WorldWideScience

Sample records for mendelevium 259

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  4. 16 CFR 259.2 - Advertising disclosures.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Advertising disclosures. 259.2 Section 259.2... ADVERTISING FOR NEW AUTOMOBILES § 259.2 Advertising disclosures. (a) No manufacturer or dealer shall make any express or implied representation in advertising concerning the fuel economy of any new automobile 1...

  5. 49 CFR 234.259 - Warning time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Warning time. 234.259 Section 234.259..., Inspection, and Testing Inspections and Tests § 234.259 Warning time. Each crossing warning system shall be tested for the prescribed warning time at least once every 12 months and when the warning system is...

  6. 39 CFR 259.1 - Government.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Government. 259.1 Section 259.1 Postal Service....1 Government. (a) Policy. The Postal Service cooperates with Federal Agencies whenever the overall costs to Government will be reduced. Assistance in a number of special projects and programs is provided...

  7. 50 CFR 259.32 - Conditional fisheries.

    Science.gov (United States)

    2010-10-01

    ... acquisition and/or reconstruction of a used vessel for operation in an adopted conditional fishery shall not... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Conditional fisheries. 259.32 Section 259.32 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC...

  8. 27 CFR 24.259 - Marks.

    Science.gov (United States)

    2010-04-01

    ... shipment. (b) Application of marks. Required marks may be cut, printed, or otherwise legibly and durably... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Marks. 24.259 Section 24....259 Marks. (a) Required marks. Each container larger than four liters or each case used to remove wine...

  9. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  10. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  11. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  12. 50 CFR 259.31 - Acquisition, construction, or reconstruction.

    Science.gov (United States)

    2010-10-01

    ... reconstruction. 259.31 Section 259.31 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC... meet conditional fishery requirements for reconstruction as set forth in § 259.32 and from all... meet conditional fishery requirements for reconstruction as set forth in § 259.32, and shall be exempt...

  13. 30 CFR 259.001 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Purpose and scope. 259.001 Section 259.001 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE MINERAL LEASING: DEFINITIONS § 259.001 Purpose and scope. The purpose of this part 259 is to define various terms appearing in...

  14. 25 CFR 700.259 - Records subject to Privacy Act.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Records subject to Privacy Act. 700.259 Section 700.259 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION COMMISSION OPERATIONS AND RELOCATION PROCEDURES Privacy Act § 700.259 Records subject to Privacy Act. The Privacy Act applies to all “records” as that...

  15. 17 CFR 259.0-1 - Availability of forms.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 259.0-1 Section 259.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS PRESCRIBED UNDER THE PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 § 259.0-1 Availability of forms. (a) This...

  16. 46 CFR 107.259 - Crane inspection and testing.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Crane inspection and testing. 107.259 Section 107.259... INSPECTION AND CERTIFICATION Inspection and Certification § 107.259 Crane inspection and testing. (a) Each crane must be inspected and tested in accordance with Section 3 of the American Petroleum Institute (A.P...

  17. 14 CFR 259.5 - Customer service plan.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Customer service plan. 259.5 Section 259.5... REGULATIONS ENHANCED PROTECTIONS FOR AIRLINE PASSENGERS § 259.5 Customer service plan. (a) Adoption of Plan. Each covered carrier shall adopt a Customer Service Plan applicable to its scheduled flights and shall...

  18. 14 CFR 121.259 - Lines and fittings.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Lines and fittings. 121.259 Section 121.259..., FLAG, AND SUPPLEMENTAL OPERATIONS Special Airworthiness Requirements § 121.259 Lines and fittings. (a) Each line, and its fittings, that is located in a designated fire zone, if it carries flammable fluids...

  19. 7 CFR 1924.259 - Handling dwelling construction complaints.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Handling dwelling construction complaints. 1924.259 Section 1924.259 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING... Construction Defects § 1924.259 Handling dwelling construction complaints. This section describes the procedure...

  20. Adhikari SD Zero-sum problems with subgroup weights 259 ...

    Indian Academy of Sciences (India)

    AUTHOR INDEX. Adhikari S D. Zero-sum problems with subgroup weights. 259. Alaeiyan Mehdi. Semisymmetric cubic graphs of order. 16p2. 19. Alexandru V. On the Iwasawa algebra associated to a normal element of Cp. 45. Alzer Horst. Integral inequalities for self-reciprocal polynomials. 131. Ambily A A see Adhikari S D.

  1. 14 CFR 171.259 - Performance requirements: General.

    Science.gov (United States)

    2010-01-01

    ... System (ISMLS) § 171.259 Performance requirements: General. (a) The ISMLS consists of the following basic... purposes, the tolerances given in parentheses indicated by an asterisk apply to the test instruments used to measure these parameters. Elevation, 0 to 10,000 ft. above sea level. Duty, continuous, unattended...

  2. Cleanup Verification Package for the 600-259 Waste Site

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron

    2006-02-09

    This cleanup verification package documents completion of remedial action for the 600-259 waste site. The site was the former site of the Special Waste Form Lysimeter, consisting of commercial reactor isotope waste forms in contact with soils within engineered caissons, and was used by Pacific Northwest National Laboratory to collect data regarding leaching behavior for target analytes. A Grout Waste Test Facility also operated at the site, designed to test leaching rates of grout-solidified low-level radioactive waste.

  3. 24 CFR 983.259 - Overcrowded, under-occupied, and accessible units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Overcrowded, under-occupied, and accessible units. 983.259 Section 983.259 Housing and Urban Development Regulations Relating to Housing and... HOUSING AND URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.259 Overcrowded, under...

  4. 7 CFR 2.59 - Deputy Under Secretaries for Natural Resources and Environment.

    Science.gov (United States)

    2010-01-01

    ... Environment. 2.59 Section 2.59 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Natural Resources and Environment § 2.59 Deputy Under Secretaries for Natural Resources and Environment. Pursuant to § 2.20(a), subject to reservations in § 2.20(b), and subject to...

  5. 20 CFR 1002.259 - How does USERRA protect an employee's pension benefits?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does USERRA protect an employee's pension benefits? 1002.259 Section 1002.259 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE, DEPARTMENT OF LABOR REGULATIONS UNDER THE UNIFORMED SERVICES EMPLOYMENT AND REEMPLOYMENT RIGHTS ACT OF 1994...

  6. Study of Endothelial Protective Activity of Phenol-Derived Thrombin and Arginase-2 Inhibitors KUD-259 and KUD-974.

    Science.gov (United States)

    Pokrovskii, M V; Korokin, M V; Kudryavtsev, K V; Pokrovskaya, T G; Gudyrev, O S; Gureev, V V; Korokina, L V; Povetkin, S V

    2017-08-01

    We performed correction of endothelial dysfunction with phenol derivatives KUD-259 and KUD-974 containing heteroatomic and heterocyclic structures. Pharmacological activity of KUD-259 and KUD-974 surpassed that of L-norvaline, a non-selective arginase inhibitor.

  7. diarrhoea among 2-59 months children treated in Black Lion

    African Journals Online (AJOL)

    diarrhoea among 2-59 months children treated in Black Lion. Hospital, Addis Ababa, Ethiopia. Damte Shimelis', Daniel Bentiz, Debela Challil. Abstract . Background: Diarrhoeal disease is one of the major causes. of morbidity and mortality in under five children. Worldwide, there are about 1.3 million under five children ...

  8. The role of Glu259 in Escherichia coli elongation factor Tu in ternary complex formation

    DEFF Research Database (Denmark)

    Nautrup Pedersen, Gitte; Rattenborg, Thomas; Knudsen, Charlotte Rohde

    1998-01-01

    spatially and chemically so that only a residue with almost the same size and chemical properties as glutamic acid fulfils the requirements with regard to size, salt bridge-formation potential and maintenance of the backbone conformation at the 259 position. Udgivelsesdato: 1998-Feb...

  9. The Ly Alpha Reference Sample. I. Survey Outline and First Results for Markarian 259

    Czech Academy of Sciences Publication Activity Database

    Ostlin, G.; Hayes, M.; Duval, F.; Sandberg, A.; Rivera-Thorsen, T.; Marquart, T.; Orlitová, Ivana; Adamo, A.; Melinder, J.; Guaita, L.; Atek, H.; Cannon, J.M.; Gruyters, P.; Herenz, E.Ch.; Kunth, D.; Laursen, P.; Más-Hesse, J. M.; Micheva, G.; Oti-Floranes, H.; Pardy, S.; Roth, M.; Schaerer, D.; Verhamme, A.

    2014-01-01

    Roč. 797, č. 1 (2014), 11/1-11/23 ISSN 0004-637X R&D Projects: GA ČR(CZ) GP14-20666P Institutional support: RVO:67985815 Keywords : cosmology: observations * galaxies: evolution * galaxies: individual: Mrk 259 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.993, year: 2014

  10. 259 “Team Pair Solo” Cooperative Learning and Personality Type ...

    African Journals Online (AJOL)

    User

    “Team Pair Solo” Cooperative Learning and Personality. Type as Determinants of Students' Achievement and. Attitude to Chemistry. (Pp. 259-276). Ogunleye, B. O. - Department of Teacher ... how to facilitate a positive learning experience of students. One of ..... collaboration in a team to carry out learning activities required.

  11. 50 CFR 259.30 - Application for Interim Capital Construction Fund Agreement (“Interim CCF Agreement”).

    Science.gov (United States)

    2010-10-01

    ...) Date of construction, acquisition, or reconstruction, (vii) Fishery of operation (which in this section... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Application for Interim Capital Construction Fund Agreement (âInterim CCF Agreementâ). 259.30 Section 259.30 Wildlife and Fisheries NATIONAL...

  12. 17 CFR 259.101 - Form U-1, application or declaration under the Public Utility Holding Company Act of 1935.

    Science.gov (United States)

    2010-04-01

    ... declaration under the Public Utility Holding Company Act of 1935. 259.101 Section 259.101 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS PRESCRIBED UNDER THE PUBLIC UTILITY... declaration under the Public Utility Holding Company Act of 1935. This form shall be used pursuant to Rule 20...

  13. Characterization of a Chinese KCNQ1 mutation (R259H) that shortens repolarization and causes short QT syndrome 2.

    Science.gov (United States)

    Wu, Zhi-Juan; Huang, Yun; Fu, Yi-Cheng; Zhao, Xiao-Jing; Zhu, Chao; Zhang, Yu; Xu, Bin; Zhu, Qing-Lei; Li, Yang

    2015-07-01

    To evaluate the association between a KCNQ1 mutation, R259H, and short QT syndrome (SQTS) and to explore the electrophysiological mechanisms underlying their association. We performed genetic screening of SQTS genes in 25 probands and their family members (63 patients). We used direct sequencing to screen the exons and intron-exon boundaries of candidate genes that encode ion channels which contribute to the repolarization of the ventricular action potential, including KCNQ1, KCNH2, KCNE1, KCNE2, KCNJ2, CACNA1c, CACNB2b and CACNA2D1. In one of the 25 SQTS probands screened, we discovered a KCNQ1 mutation, R259H. We cloned R259H and transiently expressed it in HEK-293 cells; then, currents were recorded using whole cell patch clamp techniques. R259H-KCNQ1 showed significantly increased current density, which was approximately 3-fold larger than that of wild type (WT) after a depolarizing pulse at 1 s. The steady state voltage dependence of the activation and inactivation did not show significant differences between the WT and R259H mutation (P > 0.05), whereas the time constant of deactivation was markedly prolonged in the mutant compared with the WT in terms of the test potentials, which indicated that the deactivation of R259H was markedly slower than that of the WT. These results suggested that the R259H mutation can effectively increase the slowly activated delayed rectifier potassium current (I Ks) in phase 3 of the cardiac action potential, which may be an infrequent cause of QT interval shortening. R259H is a gain-of-function mutation of the KCNQ1 channel that is responsible for SQTS2. This is the first time that the R259H mutation was detected in Chinese people.

  14. Advanced conceptual design report: T Plant secondary containment and leak detection upgrades. Project W-259

    International Nuclear Information System (INIS)

    Hookfin, J.D.

    1995-01-01

    The T Plant facilities in the 200-West Area of the Hanford site were constructed in the early 1940s to produce nuclear materials in support of national defense activities. T Plant includes the 271-T facility, the 221-T facility, and several support facilities (eg, 2706-T), utilities, and tanks/piping systems. T Plant has been recommended as the primary interim decontamination facility for the Hanford site. Project W-259 will provide capital upgrades to the T Plant facilities to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. This document provides an advanced conceptual design concept that complies with functional requirements for the T Plant Secondary Containment and Leak Detection upgrades

  15. Prognostic factorsin inoperable adenocarcinoma of the lung: A multivariate regression analysis of 259 patiens

    DEFF Research Database (Denmark)

    Sørensen, Jens Benn; Badsberg, Jens Henrik; Olsen, Jens

    1989-01-01

    as an indicator for patients having minimal disease spread. Liver metastases were of limited clinical value as a prognostic factor because they were detected in only seven cases in this patient population. A new Cox analysis ignoring the influence of this variable revealed no other variables than those occurring...... status, stage IV disease, no prior nonradical resection, liver metastases, high values of white blood cell count, and lactate dehydrogenase, and low values of aspartate aminotransaminase. The nonradical resection may not be a prognostic factor because of the resection itself but may rather serve......The prognostic factors for survival in advanced adenocarcinoma of the lung were investigated in a consecutive series of 259 patients treated with chemotherapy. Twenty-eight pretreatment variables were investigated by use of Cox's multivariate regression model, including histological subtypes...

  16. 17 CFR 259.206 - Form U-6B-2, for notification of security issues exempt under section 6(b) of the Act.

    Science.gov (United States)

    2010-04-01

    ... of security issues exempt under section 6(b) of the Act. 259.206 Section 259.206 Commodity and... security issues exempt under section 6(b) of the Act. This form shall be filed pursuant to section 6(b) of the Act as the certificate of notification of the issue, sale, renewal, or guaranty of securities...

  17. 17 CFR 259.213 - Form U-13E-1, for report by affiliate companies and independent service companies pursuant to...

    Science.gov (United States)

    2010-04-01

    ... affiliate companies and independent service companies pursuant to Rule 95 (§ 250.95 of this chapter). 259...) FORMS PRESCRIBED UNDER THE PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Forms for Statements and Reports § 259.213 Form U-13E-1, for report by affiliate companies and independent service companies pursuant to...

  18. Fragrance material review on methyl-2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone.

    Science.gov (United States)

    Scognamiglio, J; Letizia, C S; Api, A M

    2013-12-01

    A toxicologic and dermatologic review of methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone when used as a fragrance ingredient is presented. Methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all available toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone were evaluated then summarized and includes physical properties, acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (Belsito, D., Bickers, D., Bruze, M., Calow, P., Dagli, M., Fryer, A.D., Greim, H., Miyachi, Y., Saurat, J.H., Sipes, I.G., 2013. A Toxicologic and Dermatologic Assessment of Alkyl Cyclic Ketones When Used as Fragrance Ingredients (submitted for publication)) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Measurement of the Erc .m .=259 keV resonance in the 14N(p ,γ )15O reaction

    Science.gov (United States)

    Daigle, S.; Kelly, K. J.; Champagne, A. E.; Buckner, M. Q.; Iliadis, C.; Howard, C.

    2016-08-01

    The 14N(p ,γ )15O reaction regulates the power generated by the CN cycle and thus impacts the structure and evolution of every star at some point in its life. The lowest positive-energy resonance in this reaction is located at Erc .m .=259 keV, too high in energy to strongly influence quiescent stellar burning. However, the strength of this resonance is used as a cross-section normalization for lower-energy measurements of this reaction. We report on new measurements of the energy, strength, and γ -ray branching ratios for the 259-keV resonance, using different detection and data-analysis schemes. We have also reevaluated previous results, where possible. Our new recommended strength of ω γ =12.6 (3 ) meV is in agreement with the previous value of 13.1(6) meV, but is more precise and thus provides a more reliable normalization for low-energy (p ,γ ) measurements.

  20. A 259.6 μW HRV-EEG Processor With Nonlinear Chaotic Analysis During Mental Tasks.

    Science.gov (United States)

    Roh, Taehwan; Hong, Sunjoo; Cho, Hyunwoo; Yoo, Hoi-Jun

    2016-02-01

    A system-on-chip (SoC) with nonlinear chaotic analysis (NCA) is presented for mental task monitoring. The proposed processor treats both heart rate variability (HRV) and electroencephalography (EEG). An independent component analysis (ICA) accelerator decreases the error of HRV extraction from 5.94% to 1.84% in the preprocessing step. Largest Lyapunov exponents (LLE), as well as linear features such as mean and standard variation and sub-band power, are calculated with NCA acceleration. Measurements with mental task protocols result in confidence level of 95%. Thanks to the hardware acceleration, the chaos-processor fabricated in 0.13 μm CMOS technology consumes only 259.6 μW.

  1. Residue 259 in protein-tyrosine phosphatase PTP1B and PTPα determines the flexibility of glutamine 262

    DEFF Research Database (Denmark)

    Peters, Günther H.j.; Iversen, L.F.; Andersen, H.S.

    2004-01-01

    To study the flexibility of the substrate-binding site and in particular of Gln262, we have performed adiabatic conformational search and molecular dynamics simulations on the crystal structure of the catalytic domain of wild-type protein-tyrosine phosphatase (PTP) 1B, a mutant PTP1B(R47V),(D48N...... around Gln262 and the active site Cys215 reveals that the probability of finding a water molecule correctly positioned for catalysis is much larger in PTP1B than in PTP1B(R47V),(D48N),(M258C),(G259Q) and PTPalpha, in accordance with experiments....

  2. Opposing effects of cAMP and T259 phosphorylation on plasma membrane diffusion of the water channel aquaporin-5 in Madin-Darby canine kidney cells

    DEFF Research Database (Denmark)

    Koffman, Jennifer Skaarup; Christensen, Eva Arnspang; Marlar, Saw

    2015-01-01

    Aquaporin-5 (AQP5) facilitates passive water transport in glandular epithelia in response to secretory stimuli via intracellular pathways involving calcium release, cAMP and protein kinase A (PKA). In epithelial plasma membranes, AQP5 may be acutely regulated to facilitate water transport...... in the plasma membrane diffusion coefficient of AQP5. We aimed to test the short-term regulatory effects of the above pathways, by measuring lateral diffusion of AQP5 and an AQP5 phospho-mutant, T259A, using k-space Image Correlation Spectroscopy of quantum dot- and EGFP-labeled AQP5. Elevated cAMP and PKA...... inhibition significantly decreased lateral diffusion of AQP5, whereas T259A mutation showed opposing effects; slowing diffusion without stimulation and increasing diffusion to basal levels after cAMP elevation. Thus, lateral diffusion of AQP5 is significantly regulated by cAMP, PKA, and T259 phosphorylation...

  3. Pages 259 - 267.pmd

    African Journals Online (AJOL)

    Administrator

    Peltier CA, Omes C, Ndimubanzi PC et al. Validation of 2006 WHO Prediction Scores for. True HIV Infection in Children less than 18 months with a positive serological HIV test. PLoS ONE I www.plosone.org April 2009; 4. (4): I e5312. 28. Mayaux MJ, Burgard M, Teglas JP,et al. Neonatal characteristics in rapidly progressive ...

  4. 17 CFR 259.113 - Form U-13-1, for applications for approval of mutual service companies pursuant to Rule 88 (§ 250...

    Science.gov (United States)

    2010-04-01

    ... for approval of mutual service companies pursuant to Rule 88 (§ 250.88 of this chapter). 259.113....113 Form U-13-1, for applications for approval of mutual service companies pursuant to Rule 88 (§ 250... approval of a company as a mutual service company, by the company or person proposing to organize it under...

  5. Identification and evaluation of the probiotic potential of Lactobacillus paraplantarum FT259, a bacteriocinogenic strain isolated from Brazilian semi-hard artisanal cheese.

    Science.gov (United States)

    Tulini, Fabrício Luiz; Winkelströter, Lizziane Kretli; De Martinis, Elaine C P

    2013-08-01

    This study aimed to identify a bacteriocinogenic Lactobacillus isolate (FT259) obtained from Brazilian semi-hard Minas type cheese and to evaluate its probiotic and antimicrobial potentials. The strain was identified by biochemical tests (at genus level), and by 16S rDNA sequencing combined with recA gene amplification (for species). To determine the inhibitory spectrum towards food borne pathogens and lactic acid bacteria, the spot-on-the-lawn assay was carried out. Moreover, the proteinaceous nature of the antimicrobial compound produced was evaluated by susceptibility to degradation by proteolytic enzymes. The isolated strain was tested for survival in acidified culture media (pH 2.0, 2.5 and 3.5), in vitro tolerance to bile salts and viability under gastric conditions. Adhesion of Lactobacillus paraplantarum FT259 to Caco-2 cells was evaluated by surface plate count on De Man, Rogosa, and Sharpe (MRS) agar and also by FISH method (fluorescent in situ hybridization) with the aid of Eub338 probe for fluorescence microscopy analysis. The isolate was identified as L. paraplantarum FT259 and it produced bacteriocins that inhibited the growth of Listeria monocytogenes, Listeria innocua and several lactic acid bacteria. It was also observed that L. paraplantarum FT259 tolerated exposure to pH 3.5, and bile salts 0.3% for up to 180 min. In experiments with simulated gastric juice, viable cells of L. paraplantarum FT259 decreased from 8.6 log CFU/mL to 3.5 log CFU/mL after 180 min. For the same strain, in studies with Caco-2 cells, 74% of adhesion was observed through plate count and FISH assays. It was also demonstrated isolated FT259 was susceptible to the majority the antibiotics tested. Overall, the results indicated L. paraplantarum FT259 is a potential probiotic and the production of bacteriocin may be an interesting feature for food applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. The use of electronic data capture tools in clinical trials: Web-survey of 259 Canadian trials.

    Science.gov (United States)

    El Emam, Khaled; Jonker, Elizabeth; Sampson, Margaret; Krleza-Jerić, Karmela; Neisa, Angelica

    2009-03-09

    Electronic data capture (EDC) tools provide automated support for data collection, reporting, query resolution, randomization, and validation, among other features, for clinical trials. There is a trend toward greater adoption of EDC tools in clinical trials, but there is also uncertainty about how many trials are actually using this technology in practice. A systematic review of EDC adoption surveys conducted up to 2007 concluded that only 20% of trials are using EDC systems, but previous surveys had weaknesses. Our primary objective was to estimate the proportion of phase II/III/IV Canadian clinical trials that used an EDC system in 2006 and 2007. The secondary objectives were to investigate the factors that can have an impact on adoption and to develop a scale to assess the extent of sophistication of EDC systems. We conducted a Web survey to estimate the proportion of trials that were using an EDC system. The survey was sent to the Canadian site coordinators for 331 trials. We also developed and validated a scale using Guttman scaling to assess the extent of sophistication of EDC systems. Trials using EDC were compared by the level of sophistication of their systems. We had a 78.2% response rate (259/331) for the survey. It is estimated that 41% (95% CI 37.5%-44%) of clinical trials were using an EDC system. Trials funded by academic institutions, government, and foundations were less likely to use an EDC system compared to those sponsored by industry. Also, larger trials tended to be more likely to adopt EDC. The EDC sophistication scale had six levels and a coefficient of reproducibility of 0.901 (PCanada is higher than the literature indicated: a large proportion of clinical trials in Canada use some form of automated data capture system. To inform future adoption, research should gather stronger evidence on the costs and benefits of using different EDC systems.

  7. Function of RSKS-1-AAK-2-DAF-16 signaling cascade in enhancing toxicity of multi-walled carbon nanotubes can be suppressed by mir-259 activation in Caenorhabditis elegans

    Science.gov (United States)

    Zhuang, Ziheng; Li, Min; Liu, Hui; Luo, Libo; Gu, Weidong; Wu, Qiuli; Wang, Dayong

    2016-08-01

    Caenorhabditis elegans is an important non-mammalian alternative assay model for toxicological study. Previous study has indicated that exposure to multi-walled carbon nanotubes (MWCNTs) dysregulated the transcriptional expression of mir-259. In this study, we examined the molecular basis for mir-259 in regulating MWCNTs toxicity in nematodes. Mutation of mir-259 induced a susceptible property to MWCNTs toxicity, and MWCNTs exposure induced a significant increase in mir-259::GFP in pharyngeal/intestinal valve and reproductive tract, implying that mir-259 might mediate a protection mechanisms for nematodes against MWCNTs toxicity. RSKS-1, a putative ribosomal protein S6 kinase, acted as the target for mir-259 in regulating MWCNTs toxicity, and mutation of rsks-1 suppressed the susceptible property of mir-259 mutant to MWCNTs toxicity. Moreover, mir-259 functioned in pharynx-intestinal valve and RSKS-1 functioned in pharynx to regulate MWCNTs toxicity. Furthermore, RSKS-1 regulated MWCNTs toxicity by suppressing the function of AAK-2-DAF-16 signaling cascade. Our results will strengthen our understanding the microRNAs mediated protection mechanisms for animals against the toxicity from certain nanomaterials.

