-term sequestration of the mercury on the sorbent needs to be addressed. Contacting methods between the flue gas and the sorbent also merit investigation.

  10. Risk assessment of mercury contaminated sites

    International Nuclear Information System (INIS)

    Hempel, M.

    1993-01-01

    At two sites, highly contaminated with mercury, risk assessment was executed. Methods were developed to determine organomercury compounds in water, air and soil. Toxicity tests demonstrated the high toxicity of organomercury compounds compared to inorganic mercury. Besides highly toxic methylmercury, ethylmercury was found in soils close to a chemical plant in Marktredwitz. In ultrafiltration-experiments mercury showed great affinity to high molecular substances in water. Lysimeter-experiments proved, that organomercury compounds are adsorbed and transformed to inorganic and elemental mercury. (orig.) [de

  11. Alkaline sorbent injection for mercury control

    Science.gov (United States)

    Madden, Deborah A.; Holmes, Michael J.

    2002-01-01

    A mercury removal system for removing mercury from combustion flue gases is provided in which alkaline sorbents at generally extremely low stoichiometric molar ratios of alkaline earth or an alkali metal to sulfur of less than 1.0 are injected into a power plant system at one or more locations to remove at least between about 40% and 60% of the mercury content from combustion flue gases. Small amounts of alkaline sorbents are injected into the flue gas stream at a relatively low rate. A particulate filter is used to remove mercury-containing particles downstream of each injection point used in the power plant system.

  12. Apparatus for isotopic alteration of mercury vapor

    Science.gov (United States)

    Grossman, Mark W.; George, William A.; Marcucci, Rudolph V.

    1988-01-01

    An apparatus for enriching the isotopic Hg content of mercury is provided. The apparatus includes a reactor, a low pressure electric discharge lamp containing a fill including mercury and an inert gas. A filter is arranged concentrically around the lamp. In a preferred embodiment, constant mercury pressure is maintained in the filter by means of a water-cooled tube that depends from it, the tube having a drop of mercury disposed in it. The reactor is arranged around the filter, whereby radiation from said lamp passes through the filter and into said reactor. The lamp, the filter and the reactor are formed of a material which is transparent to ultraviolet light.

  13. Identification of elemental mercury in the subsurface

    Science.gov (United States)

    Jackson, Dennis G

    2015-01-06

    An apparatus and process is provided for detecting elemental mercury in soil. A sacrificial electrode of aluminum is inserted below ground to a desired location using direct-push/cone-penetrometer based equipment. The insertion process removes any oxides or previously found mercury from the electrode surface. Any mercury present adjacent the electrode can be detected using a voltmeter which indicates the presence or absence of mercury. Upon repositioning the electrode within the soil, a fresh surface of the aluminum electrode is created allowing additional new measurements.

  14. Coal fired flue gas mercury emission controls

    International Nuclear Information System (INIS)

    Wu, Jiang; Pan, Weiguo; Cao, Yan; Pan, Weiping

    2015-01-01

    Mercury (Hg) is one of the most toxic heavy metals, harmful to both the environment and human health. Hg is released into the atmosphere from natural and anthropogenic sources and its emission control has caused much concern. This book introduces readers to Hg pollution from natural and anthropogenic sources and systematically describes coal-fired flue gas mercury emission control in industry, especially from coal-fired power stations. Mercury emission control theory and experimental research are demonstrated, including how elemental mercury is oxidized into oxidized mercury and the effect of flue gas contents on the mercury speciation transformation process. Mercury emission control methods, such as existing APCDs (air pollution control devices) at power stations, sorbent injection, additives in coal combustion and photo-catalytic methods are introduced in detail. Lab-scale, pilot-scale and full-scale experimental studies of sorbent injection conducted by the authors are presented systematically, helping researchers and engineers to understand how this approach reduces the mercury emissions in flue gas and to apply the methods in mercury emission control at coal-fired power stations.

  15. Ocular disorders among workers exposed to mercury.

    Science.gov (United States)

    Gabal, M S; Raslan, O A

    1995-01-01

    Mercury vapor exposed workers may show ocular changes, as well as other systems affection. A sample of 84 workers in preparing mercury fulminate were examined for conjunctival corneal and lenticular manifestation of long duration exposure, together with mercury urinary output. Lens changes were found in 50% of the involved workers while keratopathy as recorded in 34.5% of them. No statistically significant association was found between the occurrence of eye lesions and levels of urinary elimination of mercury. These results suggest local absorption of this element is most probably the underlying cause of ocular affection.

  16. Increased mercury emissions from modern dental amalgams.

    Science.gov (United States)

    Bengtsson, Ulf G; Hylander, Lars D

    2017-04-01

    All types of dental amalgams contain mercury, which partly is emitted as mercury vapor. All types of dental amalgams corrode after being placed in the oral cavity. Modern high copper amalgams exhibit two new traits of increased instability. Firstly, when subjected to wear/polishing, droplets rich in mercury are formed on the surface, showing that mercury is not being strongly bonded to the base or alloy metals. Secondly, high copper amalgams emit substantially larger amounts of mercury vapor than the low copper amalgams used before the 1970s. High copper amalgams has been developed with focus on mechanical strength and corrosion resistance, but has been sub-optimized in other aspects, resulting in increased instability and higher emission of mercury vapor. This has not been presented to policy makers and scientists. Both low and high copper amalgams undergo a transformation process for several years after placement, resulting in a substantial reduction in mercury content, but there exist no limit for maximum allowed emission of mercury from dental amalgams. These modern high copper amalgams are nowadays totally dominating the European, US and other markets, resulting in significant emissions of mercury, not considered when judging their suitability for dental restoration.

  17. Side effects of mercury in dental amalgam

    Directory of Open Access Journals (Sweden)

    Titiek Berniyanti

    2008-03-01

    Full Text Available Dental amalgam is an alloy composed of mixture of approximately equal parts of elemental liquid mercury and an alloy powder. The popularity of amalgam arises from excellent long term performance, ease of use and low cost. Despite the popularity of dental amalgam as restorative material, there have been concerns regarding the potential adverse health and environmental effects arising from exposure to mercury in amalgam. They have long been believed to be of little significance as contributors to the overall body burden of mercury, because the elemental form of mercury is rapidly consumed in the setting reaction of the restoration. In 1997, 80% of dentist in Indonesia still using amalgam as an alternative material, and 60% of them treat the rest of unused amalgam carelessly. In recent years, the possible environmental and health impact caused by certain routines in dental practice has attracted attention among regulators. As part of point source reduction strategies, the discharge of mercury/amalgam-contaminated wastes has been regulated in a number of countries, even though it has been documented that by adopting appropriate mercury hygiene measures, the impact of amalgam use in dentistry is minimal. The purpose of this paper is to examine on studies that relate mercury levels in human to the presence of dental amalgams. It is concluded that even though mercury used in filling is hazardous, if normal occupational recommendations for proper mercury hygiene routines and source of reduction strategies are followed, no occupational health risk can be assumed.