  8. Non-LTE analysis of extremely helium-rich stars. The hot sdO stars LSE 153, 259 and 263

    Science.gov (United States)

    Husfeld, D.; Butler, K.; Heber, U.; Drilling, J. S.

    1989-01-01

    Results of a non-LTE fine analysis based mainly on high-resolution CASPEC spectra for three extremely helium-rich sdO stars are discussed in order to explain hydrogen deficiency in single stars. High temperature (Teff = 70,000 to 75,000 K) and a position in the log Teff - log g diagram were found close to the Eddington limit. Various abundance estimates are derived for hydrogen (upper limits only), carbon, nitrogen, and magnesium. Hydrogen is reduced to less than 10 percent by number in LSE 153 and LSE 263, and to less than 5 percent in LSE 259. The hydrogen deficiency is accompanied by nitrogen- and carbon-enrichment in LSE 153 and LSE 259 only. In LSE 263, carbon is depleted by about 1 dex. Stellar masses obtained by assuming that a core mass-luminosity relation holds for these stars, were found to be in the range 0.6-0.9 solar mass, yielding luminosities log L/L:solar = 3.7-4.5. Two of the program stars (LSE 153 and 259) appear to be possible successors of the R CrB and helium B stars, whereas the third star (LSE 263) displays a much lower carbon content in its photosphere making it an exceptional case among the known hydrogen deficient stars.

  9. Acute Uncomplicated Febrile Illness in Children Aged 2-59 months in Zanzibar - Aetiologies, Antibiotic Treatment and Outcome.

    Science.gov (United States)

    Elfving, Kristina; Shakely, Deler; Andersson, Maria; Baltzell, Kimberly; Ali, Abdullah S; Bachelard, Marc; Falk, Kerstin I; Ljung, Annika; Msellem, Mwinyi I; Omar, Rahila S; Parola, Philippe; Xu, Weiping; Petzold, Max; Trollfors, Birger; Björkman, Anders; Lindh, Magnus; Mårtensson, Andreas

    2016-01-01

    Despite the fact that a large proportion of children with fever in Africa present at primary health care facilities, few studies have been designed to specifically study the causes of uncomplicated childhood febrile illness at this level of care, especially in areas like Zanzibar that has recently undergone a dramatic change from high to low malaria transmission. We prospectively studied the aetiology of febrile illness in 677 children aged 2-59 months with acute uncomplicated fever managed by IMCI (Integrated Management of Childhood Illness) guidelines in Zanzibar, using point-of-care tests, urine culture, blood-PCR, chest X-ray (CXR) of IMCI-pneumonia classified patients, and multiple quantitative (q)PCR investigations of nasopharyngeal (NPH) (all patients) and rectal (GE) swabs (diarrhoea patients). For comparison, we also performed NPH and GE qPCR analyses in 167 healthy community controls. Final fever diagnoses were retrospectively established based on all clinical and laboratory data. Clinical outcome was assessed during a 14-day follow-up. The utility of IMCI for identifying infections presumed to require antibiotics was evaluated. NPH-qPCR and GE-qPCR detected ≥1 pathogen in 657/672 (98%) and 153/164 (93%) of patients and 158/166 (95%) and 144/165 (87%) of controls, respectively. Overall, 57% (387/677) had IMCI-pneumonia, but only 12% (42/342) had CXR-confirmed pneumonia. Two patients were positive for Plasmodium falciparum. Respiratory syncytial virus (24.5%), influenza A/B (22.3%), rhinovirus (10.5%) and group-A streptococci (6.4%), CXR-confirmed pneumonia (6.2%), Shigella (4.3%) were the most common viral and bacterial fever diagnoses, respectively. Blood-PCR conducted in a sub-group of patients (n = 83) without defined fever diagnosis was negative for rickettsiae, chikungunya, dengue, Rift Valley fever and West Nile viruses. Antibiotics were prescribed to 500 (74%) patients, but only 152 (22%) had an infection retrospectively considered to require

  10. Acute Uncomplicated Febrile Illness in Children Aged 2-59 months in Zanzibar - Aetiologies, Antibiotic Treatment and Outcome.

    Directory of Open Access Journals (Sweden)

    Kristina Elfving

    Full Text Available Despite the fact that a large proportion of children with fever in Africa present at primary health care facilities, few studies have been designed to specifically study the causes of uncomplicated childhood febrile illness at this level of care, especially in areas like Zanzibar that has recently undergone a dramatic change from high to low malaria transmission.We prospectively studied the aetiology of febrile illness in 677 children aged 2-59 months with acute uncomplicated fever managed by IMCI (Integrated Management of Childhood Illness guidelines in Zanzibar, using point-of-care tests, urine culture, blood-PCR, chest X-ray (CXR of IMCI-pneumonia classified patients, and multiple quantitative (qPCR investigations of nasopharyngeal (NPH (all patients and rectal (GE swabs (diarrhoea patients. For comparison, we also performed NPH and GE qPCR analyses in 167 healthy community controls. Final fever diagnoses were retrospectively established based on all clinical and laboratory data. Clinical outcome was assessed during a 14-day follow-up. The utility of IMCI for identifying infections presumed to require antibiotics was evaluated.NPH-qPCR and GE-qPCR detected ≥1 pathogen in 657/672 (98% and 153/164 (93% of patients and 158/166 (95% and 144/165 (87% of controls, respectively. Overall, 57% (387/677 had IMCI-pneumonia, but only 12% (42/342 had CXR-confirmed pneumonia. Two patients were positive for Plasmodium falciparum. Respiratory syncytial virus (24.5%, influenza A/B (22.3%, rhinovirus (10.5% and group-A streptococci (6.4%, CXR-confirmed pneumonia (6.2%, Shigella (4.3% were the most common viral and bacterial fever diagnoses, respectively. Blood-PCR conducted in a sub-group of patients (n = 83 without defined fever diagnosis was negative for rickettsiae, chikungunya, dengue, Rift Valley fever and West Nile viruses. Antibiotics were prescribed to 500 (74% patients, but only 152 (22% had an infection retrospectively considered to require

  11. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-08-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  12. Jacobo-Velázquez, D.A and Cisneros-Zevallos, L. An Alternative Use of Horticultural Crops: Stressed Plants as Biofactories of Bioactive Phenolic Compounds. Agriculture 2012, 2, 259-271

    Directory of Open Access Journals (Sweden)

    Luis Cisneros-Zevallos

    2013-09-01

    Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: http://www.mdpi.com/2077-0472/2/3/259. Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:

  13. Comparison of oral amoxicillin with placebo for the treatment of world health organization-defined nonsevere pneumonia in children aged 2-59 months: a multicenter, double-blind, randomized, placebo-controlled trial in pakistan.

    Science.gov (United States)

    Hazir, Tabish; Nisar, Yasir Bin; Abbasi, Saleem; Ashraf, Yusra Pervaiz; Khurshid, Joza; Tariq, Perveen; Asghar, Rai; Murtaza, Asifa; Masood, Tahir; Maqbool, Sajid

    2011-02-01

    world Health Organization (WHO) acute respiratory illness case management guidelines classify children with fast breathing as having pneumonia and recommend treatment with an antibiotic. There is concern that many of these children may not have pneumonia and are receiving antibiotics unnecessarily. This could increase antibiotic resistance in the community. The aim was to compare the clinical outcome at 72 h in children with WHO-defined nonsevere pneumonia when treated with amoxicillin, compared with placebo. we performed a double-blind, randomized, equivalence trial in 4 tertiary hospitals in Pakistan. Nine hundred children aged 2-59 months with WHO defined nonsevere pneumonia were randomized to receive either 3 days of oral amoxicillin (45mg/kg/day) or placebo; 873 children completed the study. All children were followed up on days 3, 5, and 14. The primary outcome was therapy failure defined a priori at 72 h. in per-protocol analysis at day 3, 31 (7.2%) of the 431 children in the amoxicillin arm and 37 (8.3%) of the 442 in placebo group had therapy failure. This difference was not statistically significant (odds ratio [OR], .85; 95%CI, .50-1.43; P = .60). The multivariate analysis identified history of difficult breathing (OR, 2.86; 95% CI, 1.29-7.23; P = .027) and temperature >37.5°C 100°F at presentation (OR, 1.99; 95% CI, 1.37-2.90; P = .0001) as risk factors for treatment failure by day 5. clinical outcome in children aged 2-59 months with WHO-defined nonsevere pneumonia is not different when treated with an antibiotic or placebo. Similar trials are needed in countries with a high burden of pneumonia to rationalize the use of antibiotics in these communities.

  14. 39 CFR 259.2 - Red Cross.

    Science.gov (United States)

    2010-07-01

    ... such as those caused by floods, tornados, hurricanes, earthquakes, fires, explosions, etc., and not to... each other, as follows: (1) The Red Cross will use Form 3575, Change of Address Order, as a standard... and complete the forms, it will distribute the forms to disaster victims who need them, and it will...

  15. 50 CFR 259.38 - Miscellaneous.

    Science.gov (United States)

    2010-10-01

    ....38 Miscellaneous. (a) Wherever the Secretary prescribes time constraints herein for the submission of... actual date of submission. All required materials may be submitted to any Financial Assistance Division office of the National Marine Fisheries Service. (b) All CCF information received by the Secretary shall...

  16. Publications | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Backward linkages in the manufacturing sector in the oil and gas value chain in Angola (restricted access). This study looks at backward linkages to the manufacturing sector in the oil and gas value chain in Angola as a potential driver of industrial development. The study employs a sub-sectoral approach rather than an ...

  17. 10 CFR 25.9 - Communications.

    Science.gov (United States)

    2010-01-01

    ... Director, Division of Facilities and Security, Mail Stop T7-D57, and sent either by mail to the U.S... Rockville Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the...

  18. Publications | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    How do you build hope and strength? Bringing effective HIV/AIDS treatment to Free State, South Africa. IDRC-supported researchers are working with the Government of Free State province, South Africa, to roll out lifesaving antiretroviral treatment while strengthening the health care system. “The AIDS issue has become ...

  19. Atypical juvenile presentation of GM2 gangliosidosis AB in a patient compound-heterozygote for c.259G>T and c.164C>T mutations in the GM2A gene

    Directory of Open Access Journals (Sweden)

    Carla Martins

    2017-06-01

    Full Text Available GM2-gangliosidosis, AB variant is an extremely rare autosomal recessive inherited disorder caused by mutations in the GM2A gene that encodes GM2 ganglioside activator protein (GM2AP. GM2AP is necessary for solubilisation of GM2 ganglioside in endolysosomes and its presentation to β-hexosaminidase A. Conversely GM2AP deficiency impairs lysosomal catabolism of GM2 ganglioside, leading to its storage in cells and tissues. We describe a 9-year-old child with an unusual juvenile clinical onset of GM2-gangliosidosis AB. At the age of 3 years he presented with global developmental delay, progressive epilepsy, intellectual disability, axial hypertonia, spasticity, seizures and ataxia, but without the macular cherry-red spots typical for GM2 gangliosidosis. Brain MRI detected a rapid onset of diffuse atrophy, whereas whole exome sequencing showed that the patient is a compound heterozygote for two mutations in GM2A: a novel nonsense mutation, c.259G>T (p.E87X and a missense mutation c.164C>T (p.P55L that was recently identified in homozygosity in patients of a Saudi family with a progressive chorea-dementia syndrome. Western blot analysis showed an absence of GM2AP in cultured fibroblasts from the patient, suggesting that both mutations interfere with the synthesis and/or folding of the protein. Finally, impaired catabolism of GM2 ganglioside in the patient's fibroblasts was demonstrated by metabolic labeling with fluorescently labeled GM1 ganglioside and by immunohistochemistry with anti-GM2 and anti-GM3 antibodies. Our observation expands the molecular and clinical spectrum of molecular defects linked to GM2-gangliosidosis and suggests novel diagnostic approach by whole exome sequencing and perhaps ganglioside analysis in cultured patient's cells.

  20. Dicty_cDB: CFE259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *fqstssrcfl*ndcrei*fnk r*nr*ilw*isrisr*--- ---**r*ryscssrl*ekcql*kppfkpngkisaanasqisdgasavllvsgrlvkklgl kprarivtctvvgsdpeymllgpipatik...aleksgltkdqidlyeineafasvvlgwkke lnidldkinpnggaiahghplgatgcilmtkmvnelersnkkyalqtmcig

  1. 24 CFR 960.259 - Family information and verification.

    Science.gov (United States)

    2010-04-01

    ... source of income, or any Federal, State or local agency, to furnish or release to the PHA or HUD such...) Other factors that affect the determination of adjusted income or income-based rent. ... scheduled reexamination or an interim reexamination of family income and composition in accordance with HUD...

  2. Dicty_cDB: SFA259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Translated Amino Acid sequence llaywififsktp*qiiik*KMAKVGEGDPRWIVENREDGHNVNGWHWSEKDCLPWSKNT IGGLFDKKVIQET...TGIPIDEFEKTEEGWKRNILDRIKHTFXXXX Frame B: llaywififsktp*qiiik*KMAKVGEGDPRWIVENREDGHNVNGWHWSEKDCLPWSKNT IGGLFD

  3. 40 CFR 180.259 - Propargite; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... Cattle, fat 0.1 Cattle, meat 0.1 Cattle, meat byproducts 0.1 Citrus, oil 30.0 Corn, field, forage 10.0... byproducts 0.1 Lemon 5.0 Milk, fat (0.08 ppm in milk) 2.0 Nectarine 4.0 Orange 10.0 Peanut 0.1 Peppermint...

  4. 4 CFR 25.9 - Soliciting, vending, and debt collection.

    Science.gov (United States)

    2010-01-01

    ... alms, commercial or political soliciting, and vending of all kinds, displaying or distributing commercial advertising, or collecting private debts in the GAO Building is prohibited. This rule does not...

  5. All projects related to | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: Economic and social development, SOCIAL INEQUALITY, WAGE DETERMINATION, DOMESTIC CONSUMPTION, Poverty alleviation, ECONOMIC POLICY. Region: China, Far East Asia, Central Asia, South Asia ... Asymmetric Demography and Global Financial Governance. Project. Different countries are at different ...

  6. Etiology of bacterial meningitis among children aged 2-59 months in Salvador, Northeast Brazil, before and after routine use of Haemophilus influenzae type b vaccine Etiologia da meningite bacteriana em crianças com idade entre 2 e 59 meses em Salvador, Nordeste do Brasil, antes e depois do uso rotineiro da vacina para Haemophilus influenzae tipo b

    Directory of Open Access Journals (Sweden)

    Cristiana M. Nascimento-Carvalho

    2004-06-01

    Full Text Available OBJECTIVE: To describe the frequency of etiologic agents of bacterial meningitis (BM among children aged 2-59 months in a sample of patients in Salvador, Northeast Brazil, with emphasis on the frequency of BM of unknown etiology (BMUE, just before, during and after the implementation of routine immunization of infants with Haemophilus influenzae type b (Hib vaccination. METHOD: Demographic, clinical and cerebrospinal fluid (CSF information was collected from the chart of every patient, aged 2-59 months, whose CSF exam was performed at the CSF Lab - José Silveira Foundation, between January 1989 and December 2001. Every CSF exam was completely performed according to standard methods. The etiologic diagnosis was based on either culture and/or latex-agglutination test. When the agent was only seen on Gram stained smear, the diagnosis was descriptive. BMUE was defined as: glucose 100 mg / dl, white blood cell count > 20 cells / mm³, percentage of neutrophils > 80%. RESULTS: Of 1519 patients, 894 (58.9% had normal exams and BM was diagnosed in 95 (6.2%. Etiologic agents were: Hib (44.2%, meningococcus (13.7%, Gram-negative bacilli (11.6%, Mycobacterium tuberculosis (6.3%, pneumococcus (4.2%, other agents (4.2%; BMUE was diagnosed in 15.8% of cases with BM. By analysing the frequency of BMUE and Hib among all exams performed yearly, the peaks were recorded in 1989 (5.3% and 1990 (16.9%, respectively, decreasing to 0.7% and 0% in 2001. CONCLUSION: It is possible that the implementation of the conjugate Hib vaccine during the 1990's has been decreasing not only the occurrence of Hib meningitis but also of BMUE.OBJETIVO: Descrever a freqüência dos agentes etiológicos de meningite bacteriana (MB em amostra das crianças com idade entre 2 e 59 meses, em Salvador, Nordeste do Brasil, com ênfase na freqüência de MB de etiologia indeterminada (MBEI, antes, durante e após a implementação da imunização rotineira de lactentes com vacina para

  7. : tous les projets | Page 259 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 6 mai 2011. End Date: 6 novembre 2013. Sujet: WOMEN'S PARTICIPATION, POLITICS, POLITICAL LEADERSHIP, WOMEN'S RIGHTS, GENDER EQUALITY. Région: Chile, South America, North and Central America, Argentina. Programme: Gouvernance et justice. Financement total : CA$ 210,900.00.

  8. 50 CFR 259.33 - Constructive deposits and withdrawals; ratification of withdrawals (as qualified) made without...

    Science.gov (United States)

    2010-10-01

    ... more timely fashion. (c) Constructive deposits (after Interim CCF Agreement effectiveness date). The... timely fashion. (2) All parties shall be counseled that it is manifestly in their best interest to... withdrawal adversely affects the Interim CCF Agreement's general status in any wise deemed by the Secretary...

  9. Yeast Interacting Proteins Database: YGR066C, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ession increases sodium and lithium tolerance; computational analysis suggests a role in regulation of expre...verexpression increases sodium and lithium tolerance; computational analysis suggests a role in regulation o

  10. Yeast Interacting Proteins Database: YLR447C, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available or; overexpression increases sodium and lithium tolerance; computational analysis suggests a role in regulat...erexpression increases sodium and lithium tolerance; computational analysis suggests a role in regulation of

  11. Yeast Interacting Proteins Database: YNL092W, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available um and lithium tolerance; computational analysis suggests a role in regulation of...ncreases sodium and lithium tolerance; computational analysis suggests a role in regulation of expression of

  12. Yeast Interacting Proteins Database: YBR270C, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available factor; overexpression increases sodium and lithium tolerance; computational analysis suggests a role in re...ctor; overexpression increases sodium and lithium tolerance; computational analysis suggests a role in regul

  13. Yeast Interacting Proteins Database: YDR311W, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available rexpression increases sodium and lithium tolerance; computational analysis sugges... zipper (bZIP) transcription factor; overexpression increases sodium and lithium tolerance; computational an

  14. Yeast Interacting Proteins Database: YGL181W, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available rexpression increases sodium and lithium tolerance; computational analysis suggests a role in regulation of ...creases sodium and lithium tolerance; computational analysis suggests a role in regulation of expression of

  15. Yeast Interacting Proteins Database: YLR423C, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available cine zipper (bZIP) transcription factor; overexpression increases sodium and lithium tolerance; computatio...cription factor; overexpression increases sodium and lithium tolerance; computational analysis suggests a ro

  16. Yeast Interacting Proteins Database: YDR259C, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ion increases sodium and lithium tolerance; computational analysis suggests a role in regulation of expressi...tative basic leucine zipper (bZIP) transcription factor; overexpression increases sodium and lithium tolerance; computation

  17. Obesity, bariatric surgery and nutritional implications - doi:10.5020/18061230.2007.p259

    Directory of Open Access Journals (Sweden)

    Michele Novaes Ravelli

    2012-01-01

    Full Text Available Obesity is an important nutritional deviation that is exponentially increasing in Brazil and in the world, becoming a public health problem. The World Health Organization verified in 2005 that 1.6 billion people above 15 years old were overweight and 400 million were obese. Among children, 20 million were overweight. Amongst the different treatments for the obesity the bariatric surgery has been used very often nowadays, for being effective against weight excess and associated co-morbidities, both for the adult and youngster populations. The surgical techniques are divided in restrictive, disabsorptive and mixed procedures. Each technique promotes digestive and absorptive distinct alterations, needing, therefore, an exclusive multidisciplinary educational program, directed both to pre and postsurgery periods, emphasizing the habits of physical activity and the necessity to adhere to the restricted dietary recommendations. The surgeries promote a severe reduction in the consumption, which induces to the ingestion of diets that are hypocaloric and deficient in micronutrients, with consequent nutritional complications.

  18. 28 CFR 2.59 - Designation of a Commissioner to act as a hearing examiner.

    Science.gov (United States)

    2010-07-01

    ..., SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code... hearing dockets. The Commissioner who serves as a hearing examiner may not vote in the same proceeding as...

  19. Oral History Project: Advanced ESL Class, Local 259 U.A.W. 1985-86.

    Science.gov (United States)

    Colon, Maria, Comp.; And Others

    A class project undertaken in an English-as-a-Second-Language class is described and presented. Students participating in the project were union employees in a Manhattan electronics factory, and most were native Spanish speakers. The project's objective was to produce an illustrated book and tapes to document work and union experience in the…

  20. Risk factors of severe pneumonia among children aged 2-59 months ...

    African Journals Online (AJOL)

    Introduction Globally, pneumonia is the leading cause of death in children under the age of 5 years. In Kenya, it is the second leading cause of mortality, accounting for greater than 30,000 deaths in this age group annually. This study sought to identify risk factors for severe pneumonia in children under the age of five years.

  1. SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID

    Energy Technology Data Exchange (ETDEWEB)

    Annamalai, Gopiraj [Government Arignar Anna Memorial Cancer Hospital & Research Institute, Kanchipuram, TAMILNADU (India); Watanabe, Yoichi [University of Minnesota, Minneapolis, MN (United States)

    2016-06-15

    Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm{sup 2} – 25×25 cm{sup 2} at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship.

  2. Changing picture of acute kidney injury in pregnancy: Study of 259 cases over a period of 33 years

    Directory of Open Access Journals (Sweden)

    J Prakash

    2016-01-01

    Full Text Available The incidence of acute kidney injury (AKI in pregnancy is declining in developing countries but still remains a major cause of maternal and fetal morbidity and mortality. The aim of the study was to analyze the changing trends in pregnancy related AKI (PR-AKI over a period of thirty-three years. Clinical characteristics of PR-AKI with respect to incidence, etiology and fetal and maternal outcomes were compared in three study periods, namely 1982-1991,1992-2002 and 2003-2014. The incidence of PR-AKI decreased to 10.4% in 1992-2002, from 15.2% in 1982-1991, with declining trend continuing in 2003-2014 (4.68%.Postabortal AKI decreased to 1.49% in 2003-2014 from 9.4% in 1982-1991of total AKI cases.The AKI related to puerperal sepsis increased to 1.56% of all AKI cases in 2003-2014 from 1.4% in 1982-1991. Preeclampsia/eclampsia associated AKI decreased from 3.5% of total AKI cases in 1982-1991 to 0.54% in 2003-2014. Pregnancy associated - thrombotic microangiopathy and acute fatty liver of pregnancy were uncommon causes of AKI. Hyperemesis gravidarum associated AKI was not observed in our study. Incidence of renal cortical necrosis (RCN decreased to 1.4% in 2003-2014 from 17% in 1982-1991.Maternal mortality reduced to 5.79% from initial high value 20% in 1982-1991. The progression of PR-AKI to ESRD decreased to1.4% in 2003-2014 from 6.15% in 1982-1991. The incidence of PR-AKI has decreased over last three decades, mainly due to decrease in incidence of postabortal AKI. Puerperal sepsis and obstetric hemorrhage were the major causes of PR-AKI followed by preeclampsia in late pregnancy. Maternal mortality and incidence and severity of RCN have significantly decreased in PR-AKI. The progression to CKD and ESRD has decreased in women with AKI in pregnancy in recent decade. However, the perinatal mortality did not change throughout study period.

  3. SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID

    International Nuclear Information System (INIS)

    Annamalai, Gopiraj; Watanabe, Yoichi

    2016-01-01

    Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm 2 – 25×25 cm 2 at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship

  4. Risk factors of severe pneumonia among children aged 2-59 months in western Kenya: a case control study.

    Science.gov (United States)

    Onyango, Dickens; Kikuvi, Gideon; Amukoye, Evans; Omolo, Jared

    2012-01-01

    Globally, pneumonia is the leading cause of death in children under the age of 5 years. In Kenya, it is the second leading cause of mortality, accounting for greater than 30,000 deaths in this age group annually. This study sought to identify risk factors for severe pneumonia in children under the age of five years. We conducted a case control study. Cases were children aged 2 to 59 months with severe pneumonia or very severe pneumonia and controls were those with non-severe pneumonia as defined by the integrated management of childhood illnesses classification. We administered structured questionnaires to mothers of participants to obtain data on socio-demographics, nutritional status and potential environmental risk factors. Data was analyzed using Epi Info; significance level was set at 0.05. We recruited 103 cases and 103 controls. The median age of cases was 14.0 (Range 3-58) months and of controls 14.0 (Range 2-54) months. Comorbidity (Odds Ratio = 3.8, Confidence Interval 1.4-10.6), delay in seeking treatment for three days or more (Odds Ratio = 2.3, Confidence Interval 1.2-4.2) and contact with upper respiratory tract infection (Odds Ratio = 2.7, Confidence Interval 1.1-6.5) were independent risk factors for severe pneumonia. Receiving antibiotics at home (Odds Ratio = 0.4, Confidence Interval 0.2-0.8) was protective. Co-morbidity, contact with upper respiratory tract infection and delay in seeking treatment are risk factors for severe pneumonia. We recommend health education regarding appropriate health seeking and engaging community health workers in pneumonia prevention, control and treatment.

  5. Speech therapy in peripheral facial palsy: an orofacial myofunctional approach - doi:10.5020/18061230.2009.p259

    Directory of Open Access Journals (Sweden)

    Hipólito Virgílio Magalhães Jr

    2012-01-01

    Full Text Available Objective: To delineate the contributions of speech therapy in the rehabilitation of peripheral facial palsy, describing the role of orofacial myofunctional approach in this process. Methods: A literature review of published articles since 1995, held from March to December 2008, based on the characterization of peripheral facial palsy and its relation with speechlanguage disorders related to orofacial disorders in mobility, speech and chewing, among others. The review prioritized scientific journal articles and specific chapters from the studied period. As inclusion criteria, the literature should contain data on peripheral facial palsy, quotes on the changes in the stomatognathic system and on orofacial miofunctional approach. We excluded studies that addressed central paralysis, congenital palsy and those of non idiopathic causes. Results: The literature has addressed the contribution of speech therapy in the rehabilitation of facial symmetry, with improvement in the retention of liquids and soft foods during chewing and swallowing. The orofacial myofunctional approach contextualized the role of speech therapy in the improvement of the coordination of speech articulation and in the gain of oral control during chewing and swallowing Conclusion: Speech therapy in peripheral facial palsy contributed and was outlined by applying the orofacial myofunctional approach in the reestablishment of facial symmetry, from the work directed to the functions of the stomatognathic system, including oralfacial exercises and training of chewing in association with the training of the joint. There is a need for a greater number of publications in this specific area for speech therapy professional.

  6. Speech therapy in peripheral facial palsy: an orofacial myofunctional approach - doi:10.5020/18061230.2009.p259

    OpenAIRE

    Hipólito Virgílio Magalhães Jr

    2012-01-01

    Objective: To delineate the contributions of speech therapy in the rehabilitation of peripheral facial palsy, describing the role of orofacial myofunctional approach in this process. Methods: A literature review of published articles since 1995, held from March to December 2008, based on the characterization of peripheral facial palsy and its relation with speechlanguage disorders related to orofacial disorders in mobility, speech and chewing, among others. The review prioritized scientifi...

  7. 47 CFR 90.259 - Assignment and use of frequencies in the bands 216-220 MHz and 1427-1432 MHz.

    Science.gov (United States)

    2010-10-01

    ... COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Standards for... applicants that establish eligibility in the Industrial/Business Pool. (2) All operation is secondary to the fixed and mobile services, including the Low Power Radio Service. (3) In the 216-217 MHz band, no new...

  8. Phosphorylation of the norepinephrine transporter at threonine 258 and serine 259 is linked to protein kinase C-mediated transporter internalization

    DEFF Research Database (Denmark)

    Jayanthi, Lankupalle D; Annamalai, Balasubramaniam; Samuvel, Devadoss J

    2006-01-01

    ester (beta-PMA)-induced phosphorylation of NET occurs on serine and threonine residues. Beta-PMA treatment inhibited NE transport, reduced plasma membrane hNET levels, and stimulated hNET phosphorylation in human placental trophoblast cells expressing the WT-hNET. Substance P-mediated activation......Recently, we have demonstrated the phosphorylation- and lipid raft-mediated internalization of the native norepinephrine transporter (NET) following protein kinase C (PKC) activation (Jayanthi, L. D., Samuvel, D. J., and Ramamoorthy, S. (2004) J. Biol. Chem. 279, 19315-19326). Here we tested...

  9. SU-E-T-259: A Statistical and Machine Learning-Based Tool for Modeling and Visualization of Radiotherapy Treatment Outcomes.

    Science.gov (United States)

    Oh, J; Wang, Y; Apte, A; Deasy, J

    2012-06-01

    Effective radiotherapy outcomes modeling could provide physicians with better understanding of the underlying disease mechanism, enabling to early predict outcomes and ultimately allowing for individualizing treatment for patients at high risk. This requires not only sophisticated statistical methods, but user-friendly visualization and data analysis tools. Unfortunately, few tools are available to support these requirements in radiotherapy community. Our group has developed Matlab-based in-house software called DREES for statistical modeling of radiotherapy treatment outcomes. We have noticed that advanced machine learning techniques can be used as useful tools for analyzing and modeling the outcomes data. To this end, we have upgraded DREES such that it takes advantage of useful Statistics and Bioinformatics toolboxes in Matlab that provide robust statistical data modeling and analysis methods as well as user-friendly visualization and graphical interface. Newly added key features include variable selection, discriminant analysis and decision tree for classification, and k-means and hierarchical clustering functions. Also, existing graphical tools and statistical methods in DREES were replaced with a library of the Matlab toolboxes. We analyzed several radiotherapy outcomes datasets with our tools and showed that these can be effectively used for building normal tissue complication probability (NTCP) and tumor control probability (TCP) models. We have developed an integrated software tool for modeling and visualization of radiotherapy outcomes data within the Matlab programming environment. It is our expectation that this tool could help physicians and scientists better understand the complex mechanism of disease and identify clinical and biological factors related to outcomes. © 2012 American Association of Physicists in Medicine.

  10. Dabène, Olivier (2009) The politics of regional integration in Latin America: theoretical and comparative explorations. New York: Palgrave Macmillan, xxviii + 259 p.

    OpenAIRE

    Dri, Clarissa Franzoi; Professora adjunta de relações internacionais da Universidade Federal de Santa Catarina e pesquisadora associada ao Centro Émile Durkheim do Instituto de Estudos Políticos de Bordeaux.

    2010-01-01

    Grande parte dos trabalhos científicos no âmbito da integração regional latino-americana a consideram como fator explicativo para outros processos, domésticos ou internacionais, ou tratam-na como um meio para a obtenção de determinados fins em termos de política externa ou políticas públicas estatais. Em “The politics of regional integration in Latin America”, Oliver Dabène argumenta que essas perspectivas são insuficientes para se apreender a complexidade das iniciativas de integração nessa ...

  11. Multibeam collection for TN259: Multibeam data collected aboard Thomas G. Thompson from 2010-11-23 to 2010-12-22, Seattle, WA to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. Digital Humanitarians: How Big Data Is Changing the Face of Humanitarian Response : Patrick Meier, 2015, CRC Press (Boca Raton, FL, 978-1-4822-4839-5, 259 pp.).

    Science.gov (United States)

    Dave, Anushree

    2017-12-01

    This is a review of Patrick Meier's 2015 book, Digital Humanitarians: How Big Data Is Changing the Face of Humanitarian Response. The book explores the role of technologies such as high-resolution satellite imagery, online social media, drones, and artificial intelligence in humanitarian responses during disasters such as the 2010 Haiti earthquake. In this analysis, the book is examined using a humanitarian health ethics perspective.

  13. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT259-268 during 2014 (NCEI Accession 0140225)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  14. New data on the Australasian Xantholinini. 9th. New genus, new species, and new records from Australia, New Caledonia and New Zealand (Coleoptera: Staphylinidae [259th contribution to the knowledge of the Staphylinidae

    Directory of Open Access Journals (Sweden)

    Arnaldo Bordoni

    2017-06-01

    Full Text Available One genus and four species of Xantholinini are described as new: Kamilaroius serpens gen. n., sp. n. and Andelis australis sp. n. from Australia; Zeteotomus caledonicus sp. n. from New Caledonia, and Wangareiella suborbata sp. n. from New Zealand. The male genitalia of Australinus megacephalus (Lea are figured for the first time. New records of other species of Xantholinini from the Australasian region are listed.

  15. Corrigendum to "Chemical composition and acidity of size-fractionated inorganic aerosols of 2013-14 winter haze in Shanghai and associated health risk of toxic elements" [Atmos. Environ. (2015) 259-271

    Science.gov (United States)

    Behera, Sailesh N.; Cheng, Jinping; Huang, Xian; Zhu, Qiongyu; Liu, Ping; Balasubramanian, Rajasekhar

    2018-03-01

    The authors regret that the sources from which the RfC (reference concentration) and the IUR (inhalation unit risk) values were obtained for estimation of RfD (reference dose, presented in Table 2) and SF (slope factor, presented in Table 3) were not clearly indicated in the published article due to an oversight. The revised tables with improved clarity are given below. a The Risk Assessment Information System (https://rais.ornl.gov/) b USEPA Integrated Risk Information System (IRIS) (http://www.epa.gov/iris) c The California EPA, the office of Environmental Health Hazard Assessment (OEHHA) (https://www.oehha.gov.gov/) d Behera, S.N., Xian, H. and Balasubramanian, R., 2014. Human health risk associated with exposure to toxic elements in mainstream and sidestream cigarette smoke. Science of the Total Environment, 472, pp.947-956.

  16. Retraction: Radenović L, Selaković V. Kainate-induced oxidative stress and neurotoxicity in the rat brain, Arch Biol Sci, 2005, 57(4:259-266, DOI: 10.2298/ABS0504259R

    Directory of Open Access Journals (Sweden)

    Editorial

    2015-01-01

    Full Text Available This is a notice of retraction of the article: Kainate-induced oxidative stress and neurotoxicity in the rat brain, published in the Archives of Biological Sciences in 2005, Vol. 57, Issue 4. The Editor-in-Chief has been informed that this paper plagiarizes an earlier paper: Radenović L, Jovanović M, Vasiljević I, Selaković V. Superoxide production and the activity of MnSOD in rat brain after intrahippocampal kainate-induced seizure. Neurosci Res Comm, 2004, 34(2:92-103. This claim is correct and almost the entire paper is a verbatim copy of the earlier one. After confirmation of this fact, the Editor-in-Chief of the Archives of Biological Sciences has decided to retract the paper immediately. We apologize to the readers of the journal that it took so many years to notice this error and to retract the paper. We request readers of the journal to directly get in touch with the editorial office and the editors of the journal for similar cases in the future, so that they can be handled promptly. Link to the retracted article 10.2298/ABS0504259R

  17. Science and Technology of Nanostructured Magnetic Materials: Proceedings of a NATO Advanced Study Institute Conference Held in Aghia Pelaghia, Crete, Greece on 24 June -6 July 1990. NATO ASI Series B: Physics. Volume 259

    Science.gov (United States)

    1990-07-06

    INIC - JNICT/CNRS Scientific exchange program, and by a grant from Reitoria da Universidade do Porto, Fundacao Gomes Teixeira is gratefully acknowledged...This work was partially supported by the INIC-JNICT/CNRS scientific exchange program and by a grant from Reitoria da Universidade do Porto, Fundago

  18. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  19. MicroSIFT Courseware Evaluations. [Set 11 (223-259), Set 12 (260-293), and a Special Set of 99 LIBRA Reviews of Junior High School Science Software, Including Subject and Title Indexes Covering Sets 1-12 and Special Set L].

    Science.gov (United States)

    Northwest Regional Educational Lab., Portland, OR.

    This document consists of 170 microcomputer software package evaluations prepared by the MicroSIFT (Microcomputer Software and Information for Teachers) Clearinghouse at the Northwest Regional Education Laboratory. Set 11 consists of 37 packages. Set 12 consists of 34 packages. A special unnumbered set, entitled LIBRA Reviews, treats 99 packages…

  20. Quaderni di filologia e lingue romanze 7 (1992, Supplemento Terza serie, Attidel Convegno "Relazione di viaggi fra Italia e Spagna" Macerata, Università degli Studi, 15-17 dicembre 1992, 259 pp.; 8(1993, 273 pp.; 9(1994, 285 pp.; 10(1995, 346 pp.

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1996-12-01

    Full Text Available Il periodico maceratese, nato nel 1979, continua ad apparire a ritmo annuale re­ golare. Avendo recensito i voll. 1985-1992 nel numero 34 di «Linguistica», presen­ tiamo qui le annate citate nel titolo, concentrandoci sempre sui contributi di interesse linguistico (o almeno filologico, che continuano ad essere in minoranza di fronte a quelli di argomento letterario.

  1. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 135 ... Query: 259 DIRRPGDIGDFIGRVVQAEVLKIDDTRRNIVISRRSLIERQREEDRAYLMQELEVGQIRK 318 ... DIRRPGDIGDFIG...RVVQAEVLKIDDTRRNIVISRRSLIERQREEDRAYLMQELEVGQIRK Sbjct: 1 ... DIRRPGDIGDFIG

  2. Origin and concentration: corporate ownership, control and performance

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen; Švejnar, Jan

    -, č. 259 (2005), s. 1-48 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : ownership * performance * privatization Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp259.pdf

  3. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AQLTLAQNVPLKGAVIVSTPQDLSLIDARRGLAMFRKVNVPVLGIVENMSYFQCPHCGTK 318 ... AQLTLAQNVPLKGAVIVSTPQDLSLIDARRGL...AMFRKVNVPVLGIVENMSYFQCPHCGTK Sbjct: 121 AQLTLAQNVPLKGAVIVSTPQDLSLIDARRGLAMFRKVNVP...PSVPRLTGLRDKPELDGERK Sbjct: 1 ... VIAVASGKGGVGKSTTALNLALGLRDLGLKVGLLDADIYGPSVPRLTGLRDKPELDGERK 60 ... Query: 259

  4. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  5. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GTDDKG Sbjct: 1 ... VNLYAPTRPITATVTGNYRLTDADASSDIHHVVLDFGSTPFPVLEGQSIGIIPPGTDDKG 60 ... Query: 259 GPYGSTYLMPNHPASSIMMICTGTGSAPMRAM...TEXXXXXIAQNEGGELVLFFGARAPSEL 318 ... GPYGSTYLMPNHPASSIMMICTGTGSAPMRAMTE ... IAQNEGG...ELVLFFGARAPSEL Sbjct: 121 GPYGSTYLMPNHPASSIMMICTGTGSAPMRAMTERRRRRIAQNEGGELVLFFGAR

  6. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pseudomallei K96243] ... Length = 259 ... Query: 12 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPR...TLAACAGRRV 71 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACA...GRRV Sbjct: 1 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACAGRRV 60 ... Query: 132 EFASACDALITESAQA

  7. ORF Alignment: NC_003106 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LLLPWKSLLHDKIRDFAPPEKFSKV 60 ... Query: 122 FPSKKSNYIVKRVDWSSRILLWELLSKLNSIELIDARNREEYEGLTSAPPEHKCEQTQVS 181 ... ... ... FPSKKSNYIVKRVDWSSRILLWELLSKLNSIELIDARNREEYEGLTSAPPEHKCEQTQVS Sbjct: 121 ...FPSKKSNYIVKRVDWSSRILLWELLSKLNSIELIDARNREEYEGLTSAPPEHKCEQTQVS 180 ... Query: 242 LSYKNVRLYDGSWVEYGN 259 ... LSYKNVRLYDGSWVEYGN Sbjct: 241 LSYKNVRLYDGSWVEYGN 258

  8. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KPVGAVKSWTGDPWYDHIKDKMDGVKELGLESEPNVEAIA 60 ... Query: 178 YDKRIEDLKAKLGDKLKMKVSIVRFMAGDVRIYHKDSFSGVILDQLGFARPES...QNVNDFA 237 ... YDKRIEDLKAKLGDKLKMKVSIVRFMAGDVRIYHKDSFSGVILDQLGFARPESQNVN...DFA Sbjct: 121 YDKRIEDLKAKLGDKLKMKVSIVRFMAGDVRIYHKDSFSGVILDQLGFARPESQNVNDFA 180 ... Query: 298 WNTAGGVLAAHLMLDDIEK 316 ... WNTAGGVLAAHLMLDDIEK Sbjct: 241 WNTAGGVLAAHLMLDDIEK 259

  9. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  10. Tvistbilæggelse mellem EU-medlemsstaterne ved Den Europæiske Unions Domstol

    DEFF Research Database (Denmark)

    Butler, Graham

    2018-01-01

    Artikel 259 and 273 TEUF giver EU-Domstolen kompetence til at træffe afgø-relse i tvister mellem EU-medlemsstaterne, forudsat at visse betingelser, der er fastsat i traktaterne er opfyldt. Artikel 259 TEUF vedrører håndhævelse af medlemsstaternes unionsretlige forpligtelser, hvorimod artikel 273 ...

  11. Tvistbilæggelse mellem EU-medlemsstaterne ved Den Europæiske Unions Domstol

    DEFF Research Database (Denmark)

    Butler, Graham

    2018-01-01

    Artikel 259 and 273 TEUF give EU-Domstolen kompetence til at træffe afgørelse i tvister mellem EU-medlemsstaterne, forudsat at visse betingelser, der er fastsat i traktaterne er opfyldt. Artikel 259 TEUF vedrører håndhævelse af medlemsstaternes unionsretlige forpligtelser, hvorimod artikel 273 TE...

  12. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 120; Issue 3. Issue front cover thumbnail. Volume 120, Issue 3. June 2010, pages 259-394. pp 259-266. Zero-Sum Problems with Subgroup Weights · S D Adhikari A A Ambily B Sury · More Details Abstract Fulltext PDF. In this note, we generalize some ...

  13. Mimicry of the regulatory role of urokinase in lamellipodia formation by introduction of a non-native interdomain disulfide bond in its receptor

    DEFF Research Database (Denmark)

    Gårdsvoll, Henrik; Kjærgaard, Magnus; Jacobsen, Benedikte

    2011-01-01

    -natural interdomain disulfide bond (uPAR(H47C-N259C)). The corresponding soluble receptor has 1) a smaller hydrodynamic volume, 2) a higher content of secondary structure, and 3) unaltered binding kinetics towards uPA. Most importantly, the purified uPAR(H47C-N259C) also displays a gain in affinity...

  14. Distribution of iron, cobalt , zinc and selenium in macrofungi

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jan; Řanda, Zdeněk

    2007-01-01

    Roč. 6, č. 4 (2007), s. 249-259 ISSN 1617-416X Institutional research plan: CEZ:AV0Z10480505 Keywords : ectomycorrhizal fungi * instrumental neutron activation analysis * terrestrial saprobes Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.259, year: 2007

  15. Proposal to reject the name Juncus setaceus (Juncaceae)

    Czech Academy of Sciences Publication Activity Database

    Kirschner, Jan

    2007-01-01

    Roč. 56, č. 1 (2007), s. 259-259 ISSN 0040-0262 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : Nomenclature * Juncus setaceus * analyse Subject RIV: EF - Botanics Impact factor: 2.524, year: 2007

  16. Two Isoforms of Yersinia pestis Plasminogen Activator Pla: Intraspecies Distribution, Intrinsic Disorder Propensity, and Contribution to Virulence.

    Science.gov (United States)

    Dentovskaya, Svetlana V; Platonov, Mikhail E; Svetoch, Tat'yana E; Kopylov, Pavel Kh; Kombarova, Tat'yana I; Ivanov, Sergey A; Shaikhutdinova, Rima Z; Kolombet, Lyubov' V; Chauhan, Sadhana; Ablamunits, Vitaly G; Motin, Vladimir L; Uversky, Vladimir N; Anisimov, Andrey P

    2016-01-01

    It has been shown previously that several endemic Y. pestis isolates with limited virulence contained the I259 isoform of the outer membrane protease Pla, while the epidemic highly virulent strains possessed only the T259 Pla isoform. Our sequence analysis of the pla gene from 118 Y. pestis subsp. microtus strains revealed that the I259 isoform was present exclusively in the endemic strains providing a convictive evidence of more ancestral origin of this isoform. Analysis of the effects of the I259T polymorphism on the intrinsic disorder propensity of Pla revealed that the I259T mutation slightly increases the intrinsic disorder propensity of the C-terminal tail of Pla and makes this protein slightly more prone for disorder-based protein-protein interactions, suggesting that the T259 Pla could be functionally more active than the I259 Pla. This assumption was proven experimentally by assessing the coagulase and fibrinolytic activities of the two Pla isoforms in human plasma, as well as in a direct fluorometric assay with the Pla peptide substrate. The virulence testing of Pla-negative or expressing the I259 and T259 Pla isoforms Y. pestis subsp. microtus and subsp. pestis strains did not reveal any significant difference in LD50 values and dose-dependent survival assays between them by using a subcutaneous route of challenge of mice and guinea pigs or intradermal challenge of mice. However, a significant decrease in time-to-death was observed in animals infected with the epidemic T259 Pla-producing strains as compared to the parent Pla-negative variants. Survival curves of the endemic I259 Pla+ strains fit between them, but significant difference in mean time to death post infection between the Pla-strains and their I259 Pla+ variants could be seen only in the isogenic set of subsp. pestis strains. These findings suggest an essential role for the outer membrane protease Pla evolution in Y. pestis bubonic infection exacerbation that is necessary for intensification

  17. 288-IJBCS-Article-Dr Tene Mathieu

    African Journals Online (AJOL)

    Dr Gatsing

    . Trop., 49(1):. 259-264. Murthy MM, Subramanyan M, Bindu Hima. M, Annapurna J. 2005. Antimicrobial activity of clerodane diterpenoids from. Polyalthia longifolia seeds. Fitoterapia,. 76(3 & 4): 336-339. Ngadjui BT, Abegaz BM, Keumedjio F,.

  18. Discovery of 6-Diazo-5-oxo-L-norleucine (DON) Prodrugs with Enhanced CSF Delivery in Monkeys: A Potential Treatment for Glioblastoma

    Czech Academy of Sciences Publication Activity Database

    Rais, R.; Jančařík, Andrej; Tenora, Lukáš; Nedelcovych, M.; Alt, J.; Englert, J.; Rojas, C.; Le, A.; Elgogary, A.; Tan, J.; Monincová, Lenka; Pate, K.; Adams, R.; Ferraris, D.; Powell, J.; Majer, Pavel; Slusher, B. S.

    2016-01-01

    Roč. 59, č. 18 (2016), s. 8621-8633 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : phase I * glutamine metabolism * adjuvant temozolomide Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016

  19. Discovery of Orally Available Prodrugs of the Glutamate Carboxypeptidase II (GCPII) Inhibitor 2-Phosphonomethylpentanedioic Acid (2-PMPA)

    Czech Academy of Sciences Publication Activity Database

    Majer, Pavel; Jančařík, Andrej; Krečmerová, Marcela; Tichý, Tomáš; Tenora, Lukáš; Wozniak, K.; Wu, Y.; Pommier, E.; Ferraris, D.; Rais, R.; Slusher, B. S.

    2016-01-01

    Roč. 59, č. 6 (2016), s. 2810-2819 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : glutamate carboxypeptidase II * glutamate * 2-PMPA * prodrug Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016

  20. Tetra(3,4-pyrido)porphyrazines Caught in the Cationic Cage: Toward Nanomolar Active Photosensitizers

    Czech Academy of Sciences Publication Activity Database

    Macháček, M.; Demuth, J.; Čermák, P.; Vavrečková, M.; Hrubá, L.; Jedličková, A.; Kubát, Pavel; Šimůnek, T.; Nováková, V.; Zimčík, P.

    2016-01-01

    Roč. 59, č. 20 (2016), s. 9443-9456 ISSN 0022-2623 Institutional support: RVO:61388955 Keywords : TARGETED PHOTODYNAMIC THERAPY * SINGLET OXYGEN * PHOTOPHYSICAL PROPERTIES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.259, year: 2016

  1. Drug Metabolism

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 3. Drug Metabolism: A Fascinating Link Between Chemistry and Biology. Nikhil Taxak Prasad V Bharatam. General Article Volume 19 Issue 3 March 2014 pp 259-282 ...

  2. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Rota.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 16-17 September 2003 (JD 259-260) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Rota Island in...

  3. EHR Incentive Programs - Data and Reports

    Data.gov (United States)

    U.S. Department of Health & Human Services — As of March 2013, more than 259,000 health care providers received payment for participating in the Medicare and Medicaid Electronic Health Record (EHR) Incentive...

  4. Review of the cyanobacterial genera implaying planktic species after recent taxonomic revisions according to polyphasic methods: state as of 2014.

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 259-270 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * plankton * taxonomic revisions Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  5. Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes

    Czech Academy of Sciences Publication Activity Database

    Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 259-271 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  6. Technological and dermatoglyphic analysis of the earliest ceramics: Pavlov (South Moravia) and Krems (Lower Austria)

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Neugebauer-Maresch, Ch.

    2004-01-01

    Roč. 45, - (2004), s. 256-259 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z8001916 Keywords : Moravia, Austria * ceramic * analysis technological, dermatoglyphic Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Tanec v literární tvorbě Boženy Němcové: Fikce nebo fakta?

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2012-01-01

    Roč. 99, č. 3 (2012), s. 259-280 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : dance * semiotic * national movement * microhistory * fiction Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.094, year: 2012

  8. Asymmetric Preorganization of Inverted Pair Residues in the Sodium-Calcium Exchanger

    Czech Academy of Sciences Publication Activity Database

    Giladi, M.; Almagor, L.; Van Dijk, L.; Hiller, R.; Man, Petr; Forest, E.; Khananshvili, D.