  18. Observations of Mercury in 1988 and 1989

    International Nuclear Information System (INIS)

    Schmude, R.W. Jr.

    1990-01-01

    A visual study of the planet Mercury was carried out in May 1988 and in April and May 1989. Most of the observations were made with the 35.5-cm telescope at the Texas A ampersand M University Observatory. This report presents drawings and a map of Mercury that covers the longitude range of 195-285 deg. One important finding was that a polarizing filter combined with color filters gives a sharper view of the planet. It is also concluded that high-resolution images of Mercury's terminator, either as seen from the earth or with the Hubble Space Telescope, can provide information about Mercury's topography. 10 refs

  19. Phytoremediation of Ionic and Methyl Mercury Pollution

    Energy Technology Data Exchange (ETDEWEB)

    Meagher, Richard B.

    2005-06-01

    Phytoremediation is defined as the use of plants to extract, resist, detoxify, and/or sequester toxic environmental pollutants. The long-term goal of the proposed research is to develop and test highly productive, field-adapted plant species that have been engineered for the phytoremediation of mercury. A variety of different genes, which should enable plants to clean mercury polluted sites are being tested as tools for mercury phytoremediation, first in model laboratory plants and then in potential field species. Several of these genes have already been shown to enhance mercury phytoremediation. Mercury pollution is a serious, world-wide problem affecting the health of human and wildlife populations. Environmentally, the most serious mercury threat is the production of methylmercury (CH3Hg+) by native bacteria at mercury contaminated wetland sites. Methylmercury is inherently more toxic than metallic (Hg(0)) or ionic (Hg(II)) mercury, and because methylmercury is prolifically biomagnified up the food chain, it poses the most immediate danger to animal populations. We have successfully engineered two model plants, Arabidopsis and tobacco, to use the bacterial merB gene to convert methylmercury to less toxic ionic mercury and to use the bacterial merA gene to further detoxify ionic mercury to the least toxic form of mercury, metallic mercury. Plants expressing both MerA and MerB proteins detoxify methylmercury in two steps to the metallic form. These plants germinate, grow, and set seed at normal growth rates on levels of methylmercury or ionic mercury that are lethal to normal plants. Our newest efforts involve engineering plants with several additional bacterial and plant genes that allow for higher levels of mercury resistance and mercury hyperaccumulation. The potential for these plants to hyperaccumulate mercury was further advanced by developing constitutive, aboveground, and root-specific gene expression systems. Our current strategy is to engineer plants to

  20. EDITORIAL: Mercury-free discharges for lighting

    Science.gov (United States)

    Haverlag, M.

    2007-07-01

    This special Cluster of articles in Journal of Physics D: Applied Physics covers the subject of mercury-free discharges that are being investigated by different light source researchers, as an alternative to existing mercury-containing lamps. The main driving force to move away from mercury-containing discharge light sources is connected to the environmentally unfriendly nature of mercury. After inhalation or direct contact, severe mercury exposure can lead to damage to human brain cells, the kidneys, the liver and the nervous system. For this reason, the use of mercury in products is becoming more and more restricted by different governmental bodies. In the lighting industry, however, many products still make use of mercury, for different reasons. The main reason is that mercury-containing products are, in most cases, more efficient than mercury-free products. For a realistic comparison of the environmental impact, the mercury-contamination due to electricity production must be taken into account, which depends on the type of fuel being used. For an average European fuel-mix, the amount of mercury that is released into the environment is around 29 μg kWh-1. This means that a typical 30 W TL lamp during a lifetime of 20,000 hours will release a total of about 20 mg mercury due to electricity production, which exceeds the total mercury dose in the lamp (more and more of which is being recycled) by a factor of 5-10 for a modern TL lamp. This illustrates that, quite apart from other environmental arguments like increased CO2 production, mercury-free alternatives that use more energy can in fact be detrimental for the total mercury pollution over the lifetime of the lamp. For this reason, the lighting industry has concentrated on lowering the mercury content in lamps as long as no efficient alternatives exist. Nevertheless, new initiatives for HID lamps and fluorescent lamps with more or less equal efficiency are underway, and a number of them are described in this

  1. Rapid Monitoring of Mercury in Air from an Organic Chemical Factory in China Using a Portable Mercury Analyzer

    OpenAIRE

    Yasutake, Akira; Cheng, Jin Ping; Kiyono, Masako; Uraguchi, Shimpei; Liu, Xiaojie; Miura, Kyoko; Yasuda, Yoshiaki; Mashyanov, Nikolay

    2011-01-01

    A chemical factory, using a production technology of acetaldehyde with mercury catalysis, was located southeast of Qingzhen City in Guizhou Province, China. Previous research showed heavy mercury pollution through an extensive downstream area. A current investigation of the mercury distribution in ambient air, soils, and plants suggests that mobile mercury species in soils created elevated mercury concentrations in ambient air and vegetation. Mercury concentrations of up to 600 ng/m3 in air o...

  2. Multiscale geomorphometric modeling of Mercury

    Science.gov (United States)

    Florinsky, I. V.

    2018-02-01

    Topography is one of the key characteristics of a planetary body. Geomorphometry deals with quantitative modeling and analysis of the topographic surface and relationships between topography and other natural components of landscapes. The surface of Mercury is systematically studied by interpretation of images acquired during the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) mission. However, the Mercurian surface is still little explored by methods of geomorphometry. In this paper, we evaluate the Mercury MESSENGER Global DEM MSGR_DEM_USG_SC_I_V02 - a global digital elevation model (DEM) of Mercury with the resolution of 0.015625° - as a source for geomorphometric modeling of this planet. The study was performed at three spatial scales: the global, regional (the Caloris basin), and local (the Pantheon Fossae area) ones. As the initial data, we used three DEMs of these areas with resolutions of 0.25°, 0.0625°, and 0.015625°, correspondingly. The DEMs were extracted from the MESSENGER Global DEM. From the DEMs, we derived digital models of several fundamental morphometric variables, such as: slope gradient, horizontal curvature, vertical curvature, minimal curvature, maximal curvature, catchment area, and dispersive area. The morphometric maps obtained represent peculiarities of the Mercurian topography in different ways, according to the physical and mathematical sense of a particular variable. Geomorphometric models are a rich source of information on the Mercurian surface. These data can be utilized to study evolution and internal structure of the planet, for example, to visualize and quantify regional topographic differences as well as to refine geological boundaries.

  3. Experimental Investigation of Magnetohydrodynamics Effects in Molten Metals and Study of Homogeneity of Radioactive Mercury Amalgams

    CERN Document Server

    Astone, A

    2002-01-01

    The high neutrino output demanded for a neutri no factory requests a high power proton beam interacting with a static target. The additional circumstances of limited space and long term stability ask for development of novel concepts for such types of targets. In our working group, part of the Neutri no Factory Working Group (NFWG) of CERN, we are investigating on the proton interaction with the mercury target. This is called the study of proton induced shocks in molten metal. In the US scheme for a neutrino factory the interaction between proton beam and the mercury jet target takes place inside a 20 Tesla solenoidal magnetic field, which serv es as a focusing device for the produced particles. This field of study is refe rred to as Magneto Hydrodynamics (MHD). The high power proton beam deposits a large amount of energy in the small volume of the target, which results in disruption. The aim is to establi...

  4. Evaluation of thallium-201 exercise scintigraphy in coronary heart disease

    International Nuclear Information System (INIS)

    Murray, R.G.; McKillop, J.H.; Bessent, R.G.; Turner, J.G.; Lorimer, A.R.; Hutton, I.; Greig, W.R.; Lawrie, T.D.V.

    1979-01-01

    Thallium-201 myocardial imaging provides a non-invasive technique in the investigation of patients with suspected coronary heart disease. This study was designed to evaluate thallium-201 ( 201 Tl) scintigraphy in predicting the presence or absence of coronary heart disease in 50 patients presenting with chest pain. The results suggest that computer analysed 201 Tl exercise scintigraphy is a valuable technique for identifying patients with significant coronary artery disease. 201 Tl image data were highly sensitive for detecting the presence of coronary artery disease though accuracy in predicting the extent of disease was limited in patients with multiple vessel disease. The data provides further justification for the use of exercise 201 Tl scintigraphy especially in conjunction with exercise electrocardiography in the investigation of patients with chest pain. (author)

  5. Tl-201 per rectum scintigraphy in chronic liver disease: assessment of Tl-201 uptake indices

    International Nuclear Information System (INIS)

    Moon, Won Jin; Choi, Yun Young; Cho, Suk Shin; Lee, Min Ho

    1999-01-01

    Heart to liver ratio on Tl-201 per rectal scintigraphy (shunt index) is known to be useful in the assessment of portal systemic shunt. We assessed Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 and correlated with shunt index in patients with chronic active hepatitis (CAH) and liver cirrhosis (LC). Fifty eight patients with biopsy-proven chronic liver disease (35 with CAH, 23 with LC) underwent Tl-201 per rectum scintigraphy after instillation of 18.5 MBq of Tl-201 into the upper rectum. We evaluated hepatic uptake (type 1: homogeneous, 2: inhomogeneous segmental, 3: inhomogeneous nonsegmental) and extrahepatic uptake of spleen, heart and kidney (grade 0: no uptake, 1: less than liver, 2: equal to liver, 3: greater than liver). We measured the early liver/heart uptake rate (the slope of the liver to heart uptake ratio for 10 mim) and shunt index (heart to liver uptake ratio). Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 was correlated with the pathologic diagnosis and shunt index. Hepatic uptake patterns of type 1 and 2 were dominant in CAH (CAH: 27/35, LC: 8/23), and type 3 in LC (CAH: 8/35, LC: 15/23)(p<0.005). The grades of extrahepatic uptake were higher in LC than in CAH (spleen: p<0.001, other soft tissue: p<0.005). The early liver/heart uptake rate of CAH (0.110±0.111) was significantly higher than that of LC (0.014±0.090)(p<0.001). The sensitivity and specificity of the early liver/heart uptake rate were 77.7% and 67.7% in differentiating LC from CAH. There was negative correlation between early liver/heart uptake rate and shunt index (r=-0.3347, p<0.01). Hepatic and extrahepatic uptake pattern and early liver/heart uptake rate on Tl-201 per rectum scintigraphy are useful in the assessment of portal systemic shunt in patients with chronic liver disease

  6. 7 CFR 201.26 - Kind, variety, and hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind, variety, and hybrid. 201.26 Section 201.26... REGULATIONS Labeling Vegetable Seeds § 201.26 Kind, variety, and hybrid. The label shall bear the name of each... kind or variety named on the label is “hybrid” seed, it shall be so designated on the label. If two or...

  7. 7 CFR 201.16 - Noxious-weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and the...

  8. Mercury removal from liquid and solid mixed waste

    International Nuclear Information System (INIS)

    Gates, D.D.; Klasson, K.T.; Corder, S.L.; Cameron, P.A.; Perona, J.J.

    1995-01-01

    Based on bench-scale laboratory experiments, the following conclusions were reached: Sulfur-impregnated, activated, carbon pellets (Mersorb) can be used to remove mercury (Hg 2+ ) to below EPA's toxic characteristic level (0.2 mg/L). Mersorb works under acid conditions (pH 2) but its capacity is reduced by approximately 50% compared with neutral conditions. Competing ions present in the target waste stream reduced the Mersorb capacity by 50%. Mersorb appears to be economical compared with leading ion exchange resin. KI/I 2 leaching solution can be used to remove up to 99% of Hg in contaminated soil and glass. KI/I 2 leaching solution worked well with several mercury species, including Hg 0 , HgO, HgS, and HgCl 2 . KI/I 2 leaching solution worked well with a wide variety of initial mercury concentrations. Radionuclide surrogate studies suggested that uranium will not partition into KI/I 2 leaching solutions. Cesium may partition into the KI/I 2 leaching solution because of the high solubility of cesium salts

  9. Maternal transfer of mercury to songbird eggs.

    Science.gov (United States)