    2016-01-01

    Roč. 6, FEB15 (2016), s. 20753 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : MASS-SPECTROMETRY * STRUCTURAL BASIS * NA+/CA2+ EXCHANGER Subject RIV: CE - Biochemistry Impact factor: 4.259, year: 2016

  9. Natural Electrical Potentials That Arise When Soils Freeze.

    Science.gov (United States)

    1986-06-01

    phenomena occurring during the freezing of dilute aqueous solutions and their possible relation- ship to thunderstorm electricity . Physical Review, 75(3): 2254-259 24 I. * - -- - , -U. - - S -- ~ v -~

  10. Reformní vize v ruském politickém myšlení druhé poloviny 18. a počátku 19. století

    Czech Academy of Sciences Publication Activity Database

    Vlček, Radomír

    2015-01-01

    Roč. 101, č. 2 (2015), s. 259-292 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Russia * history * 18th century * reform s * political system * tsarist autocracy Subject RIV: AB - History

  11. Lidová hudba a zvukový záznam

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    2006-01-01

    Roč. 93, č. 3 (2006), s. 259-267 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : folk music * sound recording * phonograph * technology * media Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Cerium oxide for the destruction of chemical warfare agents: A comparison of synthetic routes

    Czech Academy of Sciences Publication Activity Database

    Janos, P.; Henych, Jiří; Pelant, O.; Pilařová, V.; Vrtoch, L.; Kormunda, M.; Mazanec, K.; Štengl, Václav

    2016-01-01

    Roč. 304, MAR (2016), s. 259-268 ISSN 0304-3894 Institutional support: RVO:61388980 Keywords : Cerium oxide * Chemical warfare agents * Organophosphate compounds * Decontamination Subject RIV: CA - Inorganic Chemistry Impact factor: 6.065, year: 2016

  13. Marine water mites (Acari: Hydrachnidia: Pontarachnidae) from Taiwan, Korea and India, with the first description of the male of Pontarachna australis Smit, 2003

    Digital Repository Service at National Institute of Oceanography (India)

    Pesic, V.; Chatterjee, T.; Chan, B.K.K.; Ingole, B.S.

    , D.R. (1996) A freshwater species of Pontarachna (Acari, Pontarachnidae) from South Africa, with a discussion of genital acetabula in the family. Anales Instituto de Biologa, Universidad Nacionale Aut- noma de Mxico, Seria Zoologa, 67, 259...

  14. Resting electrical network activity in traps of the aquatic carnivorous plants of the genera Aldrovanda and Utricularia

    Czech Academy of Sciences Publication Activity Database

    Masi, E.; Ciszak, M.; Colzi, I.; Adamec, Lubomír; Mancuso, S.

    2016-01-01

    Roč. 6, e24989 (2016), s. 1-11 ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : electrophysiology * multielectrode array * aquatic carnivorous plants Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016

  15. 'Transatlantic Print Culture, 1880-1940: Emerging Media, Emerging Modernisms', edited by Ann Ardis and Patrick Collier

    Directory of Open Access Journals (Sweden)

    Janet Floyd

    2009-11-01

    Full Text Available A review of 'Transatlantic Print Culture, 1880-1940: Emerging Media, Emerging Modernisms', edited by Ann Ardis and Patrick Collier (London: Palgrave Macmillan, 2008. Hardback, 259 pages, £50, ISBN 9780554269.

  16. Optical properties of alkaline-earth fluorohalides BaFX (X = Cl, Br, I) compounds

    Czech Academy of Sciences Publication Activity Database

    Reshak, Ali H; Charifi, Z.; Baaziz, H.

    2007-01-01

    Roč. 51, č. 8 (2007), s. 1133-1138 ISSN 0038-1101 Institutional research plan: CEZ:AV0Z60870520 Keywords : CRYSTAL * LUMINESCENCE Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.259, year: 2007

  17. Herbivory in the soft coral Sinularia flexibilis (Alcyoniidae)

    Czech Academy of Sciences Publication Activity Database

    Piccinetti, C.C.; Ricci, R.; Pennesi, C.; Radaelli, G.; Totti, C.; Norici, A.; Giordano, Mario; Olivotto, I.

    2016-01-01

    Roč. 6, MAR 8 (2016), s. 22679 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : DIATOM THALASSIOSIRA-PSEUDONANA * STYLOPHORA-PISTILLATA * SCLERACTINIAN CORALS Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  18. Satellite gravity gradient grids for geophysics

    Czech Academy of Sciences Publication Activity Database

    Bouman, J.; Ebbing, J.; Fuchs, M.; Sebera, Josef; Lieb, V.; Szwillus, W.; Haagmans, R.; Novák, P.

    2016-01-01

    Roč. 6, February (2016), 21050/1-21050/11 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : atlantic region * GOCE * model Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2016

  19. 77 FR 26574 - Notice of Availability of the Final Environmental Impact Statement for the Celatom Mine Expansion...

    Science.gov (United States)

    2012-05-04

    ... individuals, agencies, organizations, or companies who responded to the BLM on the Draft EIS. Compact discs of... remaining 11,259 acres in the MPO area lies between and south of the active and proposed mines. Under the...

  20. Temperature-Dependent Kinetics of Grape Seed Phenolic Compounds Extraction: Experiment and Model

    Czech Academy of Sciences Publication Activity Database

    Bucic´-Kojic´, A.; Sovová, Helena; Planinic´, M.; Tomas, S.

    2013-01-01

    Roč. 136, 3-4 (2013), s. 1136-1140 ISSN 0308-8146 Institutional support: RVO:67985858 Keywords : kinetics modelling * temperature * grape seed Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.259, year: 2013

  1. Historic and ancient tsunamis uncovered on the Jalisco-Colima Pacific coast, the Mexican subduction zone

    Czech Academy of Sciences Publication Activity Database

    Ramírez-Herrera, M.-T.; Bógalo, M.-F.; Černý, Jan; Goguitchaichvili, A.; Corona, N.; Machain, M. L.; Edwards, A. C.; Sosa, S.

    2016-01-01

    Roč. 259, April 15 (2016), s. 90-104 ISSN 0169-555X Institutional support: RVO:67985831 Keywords : Earthquake * magnetic properties * Mexican subduction * tsunami deposit Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.958, year: 2016

  2. Deciphering the relationship among phosphate dynamics, electron-dense body and lipid accumulation in the green alga Parachlorella kessleri

    Czech Academy of Sciences Publication Activity Database

    Ota, S.; Yoshihara, M.; Yamazaki, T.; Takeshita, T.; Hirata, A.; Konomi, M.; Oshima, K.; Hattori, M.; Bišová, Kateřina; Zachleder, Vilém; Kawano, S.

    2016-01-01

    Roč. 6, MAY 16 (2016), s. 25731 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : electron-dense body * lipid accumulation * Parachlorella kessleri Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  3. Ionic conductivity study of Lil-Ga2S3-GeS2 chalcogenide glasses using a random – walk approach

    Czech Academy of Sciences Publication Activity Database

    Patil, S. D.; Konale, M. S.; Kolář, J.; Shimakawa, K.; Zima, Vítězslav; Wágner, T.

    2015-01-01

    Roč. 87, č. 3 (2015), s. 249-259 ISSN 0033-4545 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * impedance spectroscopy * ionic conductivity Subject RIV: CA - Inorganic Chemistry Impact factor: 2.615, year: 2015

  4. Intercalation of tartrazine into ZnAl and MgAl layered double hydroxides

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Zima, Vítězslav; Svoboda, Jan

    2005-01-01

    Roč. 70, č. 2 (2005), s. 259-267 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40500505 Keywords : intercalation * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.949, year: 2005

  5. Testosterone Test

    Science.gov (United States)

    ... and Iron-binding Capacity (TIBC, UIBC) Trichomonas Testing Triglycerides Troponin Tryptase Tumor Markers Uric Acid Urinalysis Urine ... Endocrine Society clinical practice guideline. J Clin Endocrinol Metabolism , 6 (2010) 2536–259. Centers for Disease Control ...

  6. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  7. Jak vzniká něco nového? Založení a transcendence

    Czech Academy of Sciences Publication Activity Database

    Puc, Jan

    2017-01-01

    Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf

  8. The higher phylogeny of Leptophlebiidae (Insecta: Ephemeroptera), with description of a new species of Calliarcys Eaton, 1881

    Czech Academy of Sciences Publication Activity Database

    Godunko, Roman J.; Sroka, Pavel; Soldán, Tomáš; Bojková, J.

    2015-01-01

    Roč. 73, č. 2 (2015), s. 259-280 ISSN 1863-7221 R&D Projects: GA ČR GA206/08/1389 Institutional support: RVO:60077344 Keywords : Calliarcyinae * systematics * phylogeny Subject RIV: EG - Zoology Impact factor: 1.655, year: 2015 http://www.senckenberg.de/files/content/forschung/publikationen/arthropodsystematics/asp_73_2/03_asp_73_2_godunko_259-279.pdf

  9. THE INFLUENCE OF DTFFEft.ENT PI-ANES OF NUTRITION ...

    African Journals Online (AJOL)

    All the heifers in both treatments had free access to a lick consisting af 259o yellow maize nteal, 25% biuret, 259o dicalcium phosphate, l5e, salt and lA9o sunflower oilcake meal during the winter feeding period. From October 7 the two groups were pooled and had free access to veld and a lick consisting of 50eo dicalcium.

  10. Incidence and anatomical variations of accessory navicular bone in patients with foot pain: A retrospective radiographic analysis.

    Science.gov (United States)

    Kalbouneh, Heba; Alajoulin, Omar; Alsalem, Mohammad; Humoud, Noor; Shawaqfeh, Jamil; Alkhoujah, Mohammad; Abu-Hassan, Hana; Mahafza, Waleed; Badran, Darwish

    2017-05-01

    The accessory navicular (AN) is an accessory ossicle anatomically located on the medial side of the foot, proximal to the navicular and continuous with the tibialis posterior tendon. It is occasionally a source of pain and local tenderness. Knowledge of the AN and its morphological variations can help identify the source of a patient's symptoms and prevent misinterpreting them as fractures. Foot radiographs from 1,240 patients who presented in two centers with chronic foot pain, or persistent pain developed after trauma, were retrospectively reviewed to determine the incidence and variations of the AN in relation to gender. The AN was found in 20.9% (259/1240). Among 259 feet with AN, Type 1 was identified in 25.4% (66/259), Type 2 in 42.4% (110/259) (20.0% (52/259) Type 2 A and 22.4% (58/259) Type 2B), and Type 3 in 32.0% (83/259). After 13 patients with incomplete medical records had been excluded, the remaining records showed that foot pain was associated with an AN in 10.6% of patients (26/246). In 1.2% of cases, two additional ossicles were found proximal to the navicular, possibly the result of multiple ossification centers that did not unite at the time of development. Patient symptomatology was related to the presence of an AN in 2% of patients with chronic foot pain. The AN could vary morphologically. Our data can enhance our diagnostic skills in detecting these ossicles. Clin. Anat. 30:436-444, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  11. Technology and Social Media Use Among Patients Enrolled in Outpatient Addiction Treatment Programs: Cross-Sectional Survey Study

    Science.gov (United States)

    Lynch, Kevin; Curtis, Brenda

    2018-01-01

    Background Substance use disorder research and practice have not yet taken advantage of emerging changes in communication patterns. While internet and social media use is widespread in the general population, little is known about how these mediums are used in substance use disorder treatment. Objective The aims of this paper were to provide data on patients' with substance use disorders mobile phone ownership rates, usage patterns on multiple digital platforms (social media, internet, computer, and mobile apps), and their interest in the use of these platforms to monitor personal recovery. Methods We conducted a cross-sectional survey of patients in 4 intensive outpatient substance use disorder treatment facilities in Philadelphia, PA, USA. Logistic regressions were used to examine associations among variables. Results Survey participants (N=259) were mostly male (72.9%, 188/259), African American (62.9%, 163/259), with annual incomes less than US $10,000 (62.5%, 161/259), and averaged 39 (SD 12.24) years of age. The vast majority of participants (93.8%, 243/259) owned a mobile phone and about 64.1% (166/259) owned a mobile phone with app capabilities, of which 85.1% (207/243) accessed the internet mainly through their mobile phone. There were no significant differences in age, gender, ethnicity, or socio-economic status by computer usage, internet usage, number of times participants changed their phone, type of mobile phone contract, or whether participants had unlimited calling plans. The sample was grouped into 3 age groups (Millennials, Generation Xers, and Baby Boomers). The rates of having a social media account differed across these 3 age groups with significant differences between Baby Boomers and both Generation Xers and Millennials (PMillennials (P<.001). The majority of respondents (70.1%, 181/259) said they would prefer to use a relapse prevention app on their phone or receive SMS (short message service) relapse prevention text messages (72.3%, 186/259

  12. “Dead” Rules of Chapter 26 of the Criminal Code of the Russian Federation​

    Directory of Open Access Journals (Sweden)

    Kalinina Oksana M.

    2018-03-01

    Full Text Available The article draws attention to the practice of application of norms about the criminal responsibility for environmental crimes, which include non-performing regulations, in particular articles 248, 259 of the Criminal Code of the Russian Federation. According to the Author, the establishment of criminal responsibility for crimes provided in articles 248, 259 of the Criminal Code of the Russian Federation, not caused by necessity in the absence of violations or their singleness. These regulatory provisions do not implement the objectives of part 1 of article 2 of the Criminal Code of the Russian Federation. These rules are “dead” and should be decriminalized. The responsibility for such illegal actions may be provided in an administrative or civil legislation, or offset by competing norms. In this situation, the change in the content of article 248, 259 of the Criminal Code of the Russian Federation will not affect their effectiveness.

  13. Effects of Dietary Lipid Levels on Growth Performance, Apparent Digestibility Coefficients of Nutrients, and Blood Characteristics of Juvenile Crucian Carp (Carassius auratus gibelio)

    OpenAIRE

    Wang, Aimin; Han, Guangming; Lv, Fu; Yang, Wenping; Huang, Jintian; Yin, Xiaoling

    2014-01-01

    In this study, the effects of dietary lipid levels on growth, apparent digestibility, and blood biochemical indices of juveniles crucian carp (Carassius auratus gibelio) were evaluated. Triplicate groups of fish (average weight 2.05±0.02 g) were fed four isonitrogenous experimental diets formulated with increasing levels (13.6, 61.3, 115, and 259.8 g kg-1) of lipid. The weight gain (WG), specific growth rate (SGR) was highest in fish fed 115 g kg-1 of lipid, the WG and SGR of 259.8 g kg-1 lip...

  14. International measures project for rational energy use (Survey project of the analysis tool of Asian energy consumption efficiency). List of errata; 1998 nendo kokusai energy shiyo gorika nado taisaku jigyo seigohyo. Asia energy shohi koritsuka bunseki tool chosa jigyo

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    The list of errata was prepared for the data book of the international measures project for rational energy use (Survey project of the analysis tool of Asian energy consumption efficiency). Corrected pages of the data book 1 (1990) are as follows: 187-190, 223-226, 259-262, 295- 298, 369-370, 387-388 and 405-406 on Malaysian data. Corrected pages of the data book 2 (1985) are as follows: 102-105 on Chinese data, 154 on common data, and 187-190, 223-226, 259-262, 295-298, 369-370, 387-388 and 405-406 on Malaysian data. (NEDO)

  15. AcEST: BP916642 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ides f... 35 0.20 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 34 0.34 sp|O94386|YGS9...EL----QAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLEKQKSR 258 Query: 145 L 143 L Sbjct: 259 L 259 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizoph...renia 1 protein OS=Homo sapiens GN=DISC1 PE=1 SV=3 Length = 854 Score = 34.3 bits (

  16. La inútil añoranza de la normalidad

    Directory of Open Access Journals (Sweden)

    Margarita Valencia

    2012-01-01

    Full Text Available Litchis de Madagascar. Aquiles Cuervo. Editorial Elfin de la noche. Buenos Aires, 2011, 91 págs. El ruido de las cosas al caer. Juan Gabriel Vásquez. Premio Alfaguara de novela 2011. Alfaguara. Bogotá. 2011, 259 págs. Tres ataúdes blancos. Antonio Ungar. Premio Herralde de Novela. Editorial Anagrama. Barcelona. 2010, 259 págs. Suicídame. Andrés Arias. Ediciones B. Bogotá, 2010, 261 págs. C.M. no récord. Juan Álvarez. Alfaguara. Bogotá, 2010, 262 págs.

  17. Ressenya a Mercedes Gallent Marco, Orígenes del sistema sanitario valenciano. Documentos fundacionales del Hospital General de Valencia, València, Institució Alfons el Magnànim-Centre Valencià d’Estudis i Investigació. Diputació de València, 2016.

    Directory of Open Access Journals (Sweden)

    Blai Josep Server Server

    2017-06-01

    Full Text Available Ressenya a Mercedes Gallent Marco, Orígenes del sistema sanitario valenciano. Documentos fundacionales del Hospital General de Valencia, València, Institució Alfons el Magnànim, 2016, 259 pp. ISBN 978-84-7822-6851-6 Review to Mercedes Gallent Marco, Orígenes del sistema sanitario valenciano. Documentos fundacionales del Hospital General de Valencia, València, Institució Alfons el Magnànim, 2016, 259 pp. ISBN 978-84-7822-6851-6

  18. Mapping of calmodulin binding site on the C-tail of TRPC6 channel

    Czech Academy of Sciences Publication Activity Database

    Friedlová, Eliška; Gryčová, Lenka; Lánský, Petr; Šulc, Miroslav; Teisinger, Jan

    2007-01-01

    Roč. 102, Suppl.1 (2007), s. 259-259 ISSN 0022-3042. [Biennial meeting of the International Society for Neurochemistry /21./ and Annual meeting of the American Society for Neurochemistry /38./. 19.08.2007-24.08.2007, Cancun] R&D Projects: GA AV ČR(CZ) IAA600110701; GA ČR(CZ) GA303/07/0915; GA MŠk(CZ) LC554; GA ČR(CZ) GD305/03/H148 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z50200510 Keywords : cpo1 * TRPC6 * calmodulin binding site * fluorescence Subject RIV: BO - Biophysics

  19. BRMS1 Suppresses Breast Cancer Metastasis to Bone via Its Regulation of microRNA-125b and Downstream Attenuation of TNF-Alpha and HER2 Signaling Pathways

    Science.gov (United States)

    2014-04-01

    W81XWH-10-1-0749; Contract grant sponsor: American Cancer Society; Contract grant number: RSG-11-259-01- CSM ; Contract grant sponsor: Na- tional Foundation...sponsor: Cancer Research Center of Excellence (Taiwan); Contract grant number: DOH102- TD -C-111-005 *Correspondence to: Department of Cancer Biology, The...Cancer Research Program (Postdoctoral Fellowship Award W81XWH-10-1-0749). D.R.H. is supported by the American Cancer Society (Award RSG-11-259-01- CSM

  20. Potential of improving the treatment of tuberculosis through nanomedicine

    CSIR Research Space (South Africa)

    Semete, B

    2012-03-01

    Full Text Available Controlled Release, 63, 235-259. Smith, P. J., van Dyk, J., & Fredericks, A. (1999) Determination of rifampicin, isoniazid and pyrazinamide by high performance liquid chromatography after their simultaneous extraction from plasma. Int J Lung Dis, 3, 325...

  1. Changes in white blood cells in sheep blood during selenium supplementation

    Czech Academy of Sciences Publication Activity Database

    Písek, L.; Trávníček, J.; Salát, Jiří; Kroupová, V.; Soch, M.

    2008-01-01

    Roč. 53, č. 5 (2008), s. 255-259 ISSN 0375-8427 R&D Projects: GA ČR GD523/03/H076 Institutional research plan: CEZ:AV0Z60220518 Keywords : ewes * immunity * T lymphocytes * CD4(+) * CD8(+) Subject RIV: GG - Livestock Rearing Impact factor: 0.659, year: 2008

  2. Empirical evidence for large X-effects in animals with undifferentiated sex chromosomes

    Czech Academy of Sciences Publication Activity Database

    Dufresnes, C.; Majtyka, T.; Baird, Stuart J. E.; Gerchen, J. F.; Borzée, A.; Savary, R.; Ogielska, M.; Perrin, N.; Stöck, M.

    2016-01-01

    Roč. 6, č. 21029 (2016), s. 21029 ISSN 2045-2322 Institutional support: RVO:68081766 Keywords : controlled study * genetic marker * hybrid zone * Hyla * introgression * sex chromosome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  3. Multidose pharmacokineetecs of orally administered florfenicol in channel catfish Ictalurus punctatus

    Science.gov (United States)

    Plasma disposition of florfenicol in channel catfish was investigated after an oral dose (10mg/kg for 10 days) administered in freshwater at water temperatures ranging from 24.7 to 25.9°C. Florfenicol concentrations in plasma were analyzed by means of liquid chromatography with MS/MS detection. Af...

  4. In-situ prepared polyaniline-silver composites: single- and two-step strategies

    Czech Academy of Sciences Publication Activity Database

    Bober, Patrycja; Stejskal, Jaroslav; Trchová, Miroslava; Prokeš, J.

    2014-01-01

    Roč. 122, 10 March (2014), s. 259-266 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : composites * conducting polymer * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.504, year: 2014

  5. Ultra-low gossypol cottonseed: gene-silencing opens up a vast, but underutilized protein resource for human nutrition

    Science.gov (United States)

    Cotton, grown mainly for its fiber, is a major crop in several developing and developed countries across the globe. In 2012, 48.8 million metric tons (MMT) of cottonseed was produced worldwide as a by-product of the 25.9 MMT of cotton lint production (FAO Production Statistics). This amount of cot...

  6. Chapter 2: Livestock and grazed land emissions. U.S. Agriculture and Forestry Greenhouse Gas Inventory: 1990-2005. Technical bulletin 1921

    Science.gov (United States)

    : A total of 259 Tg CO2 eq. of greenhouse gasses (GHGs) were emitted from livestock, managed livestock waste, and grazed land in 2005. This represents about 49% of total emissions from the agricultural sector. Compared to the base line year (1990), emissions from this source were about 2% lower in...

  7. Cold tolerance is unaffected by oxygen availability despite changes in anaerobic metabolism

    Czech Academy of Sciences Publication Activity Database

    Boardman, L.; Sorensen, J. G.; Košťál, Vladimír; Šimek, Petr; Terblanche, J. S.

    2016-01-01

    Roč. 6, SEPT 13 (2016), č. článku 32856. ISSN 2045-2322 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : hypoxia * cold * insect Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep32856

  8. In this section of Resonance, we invite readers to pose questions ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Discovering Facts: Finding the Longest Day with School Children. Vishwesha Guttal. Classroom Volume 20 Issue 3 March 2015 pp 254-259. Fulltext. Click here to view fulltext PDF. Permanent link:

  9. Transcobalamin C776G genotype modifies the association between vitamin B12 and homocysteine in older hispanics

    Science.gov (United States)

    Background: A common polymorphism, C776G, in the plasma B12 transport protein transcobalamin (TC), encodes for either proline or arginine at codon 259. This polymorphism may affect the affinity of TC for B12 and subsequent delivery of B12 to tissues. Methods: TC genotype and its associations with i...

  10. Lipid Driven Nanodomains in Giant Lipid Vesicles are Fluid and Disordered

    Czech Academy of Sciences Publication Activity Database

    Koukalová, Alena; Amaro, Mariana; Aydogan, Gokcan; Gröbner, G.; Williamson, P. T. F.; Mikhalyov, I.; Hof, Martin; Šachl, Radek

    2017-01-01

    Roč. 7, JUL 2017 (2017), č. článku 5460. ISSN 2045-2322 R&D Projects: GA ČR GA17-03160S Institutional support: RVO:61388955 Keywords : FLUORESCENCE CORRELATION SPECTROSCOPY * PLASMA-MEMBRANE VESICLES * RESONANCE ENERGY-TRANSFER Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    polynomials. 131. Ambily A A see Adhikari S D. 259. Athreya Krishna B. Critical age-dependent branching Markov processes and their scaling limits. 363. Athreya Siva R see Athreya ... the 'standard linear model' of viscoelasti- city. 495. Guo Yu-hong ... Mixed norm estimate for Radon transform on weighted Lp spaces. 441.

  12. FEM simulation of a sono-reactor accounting for vibrations of the boundaries

    Czech Academy of Sciences Publication Activity Database

    Louisnard, O.; González-Garcia, J.; Tudela, I.; Klíma, Jiří; Sáez, V.; Vargas-Hernandez, Y.

    2009-01-01

    Roč. 16, č. 2 (2009), s. 250-259 ISSN 1350-4177 R&D Projects: GA MŠk 1P05OC074 Institutional research plan: CEZ:AV0Z40400503 Keywords : finite elements * ultrasound * standing waves Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.993, year: 2009

  13. Non-uniform self-assembly: On the anisotropic architecture of alpha-synuclein supra-fibrillar aggregates

    Czech Academy of Sciences Publication Activity Database

    Semerdzhiev, S. A.; Shvadchak, Volodymyr V.; Subramaniam, V.; Claessens, M. M. A. E.

    2017-01-01

    Roč. 7, Aug 9 (2017), č. článku 7699. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : liquid crystal spherulites * Parkinson's disease * Alzheimer's disease Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016 https://www.nature.com/ articles /s41598-017-06532-1

  14. Molecular MR imaging of fibrosis in a mouse model of pancreatic cancer

    Czech Academy of Sciences Publication Activity Database

    Polášek, Miloslav; Yang, Y.; Schühle, D. T.; Yaseen, M. A.; Kim, Y. R.; Sung, Y. S.; Guimaraes, A. R.; Caravan, P.