    Ackerman, Joshua T; Hartman, C Alex; Herzog, Mark P

    2017-11-01

    We evaluated the maternal transfer of mercury to eggs in songbirds, determined whether this relationship differed between songbird species, and developed equations for predicting mercury concentrations in eggs from maternal blood. We sampled blood and feathers from 44 house wren (Troglodytes aedon) and 34 tree swallow (Tachycineta bicolor) mothers and collected their full clutches (n = 476 eggs) within 3 days of clutch completion. Additionally, we sampled blood and feathers from 53 tree swallow mothers and randomly collected one egg from their clutches (n = 53 eggs) during mid to late incubation (6-10 days incubated) to evaluate whether the relationship varied with the timing of sampling the mother's blood. Mercury concentrations in eggs were positively correlated with mercury concentrations in maternal blood sampled at (1) the time of clutch completion for both house wrens (R 2  = 0.97) and tree swallows (R 2  = 0.97) and (2) during mid to late incubation for tree swallows (R 2  = 0.71). The relationship between mercury concentrations in eggs and maternal blood did not differ with the stage of incubation when maternal blood was sampled. Importantly, the proportion of mercury transferred from mothers to their eggs decreased substantially with increasing blood mercury concentrations in tree swallows, but increased slightly with increasing blood mercury concentrations in house wrens. Additionally, the proportion of mercury transferred to eggs at the same maternal blood mercury concentration differed between species. Specifically, tree swallow mothers transferred 17%-107% more mercury to their eggs than house wren mothers over the observed mercury concentrations in maternal blood (0.15-1.92 μg/g ww). In contrast, mercury concentrations in eggs were not correlated with those in maternal feathers and, likewise, mercury concentrations in maternal blood were not correlated with those in feathers (all R 2  mercury concentrations from maternal blood to eggs

  10. Recovery of Mercury From Contaminated Liquid Wastes

    International Nuclear Information System (INIS)

    1998-01-01

    The Base Contract program emphasized the manufacture and testing of superior sorbents for mercury removal, testing of the sorption process at a DOE site, and determination of the regeneration conditions in the laboratory. During this project, ADA Technologies, Inc. demonstrated the following key elements of a successful regenerable mercury sorption process: (1) sorbents that have a high capacity for dissolved, ionic mercury; (2) removal of ionic mercury at greater than 99% efficiency; and (3) thermal regeneration of the spent sorbent. ADA's process is based on the highly efficient and selective sorption of mercury by noble metals. Contaminated liquid flows through two packed columns that contain microporous sorbent particles on which a noble metal has been finely dispersed. A third column is held in reserve. When the sorbent is loaded with mercury to the point of breakthrough at the outlet of the second column, the first column is taken off-line and the flow of contaminated liquid is switched to the second and third columns. The spent column is regenerated by heating. A small flow of purge gas carries the desorbed mercury to a capture unit where the liquid mercury is recovered. Laboratory-scale tests with mercuric chloride solutions demonstrated the sorbents' ability to remove mercury from contaminated wastewater. Isotherms on surrogate wastes from DOE's Y-12 Plant in Oak Ridge, Tennessee showed greater than 99.9% mercury removal. Laboratory- and pilot-scale tests on actual Y-12 Plant wastes were also successful. Mercury concentrations were reduced to less than 1 ppt from a starting concentration of 1,000 ppt. The treatment objective was 50 ppt. The sorption unit showed 10 ppt discharge after six months. Laboratory-scale tests demonstrated the feasibility of sorbent regeneration. Results show that sorption behavior is not affected after four cycles

  11. Worldwide trend of atmospheric mercury since 1995

    Directory of Open Access Journals (Sweden)

    F. Slemr

    2011-05-01

    Full Text Available Concern about the adverse effects of mercury on human health and ecosystems has led to tightening emission controls since the mid 1980s. But the resulting mercury emissions reductions in many parts of the world are believed to be offset or even surpassed by the increasing emissions in rapidly industrializing countries. Consequently, concentrations of atmospheric mercury are expected to remain roughly constant. Here we show that the worldwide atmospheric mercury concentrations have decreased by about 20 to 38 % since 1996 as indicated by long-term monitoring at stations in the Southern and Northern Hemispheres combined with intermittent measurements of latitudinal distribution over the Atlantic Ocean. The total reduction of the atmospheric mercury burden of this magnitude within 14 years is unusually large among most atmospheric trace gases and is at odds with the current mercury emission inventories with nearly constant anthropogenic emissions over this period. This suggests a major shift in the biogeochemical cycle of mercury including oceans and soil reservoirs. Decreasing reemissions from the legacy of historical mercury emissions are the most likely explanation for this decline since the hypothesis of an accelerated oxidation rate of elemental mercury in the atmosphere is not supported by the observed trends of other trace gases. Acidification of oceans, climate change, excess nutrient input and pollution may also contribute by their impact on the biogeochemistry of ocean and soils. Consequently, models of the atmospheric mercury cycle have to include soil and ocean mercury pools and their dynamics to be able to make projections of future trends.

  12. Clinical evaluation of Tl-201 SPECT in nasopharyngeal carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Togawa, Takashi; Yui, Nobuharu; Shimada, Fumiyuki; Omura, Ken; Katahashi, Tatsuaki; Hatano, Kazuo [Chiba Cancer Center (Japan). Hospital

    1995-03-01

    Tl-201 SPECT was performed on 19 patients, 13 males and 6 females aged 28 to 73 yrs (mean 51), with nasopharyngeal carcinoma (NPC) histologically proven to evaluate whether or not Tl-201 SPECT was useful and reliable for assessing the tumor viability of NPC. Thirty eight Tl-201 SPECT studies were performed for the follow-up study after radiation therapy in 9 of 19 patients and for the assessment of tumor extent before treatment in the other 10 patients. Data acquisition was started 5 min after the intravenous injection of 111 MBq of Tl-201 chloride using a three-head rotating gamma camera (Toshiba GCA 9300A) equipped with fan-beam collimators. Tl-201 clearly accumulated to the tumor in 10 patients before radiation treatment and increased Tl-201 uptake by the lesion disappeared after the treatment. Three of 9 patients who were followed up after radiotherapy developed apparent local recurrence and Tl-201 SPECT could definitely visualize these recurrent lesions. Tl-201 SPECT was very useful for detecting local recurrent tumor. High resolution SPECT system with the use of Tl-201 chloride is a new reliable and accurate diagnostic tool for assessing the tumor viability of NPC. (author).

  13. Mercury Methylation and Detoxification by Novel Microorganisms in Mercury Enriched Mesothermal Springs

    Science.gov (United States)

    Gionfriddo, C. M.; Krabbenhoft, D. P.; Stott, M.; Wick, R. R.; Schultz, M. B.; Holt, K. E.; Moreau, J. W.

    2015-12-01

    Hot springs and fumaroles release significant quantities of aqueous and gaseous mercury into the environment. Yet few studies have looked at the microbial underpinnings of mercury transformations in geothermal settings. Recent advancements in culture-independent molecular techniques, such as ultra-high-throughput sequencing, allow us to delve deeply into the functional and phylogenetic make-up of these extreme environments. Here we present results from deep metagenomic sequencing of geothermal microbial communities cycling mercury, focussing on the connections between putative metabolisms and mercury methylation, and the evolution of the mer-operon. Presented are data from two adjacent, acidic (pHNew Zealand), extremely enriched in total mercury (>1000 ng L-1), and varying methylmercury concentrations (1-10 ng L-1). Microbial communities of both springs are dominated by mercury resistant acidophilic, sulfur- and iron-cycling microbes: Acidithiobacillus, Thiomonas, and Thermoplasma. Mercury methylation genes (hgcAB) were only detected in the cooler spring (ΔT~10 °C), with an order of magnitude greater methylmercury (10 ng L-1). The hgcAB genes have no known closest relatives (40°C), and methylmercury concentration. We conclude that the relative amount of mercury methylation in each hot spring is controlled by the presence of methylating bacteria and archaea, the release of bioavailable mercury species from sulfide minerals, counterbalanced by microbial mercury demethylation and reduction and mercury sulfide mineralization.

  14. Mercury rising : mercury emissions from Ontario Power Generation's coal-fired plants

    International Nuclear Information System (INIS)

    Rang, S.

    2004-09-01

    Ontario Power Generation (OPG) operates 5 coal-fired power plants which are the largest single source of mercury emissions in Ontario. Mercury is a persistent, bioaccumulative neurotoxin which is considered toxic under the Canadian Environmental Protection Act. This report examines the health and environmental impacts of mercury, and the trends for mercury emission in Ontario. In 2002, the 5 coal-fired plants emitted 527 kg of mercury into the atmosphere and contributed 39 per cent of the total amount of mercury emitted into the air. While many other sectors have reduced their mercury emissions since 1988, Ontario's coal-fired plants have lagged behind and have actually increased mercury emissions by 16 per cent since 1988. This paper suggests that phasing out OPG coal-fired plants by 2007 could lead to a 39 per cent reduction in airborne mercury emissions. It would also allow Ontario to achieve the Canada Wide Standard for mercury emissions 3 years early, and would help both Ontario and Canada meet air pollution reduction commitments under international agreements. It was noted that phasing out coal-fired power plants by one-third will help Ontario achieve its goal of a 90 per cent reduction in mercury emissions by 2010. It was suggested that alternative power sources can offer a wide range of environmental advantages. 16 refs., 3 tabs., 2 figs

  15. Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2

    Energy Technology Data Exchange (ETDEWEB)

    Tuzen, Mustafa, E-mail: m.tuzen@gmail.com [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Uluozlu, Ozgur Dogan [Gaziosmanpasa University, Faculty of Science and Arts, Chemistry Department, 60250 Tokat (Turkey); Karaman, Isa [Gaziosmanpasa University, Faculty of Science and Arts, Biology Department, 60250 Tokat (Turkey); Soylak, Mustafa [Erciyes University, Faculty of Science and Arts, Chemistry Department, 38039 Kayseri (Turkey)

    2009-09-30

    A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L{sup -1} HCl for methyl mercury and 2 mol L{sup -1} HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g{sup -1}. The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L{sup -1}. Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.

  16. Mercury(II) and methyl mercury speciation on Streptococcus pyogenes loaded Dowex Optipore SD-2

    International Nuclear Information System (INIS)

    Tuzen, Mustafa; Uluozlu, Ozgur Dogan; Karaman, Isa; Soylak, Mustafa

    2009-01-01

    A solid phase extraction procedure based on speciation of mercury(II) and methyl mercury on Streptococcus pyogenes immobilized on Dowex Optipore SD-2 has been established. Selective and sequential elution with 0.1 mol L -1 HCl for methyl mercury and 2 mol L -1 HCl for mercury(II) were performed at pH 8. The determination of mercury levels was performed by cold vapour atomic absorption spectrometry (CVAAS). Optimal analytical conditions including pH, amounts of biosorbent, sample volumes, etc., were investigated. The influences of the some alkaline and earth alkaline ions and some transition metals on the recoveries were also investigated. The capacity of biosorbent for mercury(II) and methyl mercury was 4.8 and 3.4 mg g -1 . The detection limit (3 sigma) of the reagent blank for mercury(II) and methyl mercury was 2.1 and 1.5 ng L -1 . Preconcentration factor was calculated as 25. The relative standard deviations of the procedure were below 7%. The validation of the presented procedure is performed by the analysis of standard reference material (NRCC-DORM 2 Dogfish Muscle). The procedure was successfully applied to the speciation of mercury(II) and methyl mercury in natural water and environmental samples.

  17. Spallation neutron source target station design, development, and commissioning

    International Nuclear Information System (INIS)

    Haines, J.R.; McManamy, T.J.; Gabriel, T.A.; Battle, R.E.; Chipley, K.K.; Crabtree, J.A.; Jacobs, L.L.; Lousteau, D.C.; Rennich, M.J.; Riemer, B.W.

    2014-01-01

    The spallation neutron source target station is designed to safely, reliably, and efficiently convert a 1 GeV beam of protons to a high flux of about 1 meV neutrons that are available at 24 neutron scattering instrument beam lines. Research and development findings, design requirements, design description, initial checkout testing, and results from early operation with beam are discussed for each of the primary target subsystems, including the mercury target, neutron moderators and reflector, surrounding vessels and shielding, utilities, remote handling equipment, and instrumentation and controls. Future plans for the mercury target development program are also briefly discussed

  18. Sexual differences in the excretion of organic and inorganic mercury by methyl mercury-treated rats

    International Nuclear Information System (INIS)

    Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Mushak, P.; Hall, L.L.