    2017-01-01

    Roč. 7, Aug 14 (2017), č. článku 8114. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : fibrosis * molecular imaging * pancreatic cancer Subject RIV: FD - Oncology ; Hematology OBOR OECD: Oncology Impact factor: 4.259, year: 2016 https://www.nature.com/ articles /s41598-017-08838-6

  15. Differential distribution of Y-chromosome haplotypes in Swiss and Southern European goat breeds

    Czech Academy of Sciences Publication Activity Database

    Vidal, O.; Drögemüller, C.; Obexer-Ruff, G.; Reber, I.; Jordana, J.; Martínez, A.; Bâlteanu, V. A.; Delgado, J. V.; Eghbalsaied, S.; Landi, V.; Goyache, F.; Traore, A.; Pazzola, M.; Vacca, G.M.; Badaoui, B.; Pilla, F.; D'Andrea, M.; Álvarez, I.; Capote, J.; Sharaf, Abdoallah; Pons, A.; Amills, M.

    2017-01-01

    Roč. 7, NOV 23 (2017), č. článku 16161. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : mitochondrial-dna * nucleotide diversity * genetic diversity * domestication * origins * phylogenies * east Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 4.259, year: 2016

  16. Download

    African Journals Online (AJOL)

    Nazlı

    2017-12-29

    Dec 29, 2017 ... plants is invaluable in this sense. ... Essential oil of plant as the subject of this study was obtained from TP which is common in the Sivas province. ..... and chalcones. Pharmacol Res; 57: 259-265. 23. NCCLS (National Committee for Clinical Laboratory Standards) (1997).Performance standards for.

  17. Understanding corruption and corruptibility through experiments

    Czech Academy of Sciences Publication Activity Database

    Dušek, Libor; Ortmann, Andreas; Lízal, Lubomír

    2005-01-01

    Roč. 14, č. 2 (2005), s. 147-162 ISSN 1210-0455 R&D Projects: GA ČR GA402/04/0167 Institutional research plan: CEZ:AV0Z70850503 Keywords : corruption * corruptibility * experiments Subject RIV: AH - Economics http://www.vse.cz/pep/abstrakt.php3?IDcl=259

  18. 2015-2016 Travel and Hospitality Expense Reports for Joanne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Destination(s):. Delhi (India). Airfare: $11,659.58. Other. Transportation: $106.70. Accommodation: $2,913.67. Meals and. Incidentals: $847.77. Other: $259.25. Total: $15,786.97. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.

  19. Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti

    Czech Academy of Sciences Publication Activity Database

    Ďurďovič, Martin

    2014-01-01

    Roč. 36, č. 3 (2014), s. 259-281 ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281

  20. Secreted Isoform of Human Lynx1 (SLURP-2): Spatial Structure and Pharmacology of Interactions with Different Types of Acetylcholine Receptors

    Czech Academy of Sciences Publication Activity Database

    Lyukmanova, E. N.; Shulepko, M. A.; Shenkarev, Z. O.; Bychkov, M. L.; Paramonov, A. S.; Chugunov, A. O.; Kulbatskii, D. S.; Arvaniti, M.; Dolejší, Eva; Schaer, T.; Arseniev, A. S.; Efremov, R. G.; Thomsen, M. S.; Doležal, Vladimír; Bertrand, D.; Dolgikh, D. A.; Kirpichnikov, M. P.

    2016-01-01

    Roč. 6, Aug 3 (2016), s. 30698 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA14-05696S Institutional support: RVO:67985823 Keywords : ion channel * signalling * molecular modelling * protein–protein interaction networks * solution-state NMR Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016

  1. Maximum effort in the minimum-effort game

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Normann, H.-T.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  2. Sokoto Journal of Veterinary Sciences Occurrence of parasite eggs ...

    African Journals Online (AJOL)

    ADEYEYE

    water and water supplies contaminated with sewage for irrigation, post-harvest ... and washed in distilled water (1500 mls) in a plastic container. .... Pharmaceutical Biology, 3: 249-259. Beuchat LR (2002). Ecological factors influencing survival and growth of human pathogens on raw fruits and vegetables. Microbes and.

  3. Omphalocoeles: A decade in review

    African Journals Online (AJOL)

    4 omphalocoeles (Fig. 5). Beckwith-Wiedemann syndrome had the largest association in this series, with 58 (37.6%) patients. Other syndromes included chromosomal abnormalities, viz. trisomy. 18, 13 and 21 in 12 (7.79%) patients, pentalogy of Cantrell in. 7 (4.54%) and OEIS complex in 4 (2.59%) (Fig. 6). The associated.

  4. Dicty_cDB: Contig-U10091-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available itoralis HTCC259... 34 10.0 ( O30611 ) RecName: Full=Ice nucleation protein; &AF013159_1(AF01... 34 10.0 (A5I2X9) RecName: Full=Segre...gation and condensation protein B; ... 34 10.0 (Q54FQ3) RecName: Full=Probable poly

  5. Entanglement and nonclassicality in four-mode Gaussian states generated via parametric down-conversion and frequency up-conversion

    Czech Academy of Sciences Publication Activity Database

    Arkhipov, Ie.I.; Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.

    2016-01-01

    Roč. 6, Sep (2016), 1-12, č. článku 33802. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : four-mode Gaussian states * parametric down-conversion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  6. Immunogenicity of a 7-valent pneumococcal conjugate vaccine (PCV7) and impact on carriage in Venezuelan children at risk of invasive pneumococcal diseases

    NARCIS (Netherlands)

    Rivera-Olivero, I.A.; Nogal, B. del; Fuentes, M.; Cortez, R.; Bogaert, D.; Hermans, P.W.M.; Waard, J.H. de

    2014-01-01

    BACKGROUND AND AIMS: We evaluated the immunogenicity of the 7-valent pneumococcal conjugate vaccine (PCV7), and its impact on pneumococcal carriage in Venezuelan children at high risk for invasive pneumococcal disease (IPD). METHODS: 82 children (age 2-59 months) with sickle cell anemia (n=22),

  7. A theoretical investigation of photoemission spectra from (GaAs).sub.2./sub. (AlAs).sub.2./sub. superlattices

    Czech Academy of Sciences Publication Activity Database

    Strasser, T.; Solterbeck, C.; Schattke, W.; Bartoš, Igor; Cukr, Miroslav; Jiříček, Petr; Fadley, C. S.; Van Hove, M. A.

    114-116, - (2001), s. 1127-1132 ISSN 0368-2048 Institutional research plan: CEZ:A02/98:Z1-010-914 Keywords : superlattices * III/V semiconductors * photoemission * one-step model Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.259, year: 2001

  8. Experimental Study of the Effect of Si/Al Composition on the Aluminum Distribution in (Al)MCM-41

    Czech Academy of Sciences Publication Activity Database

    Dědeček, Jiří; Žilková, Naděžda; Čejka, Jiří

    44-45, 1/3 (2001), s. 259-266 ISSN 1387-1811 R&D Projects: GA AV ČR IAA4040001; GA AV ČR IBS4040017 Institutional research plan: CEZ:AV0Z4040901 Keywords : (Al)MCM-41 * Al distribution * VIS spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.497, year: 2001

  9. Featuring Old/New Recognition: The Two Faces of the Pseudoword Effect

    Science.gov (United States)

    Joordens, Steve; Ozubko, Jason D.; Niewiadomski, Marty W.

    2008-01-01

    In his analysis of the pseudoword effect, [Greene, R.L. (2004). Recognition memory for pseudowords. "Journal of Memory and Language," 50, 259-267.] suggests nonwords can feel more familiar that words in a recognition context if the orthographic features of the nonword match well with the features of the items presented at study. One possible…

  10. Synthesis of fluorescent diblock copolymer nanoparticle supported ...

    Indian Academy of Sciences (India)

    2017-06-09

    Jun 9, 2017 ... This motivated us to do the present investigation. The lit- erature review indicated that the .... DBC nanoparticles start to act as a homogeneous catalyst. So, after the addition of DBCNC, the kapp ..... [46] Deshpande P A, Aruna S T and Madras G 2011 Clean Soil Air. Water 39 259. [47] Deshpande P A and ...

  11. Increased core body temperature in astronauts during long-duration space missions

    Czech Academy of Sciences Publication Activity Database

    Stahn, A. C.; Werner, A.; Opatz, O.; Maggioni, M. A.; Steinach, M.; von Ahlefeld, V. W.; Moore, A.; Crucian, B. E.; Smith, S. M.; Zwart, S. R.; Schlabs, T.; Mendt, S.; Trippel, T.; Koralewski, E.; Koch, J.; Chouker, A.; Reitz, Guenther; Shang, P.; Rocker, L.; Kirsch, K. A.; Gunga, H-C.

    2017-01-01

    Roč. 7, č. 11 (2017), č. článku 16180. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : core body temperature * astonauts' CBT * spaceflights Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering Impact factor: 4.259, year: 2016

  12. Pán a pán, který běží – vývoj kresby v mladším školním věku

    Czech Academy of Sciences Publication Activity Database

    Vágnerová, M.; Janošová, Pavlína

    2017-01-01

    Roč. 51, č. 4 (2017), s. 240-259 ISSN 0555-5574 Grant - others:AV ČR(CZ) StrategieAV21/14 Program:StrategieAV Institutional support: RVO:68081740 Keywords : development of drawing * early school age * running human figure drawing * diagnostic possibilitie of drawing Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations)

  13. Chemical degradation of trimethyl phosphate as surrogate for organo-phosporus pesticides on nanostructured metal oxides

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Henych, Jiří; Matys Grygar, Tomáš; Pérez, Raul

    2015-01-01

    Roč. 61, JAN (2015), s. 259-269 ISSN 0025-5408 R&D Projects: GA ČR(CZ) GAP106/12/1116 Institutional support: RVO:61388980 Keywords : Nanostructured oxides * Stoichiometric degradation * Trimethyl phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015

  14. Synthesis and structural characterization of CsNiP crystal

    Indian Academy of Sciences (India)

    Unknown

    Danebrock et al 1996; Shirotani et al 1996; Kuriyama et al 1998) and also show superconductivity at low tem- .... G S, Sridhar M A and Prasad J S 2003 Mater. Res. Bull. 33. 1309. Muller R, Shelton R N, Richardson H W and Jacobson R A. 1983 J. Less Common Metals 92 177. Nakotte H et al 1999 Physica B259–261 280.

  15. Seismic communication in demon African mole rat Tachyoryctes daemon from Tanzania

    Czech Academy of Sciences Publication Activity Database

    Hrouzková, E.; Dvořáková, V.; Jedlička, Petr; Šumbera, R.

    2013-01-01

    Roč. 31, č. 3 (2013), s. 255-259 ISSN 0289-0771 Institutional support: RVO:67985530 Keywords : seismic communication * substrate-borne vibration * subterranean mammal Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.790, year: 2013

  16. Pension reform in the Czech Republic: present situation and future prospects (a comparison with Austria)

    Czech Academy of Sciences Publication Activity Database

    Vavrejnová, Marie; Belabed, E.; Wörister, K.

    2004-01-01

    Roč. 13, č. 3 (2004), s. 237-259 ISSN 1210-0455 R&D Projects: GA AV ČR KSK9058117 Institutional research plan: CEZ:AV0Z7085904 Keywords : pension reforms * aging * multi-pillar system Subject RIV: AH - Economics

  17. Status Of Strategic Management Practices Of Secondary School ...

    African Journals Online (AJOL)

    The purpose of the study was to determine the extent to which principals practice strategic management skills in students' administration in secondary schools in Anambra State. All the two hundred and fifty-nine (259) secondary school principals of the six education zones of Anambra State were used for the study.

  18. Evolutionary maintenance of sexual dimorphism in head size in the lizard Zootoca vivipara: a test of two hypotheses

    Czech Academy of Sciences Publication Activity Database

    Gvoždík, Lumír; Van Damme, R.

    2003-01-01

    Roč. 259, č. 1 (2003), s. 7-13 ISSN 0952-8369 R&D Projects: GA AV ČR KSK6005114 Keywords : sexual dimorphism * agonistic interactions * copulation Subject RIV: EG - Zoology Impact factor: 1.175, year: 2003

  19. Haematological profile of the domestic pigeon ( Columba livia ...

    African Journals Online (AJOL)

    MCV) – 133.86 ± 19.37 fl; mean corpuscular haemoglobin (MCH) – 38.67 ± 5.34 pg; mean corpuscular hemoglobin concentration (MCHC) – 28.97 ± 2.59 g/dl; leukocyte counts (103/ul): total leukocyte – 23.36 ± 7.06; lymphocyte – 10.66 ± 3.49, ...

  20. The effect of magnesium oxide supple- mentation on the fertility of ...

    African Journals Online (AJOL)

    Ed. Hacker,. J.B. CAB Farnham Royal, UK, p259. McDOWELL, L.R., CONRAD, J.H., ELLIS, G.L. &. LOOSLI, J.K., 1983. Minerals for Grazing Ruminants in. Tropical Regions. Univ. of Florida, Gainesville. MILLER, W.J., 1979. Dairy Cattle Feeding and Nutrition. Academic Press, New York. PICKARD, D.W., 1986. Minerals and ...

  1. Structural changes in alginate-based microspheres exposed to in vivo environment as revealed by confocal Raman microscopy

    Czech Academy of Sciences Publication Activity Database

    Kroneková, Z.; Pelach, M.; Mazancová, P.; Uhelská, L.; Treľová, D.; Rázga, F.; Némethová, V.; Szalai, S.; Chorvát, D.; McGarrigle, J. J.; Omami, M.; Isa, D.; Ghani, S.; Majková, E.; Oberholzer, J.; Raus, Vladimír; Šiffalovič, P.; Lacík, I.

    2018-01-01

    Roč. 8, 26 January (2018), s. 1-12, č. článku 1637. ISSN 2045-2322 Institutional support: RVO:61389013 Keywords : confocal Raman microscopy * alginate * microcapsule Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016

  2. Aromatic and proteomic analyses corroborate the distinction between Mediterranean landraces and modern varieties of durum wheat

    Czech Academy of Sciences Publication Activity Database

    Federico, V.; Pompeiano, Antonio; Gu, Z.; Lo Presti, E.; Whitney, L.; Monti, M.; Di Miceli, G.; Giambalvo, D.; Ruisi, P.; Guglielminetti, L.; Mancuso, S.

    2016-01-01

    Roč. 6, oct (2016), č. článku 34619. ISSN 2045-2322 Institutional support: RVO:67179843 Keywords : PTR-TOF-MS * volatile compounds * gluten strength * rapid characterization * protein-composition * extrusion-cooking * quality * cultivars * flour * subunits Subject RIV: GC - Agronomy Impact factor: 4.259, year: 2016

  3. Nonpyrogenic Molecular Adjuvants Based on norAbu-Muramyldipeptide and norAbu-Glucosaminyl Muramyldipeptide: Synthesis, Molecular Mechanisms of Action, and Biological Activities in Vitro and in Vivo

    Czech Academy of Sciences Publication Activity Database

    Effenberg, R.; Turánek Knötigová, P.; Zyka, D.; Čelechovská, H.; Mašek, J.; Bartheldyová, E.; Hubatka, F.; Koudelka, Š.; Lukáč, R.; Kovalová, Anna; Šaman, David; Křupka, M.; Barkocziova, L.; Kosztyu, P.; Šebela, M.; Drož, L.; Hučko, M.; Kanásová, M.; Miller, A.D.; Raška, M.; Ledvina, M.; Turánek, J.

    2017-01-01

    Roč. 60, č. 18 (2017), s. 7745-7763 ISSN 0022-2623 R&D Projects: GA MŠk(CZ) LO1304 Institutional support: RVO:61388963 Keywords : N-acetylmuramyl peptides * muramyl dipeptide * adamantylamide dipeptide Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  4. N-(Pivaloyloxy)alkoxy-carbonyl Prodrugs of the Glutamine Antagonist 6-Diazo-5-oxo-L-norleucine (DON) as a Potential Treatment for HIV Associated Neurocognitive Disorders

    Czech Academy of Sciences Publication Activity Database

    Nedelcovych, M. T.; Tenora, Lukáš; Kim, B. H.; Kelschenbach, J.; Chao, W.; Hadas, E.; Jančařík, Andrej; Prchalová, Eva; Zimmermann, S. C.; Dash, R. P.; Gadiano, A. J.; Garrett, C.; Furtmüller, G.; Oh, B.; Brandacher, G.; Alt, J.; Majer, Pavel; Volsky, D.J.; Rais, R.; Slusher, B. S.

    2017-01-01

    Roč. 60, č. 16 (2017), s. 7186-7198 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : long-term potentiation * magnetic resonance spectroscopy * virus type 1 encephalitis Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  5. Synthesis and Evaluation of Asymmetric Acyclic Nucleoside Bisphosphonates as Inhibitors of Plasmodium falciparum and Human Hypoxanthine-Guanine-(Xanthine) Phosphoribosyltransferase

    Czech Academy of Sciences Publication Activity Database

    Špaček, Petr; Keough, D. T.; Chavchich, M.; Dračínský, Martin; Janeba, Zlatko; Naesens, L.; Edstein, M. D.; Guddat, L. W.; Hocková, Dana

    2017-01-01

    Roč. 60, č. 17 (2017), s. 7539-7554 ISSN 0022-2623 R&D Projects: GA ČR(CZ) GA16-06049S Institutional support: RVO:61388963 Keywords : hypoxanthine-guanine phosphoribosyltransferase * 2nd phosphonate group * 6-oxopurine phosphoribosyltransferases Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  6. Halogen Bonding in Nucleic Acid Complexes

    Czech Academy of Sciences Publication Activity Database

    Kolář, Michal H.; Tabarrini, O.

    2017-01-01

    Roč. 60, č. 21 (2017), s. 8681-8690 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : aldose reductase inhibition * minor groove binders * medicinal chemistry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.259, year: 2016

  7. Insulin-like Growth Factor 1 Analogs Clicked in the C Domain: Chemical Synthesis and Biological Activities

    Czech Academy of Sciences Publication Activity Database

    Macháčková, Kateřina; Collinsová, Michaela; Chrudinová, Martina; Selicharová, Irena; Pícha, Jan; Buděšínský, Miloš; Vaněk, Václav; Žáková, Lenka; Brzozowski, A. M.; Jiráček, Jiří

    2017-01-01

    Roč. 60, č. 24 (2017), s. 10105-10117 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : IGF-1 * receptor * synthesis * triazole Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016 http://pubs.acs.org/doi/full/10.1021/acs.jmedchem.7b01331

  8. Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results From An O3-Gradient and a Face Experiment

    Science.gov (United States)

    D.F. Karnosky; B. Mankovska; K. Percy; R.E. Dickson; G.K. Podila; J. Sober; A. Noormets; G. Hendrey; Mark D. Coleman; M. Kubiske; K.S. Pregitzer; J.G. Isebrands

    1999-01-01

    Abstract. Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[(O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3...

  9. Iron(II) supramolecular helicates interfere with the HIV-1 Tat-TAR RNA interaction critical for viral replication

    Czech Academy of Sciences Publication Activity Database

    Malina, Jaroslav; Hannon, Michael J.; Brabec, Viktor

    2016-01-01

    Roč. 6, JUL2016 (2016) ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA16-03517S Institutional support: RVO:68081707 Keywords : DINUCLEAR RUTHENIUM(II) COMPLEX * METALLOSUPRAMOLECULAR CYLINDERS * BIOLOGICAL EVALUATION Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  10. effect of liquid nitrogen storage time on the survival and ...

    African Journals Online (AJOL)

    Administrator

    Investigations were undertaken on the effect of liquid nitrogen (LN) storage time on survival and regeneration of somatic embryos of cocoa ..... L. In vitro Cellular and Developmental. Biology-Plant, 38: 252-259. Pence, V. C. 1991. Cryopreservation of immature embryos of Theobroma cacao. Plant Cell. Reports10: 144-147.

  11. Binary asteroid population. 1. Angular momentum content

    Czech Academy of Sciences Publication Activity Database

    Pravec, Petr; Harris, A. W.

    2007-01-01

    Roč. 190, č. 1 (2007), s. 250-259 ISSN 0019-1035 R&D Projects: GA ČR(CZ) GA205/05/0604 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.869, year: 2007

  12. Comparative assessment of fungal augmentation treatments of a fine-textured and historically oil-contaminated soil

    Czech Academy of Sciences Publication Activity Database

    Covino, Stefano; Stella, Tatiana; D'Annibale, A.; Lladó, Salvador; Baldrian, Petr; Čvančarová, Monika; Cajthaml, Tomáš; Petruccioli, M.

    2016-01-01

    Roč. 566, OCT1 (2016), s. 250-259 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GA15-02328S Institutional support: RVO:61388971 Keywords : Oil-contaminated soil * Bioremediation * Contaminant bioavailability Subject RIV: EE - Microbiology, Virology Impact factor: 4.900, year: 2016

  13. Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva

    Czech Academy of Sciences Publication Activity Database

    Psota, V.; Čmelík, Richard; Sachambula, L.

    2011-01-01

    Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation

  14. Escitalopram in the Treatment of Adolescent Depression: A Randomized Placebo-Controlled Multisite Trial

    Science.gov (United States)

    Emslie, Graham J.; Ventura, Daniel; Korotzer, Andrew; Tourkodimitris, Stavros

    2009-01-01

    A randomized, double-blind, placebo-controlled trial that involves 312 male and female patients aged 12-17 reveal the effectiveness of escitalopram in the treatment of depressed adolescents. Eighty-three percent of the participants or 259 participants completed the 8 weeks therapy period.

  15. Collins and Sivers asymmetries in muonproduction of pions and kaons off transversely polarised protons

    Czech Academy of Sciences Publication Activity Database

    Adolph, C.; Akhunzyanov, R.; Alexeev, M.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlák, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O.; Donskov, S. V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, E.; Hinterberger, F.; Höppner, Ch.; Horikawa, N.; d´Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jarý, V.; Jasinski, P.; Jörg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu. A.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Krämer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pesaro, G.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlüter, T.; Schmidt, K.; Schmieden, H.; Schönning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Steiger, L.; Stolarski, M.; Šulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Roč. 744, MAY 11 (2015), s. 250-259 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : single spin asymmetries * scattering * distributions * ratio Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.787, year: 2015

  16. New methodology for a person identification system

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 31; Issue 3. New methodology for a person identification system. R Bremananth A Chitra. Volume 31 Issue 3 June 2006 pp 259-276 ... Experimental results illustrate that the proposed method has been easily espoused in elections, bank transactions and other security applications.

  17. 75 FR 63145 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-14

    ... individuals, partnerships, and corporations which are applying for or have entered into Capital Construction...: National Oceanic and Atmospheric Administration (NOAA). Title: Interim Capital Construction Fund Agreement... Capital Construction Fund Program pursuant to 50 CFR part 259. At the completion of construction...

  18. Geochemistry of Fe-rich peridotites and associated pyroxenites from Horní Bory, Bohemian Massif: insights into subduction-related melt-rock reactions

    Czech Academy of Sciences Publication Activity Database

    Ackerman, Lukáš; Jelínek, E.; Medaris Jr., G.; Ježek, J.; Siebel, W.; Strnad, L.

    2009-01-01

    Roč. 259, 3-4 (2009), s. 152-167 ISSN 0009-2541 R&D Projects: GA AV ČR IAA3013403 Institutional research plan: CEZ:AV0Z30130516 Keywords : peridotite * dunite-wehrlite * melt-rock reaction Subject RIV: DD - Geochemistry Impact factor: 3.407, year: 2009

  19. Long-term outcomes of left bundle branch block in high-risk survivors of acute myocardial infarction: the VALIANT experience

    DEFF Research Database (Denmark)

    Stephenson, Kent; Skali, Hicham; McMurray, John J V

    2006-01-01

    to valsartan, captopril, or both a mean of 5 days after MI. Baseline ECG data were available from 14,259 patients. We assessed the predictive value of new LBBB for death and major cardiovascular outcomes after 3 years, adjusting for multiple baseline covariates including LV ejection fraction. RESULTS...

  20. Nanoparticle core stability and surface functionalization drive the mTOR signaling pathway in hepatocellular cell lines.

    Czech Academy of Sciences Publication Activity Database

    Lunova, M.; Prokhorov, A.; Jirsa, M.; Hof, M.; Olžyńska, A.; Jurkiewicz, P.; Kubinová, Šárka; Lunov, O.; Dejneka, A.

    2017-01-01

    Roč. 7, č. 1 (2017), s. 16049 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : mesoporous silica nanoparticles * iron -oxide nanoparticles * double-stranded-rna * drug-delivery Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  1. EAMJ September 432-448.indd

    African Journals Online (AJOL)

    2008-09-09

    Sep 9, 2008 ... The duration of surgery and the use of power tools influenced the contamination rate. ... been shown to reduce the risk of exposure to blood and body ... Maxillofacial surgery. 3. 3.7. Neurosurgery. 4. 4.9. Obstetrics/Gynaecology. 7. 8.6. Orthopaedics. 21. 25.9. Paediatric surgery. 1. 1.2. Plastic surgery. 5. 6.2.