    1987-01-01

    Adult male and female Long Evans rats received 1 mumole of methyl ( 203 Hg) mercuric chloride per kilogram sc. Whole-body retention of mercury and excretion of organic and inorganic mercury in urine and feces were monitored for 98 days after dosing. Females cleared mercury from the body more rapidly than did males. The major route of mercury excretion was feces. By 98 days after dosing, cumulative mercury excretion in feces accounted for about 51% of the dose in males and about 54% of the dose in females. For both sexes, about 33% of the dose was excreted in feces as inorganic mercury. Cumulative excretion of organic mercury in feces accounted for about 18 and 21% of the dose in males and females, respectively. Urinary excretion of mercury was quantitatively a smaller route for mercury clearance but important sexual differences in loss by this route were found. Over the 98-day experimental period, males excreted in urine about 3.2% of the dose and females excreted 7.5%. Cumulative organic Hg excretion in urine accounted for 1.8% of the dose in males and 5.3% of the dose in females. These sexual differences in urinary and fecal excretion of organic and inorganic mercury following methyl mercury treatment were consistent with previous reports of sexual differences in mercury distribution and retention in methyl mercury-treated rats, particularly sexual differences in organic mercury uptake and retention in the kidney. Relationships between body burdens of organic or inorganic Hg and output of these forms of Hg in urine and feces were also found to be influenced by the interval after MeHg treatment and by sex. Relationship between concentration of Hg in liver and feces and in kidney and urine differed for organic and inorganic Hg and depended upon sexual status and interval after MeHg treatment

  19. Safety concept for spallation target system. JAERI/KEK joint project

    International Nuclear Information System (INIS)

    Kobayashi, K.; Kaminaga, M.; Haga, K.; Kinoshita, H.; Hino, R.

    2001-01-01

    A MW-class mercury target of the spallation target generates much larger amounts of radioactive nuclides than existing spallation neutron sources. To estimate the maximum level of public exposure under the guillotine break of mercury pipelines that is one of the major accidents of the target system, the hazard analyses were carried out by using a transportation model which considers heat transmission of mercury decay heat, diffusion of evaporated radioactive nuclides, etc. In the analyses, mercury, iodine, bromine and noble gas were selected as the effective source term because of their high vapor pressures and activation levels. From the preliminary analytical results obtained under the conservative conditions of 2 m/s of the air velocity around the mercury leakage area, the maximum level of the public exposure was approximately 5.8 x 10 -3 mSv. This level is negligible in comparison with 1 mSV one-year natural radiation exposure. (author)

  20. Neonatal nonepileptic myoclonus is a prominent clinical feature of KCNQ2 gain-of-function variants R201C and R201H

    NARCIS (Netherlands)

    Mulkey, S.B.; Ben-Zeev, B.; Nicolai, J.; Carroll, J.L.; Gronborg, S.; Jiang, Y.H.; Joshi, N.; Kelly, M.; Koolen, D.A.; Mikati, M.A.; Park, K.; Pearl, P.L.; Scheffer, I.E.; Spillmann, R.C.; Taglialatela, M.; Vieker, S.; Weckhuysen, S.; Cooper, E.C.; Cilio, M.R.

    2017-01-01

    OBJECTIVE: To analyze whether KCNQ2 R201C and R201H variants, which show atypical gain-of-function electrophysiologic properties in vitro, have a distinct clinical presentation and outcome. METHODS: Ten children with heterozygous, de novo KCNQ2 R201C or R201H variants were identified worldwide,

  1. Increased Mercury Bioaccumulation Follows Water Quality Improvement

    Energy Technology Data Exchange (ETDEWEB)

    Bogle, M.A.; Peterson, M.J.; Smith, J.G.; Southworth, G.R.

    1999-09-15

    Changes in physical and chemical characteristics of aquatic habitats made to reduce or eliminate ecological risks can sometimes have unforeseen consequences. Environmental management activities on the U.S. Dept. of Energy reservation in Oak Ridge, Tennessee,have succeeded in improving water quality in streams impacted by discharges fi-om industrial facilities and waste disposal sites. The diversity and abundance of pollution-sensitive components of the benthic macroinvertebrate communities of three streams improved after new waste treatment systems or remedial actions reduced inputs of various toxic chemicals. Two of the streams were known to be mercury-contaminated from historical spills and waste disposal practices. Waterborne mercury concentrations in the third were typical of uncontaminated systems. In each case, concentrations of mercury in fish, or the apparent biological availability of mercury increased over the period during which ecological metrics indicated improved water quality. In the system where waterborne mercury concentrations were at background levels, increased mercury bioaccumulation was probably a result of reduced aqueous selenium concentrations; however, the mechanisms for increased mercury accumulation in the other two streams remain under investigation. In each of the three systems, reduced inputs of metals and inorganic anions was followed by improvements in the health of aquatic invertebrate communities. However, this reduction in risk to aquatic invertebrates was accompanied by increased risk to humans and piscivorous wildlife related to increased mercury concentrations in fish.

  2. Increased Mercury Bioaccumulation Follows Water Quality Improvement

    International Nuclear Information System (INIS)

    Bogle, M.A.; Peterson, M.J.; Smith, J.G.; Southworth, G.R.

    1999-01-01

    Changes in physical and chemical characteristics of aquatic habitats made to reduce or eliminate ecological risks can sometimes have unforeseen consequences. Environmental management activities on the U.S. Dept. of Energy reservation in Oak Ridge, Tennessee,have succeeded in improving water quality in streams impacted by discharges fi-om industrial facilities and waste disposal sites. The diversity and abundance of pollution-sensitive components of the benthic macroinvertebrate communities of three streams improved after new waste treatment systems or remedial actions reduced inputs of various toxic chemicals. Two of the streams were known to be mercury-contaminated from historical spills and waste disposal practices. Waterborne mercury concentrations in the third were typical of uncontaminated systems. In each case, concentrations of mercury in fish, or the apparent biological availability of mercury increased over the period during which ecological metrics indicated improved water quality. In the system where waterborne mercury concentrations were at background levels, increased mercury bioaccumulation was probably a result of reduced aqueous selenium concentrations; however, the mechanisms for increased mercury accumulation in the other two streams remain under investigation. In each of the three systems, reduced inputs of metals and inorganic anions was followed by improvements in the health of aquatic invertebrate communities. However, this reduction in risk to aquatic invertebrates was accompanied by increased risk to humans and piscivorous wildlife related to increased mercury concentrations in fish

  3. A Challenging Case of Acute Mercury Toxicity

    Directory of Open Access Journals (Sweden)

    Ali Nayfeh

    2018-01-01

    Full Text Available Background. Mercury exists in multiple forms: elemental, organic, and inorganic. Its toxic manifestations depend on the type and magnitude of exposure. The role of colonoscopic decompression in acute mercury toxicity is still unclear. We present a case of acute elemental mercury toxicity secondary to mercury ingestion, which markedly improved with colonoscopic decompression. Clinical Case. A 54-year-old male presented to the ED five days after ingesting five ounces (148 cubic centimeters of elemental mercury. Examination was only significant for a distended abdomen. Labs showed elevated serum and urine mercury levels. An abdominal radiograph showed radiopaque material throughout the colon. Succimer and laxatives were initiated. The patient had recurrent bowel movements, and serial radiographs showed interval decrease of mercury in the descending colon with interval increase in the cecum and ascending colon. Colonoscopic decompression was done successfully. The colon was evacuated, and a repeat radiograph showed decreased hyperdense material in the colon. Three months later, a repeat radiograph showed no hyperdense material in the colon. Conclusion. Ingested elemental mercury can be retained in the colon. Although there are no established guidelines for colonoscopic decompression, our patient showed significant improvement. We believe further studies on this subject are needed to guide management practices.

  4. The influence of floodplains on mercury availability

    Energy Technology Data Exchange (ETDEWEB)

    Wallschlaeger, D.; Wilken, R.D. [GKSS Research Center, Geesthacht (Germany). Inst. of Physical and Chemical Analytics

    1997-09-01

    The floodplains of the German river Elbe affect the mercury distribution in the river system in two different ways: they act both as a medium-term sink and as a long-term source. The large amounts of mercury deposited onto the floodplains during annual floodings are first effectively fixed in the soils, rendering them basically unavailable. Sequential extraction experiments reveal that only a small fraction of the mercury (< 3%) is present in available forms, whereas the vast majority is associated with humic substances or present in sulfidic binding forms. After deposition, a small fraction of the total mercury is gradually remobilized into the aqueous phase bound passively to water-soluble humic acids. The availability of mercury in these complexes is still low, since environmental influences such as changes in pH or redox potential and competition with other cations do not cause any mercury liberation. In the next step, reactions in the aqueous phase lead to the formation of the highly available volatile species Hg{sup 0} and dimethylmercury (DMM). Their evaporation gives rise to a strong mercury flux from the floodplains into the atmosphere. Preliminary mass balances indicate that the majority of the deposited mercury stays bound in the floodplain soils, while small amounts are emitted back into the river`s ecosystem. Atmospheric emission is more important as a remobilization pathway than aquatic export.

  5. OCCURENCE OF MERCURY IN PET FOOD

    Directory of Open Access Journals (Sweden)

    M.C. Abete

    2013-02-01

    Full Text Available Mercury levels in 61 complete pet feed containing fish were evaluated. In five samples a mercury content exceeding the maximum residues level (0.4 mg/kg was detected. The statistical evaluation didn’t show a significant correlation between the percentage of fish in feedingstuffs and the contamination level.

  6. Hair mercury measurement in Egyptian autistic children

    African Journals Online (AJOL)

    Farida El-baz

    Abstract Background: A review of medical literature has shown that exposure to mercury, whether organic or inorganic, can give rise to the symptoms and traits defining or commonly found in autism spectrum disorders (ASD). Mercury can cause impairments in social interaction, commu- nication difficulties, and repetitive ...

  7. Terahertz oscillations in mercury cuprate superconductors

    Indian Academy of Sciences (India)

    Abstract. It has been recently reported that the three-dimensional Bose–Einstein con- densation of the quasi-particles is valid for the mercury cuprates at liquid helium tem- perature. In this study, the validity of the interlayer theory in three dimensions has been investigated for optimally oxygen-doped mercury cuprates at the ...

  8. Mercury poisoning | Shamley | South African Medical Journal

    African Journals Online (AJOL)

    The diagnosis of mercury poisoning requires a high index of suspicion. Mercury poisoning in a patient involved in illicit gold extraction is reported and 6 other cases considered. Some of the clinical features and treatment of this condition are discussed. S Afr Med J 1989; 76: 114-116 ...

  9. Mercury soil surveys: a good reconnaissance tool

    Energy Technology Data Exchange (ETDEWEB)

    Stone, C.; Ruscetta, C.A.; Foley, D. (eds.)

    1981-05-01

    Three examples of mercury soil surveys are discussed, along with the gravity data. An excellent correlation was found in southern Arizona between buried structures revealed by gravity and mercury soil surveys. The advantages of the latter over the former as a reconnaissance tool are listed. (MHR)

  10. Intentional intravenous mercury injection | Yudelowitz | South African ...

    African Journals Online (AJOL)

    Intravenous mercury injection is rarely seen, with few documented cases. Treatment strategies are not clearly defined for such cases, although a few options do show benefit. This case report describes a 29-year-old man suffering from bipolar disorder, who presented following self-inflicted intravenous injection of mercury.

  11. Pneumonitis after Inhalation of Mercury Vapours

    Directory of Open Access Journals (Sweden)

    JD Glezos

    2006-01-01

    Full Text Available A 43-year-old man presented to hospital with pneumonia but only after discharge from hospital did he admit to deliberate prior inhalation of mercury. His pulmonary involvement appeared to resolve almost completely with antibiotics and supportive care. Nevertheless, persisting elevated urinary excretion of mercury required two courses of chelation therapy. No serious systemic sequelae were observed.

  12. Recent Advances in Atmospheric Chemistry of Mercury

    Directory of Open Access Journals (Sweden)

    Lin Si

    2018-02-01

    Full Text Available Mercury is one of the most toxic metals and has global importance due to the biomagnification and bioaccumulation of organomercury via the aquatic food web. The physical and chemical transformations of various mercury species in the atmosphere strongly influence their composition, phase, transport characteristics and deposition rate back to the ground. Modeling efforts to assess global cycling of mercury require an accurate understanding of atmospheric mercury chemistry. Yet, there are several key uncertainties precluding accurate modeling of physical and chemical transformations. We focus this article on recent studies (since 2015 on improving our understanding of the atmospheric chemistry of mercury. We discuss recent advances in determining the dominant atmospheric oxidant of elemental mercury (Hg0 and understanding the oxidation reactions of Hg0 by halogen atoms and by nitrate radical (NO3—in the aqueous reduction of oxidized mercury compounds (HgII as well as in the heterogeneous reactions of Hg on atmospheric-relevant surfaces. The need for future research to improve understanding of the fate and transformation of mercury in the atmosphere is also discussed.

  13. Urban artisanal gold shops and mercury emissions

    International Nuclear Information System (INIS)

    Cordy, P.; Veiga, M.; Carrasco, V.H.G.