  2. Influence of doxorubicin on model cell membrane properties: insights from in vitro and in silico studies

    Czech Academy of Sciences Publication Activity Database

    Alves, A. C.; Magarkar, Aniket; Horta, M.; Lima, J. L. F. C.; Bunker, A.; Nunes, C.; Reis, S.

    2017-01-01

    Roč. 7, Jul 24 (2017), č. článku 6343. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : P-glycoprotein * molecular dynamics * multidrug resistance Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-06445-z

  3. Inhibition of nuclear factor kappaB proteins-platinated DNA interactions correlates with cytotoxic effectiveness of the platinum complexes

    Czech Academy of Sciences Publication Activity Database

    Brabec, Viktor; Kašpárková, Jana; Kostrhunová, Hana; Farrell, N.P.

    2016-01-01

    Roč. 6, AUG2016 (2016), č. článku 28474. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LH13096 Institutional support: RVO:68081707 Keywords : interstrand cross-links * group domain proteins Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  4. Detection of ESBL among ampc producing enterobacteriaceae ...

    African Journals Online (AJOL)

    Methods: A total of 259 clinical isolates of Enterobacteriaceae were isolated and screened for ESBL production by (i) CLSI double-disk diffusion method (ii) cefepime- clavulanic acid method (iii) boronic disk potentiation method. AmpC production was detected using cefoxitin alone and in combination with boronic acid and ...

  5. Mn3O4 nano-sized crystals: Rapid synthesis and extension to ...

    Indian Academy of Sciences (India)

    of manganese ions, but also to prepare dispersed nano- sized LiMn2O4 materials with good electrochemical properties. Acknowledgements. This work was supported by the Science and Tech- nology Planning Project of Gansu Province (No. 1308RJZA259) and the Branchy Tamarisk Develop- ment Program for Young ...

  6. Significance of transition between Talchir Formation and Karharbari ...

    Indian Academy of Sciences (India)

    intracontinental ranges: High and Middle Atlas, Morocco;. Geol. Rundschau 81 249–259. Goldring R and Bridges P 1973 Sublittoral sheet sandstones;. J. Sediment. Petrol. 43 736–747. Gray J M 1996 Glacio-Isostasy, Glacio-Eustasy and rela- tive sea-level change; In: Past Glacial Environments: Sed- iments, Forms and ...

  7. p53 Over-expression and p53 mutations in colon carcinomas: Relation to dietary risk factors

    NARCIS (Netherlands)

    Voskuil, D.W.; Kampman, E.; Kraats, A.A. van; Balder, H.F.; Muijen, G.N.P. van; Goldbohm, R.A.; Veer, P. van 't

    1999-01-01

    Epidemiological studies have suggested that dietary factors may differently affect p53-dependent and p53-independent pathways to colon cancer. Results of such studies may depend on the method used to assess p53 status. This case-control study of 185 colon-cancer cases and 259 controls examines this

  8. Priority choice experimental two-qubit tomography: measuring one by one all elements of density matrices

    Czech Academy of Sciences Publication Activity Database

    Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.

    2016-01-01

    Roč. 6, Jan (2016), 1-7, č. článku 19610. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : entangled photons * state tomography Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  9. On the lexicographical description of equivalent open class ...

    African Journals Online (AJOL)

    Riette Ruthven

    Skibitzki, Bernd and Barbara Wotjak (Eds.). 1999. Linguistik und. Deutsch als Fremdsprache: 259-281. Tübingen: Max Niemeyer. Wiegand, Herbert Ernst. 2001. Sprachkontaktwörterbücher. Typen, Funktionen, Strukturen. Igla,. Birgit, Pavel Petkov and Herbert Ernst Wiegand (Eds.). 2001. Theoretische und praktische Pro-.

  10. Artificial Intelligence Applications for Nuclear Survivability Validation

    Science.gov (United States)

    1992-11-01

    AD-A259 394 IIIIIt~l111 11 11 11 1 1hIf L- E, Defense Nuclear Agency Alexandria, VA 22310-3398 DNA-TR-92-82 Artificial Intelligence Applications for...TYPE AND DATES COVERED 921101 Technical 920101 -920408 4. TITLE AND SUBTITLE 5, FUNDING NUMBERS Artificial Intelligence Applications for Nuclear

  11. Infective endocarditis - the effect of liposomes as carrier substance ...

    African Journals Online (AJOL)

    1991-05-18

    May 18, 1991 ... Infective endocarditis has a high mortality and morbidity rate despite all available treatment. Little attention has ... Infective endocarditis (lE) is an uncommon but important disease with a rising incidence in .... bacterial endocarditis in infancy, childhood and adolescence. Eur] Pediatr. 1983; 140: 253-259. 6.

  12. Diurnal and seasonal fluctuations in wood ant (.i.Formica polyctena./i.) nest temperature in two geographically distant populations along a south-north gradient

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Finer, L.

    2007-01-01

    Roč. 54, - (2007), s. 251-259 ISSN 0020-1812 Grant - others:Academy of Finland(FI) 200870 Institutional research plan: CEZ:AV0Z60660521 Source of funding: V - iné verejné zdroje Keywords : ant nests * thermoregulation * Formica rufa group Subject RIV: EH - Ecology, Behaviour Impact factor: 1.391, year: 2007

  13. Effect of reproductive status on body condition score, progesterone ...

    African Journals Online (AJOL)

    Alrahma

    2015-10-28

    Oct 28, 2015 ... the mean body condition score was below the average levels, but did vary noticeably with pregnancy or between sheep ... Therefore, feed resources ..... Feed Sci. Technol. 126(3-4): 259-276. Russel AJF, Doney JM, Gunn RG (1969). Subjective assessment of fat in live sheep. J. Agric. Sci. 72(3):45l-454.

  14. Příběh války. Vědecko-pedagogická konference v Poslanecké sněmovně Parlamentu ČR

    Czech Academy of Sciences Publication Activity Database

    Beranská, Veronika

    2017-01-01

    Roč. 104, č. 2 (2017), s. 259-261 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : World War II * Association of the Czechs from Volynia and their friends * Volynia Czechs * Chamber of deputies Parliament of the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  15. Glucagon Receptor Antagonism Improves Glucose Metabolism and Cardiac Function by Promoting AMP-Mediated Protein Kinase in Diabetic Mice

    Directory of Open Access Journals (Sweden)

    Ankit X. Sharma

    2018-02-01

    Full Text Available The antidiabetic potential of glucagon receptor antagonism presents an opportunity for use in an insulin-centric clinical environment. To investigate the metabolic effects of glucagon receptor antagonism in type 2 diabetes, we treated Leprdb/db and Lepob/ob mice with REMD 2.59, a human monoclonal antibody and competitive antagonist of the glucagon receptor. As expected, REMD 2.59 suppresses hepatic glucose production and improves glycemia. Surprisingly, it also enhances insulin action in both liver and skeletal muscle, coinciding with an increase in AMP-activated protein kinase (AMPK-mediated lipid oxidation. Furthermore, weekly REMD 2.59 treatment over a period of months protects against diabetic cardiomyopathy. These functional improvements are not derived simply from correcting the systemic milieu; nondiabetic mice with cardiac-specific overexpression of lipoprotein lipase also show improvements in contractile function after REMD 2.59 treatment. These observations suggest that hyperglucagonemia enables lipotoxic conditions, allowing the development of insulin resistance and cardiac dysfunction during disease progression.

  16. Cutaneous Leishmaniasis

    Science.gov (United States)

    2011-06-01

    intracellular amastigotes are usually abundant. Diagnosis The different parasitologic techniques for confirming Leishmania infection are variously...effective, depending on whether the syndrome under examination is oligoparasitic or polyparasitic. A confirmed parasitologic diagnosis is es- tablished by...1990;43:257-259. 23. Grimaldi G Jr, Tesh RB. Leishmaniases of the New World: current concepts and implications for future research . Clin Microbiol Rev

  17. Direct fabrication of 3D graphene on nanoporous anodic alumina by plasma-enhanced chemical vapor deposition

    Czech Academy of Sciences Publication Activity Database

    Zhan, H.; Garrett, D.J.; Apollo, N.V.; Ganesan, K.; Lau, D.; Prawer, S.; Červenka, Jiří

    2016-01-01

    Roč. 6, Jan (2016), 1-8, č. článku 19822. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : double-layer capacitors * carbon nanotube arrays * amorphous-carbon * supercapacitor applications * Raman-spectroscopy * energy-storage Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  18. High-yield fabrication and properties of 1.4 nm nanodiamonds with narrow size distribution

    Czech Academy of Sciences Publication Activity Database

    Stehlík, Štěpán; Varga, Marián; Ledinský, Martin; Miliaieva, Daria; Kozak, Halyna; Skakalova, V.; Mangler, C.; Pennycook, T. J.; Meyer, J.C.; Kromka, Alexander; Rezek, Bohuslav

    2016-01-01

    Roč. 6, Dec (2016), 1-8, č. článku 38419. ISSN 2045-2322 R&D Projects: GA ČR GA15-01809S Institutional support: RVO:68378271 Keywords : detonation nanodiamonds * Raman-spectroscopy * diamond nanoparticles * selective oxidation * ion-implantation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  19. 75 FR 3932 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2010-01-25

    ..., Industrial Staffing, Elk Grove Village, IL: May 20, 2008. TA-W-70,916; Agilent Technologies, Digital Test... Division, Leased Workers from Furst Staffing, Stockton, IL: June 5, 2008. TA-W-71,259; Cooper Tools, Inc., Cooper Power Tools Division, Cooper Industries, Dayton, OH: June 22, 2009. TA-W-72,093; Atlantic Guest...

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Sangappa. Articles written in Journal of Biosciences. Volume 30 Issue 2 March 2005 pp 259-268 Articles. Crystal structure of raw pure Mysore silk fibre based on (Ala-Gly)2-Ser-Gly peptide sequence using Linked-Atom-Least-Squares method · Sangappa S S Mahesh R Somashekar.

  1. Shyness Predicts Depressive Symptoms among Adolescents : A Prospective Study

    Science.gov (United States)

    Murberg, Terje A.

    2009-01-01

    This study examines the relation between shyness, social support and depressive symptoms in a sample of 259 students (aged 14-16 years) in two secondary schools. Results at both time-points showed positive associations of depressive symptoms with shyness and with being female and negative associations of depressive symptoms with social support and…

  2. Bullying in Students with and without Hearing Loss

    Science.gov (United States)

    Pinquart, Martin; Pfeiffer, Jens P.

    2015-01-01

    While bullying is a common phenomenon at schools in general, very few studies have addressed bullying in students with hearing impairment. This study assessed being bullied and bullying others in 181 adolescents from German schools for students who are deaf and hard of hearing, and in 259 hearing peers from regular schools. Students who are deaf…

  3. Akdeniz, K. Gediz see Gültekin, Özgür, 349 Alhassan, JA On the ...

    Indian Academy of Sciences (India)

    user1

    AUTHOR INDEX. Akdeniz, K. Gediz see Gültekin, Özgür,. 349. Alhassan, J. A.. On the Absence of Core Luminosity–. Core-Dominance Parameter (PC–R). Correlation in Radio Galaxies and BL. Lacs. 61. Ali, Nawsad. Axially Symmetric Bianchi Type-I. Bulk-Viscous Cosmological Models with Time-Dependent and q 259.

  4. Demand and Supply of Teachers to Secondary Schools in Anambra ...

    African Journals Online (AJOL)

    This study investigated the demand and supply of teachers to secondary schools in Anambra State of Nigeria due to school type. The survey design approach was adopted for this study. The population of the study comprised of all the secondary school principals, numbering 259 in the six education zones of Anambra State.

  5. A rare-earth free magnesium alloy with improved intrinsic ductility

    Czech Academy of Sciences Publication Activity Database

    Sandlöbes, S.; Friák, Martin; Korte-Ketzel, S.; Pei, Z.; Neugebauer, J.; Raabe, D.

    2017-01-01

    Roč. 7, SEP (2017), č. článku 10458. ISSN 2045-2322 Institutional support: RVO:68081723 Keywords : MECHANICAL-PROPERTIES * MG-ZN * PRISMATIC-SLIP * DEFORMATION-BEHAVIOR Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  6. Evolutionary plasticity of restorer-of-fertility-like proteins in rice

    Czech Academy of Sciences Publication Activity Database

    Melonek, J.; Stone, James D.; Small, I.

    2016-01-01

    Roč. 6, Oct 24 (2016), s. 1-12, č. článku 35152. ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : cytoplasmic male-sterility * genome-wide analysis * PPR protein Subject RIV: EF - Botanics Impact factor: 4.259, year: 2016

  7. Glucagon-induced acetylation of Foxa2 regulates hepatic lipid metabolism.

    Science.gov (United States)

    von Meyenn, Ferdinand; Porstmann, Thomas; Gasser, Emanuel; Selevsek, Nathalie; Schmidt, Alexander; Aebersold, Ruedi; Stoffel, Markus

    2013-03-05

    Circulating levels of insulin and glucagon reflect the nutritional state of animals and elicit regulatory responses in the liver that maintain glucose and lipid homeostasis. The transcription factor Foxa2 activates lipid metabolism and ketogenesis during fasting and is inhibited via insulin-PI3K-Akt signaling-mediated phosphorylation at Thr156 and nuclear exclusion. Here we show that, in addition, Foxa2 is acetylated at the conserved residue Lys259 following inhibition of histone deacetylases (HDACs) class I-III and the cofactors p300 and SirT1 are involved in Foxa2 acetylation and deacetylation, respectively. Physiologically, fasting states and glucagon stimulation are sufficient to induce Foxa2 acetylation. Introduction of the acetylation-mimicking (K259Q) or -deficient (K259R) mutations promotes or inhibits Foxa2 activity, respectively, and adenoviral expression of Foxa2-K259Q augments expression of genes involved in fatty acid oxidation and ketogenesis. Our study reveals a molecular mechanism by which glucagon signaling activates a fasting response through acetylation of Foxa2. Copyright © 2013 Elsevier Inc. All rights reserved.

  8. The Palin Parent Rating Scales: Parents' Perspectives of Childhood Stuttering and Its Impact

    Science.gov (United States)

    Millard, Sharon K.; Davis, Stephen

    2016-01-01

    Purpose: The goal of this study is to explore the psychometric properties of the Parent Rating Scales-V1 (S. K. Millard, S. Edwards, & F. M. Cook, 2009), an assessment tool for parents of children who stutter, and to refine the measure accordingly. Method: We included 259 scales completed prior to therapy. An exploratory factor analysis…

  9. Achievement Goals and Means: A Cultural Comparison.

    Science.gov (United States)

    Niles, Sushila

    1998-01-01

    Achievement goals and means were examined with 259 Anglo Australian adults (individualist culture) and 300 Sri Lankans (collectivist culture). Results reflect an individualist orientation in preferred achievement goals among Australians. Sri Lankans, although predominantly more family and group oriented, also have important individual goals. Both…

  10. Effect of Machine Geometry on Higher Harmonics Content in Air-Gap Magnetic Field of Synchronous Reluctance Machine

    Czech Academy of Sciences Publication Activity Database

    Schreier, Luděk; Chomát, Miroslav; Doležel, Ivo

    2001-01-01

    Roč. 176, č. 1500 (2001), s. 259-266 ISSN 0072-4688 R&D Projects: GA ČR GA102/01/0181 Keywords : synchronous reluctance machine * torque pulsation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  11. Selenium protects the immature rat heart against ischemia/reperfusion injury

    Czech Academy of Sciences Publication Activity Database

    Ošťádalová, Ivana; Vobecký, Miloslav; Chvojková, Zuzana; Miková, D.; Hampl, V.; Wilhelm, J.; Ošťádal, Bohuslav

    2007-01-01

    Roč. 300, 1-2 (2007), s. 259-267 ISSN 0300-8177 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : selenium * immature heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.707, year: 2007

  12. Climatic and environmental aspects of the Mongol withdrawal from Hungary in 1242 CE

    Czech Academy of Sciences Publication Activity Database

    Büntgen, Ulf; Di Cosmo, N.

    2016-01-01

    Roč. 6, MAY (2016), č. článku 25606. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : Central Europe * ice age * variability * Carpathians * plain Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  13. Pseudotrichonympha leei, Pseudotrichonympha lifesoni, and Pseudotrichonympha pearti, new species of parabasalian flagellates and the description of a rotating subcellular structure

    Czech Academy of Sciences Publication Activity Database

    del Campo, J.; James, E. R.; Hirakawa, Y.; Fiorito, R.; Kolísko, Martin; Irwin, N. A.T.; Mathur, V.; Boscaro, V.; Hehenberger, E.; Karnkowska, A.; Scheffrahn, R. H.; Keeling, P. J.

    2017-01-01

    Roč. 7, NOV 27 (2017), č. článku 16349. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : lower termites * phylogeny * symbiosis * protozoa * primers * tool Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  14. Vitamin B2 as a virulence factor in Pseudogymnoascus destructans skin infection

    Czech Academy of Sciences Publication Activity Database

    Flieger, Miroslav; Banďouchová, H.; Černý, J.; Chudíčková, Milada; Kolařík, Miroslav; Kováčová, V.; Martínková, Natália; Novák, Petr; Šebesta, O.; Stodůlková, Eva; Pikula, J.

    2016-01-01

    Roč. 6, č. 33200 (2016), s. 33200 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:61388971 ; RVO:68081766 Keywords : riboflavin * white-nose syndrome (WNS) * bats Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016

  15. A Military Relevant Model of Closed Concussive Head Injury: Longitudinal Studies Characterizing and Validating Single and Repetitive mTBI

    Science.gov (United States)

    2015-10-01

    metabolic homeostasis associated with repeated concussion versus a single concussion. More specifically, 3×PCIs resulted in increased levels of glycogen ...carnosine is an endogenous neuroprotector against free radicals. Cell Mol Neurobiol, 17(2), 259-271. 3. Borges, N., Cerejo, A., Santos, A., Sarmento, A

  16. Author's correction The genetic factors influencing the development ...

    Indian Academy of Sciences (India)

    The genetic factors influencing the development of trichotillomania. Koushik Chatterjee. J. Genet. 91, 259–262. This article was published online on the journal website (www.ias.ac.in/jgenet/) on 2nd November 2011 and also on Springer's. Online First (http://www.springerlink.com/content/0022-1333/preprint/). The changes ...

  17. Mitochondrial biogenesis in brown adipose tissue is associated with differential expression of transcription regulatory factors

    Czech Academy of Sciences Publication Activity Database

    Villena, J. A.; Carmona, M. C.; Rodriguez de la Concepción, M.; Rossmeisl, Martin; Vinas, O.; Mampel, T.; Iglesias, R.; Giralt, M.; Villarroya, F.

    2002-01-01

    Roč. 59, č. 11 (2002), s. 1934-1944 ISSN 1420-682X Grant - others:Ministerio de Ciencia y Tecnología (ES) PM98.0188 Institutional research plan: CEZ:AV0Z5011922 Keywords : brown adipose tissue * mitochondria * transcription factors Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.259, year: 2002

  18. Numerical modelling of the reinforcing effect of geosynthetic material used in a ballasted railway tracks

    Czech Academy of Sciences Publication Activity Database

    Jiroušek, Ondřej; Jíra, J.; Hrdlička, Ondřej; Kunecký, Jiří; Kytýř, Daniel; Vyčichl, J.; Doktor, Tomáš

    2010-01-01

    Roč. 224, č. 4 (2010), s. 259-267 ISSN 0954-4097 Institutional research plan: CEZ:AV0Z20710524 Keywords : railway track bed * reinforcing geogrid * finite-element modelling * settlement reduction * contact analysis * ballast material Subject RIV: JN - Civil Engineering Impact factor: 0.389, year: 2010 http://journals.pepublishing.com/content/k561040632411117/

  19. Deformation pattern in vibrating microtubule: Structural mechanics study based on an atomistic approach

    Czech Academy of Sciences Publication Activity Database

    Havelka, Daniel; Deriu, M.A.; Cifra, Michal; Kučera, Ondřej

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 4227. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-17102S Institutional support: RVO:67985882 Keywords : Continuum model * Protein microtubules * Molecular-dymamics Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  20. 77 FR 30514 - Native Hawaiian Career and Technical Education Program; Final Waiver and Extension of Project Period

    Science.gov (United States)

    2012-05-23

    ... DEPARTMENT OF EDUCATION Native Hawaiian Career and Technical Education Program; Final Waiver and... Career and Technical Education Program Catalog of Federal Domestic Assistance (CFDA) Number: 84.259A... Technical Education Program (NHCTEP), the Secretary hereby waives 34 CFR 75.261(c)(2) in order to extend the...

  1. Myogenic nature of insect heartbeat and intestinal peristalsis, revealed by neuromuscular paralysis caused by the sting of a braconid wasp

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel; Lukáš, J.

    2011-01-01

    Roč. 57, č. 2 (2011), s. 251-259 ISSN 0022-1910 Grant - others:MZe ČR(CZ) 002 700 604 Institutional research plan: CEZ:AV0Z50070508 Keywords : autonomic heartbeat * myogenic heartbeat * anterograde heartbeat Subject RIV: ED - Physiology Impact factor: 2.236, year: 2011

  2. S¯adhan¯a Vol. 31, 2005 Subject Index

    Indian Academy of Sciences (India)

    New method for a person identification sys- tem. 259. Bearing ... radical basis function neural networks 235. Bending vibrations ..... Quadratic forms. Random eigenvalue problems revisited 293. Quasi-transverse waves. Effect of magnetic filed on the propagation of quasi-transverse waves in nonhomogeneous conducting ...

  3. Western Carpathian mountain spruce forest after a windthrow: Natural regeneration in cleared and uncleared areas

    Czech Academy of Sciences Publication Activity Database

    Jonášová, Magda; Vávrová, Eva; Cudlín, Pavel

    2010-01-01

    Roč. 259, č. 1 (2010), s. 1121-1134 ISSN 0378-1127 Institutional research plan: CEZ:AV0Z60870520 Keywords : Carpathian spruce forest * Windthrow * Natural regeneration * Disturbances Subject RIV: GK - Forest ry Impact factor: 1.992, year: 2010

  4. A new formulation of Bacillus thuringiensis: UV protection and sustained release mosquito larvae studies

    Czech Academy of Sciences Publication Activity Database

    Zhang, L.; Zhang, X.; Zhang, Y.; Wu, S.; Gelbič, Ivan; Xu, L.; Guan, X.

    2016-01-01

    Roč. 6, DEC 22 (2016), č. článku 39425. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * pest control * UV protection Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep39425

  5. Simultaneous effect of organic modifier and physicochemical parameters of barbiturates on their retention on a narrow-bore PGC column

    Czech Academy of Sciences Publication Activity Database

    Forgács, E.; Cserháti, T.; Mikšík, Ivan; Eckhardt, Adam; Deyl, Zdeněk

    2004-01-01

    Roč. 800, č. 1-2 (2004), s. 259-262 ISSN 1570-0232 Grant - others:CZ - HU(CZ) Cooperation programme Institutional research plan: CEZ:AV0Z5011922 Keywords : barbiturates * porous graphitized carbon Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.176, year: 2004

  6. Robustness of one-dimensional viscous fluid motion under multidimensional perturbations

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Sun, Y.

    2015-01-01

    Roč. 259, č. 12 (2015), s. 7529-7539 ISSN 0022-0396 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes equations * 1-D compressible fluid flow * relative energy Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022039615004325

  7. Citizen science shows systematic changes in the temperature difference between air and inland waters with global warming

    Czech Academy of Sciences Publication Activity Database

    Weyhenmeyer, G. A.; Mackay, M.; Stockwell, J. D.; Thiery, W.; Grossart, H. P.; Augusto-Silva, P. B.; Baulch, H. M.; de Eyto, E.; Hejzlar, Josef; Kangur, K.; Kirillin, G.; Pierson, D. C.; Rusak, J. A.; Sadro, S.; Woolway, R. I.

    2017-01-01

    Roč. 7, March (2017), č. článku 43890. ISSN 2045-2322 R&D Projects: GA ČR GA15-13750S Institutional support: RVO:60077344 Keywords : dissolved organic-carbon * transfer velocity * energy fluxes * lake * evaporation Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 4.259, year: 2016

  8. Success factors in new ventures : A meta-analysis

    NARCIS (Netherlands)

    Song, Michael; Podoynitsyna, Ksenia; van der Bijl, H.M.; Halman, Johannes I.M.