    2008-01-01

    Artisanal miners in developing countries use mercury amalgamation processes to extract gold. The amalgams are then refined before being sold on to urban gold shops. The amalgams can often contain between 2 to 40 per cent mercury. Unburned amalgams are also often sold directly to gold shops. There are serious health risks for shop employees and nearby populations when the gold is melted and further purified. Studies have shown that mercury concentrations in the ambient air of gold shops often exceeds World Health Organization (WHO) limits by an order of magnitude or more. This study examined the practices and technologies used to refine gold in Latin America and Indonesia. The study compared and contrasted various refining methods and their resulting mercury emissions. Methods of reducing mercury emissions were also investigated, including a filtration system designed to capture 80 per cent of mercury emissions. Barriers to implementing mercury emissions reduction plans were also investigated. It was concluded that the design of urban gold shops must include condensers, fume hoods, and efficient mercury capture systems. 15 refs

  14. Mercury cycling in peatland watersheds. Chapter 11.

    Science.gov (United States)

    Randall K. Kolka; Carl P.J. Mitchell; Jeffrey D. Jeremiason; Neal A. Hines; David F. Grigal; Daniel R. Engstrom; Jill K. Coleman-Wasik; Edward A. Nater; Edward B. Swain; Bruce A. Monson; Jacob A. Fleck; Brian Johnson; James E. Almendinger; Brian A. Branfireun; Patrick L. Brezonik; James B. Cotner

    2011-01-01

    Mercury (Hg) is of great environmental concern due to its transformation into the toxic methylmercury (MeHg) form that bioaccumulates within the food chain and causes health concerns for both humans and wildlife (U.S. Environmental Protection Agency 2002). Mercury can affect neurological development in fetuses and young children. In adults, exposure to Hg can lead to...

  15. Mercury in tropical and subtropical coastal environments

    Science.gov (United States)

    Costa, Monica F.; Landing, William M.; Kehrig, Helena A.; Barletta, Mário; Holmes, Christopher D.; Barrocas, Paulo R. G.; Evers, David C.; Buck, David G.; Vasconcellos, Ana Claudia; Hacon, Sandra S.; Moreira, Josino C.; Malm, Olaf

    2012-01-01

    Anthropogenic activities influence the biogeochemical cycles of mercury, both qualitatively and quantitatively, on a global scale from sources to sinks. Anthropogenic processes that alter the temporal and spatial patterns of sources and cycling processes are changing the impacts of mercury contamination on aquatic biota and humans. Human exposure to mercury is dominated by the consumption of fish and products from aquaculture operations. The risk to society and to ecosystems from mercury contamination is growing, and it is important to monitor these expanding risks. However, the extent and manner to which anthropogenic activities will alter mercury sources and biogeochemical cycling in tropical and sub-tropical coastal environments is poorly understood. Factors as (1) lack of reliable local/regional data; (2) rapidly changing environmental conditions; (3) governmental priorities and; (4) technical actions from supra-national institutions, are some of the obstacles to overcome in mercury cycling research and policy formulation. In the tropics and sub-tropics, research on mercury in the environment is moving from an exploratory “inventory” phase towards more process-oriented studies. Addressing biodiversity conservation and human health issues related to mercury contamination of river basins and tropical coastal environments are an integral part of paragraph 221 paragraph of the United Nations document “The Future We Want” issued in Rio de Janeiro in June 2012. PMID:22901765

  16. Episodic bioavailability of environmental mercury: implications for ...

    African Journals Online (AJOL)

    Perennial wildfires in Africa and other continents contribute an estimated 8 x 105 kg of mercury to the global atmosphere with a residence time of approximately one year. This phenomenon changes the flux of biologically available mercury in natural microbial communities where enzymatic actions, including mercuric ...

  17. Terahertz oscillations in mercury cuprate superconductors

    Indian Academy of Sciences (India)

    It has been recently reported that the three-dimensional Bose–Einstein condensation of the quasi-particles is valid for the mercury cuprates at liquid helium temperature. In this study, the validity of the interlayer theory in three dimensions has been investigated for optimally oxygen-doped mercury cuprates at the temperature ...

  18. Mercury in Thana creek, Bombay harbour

    Digital Repository Service at National Institute of Oceanography (India)

    Zingde, M.D.; Desai, B.N.

    Mercury content of the water column estimated along Thana Creek/Bombay Harbour gave a standing stock of about 77 kg in excess of the expected background. Mercury concentration in sediment from 23 locations which varied from 0.17 to 8.21 ppm (dry...

  19. Urban artisanal gold shops and mercury emissions

    Energy Technology Data Exchange (ETDEWEB)

    Cordy, P.; Veiga, M.; Carrasco, V.H.G. [British Columbia Univ., Vancouver, BC (Canada). Dept. of Mining and Mineral Process Engineering

    2008-07-01

    Artisanal miners in developing countries use mercury amalgamation processes to extract gold. The amalgams are then refined before being sold on to urban gold shops. The amalgams can often contain between 2 to 40 per cent mercury. Unburned amalgams are also often sold directly to gold shops. There are serious health risks for shop employees and nearby populations when the gold is melted and further purified. Studies have shown that mercury concentrations in the ambient air of gold shops often exceeds World Health Organization (WHO) limits by an order of magnitude or more. This study examined the practices and technologies used to refine gold in Latin America and Indonesia. The study compared and contrasted various refining methods and their resulting mercury emissions. Methods of reducing mercury emissions were also investigated, including a filtration system designed to capture 80 per cent of mercury emissions. Barriers to implementing mercury emissions reduction plans were also investigated. It was concluded that the design of urban gold shops must include condensers, fume hoods, and efficient mercury capture systems. 15 refs.

  20. Mercury Sorption onto Malt Spent Rootlets

    Science.gov (United States)

    Manariotis, I. D.; Anagnostopoulos, V.; Karapanagioti, H. K.; Chrysikopoulos, C.

    2011-12-01

    Mercury is a metal of particular concern due to its toxicity even at relatively low concentrations. The maximum permissible level for mercury in drinking water set by the European Union is 0.001 mg/L. Mercury is released into the environment via four principal pathways: (1) natural processes; i.e. a volcanic eruption, (2) incidental to some other activity; i.e. coal burning power plants, (3) accidentally during the manufacture, breakage or disposal of products that have mercury put into them deliberately, and (4) direct use in industrial settings. The present study focuses on the removal of mercury (II) from aqueous solutions via sorption onto Malt Spent Rootlets (MSR). Batch experiments were conducted employing MSR with size ranging from 0.18 to 1 mm. The effects of pH, mercury concentration, contact time, and solid to liquid ratio on mercury sorption onto MSR were investigated. The highest mercury removal from the aqueous phase, of 41%, was observed at pH of 5.