    2008-01-01

    Technology entrepreneurship is key to economic development. New technology ventures (NTVs) can have positive effects on employment and could rejuvenate industries with disruptive technologies. However, NTVs have a limited survival rate. In our most recent empirical study of 11,259 NTVs established

  9. The Explanatory and Predictive Relationship Pattern between University Students' Goal Orientation Behaviours and Their Academic Achievement

    Science.gov (United States)

    Akpur, Ugur

    2016-01-01

    The purpose of this study is to determine the explanatory and predictive relationship pattern between university students' goal orientation behaviours and their academic achievement. The study group consisted of 259 university students. A "2x2 Achievement Goal Orientations Scale" was used to determine the students' goal orientation…

  10. Functional groups of fossil marattialeans: chemotaxonomic implications for Pennsylvanian tree ferns and pteridophylls

    Czech Academy of Sciences Publication Activity Database

    Pšenička, J.; Zodrow, E. L.; Mastalerz, M.; Bek, Jiří

    2005-01-01

    Roč. 61, 3-4 (2005), s. 259-280 ISSN 0166-5162 R&D Projects: GA AV ČR(CZ) IAA3013902 Institutional research plan: CEZ:AV0Z30130516 Keywords : interdisciplinary approach * functional groups * FTIR Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.397, year: 2005

  11. African Zoology - Vol 24, No 4 (1989)

    African Journals Online (AJOL)

    Fine structure of endogenous stages of Eimeria turcicus developing in gall bladder epithelium of the gecko Hemidactylus turcicus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I Paperna, J.H. Landsberg, 251-259 ...

  12. Internal dynamics of intense twin beams and their coherence

    Czech Academy of Sciences Publication Activity Database

    Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.

    2016-01-01

    Roč. 6, Feb (2016), 1-8, č. článku 22320. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : dynamics of intense * twin beams * pump-depleted parametric * down-conversion * coherence Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  13. Development of a human vasopressin V-1a-receptor antagonist from an evolutionary-related insect neuropeptide

    Czech Academy of Sciences Publication Activity Database

    Di Giglio, M. G.; Muttenthaler, M.; Harpsoe, K.; Liutkeviciute, Z.; Keov, P.; Eder, T.; Rattei, T.; Arrowsmith, S.; Wray, S.; Marek, Aleš; Elbert, Tomáš; Alewood, P. F.; Gloriam, D. E.; Gruber, C. W.

    2017-01-01

    Roč. 7, Feb 1 (2017), č. článku 41002. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : neuropeptide * inotocin * V1aR-antagonist Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep41002

  14. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-24

    Nov 24, 2017 ... [4] Idrus, S.S., Ismail, H., and Palaniandy, S., 2011. Study of the effect of different shapes of ultrafine silica as fillers in natural rubber compounds. Polym Test 30, 251-259. [5] Rattanasom, N., Prasertsri, S., and Ruangritnumchai, T., 2009. Comparison of the mechanical properties at similar hardness level of ...

  15. Myocardial scintigraphy. Clinical use and consequence in a non-invasive cardiological department

    DEFF Research Database (Denmark)

    Dümcke, Christine Elisabeth; Graff, J; Rasmussen, SPL

    2006-01-01

    to analyse the clinical use of MPI in a university hospital without invasive cardiological laboratory. MATERIAL AND METHODS: In the period 01.01.2002 to 31.12.2003, 259 patients (141 women, 118 men) were referred to MPI from our department of cardiology. RESULTS: Normal MPI was seen in 111 patients (43...

  16. Nonlinear magnetoelectric effect in paraelectric state of Co4Nb2O9 single crystal

    Czech Academy of Sciences Publication Activity Database

    Cao, Ym.; Deng, Gc.; Beran, Přemysl; Feng, Zj.; Kang, Bj.; Zhang, Jc.; Guiblin, N.; Dkhil, B.; Ren, W.; Cao, Sx.

    2017-01-01

    Roč. 7, č. 10 (2017), č. článku 14079. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : magnetoelectric * single crystal * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  17. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. R Bremananth. Articles written in Sadhana. Volume 31 Issue 3 June 2006 pp 259-276. New methodology for a person identification system · R Bremananth A Chitra · More Details Abstract Fulltext PDF. Reliable person identification is a key factor for any safety measure. Unlike other biometrics ...

  18. Production of human papillomavirus type16 E7 oncoprotein fused with ß-glucuronidase in transgenic tomato and potato

    Czech Academy of Sciences Publication Activity Database

    Bříza, Jindřich; Pavingerová, Daniela; Vlasák, Josef; Ludvíková, V.; Niedermeierová, Hana

    2007-01-01

    Roč. 51, č. 2 (2007), s. 268-276 ISSN 0006-3134 R&D Projects: GA ČR GA521/05/2092 Institutional research plan: CEZ:AV0Z50510513 Keywords : transgenic plants * human papillomavirus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.259, year: 2007

  19. Review of James L. Baughman, Jennifer Ratner-Rosenhagen, and James P. Danky, eds, Protest on the Page: Essays on Print and the Culture of Dissent since 1865 (2015

    Directory of Open Access Journals (Sweden)

    Maria Zirra

    2017-12-01

    Full Text Available James L. Baughman, Jennifer Ratner-Rosenhagen, and James P. Danky, eds, Protest on the Page: Essays on Print and the Culture of Dissent since 1865 (Madison: University of Wisconsin Press, 2015. xv + 259 pp. ISBN 978-0-299-30284-9.

  20. Characterization of MTNR1A gene in terms of genetic variability in a ...

    Indian Academy of Sciences (India)

    2015-12-07

    Dec 7, 2015 ... The gene has been widely mapped in a number of livestock species like cattle, goat, pig and sheep by. Messer et al. ... tropical arid conditions. The first region was at Sheep Breed- ing Research ... Here, the sheep were fed on natural pasture integrated with concentrated feed. A total of 259 sheep (ewes) ( ...

  1. Upgradation of MOT and its Relevance to WET Campaigns Alisher S ...

    Indian Academy of Sciences (India)

    median values). Outer scale (m). 25.9 ± 19.0. Seeing angle (arcsec). 0.67 ± 0.25. Isoplanatic patch (arcsec). 2.48 ± 0.70 of Chilean sites – La Silla (dotted line) and Paranal (dashed line) in 1989–1995 and. Canarian site – Roque de los ...

  2. Global warming not so harmful for all plants-response of holomycotrophic orchid species for the future climate change

    Czech Academy of Sciences Publication Activity Database

    Kolanowska, Marta; Kras, M.; Lipińska, M.; Mystkowska, K.; Szlachetko, D. L.; Naczk, A. M.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 12704. ISSN 2045-2322 R&D Projects: GA ČR GB14-36098G Institutional support: RVO:86652079 Keywords : global warming * Orchids * climate change Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.259, year: 2016

  3. Driving forces of stability and change in woodland structure: A case-study from the Czech lowlands

    Czech Academy of Sciences Publication Activity Database

    Szabó, Péter

    2010-01-01

    Roč. 259, č. 3 (2010), s. 650-656 ISSN 0378-1127 R&D Projects: GA AV ČR IAA600050812 Institutional research plan: CEZ:AV0Z60050516 Keywords : woodland management * woodland structure * historical ecology Subject RIV: EF - Botanics Impact factor: 1.992, year: 2010

  4. 75 FR 31702 - Nondiscrimination on the Basis of Age in Programs or Activities Receiving Federal Assistance from...

    Science.gov (United States)

    2010-06-04

    .... Nonetheless, EPA would accept comments about any potential impact of EEOC's definition on EPA's regulation... 100-259, 102 Stat. 28, to add a definition for the term ``program or activity.'' The Age... race, color, national origin, sex (gender), or disability in any program or activity receiving EPA...

  5. 75 FR 31738 - Nondiscrimination on the Basis of Age in Programs or Activities Receiving Federal Assistance From...

    Science.gov (United States)

    2010-06-04

    ... impact of EEOC's definition on EPA's regulation. Parties interested in the ADEA action should refer to... amended by the Civil Rights Restoration Act of 1987, Public Law 100-259, 102 Stat. 28, to add a definition... nondiscrimination regulations prohibit discrimination on the basis of race, color, national origin, sex (gender), or...

  6. Glacial refugia and the prediction of future habitat coverage of the South American lichen species Ochrolechia austroamericana

    Czech Academy of Sciences Publication Activity Database

    Kukwa, M.; Kolanowska, Marta

    2016-01-01

    Roč. 6, dec (2016), č. článku 38779. ISSN 2045-2322 R&D Projects: GA ČR GB14-36098G Institutional support: RVO:67179843 Keywords : glacial refugia * prediction of future * Ochrolechia austroamericana Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  7. Spatial distribution of N, P and K in major yam soils of southeastern ...

    African Journals Online (AJOL)

    Results revealed multi-nutrient deficiencies of N, P, and K in the area. The magnitude of deficiency is N > K > P. Pragmatically, 4.19, 2.59 and 1.76 m ha are deficient in total N, exchangeable K and available P, respectively. This could guide soil nutrient management decision for sustainable yam production in the area.

  8. Gardening in the zone of death: an experimental assessment of the absolute elevation limit of vascular plants

    Czech Academy of Sciences Publication Activity Database

    Dvorský, Miroslav; Chlumská, Zuzana; Altman, Jan; Čapková, K.; Řeháková, Klára; Macek, Martin; Kopecký, Martin; Liancourt, Pierre; Doležal, Jiří

    2016-01-01

    Roč. 6, č. 24440 (2016), s. 1-10 ISSN 2045-2322 R&D Projects: GA ČR GA13-13368S Institutional support: RVO:67985939 Keywords : Tibetan Plateau * warming * elevational limit Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  9. Universal growth modes of high-elevation conifers

    Czech Academy of Sciences Publication Activity Database

    Datsenko, N. M.; Sonechkin, D. M.; Büntgen, Ulf; Yang, B.

    2016-01-01

    Roč. 38, JUN (2016), s. 38-50 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-ring chronologies * summer temperature-variations * northeastern tibetan plateau * climate signal * fennoscandian summers * annual precipitation * density * variability * qinghai * Growth modes * Ring width and maximum latewood density * Eigenvector analysis Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016

  10. Proton irradiation: a key to the challenge of N-glycosidic bond formation in a prebiotic context

    Czech Academy of Sciences Publication Activity Database

    Saladino, R.; Bizzarri, B.M.; Botta, L.; Šponer, Jiří; Šponer, Judit E.; Georgelin, T.; Jaber, M.; Rigaud, B.; Kapralov, M.; Timoshenko, G. N.; Rozanov, A.; Krasavin, E.; Timperio, A.M.; Di Mauro, E.

    2017-01-01

    Roč. 7, NOV2017 (2017), č. článku 14709. ISSN 2045-2322 R&D Projects: GA ČR GA17-05076S Institutional support: RVO:68081707 Keywords : aqueous-solution * nucleic-acids * formamide * radicals Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  11. quantity and quality of litterfall in pure pine and pine/gmelina mixed ...

    African Journals Online (AJOL)

    KOME

    46: 237-242. Keay, R. W. J., 1959. An outlines of Nigeria vegetation. 3rd edn. Government Printer, Lagos, 43pp. Luizao, F. J. and Schubart, H. O. R., 1987. Litter production and decomposition in a terra-firme forest at Central. Amazonia. Experimentia 43: 259-265. Melin, E., 1962. Physiological aspects of mucorrhizae of forest.

  12. Stibine preconcentration in a quartz trap with subsequent atomization in the quartz multiatomizer for atomic absorption spectrometry

    Czech Academy of Sciences Publication Activity Database

    Korkmaz, D.; Dědina, Jiří; Ataman, O. Y.

    2004-01-01

    Roč. 19, č. 2 (2004), s. 255-259 ISSN 0267-9477 R&D Projects: GA ČR GA203/01/0453 Institutional research plan: CEZ:AV0Z4031919 Keywords : stibine preconcentration * quartz multiatomizer * efficiency Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2004

  13. SLC22A3 polymorphisms do not modify pancreatic cancer risk, but may influence overall patient survival

    Czech Academy of Sciences Publication Activity Database

    Mohelníková-Duchoňová, B.; Strouhal, O.; Hughes, D. J.; Holcatová, I.; Oliverius, M.; Kala, Z.; Campa, D.; Rizzato, C.; Canzian, F.; Pezzilli, R.; Talar-Wojnarowska, R.; Malecka-Panas, E.; Sperti, C.; Federico Zambon, C.; Pedrazzoli, S.; Fogar, P.; Milanetto, A.C.; Capurso, G.; Fave, G.D.; Valente, R.; Gazouli, M.; Malleo, G.; Lawlor, R.T.; Strobel, O.; Hackert, T.; Giese, N.; Vodička, Pavel; Vodičková, Ludmila; Landi, S.; Tavano, F.; Gioffreda, D.; Piepoli, A.; Pazienza, V.; Mambrini, A.; Pedata, M.; Cantore, M.; Bambi, F.; Ermini, S.; Funel, N.; Lemstrová, R.; Souček, P.

    2017-01-01

    Roč. 7, MAR 2017 (2017), s. 43812 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP301/12/1734 Institutional support: RVO:68378041 Keywords : genome-wide association * genetic susceptibility * loci * transporters Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  14. Investigation of the clinical features and therapeutic methods for the ...

    African Journals Online (AJOL)

    Purpose: To establish if there are different classes of inflammatory lacrimal punctum diseases (ILPDs) and to examine the various strategies by which they can be managed therapeutically. Methods: Two hundred and fifty nine (259) patients with inflammatory punctum lacrimal disease were identified and used as subjects for ...

  15. The Hardy inequality with boundary or intermediate conditions

    Czech Academy of Sciences Publication Activity Database

    Kufner, Alois

    2017-01-01

    Roč. 8, č. 2 (2017), s. 105-109 ISSN 2077-9879 Institutional support: RVO:67985840 Keywords : Hardy's inequality * boundary conditions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics http://www.mathnet.ru/ php /archive.phtml?wshow=paper&jrnid=emj&paperid=259&option_lang=eng

  16. Optical observations of enhanced activity of the 2005 Draconid meteor shower

    Czech Academy of Sciences Publication Activity Database

    Koten, Pavel; Borovička, Jiří; Spurný, Pavel; Štork, Rostislav

    2007-01-01

    Roč. 466, č. 2 (2007), s. 729-735 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030502; GA ČR GA205/05/0543 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteors * meteor shower s * Draconids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  17. On the hydrogen neutral outflowing disks of B[e] supergiants

    Czech Academy of Sciences Publication Activity Database

    Kraus, Michaela; Borges Fernandes, M.; de Araújo, F. X.

    2007-01-01

    Roč. 463, č. 2 (2007), s. 627-634 ISSN 0004-6361 R&D Projects: GA ČR GA205/04/1267 Institutional research plan: CEZ:AV0Z10030501 Keywords : supergiants * winds * outflows Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  18. Poverty as a Predictor of 4-Year-Olds' Executive Function: New Perspectives on Models of Differential Susceptibility

    Science.gov (United States)

    Raver, C. Cybele; Blair, Clancy; Willoughby, Michael

    2013-01-01

    In a predominantly low-income, population-based longitudinal sample of 1,259 children followed from birth, results suggest that chronic exposure to poverty and the strains of financial hardship were each uniquely predictive of young children's performance on measures of executive functioning. Results suggest that temperament-based vulnerability…

  19. Comparison of Biomass and Lipid Production under Ambient Carbon Dioxide Vigorous Aeration and 3% Carbon Dioxide Condition Among the Lead Candidate Chlorella Strains Screened by Various Photobioreactor Scales

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Naoko [Univ. of Nebraska, Lincoln, NE (United States); Barnes, Austin [Univ. of Nebraska, Lincoln, NE (United States); Jensen, Travis [Univ. of Nebraska, Lincoln, NE (United States); Noel, Eric [Univ. of Nebraska, Lincoln, NE (United States); Andlay, Gunjan [Synaptic Research, Baltimore, MD (United States); Rosenberg, Julian N. [Johns Hopkins Univ., Baltimore, MD (United States); Betenbaugh, Michael J. [Johns Hopkins Univ., Baltimore, MD (United States); Guarnieri, Michael T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Oyler, George A. [Univ. of Nebraska, Lincoln, NE (United States); Johns Hopkins Univ., Baltimore, MD (United States); Synaptic Research, Baltimore, MD (United States)

    2015-09-01

    Chlorella species from the UTEX collection, classified by rDNA-based phylogenetic analysis, were screened based on biomass and lipid production in different scales and modes of culture. Lead candidate strains of C. sorokiniana UTEX 1230 and C. vulgaris UTEX 395 and 259 were compared between conditions of vigorous aeration with filtered atmospheric air and 3% CO2 shake-flask cultivation. We found that the biomass of UTEX 1230 produced 2 times higher at 652 mg L-1 dry weight under both ambient CO2 vigorous aeration and 3% CO2 conditions, while UTEX 395 and 259 under 3% CO2 increased to 3 times higher at 863 mg L-1 dry weight than ambient CO2 vigorous aeration. The triacylglycerol contents of UTEX 395 and 259 increased more than 30 times to 30% dry weight with 3% CO2, indicating that additional CO2 is essential for both biomass and lipid accumulation in UTEX 395 and 259.

  20. White-nose syndrome without borders: Pseudogymnoascus destructans infection tolerated in Europe and Palearctic Asia but not in North America

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan; Banďouchová, H.; Brichta, J.; Cmoková, A.; Jaron, K. S.; Kolařík, Miroslav; Kováčová, V.; Kubátová, A.; Nováková, Alena; Orlov, O.; Pikula, J.; Presetnik, P.; Šuba, J.; Zahradníková Jr., A.; Martínková, Natália

    2016-01-01

    Roč. 6, č. 19829 (2016), č. článku 19829. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:68081766 ; RVO:61388971 Keywords : White-nose syndrome * zoonotic viruses * emerging disease Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016

  1. The Execution of the Miners of Kutná Hora at Poděbrady and in Křivoklát in 1496. On the Veneration of the Miners of Poděbrady in the Sixteenth Century

    Czech Academy of Sciences Publication Activity Database

    Šárovcová, Martina

    Suppl., č. 2 (2015), s. 259-278 ISSN 0015-1831 Institutional support: RVO:68378033 Keywords : music manuscripts * Utraquism * Bohemian Reformation * illuminated fragments * Jan Hus * Fabián Puléř * early modern illuminated manuscripts Subject RIV: AL - Art, Architecture, Cultural Heritage

  2. Original Article

    African Journals Online (AJOL)

    Jul;48(1):259–72. 4. O'Doherty MJ, Kettle AG, Wells P. Collins RE,. Coakley AJ. Parathyroid imaging with technetium-99m- sestamibi: preoperative localization and tissue uptake studies. J Nucl Med. 1992 Mar;33(3):313-8. 5. Fukagawa M, Kitaoka M, Inazawa T, Kurokawa K. Imaging of the parathyroid in chronic renal failure:.

  3. Effects of sugars and growth regulators on in vitro growth of Dactylorhiza species

    Czech Academy of Sciences Publication Activity Database

    Wotavová-Novotná, K.; Vejsadová, H.; Kindlmann, Pavel

    2007-01-01

    Roč. 51, č. 1 (2007), s. 198-200 ISSN 0006-3134 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60870520 Keywords : auxins * cytokinins * glucose * in vitro cultivation * sucrose * terrestrial orchids Subject RIV: EF - Botanics Impact factor: 1.259, year: 2007

  4. A solution of David Galeďs lion and man problem

    Czech Academy of Sciences Publication Activity Database

    Sgall, Jiří

    2001-01-01

    Roč. 259, 1-2 (2001), s. 663-670 ISSN 0304-3975 R&D Projects: GA AV ČR IAA1019901; GA ČR GA201/97/P038 Keywords : combinatorial game theory Subject RIV: BA - General Mathematics Impact factor: 0.468, year: 2001

  5. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  6. Retained Placenta Aspect of Clinical Management in a Tertiary ...

    African Journals Online (AJOL)

    Eleven (32.4%) patients were admitted with retained placenta following home delivery. Two (5.6%) delivery in a peripheral hospital, 6(17.7%) delivered in a Health center and 2(5.9%) delivered in a maternity home. Preterm deliveries accounted for 17.7% of the cases. Eighteen parturient were admitted in shock. One patient ...

  7. Field-induced exciton condensation in LaCoO.sub.3./sub.

    Czech Academy of Sciences Publication Activity Database

    Sotnikov, A.; Kuneš, Jan

    2016-01-01

    Roč. 6, Jul (2016), 1-6, č. článku 30510. ISSN 2045-2322 EU Projects: European Commission(XE) 646807 - EXMAG Institutional support: RVO:68378271 Keywords : exciton condensation * LaCoO 3 * dynamical mean-field theory Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  8. Genetic and environmental influences in Dupuytren's disease

    DEFF Research Database (Denmark)

    Larsen, Søren; Krogsgaard, D G; Larsen, Lisbeth Aagaard

    2015-01-01

    We aimed to assess the relative contribution of genes and environment in the aetiology of Dupuytren's disease by studying Danish twins born between 1870 and 2000. Twins with a diagnosis (n = 365) and the subgroup who also had an operation (n = 259) after 1977 were identified through linkage...

  9. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  10. The Role of Self-Efficacy and Referent Specific Social Support in Promoting Rural Adolescent Girls' Physical Activity

    Science.gov (United States)

    Beets, Michael W.; Pitetti, Kenneth H.; Forlaw, Loretta

    2007-01-01

    Objective: To examine the role of social support (SS) and self-efficacy (SE) for physical activity (PA) in rural high school girls (N = 259, 15.5+1.2yrs). Methods: Using structural equation modeling, the relationships among PA, SS for PA from mother, father, and peers, and SE for overcoming barriers, seeking support, and resisting competing…

  11. 76 FR 19468 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2011-04-07

    ... Hills, CA.... February 14, 2010. Applications, WellPoint Co., BC of CA, Leased Workers Bender, etc. 75...; Leased Workers from All Star Staffing. 75,309 Dallas Group of America, Jefferson February 14, 2010. Inc... No. Subject firm Location Impact date 75,259 Four Star Plastics..... Richmond, KY February 11, 2010...

  12. Differential effects of v-Jun and c-Jun proteins on v-myb-transformed monoblasts

    Czech Academy of Sciences Publication Activity Database

    Ševčíková, S.; Souček, Karel; Kubala, Lukáš; Bryja, Vítězslav; Šmarda, J.

    2002-01-01

    Roč. 59, č. 10 (2002), s. 1690-1705 ISSN 1420-682X R&D Projects: GA ČR GA301/01/0040 Institutional research plan: CEZ:AV0Z5004920 Keywords : v-myb * Jun * differentiation Subject RIV: BO - Biophysics Impact factor: 5.259, year: 2002

  13. Pattern of gastrointestinal opportunistic infections among HIV ...

    African Journals Online (AJOL)

    Twenty-two per cent (22%) of these had mixed parasitosis of cryptosporidium and hookworm. There was no significant association of CD4 cells count with intestinal parasitosis. x2 = 5.286 and p=0.259. However marital status was significantly associated with gastrointestinal opportunistic parasitosis with x2 of 12.693, ...

  14. The what-where trade-off in multiple-identity tracking

    NARCIS (Netherlands)

    Cohen, M.A.; Pinto, Y.; Howe, P.D.L.; Horowitz, T.S.

    2011-01-01

    Observers are poor at reporting the identities of objects that they have successfully tracked (Pylyshyn, Visual Cognition, 11, 801-822, 2004; Scholl & Pylyshyn, Cognitive Psychology, 38, 259-290, 1999). Consequently, it has been claimed that objects are tracked in a manner that does not encode their

  15. Ježekite, Na.sub.8./sub.[(UO.sub.2./sub.)(CO.sub.3./sub.).sub.3./sub.](SO.sub.4./sub.).sub.2./sub..3H.sub.2./sub.O, a new uranyl mineral from Jáchymov, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Belakovskiy, D. I.; Čejka, J.; Chernyshov, D.

    2015-01-01

    Roč. 60, č. 4 (2015), 259-267 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : ježekite * new mineral * uranyl carbonate-sulfate * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

  16. Malakostratigrafie holocenního pěnovce na Babině u Hradiště pod Vrátnom (jihozápadní Slovensko)

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2013-01-01

    Roč. 2012, Prosinec (2013), s. 259-262 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : SW Slovakia * Holocene * tufa * buried soils * molluscan succession Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-52.pdf

  17. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. G Nandakumar. Articles written in Journal of Earth System Science. Volume 113 Issue 3 September 2004 pp 259-267. Delineation of structures favourable to groundwater occurrence employing seismic refraction method — A case study from Tiruvuru, Krishna district, ...

  18. Role of guard rings in improving the performance of silicon detectors

    Indian Academy of Sciences (India)

    guard rings (FGR) in improving breakdown voltage and reducing leakage current of silicon detectors is well-known. ... FGRs biased even a detector having large surface leakage current can be used to give the same response as a ... number of free charge carriers thus produced is proportional to the energy deposited. 259 ...

  19. The lateral distance between a proton pump and ATP synthase determines the ATP-synthesis rate

    Czech Academy of Sciences Publication Activity Database

    Sjöholm, C.; Bergstrand, J.; Nilsson, T.; Šachl, Radek; von Ballmoos, Ch.; Widengren, J.; Brzezinski, P.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 2926. ISSN 2045-2322 Institutional support: RVO:61388955 Keywords : biological energy-conversion * cytochrome -c-oxidase * membrane-surface * rhodobacter-sphaeroides Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  20. Modification of jet-like correlations in Pb-Au collisions at 158A GeV/c

    Czech Academy of Sciences Publication Activity Database

    Adamová, Dagmar; Agakichiev, G.; Antonczyk, D.; Appelshäuser, H.; Belaga, V.; Bielčíková, Jana; Braun-Munzinger, P.; Busch, O.; Cherlin, A.; Damjanović, S.; Dietel, T.; Dietrich, L.; Drees, A.; Dubitzky, W.; Esumi, S.I.; Filimonov, K.; Fomenko, K.; Fraenkel, Z.; Garabatos, C.; Glassel, P.; Holeczek, J.; Kalisky, M.; Kniege, S.; Kushpil, Vasilij; Maas, A.; Marin, A.; Milosevic, J.; Milov, A.; Miskowiec, D.; Panebrattsev, Y.; Petchenova, O.; Petráček, Vojtěch; Pfeiffer, A.; Ploskon, M.; Rak, Jan; Ravinovich, I.; Rehak, P.; Sako, H.; Schmitz, W.; Schuchmann, S.; Sedykh, S.; Shimansky, S.; Stachel, J.; Šumbera, Michal; Tilsner, H.; Tserruya, I.; Wessels, J. P.; Wienold, T.; Wurm, J.P.; Xie, W.; Yurevich, S.; Yurevich, V.

    2009-01-01

    Roč. 678, č. 3 (2009), s. 259-263 ISSN 0370-2693 Institutional research plan: CEZ:AV0Z10480505 Keywords : QUARK-GLUON PLASMA * RADIATIVE ENERGY-LOSS * COLLABORATION Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.083, year: 2009

  1. 1678-IJBCS-Article-Jacques Fatombi

    African Journals Online (AJOL)

    hp

    Production of Natural Coagulant from. Moringa oleifera Seed for Application in. Treatment of Low Turbidity Water. Journal of Water Resource and. Protection, 2: 259-266. García-Mendieta A, Olguín MT, Solache-Ríos. M. 2012. Biosorption properties of green tomato peel (Physalis philadelphica Lam) for iron, manganese and ...

  2. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Anil Gupta. Articles written in Sadhana. Volume 37 Issue 2 April 2012 pp 241-259. A review of designing machine tool for leanness · Anil Gupta T K Kundra · More Details Abstract Fulltext PDF. As an ideology, Leanness is not a new concept but still researchers strive for developing new methods ...

  3. From Informal Strategies to Structured Procedures: Mind the Gap!

    Science.gov (United States)

    Anghileri, Julia; Beishuizen, Meindert; Van Putten, Kees

    2002-01-01

    Explores written calculation methods for division used by pupils in England (n=276) and the Netherlands (n=259). Analyses informal strategies and identifies progression towards more structured procedures that result from different teaching approaches. Comparison of methods used shows greater success in the Dutch approach which is based on…

  4. A Discourse Analysis of "(the) same" in English Conversation.

    Science.gov (United States)

    Wong, Jean; Celce-Murcia, Marianne

    This paper first briefly reviews what Halliday and Hasan (1976) said about "(the) same." The paper then examines the understanding of this form by qualitatively analyzing 259 naturally occurring spoken tokens of "(the) same" in their discourse contexts. It focuses on the following questions with reference to the data: (1) What…

  5. Gas stripping in galaxy clusters: a new SPH simulation approach

    Czech Academy of Sciences Publication Activity Database

    Jáchym, Pavel; Palouš, Jan; Köppen, J.; Combes, F.

    2007-01-01

    Roč. 472, č. 1 (2007), s. 5-20 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : galaxie s * interactions * intergalactic medium Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  6. Is the dark matter halo of the Milky Way flattened?

    Czech Academy of Sciences Publication Activity Database

    Růžička, Adam; Palouš, Jan; Theis, Ch.

    2007-01-01

    Roč. 461, č. 1 (2007), s. 155-169 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : N-body simulations * galaxie s * interactions * Magellanic clouds Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  7. Stress among Secondary School Teachers in Ebonyi State, Nigeria: Suggested Interventions in the Worksite Milieu

    Science.gov (United States)

    Nwimo, Ignatius O.; Onwunaka, Chinagorom

    2015-01-01

    The aim of the study was to determine the level of stress experienced by secondary school teachers in Ebonyi State. The dimensions of stress studied included physical stress, mental stress, emotional stress and social stress. The study adopted the cross-sectional survey design using a sample of 660 (male 259, female 401) teachers randomly drawn…

  8. Phase morphology of PP/COC blends

    Czech Academy of Sciences Publication Activity Database

    Šlouf, Miroslav; Kolařík, Jan; Fambri, L.

    2003-01-01

    Roč. 91, č. 1 (2003), s. 253-259 ISSN 0021-8995 R&D Projects: GA ČR GP106/02/P029 Institutional research plan: CEZ:AV0Z4050913 Keywords : polypropylene * norbornene * polyolefin Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.017, year: 2003

  9. The enigma of the lower gut-associated lymphoid tissue (GALT)

    Czech Academy of Sciences Publication Activity Database

    Butler, J. E.; Šinkora, Marek

    2013-01-01

    Roč. 94, č. 2 (2013), s. 259-270 ISSN 0741-5400 R&D Projects: GA ČR GAP502/10/0038; GA ČR GAP502/12/0110 Institutional support: RVO:61388971 Keywords : B lymphocytes * lymphogenesis * B cell development Subject RIV: EC - Immunology Impact factor: 4.304, year: 2013

  10. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Parvinder Kumar. Articles written in Journal of Genetics. Volume 87 Issue 3 December 2008 pp 257-259 Research Note. Double trisomy with 48, XXX+21 karyotype in a Down's syndrome child from Jammu and Kashmir, India · Wahied Khawar Balwan Parvinder Kumar T. R. Raina ...

  11. Millennial cycles of mean sea level excited by earth´s orbital variations

    Czech Academy of Sciences Publication Activity Database

    Chapanov, Y.; Ron, Cyril; Vondrák, Jan

    2015-01-01

    Roč. 12, č. 3 (2015), s. 259-266 ISSN 1214-9705 R&D Projects: GA ČR GA13-15943S Institutional support: RVO:67985815 Keywords : millenial cycles * mean sea level * Earth's insolation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.561, year: 2015

  12. Silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine - characterization of this primary explosive

    Czech Academy of Sciences Publication Activity Database

    Musil, T.; Matyáš, R.; Vala, R.; Růžička, A.; Vlček, Milan

    2014-01-01

    Roč. 39, č. 2 (2014), s. 251-259 ISSN 0721-3115 Institutional support: RVO:61389013 Keywords : primary explosive * AgDANT * silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine Subject RIV: CC - Organic Chemistry Impact factor: 1.604, year: 2014

  13. Binding of N-methylscopolamine to the extracellular domain of muscarinic acetylcholine receptors

    Czech Academy of Sciences Publication Activity Database

    Jakubík, Jan; Randáková, Alena; Zimčík, Pavel; El-Fakahany, E. E.; Doležal, Vladimír

    2017-01-01

    Roč. 7, Jan 16 (2017), č. článku 40381. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : muscarinic acetylcholine receptors * N-methylscopolamine * ligand binding * molecular dynamics Subject RIV: ED - Physiology OBOR OECD: Physiology (including cytology) Impact factor: 4.259, year: 2016

  14. Differences in body composition, body proportions and timing of ...

    African Journals Online (AJOL)

    The purpose of this study was to assess differences in body composition, proportions and timing of puberty between stunted and non-stunted South African adolescents in the North West Province, South Africa. A total of 259 black adolescents (118 boys, 141 girls), aged 13-18 years were measured. The following data were ...

  15. International Uranium Resources Evaluation Project (IUREP) national favourability studies: Niue

    International Nuclear Information System (INIS)

    1977-12-01

    Niue is described as a coral island containing 259 square kilometers, located between Tonga and the Southern Cook Islands in the Central Pacific. Geologically, little is known, or can be deduced from available information, therefore reported occurrences of uranium are the basis for a potential in category 1 (less than 1,000 tonnes U) . (author)

  16. Culture conditions for the production of a tannase of Aspergillus ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-06-03

    Jun 3, 2009 ... polyphenols in forage legumes. J. Anim. Sci. 73: 1516-1528. Saxena RK, Sharmila P, Singh VP (1995). Microbial degradation of tannins. In: Singh VP (Ed) Biotransformations: Microbial degradation of health-risk compounds. Elsevier Science Publishers B.V.. Amsterdam. Progr. Ind. Microbiol. 32: 259-270.

  17. The N-terminal domain plays a crucial role in the structure of a full-length human mitochondrial Lon protease

    Czech Academy of Sciences Publication Activity Database

    Kereiche, S.; Kováčik, L.; Bednár, J.; Pevala, V.; Kunová, N.; Ondrovičová, G.; Bauer, J.; Ambro, L.; Bellová, J.; Kutejová, Eva; Raška, I.

    2016-01-01

    Roč. 6, SEP 16 (2016), s. 33631 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : ESCHERICHIA - COLI LON * SUBSTRATE TRANSLOCATION * PROTEOLYTIC MACHINE Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  18. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  19. The Impact of "DSM-5" A-Criteria Changes on Parent Ratings of ADHD in Adolescents

    Science.gov (United States)

    Sibley, Margaret H.; Yeguez, Carlos E.

    2014-01-01

    Objective: Diagnostic and Statistical Manual of Mental Disorders (5th ed.; DSM-5) A-criteria for ADHD were expanded to include new descriptors referencing adolescent and adult symptom manifestations. This study examines the effect of these changes on symptom endorsement in a sample of adolescents with ADHD (N = 259; age range = 10.72-16.70).…

  20. The Contribution of Counseling Providers to the Success or Failure of Marriages

    Science.gov (United States)

    Ansah-Hughes, Winifred

    2015-01-01

    This study is an investigation into the contribution of counseling providers to the success or failure of marriages. The purposive and the simple random sampling methods were used to select eight churches and 259 respondents (married people) in the Techiman Municipality. The instrument used to collect data was a 26-item questionnaire including a…

  1. A matemática no projeto ciência na escola: a busca da autonomia dos alunos/The mathematics in the school science project...

    Directory of Open Access Journals (Sweden)

    Claudinei de Camargo Sant' Ana

    Full Text Available SANT’ANA, C. C. A matemática no projeto ciência na escola: a busca da autonomia dos alunos. 2008. 259fl. Tese (Doutorado em Educação – Faculdade de Educação, Universidade Estadual de Campinas, Campinas. 2008.

  2. Regional coherency of boreal forest growth defines Arctic driftwood provenancing

    Czech Academy of Sciences Publication Activity Database

    Hellmann, L.; Agafonov, L.; Churakova (Sidorova), O.; Düthorn, E.; Eggertsson, O.; Esper, J.; Kirdyanov, A. V.; Knorre, A. A.; Moiseev, P.; Myglan, V. S.; Nikolaev, A. N.; Reinig, F.; Schweingruber, F.; Solomina, O.; Tegel, W.; Büntgen, Ulf

    2016-01-01

    Roč. 39, sep (2016), s. 3-9 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : mackenzie river driftwood * tree-ring data * central siberia * origin * archipelago * holocene * ocean * sea * ice * circulation * Driftwood * Arctic * Dendro-provenancing * Boreal Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016

  3. Effect of inhibition of biosynthesis of phenylpropanoids on sessile oak somatic embryogenesis

    Czech Academy of Sciences Publication Activity Database

    Cvikrová, Milena; Malá, J.; Hrubcová, Marie; Eder, Josef; Zoń, J.; Macháčková, Ivana

    2003-01-01

    Roč. 41, č. 3 (2003), s. 251-259 ISSN 0981-9428 R&D Projects: GA MŠk LN00A081 Institutional research plan: CEZ:AV0Z5038910 Keywords : Inhibition of phenylpropanoid biosynthesis * Somatic embryogenesis * Oak Subject RIV: CE - Biochemistry Impact factor: 1.729, year: 2003

  4. 8 CFR 253.1 - Parole.

    Science.gov (United States)

    2010-01-01

    .... (g) Other crewmen. In the discretion of the district director, any alien crewman not within the... the conditions under which the alien crewman is paroled into the United States. The Form I-259 shall also specify the Service office to which the alien crewman is to be presented for inspection upon...

  5. Does Eating Breakfast Affect the Performance of College Students on Biology Exams?

    Science.gov (United States)

    Phillips, Gregory W.

    2005-01-01

    This study examined the breakfast eating habits of 1,259 college students over an eleven year period to determine if eating breakfast had an impact upon their grade on a General Biology exam. The study determined that there was a significant difference in the performance on the exam with a higher percent of the participants, who had eaten…

  6. Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?

    Czech Academy of Sciences Publication Activity Database

    Linek, Lukáš; Pecháček, Š.

    2007-01-01

    Roč. 23, č. 2 (2007), s. 259-275 ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences

  7. Prevalence, severity and factors associated with peripheral ...

    African Journals Online (AJOL)

    The history of ever having a foot ulcer was significantly associated with peripheral neuropathy (OR 2.59; 95% CI: 1.03 – 6.49, p = 0.042). Conclusion: DPN occurs in 1 in 4 of newly diagnosed diabetic patients in Mulago hospital. Two thirds of these patients had moderate to severe neuropathy. DPN was independently ...

  8. 77 FR 13637 - Notice of Quarterly Report (October 1, 2011-December 31, 2011)

    Science.gov (United States)

    2012-03-07

    ...-- pensions. Debit/smart cards issued. Mortgage bonds registered. Value of registered mortgage bonds. Clearing.... Number of schools available in Alatona. Number of health centers available in the Alatona. Number of... vocational education and training (TVET) legislation passed. Health Project $38,973,259 Increase the $20,348...

  9. A comprehensive study of soft magnetic materials based on FeSi spheres and polymeric resin modified by silica nanorods

    Czech Academy of Sciences Publication Activity Database

    Strečková, M.; Füzer, J.; Kobera, Libor; Brus, Jiří; Fáberová, M.; Bureš, R.; Kollár, P.; Lauda, M.; Medvecký, L.; Girman, V.; Hadraba, Hynek; Baťková, M.; Baťko, I.

    2014-01-01

    Roč. 147, č. 3 (2014), s. 649-660 ISSN 0254-0584 Institutional support: RVO:61389013 ; RVO:68081723 Keywords : composite materials * magnetic materials * chemical synthesis Subject RIV: CD - Macromolecular Chemistry; JH - Ceramics, Fire-Resistant Materials and Glass (UFM-A) Impact factor: 2.259, year: 2014

  10. Pillai, Prof. Valliyil Narayanan Rajasekharan

    Indian Academy of Sciences (India)

    Date of birth: 20 October 1949. Specialization: Bio-organic Chemistry, Synthetic Organic Chemistry & Macromolecular Science Address: Harishree, S-31, Medical College Road, Gandhinagar P.O., Kottayam 686 008, Kerala Contact: Residence: (0481) 259 7885. Mobile: 99958 24472. Email: rajasekharpillai@gmail.com, ...

  11. Critical Climate: Relations among Sexual Harassment, Climate, and Outcomes for High School Girls and Boys

    Science.gov (United States)

    Ormerod, Alayne J.; Collinsworth, Linda L.; Perry, Leigh Ann

    2008-01-01

    This study examined the relationships among peer-to-peer sexual harassment, school climate, adult-to-student harassment, and outcomes (psychological and physical well-being; school withdrawal and safety) for high school girls (n = 310) and boys (n = 259) recruited from seven public high schools in a Midwestern state. More frequent, severe peer…

  12. Tributyltin-resistant Methanothermobacter thermautotrophicus mutant with mutational substitutions in the A.sub.1./sub.A.sub.0./sub.-ATP synthase operon

    Czech Academy of Sciences Publication Activity Database

    Nováková, Z.; Bobálová, Janette; Vidová, M.; Hapala, I.; Šmigáň, P.

    2009-01-01

    Roč. 298, č. 2 (2009), s. 255-259 ISSN 0378-1097 Institutional research plan: CEZ:AV0Z40310501 Keywords : methanoarchaea * bioenergetics * tributyltin resistance Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.199, year: 2009

  13. Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut

    Czech Academy of Sciences Publication Activity Database

    Bodláková, K.; Jedlička, Pavel; Kodrík, Dalibor

    2017-01-01

    Roč. 24, č. 2 (2017), s. 259-269 ISSN 1672-9609 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : AKH * AKH receptor * amylase * enzyme * gene expression * midgut Subject RIV: ED - Physiology OBOR OECD: Entomology; Biochemistry and molecular biology (BC-A) Impact factor: 2.026, year: 2016

  14. Activation of an anti-bacterial toxin by the biosynthetic enzyme CysK: mechanism of binding, interaction specificity and competition with cysteine synthase

    Czech Academy of Sciences Publication Activity Database

    Benoni, Roberto; Beck, C. M.; Garza-Sánchez, F.; Bettati, S.; Mozzarelli, A.; Hayes, C. S.; Campanini, B.

    2017-01-01

    Roč. 7, Aug 18 (2017), č. článku 8817. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : O-acetylserine sulfhydrylase * dependent growth inhibition * Salmonella typhimurium LT-2 Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-09022-6

  15. Better theory-of-mind skills in children hearing voices mitigate the risk of secondary delusion formation

    NARCIS (Netherlands)

    Bartels-Velthuis, A. A.; Blijd-Hoogewys, E. M. A.; van Os, J.

    Objective: To examine the social cognitive vulnerabilities mediating delusion formation in children presenting with hallucinatory experiences. Method: A sample of 259 12- and 13-year-old children, from a baseline case-control sample of children with and without auditory hallucinations (AH), were

  16. Breastfeeding pattern, anthropometry and health status of infants ...

    African Journals Online (AJOL)

    2010-04-08

    Apr 8, 2010 ... The numbers that received colostrum and prelacteal feed were 118 (82.5%) and 59 (25.9%), respectively. On-demand breastfeeding was more popular than timed feeding (95.5% vs 7.5%; p < 0.05). At 24 weeks of age EBF males and females ..... who.int/child-adolescent-health/new.../tool-breast_feeding.ht ...

  17. FMNH2-dependent monooxygenases initiate catabolism of sulfonamides in Microbacterium sp strain BR1 subsisting on sulfonamide antibiotics

    Czech Academy of Sciences Publication Activity Database

    Ricken, B.; Kolvenbach, B.A.; Bergesch, C.; Benndorf, D.; Kroll, K.; Strnad, Hynek; Vlček, Čestmír; Adaixo, R.; Hammes, F.; Shahgaldian, P.; Schaeffer, A.; Kohler, H.P.E.; Corvini, P.F.X.

    2017-01-01

    Roč. 7, podzim (2017), č. článku 15783. ISSN 2045-2322 Institutional support: RVO:68378050 Keywords : resistance mechanism * clinical specimens * sulfamethoxazole * bacteria * degradation * benzylpenicillin * biodegradation * genes * sulfadiazine * arthrobacter Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  18. Photometry of 2004 RZ164: a probable binary asteroid

    Czech Academy of Sciences Publication Activity Database

    Kwiatkowski, T.; Kryszczynska, A.; Marciniak, A.; Borczyk, W.; Masi, G.; Galád, Adrián; Goncalves, R.; Colas, F.

    2007-01-01

    Roč. 462, č. 1 (2007), s. 341-344 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GA205/05/0604 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids, photometry * photometry Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  19. Reduced host-specificity in a parasite infecting non-littoral Lake Tanganyika cichlids evidenced by intraspecific morphological and genetic diversity

    Czech Academy of Sciences Publication Activity Database

    Kmentová, N.; Gelnar, M.; Mendlová, M.; Van Steenberge, M.; Koblmüller, Stephan; Vanhove, M. P. M.

    2016-01-01

    Roč. 6, č. 39605 (2016), č. článku 39605. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Monogenean parasites * Ancyrocephalidae * adaptive radiation * statistical tests * population growth * DNA polymorphism * fish families * Teleostei * phylogeny Subject RIV: EG - Zoology Impact factor: 4.259, year: 2016

  20. contents TIB

    African Journals Online (AJOL)

    G5

    It is therefore important to differentiate cases with TTP/HUS from those with severe pre-eclampsia and. HELLP as plasma exchange is of no benefit in the treatment of the latter pathologies.2,5,9. Imaging features. These are generally related to the neu- rological manifestations of these patholo- gies. Cerebral vasospasm has ...

  1. Dalších deset let archeologického areálu pod třetím nádvořím Pražského hradu

    Czech Academy of Sciences Publication Activity Database

    Boháčová, Ivana

    2008-01-01

    Roč. 68, č. 4 (2008), s. 259-263, 334-337 ISSN 1210-5538 R&D Projects: GA MK KZ97P02OPP006 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeological heritige * Prague Castle * Early Mediaeval * interdisciplinary excavation * conservation Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results from an O3-Gradient and a FACE Experiment

    Science.gov (United States)

    D. F. Karnosky; B. Mankovska; K. Percy; R. E. Dickson; G. K. Podila; J. Sober; A. Noormets; G. Hendrey; M. D. Coleman; M. Kubiske; K. S. Pregitzer; J. G. Isebrands

    1999-01-01

    Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3 sensitivity by growth and biomass...

  3. Characterisation of 2,4-Dinitroanisole: An Ingredient for Use in Low Sensitivity Melt Cast Formulations

    Science.gov (United States)

    2006-08-01

    Endeavor coordinate measuring machine (Model 9.12.7). For calibration standards, a series of Composition B charges (identical dimensions to ARX-4027...trifluoromethylsulfonyl)anisole, Nouveau Journal de Chimie 4(4) 255-259. 24. Bernasconi, C. F. and Gandler, J. R. (1977) Intermediates in nucleophilic aromatic

  4. HANSENULA WICKERHAMII SP. N., A NEW YEAST FROM FINNISH SOIL

    Science.gov (United States)

    Capriotti, Augusto

    1961-01-01

    Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638

  5. A Gateway((R)) -compatible bacterial adenylate cyclase-based two-hybrid system

    Czech Academy of Sciences Publication Activity Database

    Ouellette, S. P.; Gauliard, E.; Antošová, Zuzana; Ladant, D.

    2014-01-01

    Roč. 6, č. 3 (2014), s. 259-267 ISSN 1758-2229 Institutional support: RVO:67985823 Keywords : bacterial two-hybrid system * protein–protein interactions * cell division * Gateway((R))(GW) cloning system Subject RIV: EE - Microbiology, Virology Impact factor: 3.293, year: 2014

  6. The Predictive Value of Selected Extrinsic and Intrinsic Indicators of Overall Job Satisfaction in Diagnostic Radiological Technology, Radiation Therapy, and Nuclear Medicine Technology Allied Health Faculty

    Science.gov (United States)

    Beavers, Gregory S.

    2010-01-01

    Healthcare is the largest industry in the United States and 60 percent of its 14 million workers are in allied health jobs. The need to attract and retain allied health faculty is critical to preparing a competent workforce in healthcare. This study reports the results of a survey of 259 faculty members working in diagnostic radiologic technology,…

  7. Eestlased riisusid Balti fotovõistlusel koore

    Index Scriptorium Estoniae

    2011-01-01

    Eesti, Läti ja Leedu fotovõistlusest, kus valiti Baltikumi parimad loodusfotod ja maaelu kajastavad fotod. Osales 259 fotograafi. Parim loodusfoto oli Kaido Haageni "Kus sa oled, mu sõber" ning parim foto maaelu kategoorias Arne Aderi "Jõuluks koju"

  8. Circulating nucleic acids as a new diagnostic tool

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Markéta; Plzák, J.; Strnad, Hynek; Betka, J.

    2010-01-01

    Roč. 15, č. 2 (2010), s. 242-259 ISSN 1425-8153 R&D Projects: GA MŠk 2B06106 Institutional research plan: CEZ:AV0Z50520514 Keywords : circulating nucleic acids * diagnostics * cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.455, year: 2010

  9. Vegetable and animal products as determinants of colon cancer risk in Dutch men and women

    NARCIS (Netherlands)

    Kampman, E.; Verhoeven, D.; Sloots, L.; Veer, P. van 't

    1995-01-01

    To examine the relationship between colon cancer and food groups from vegetable or animal sources and their possible interactions with gender, we analyzed data from a Dutch case-control study. Dietary patterns were assessed for 232 colon cancer cases and 259 population controls. In multivariate

  10. Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..

    Czech Academy of Sciences Publication Activity Database

    Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.

    259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999

  11. Prevalence and associations of symptomatic renal papillary necrosis ...

    African Journals Online (AJOL)

    Key words: Female gender, microscopic hematuria, renal papillary necrosis, sickle cell anemia. Date of Acceptance: 12-Nov-2015. Address for correspondence: Dr. AJ Madu, ..... Diagn Imaging 1983;52:259-63. 2. Davies PJ. Beethoven's deafness: A new theory. Med J Aust. 1988;149(11-. 12):644–9. 3. Friedrich N. Ueber ...

  12. Magnetic ordering temperature of nanocrystalline Gd: enhancement of magnetic interactions via hydrogenation-induced "negative" pressure

    Czech Academy of Sciences Publication Activity Database

    Tereshina, Evgeniya; Khmelevskyi, S.; Politova, G.; Kaminskaya, T.; Drulis, H.; Tereshina, I. S.

    2016-01-01

    Roč. 6, Mar (2016), 1-7, č. článku 22553. ISSN 2045-2322 R&D Projects: GA ČR GA16-03593S Institutional support: RVO:68378271 Keywords : ferromagnetism * gadolinium * Curie temperature Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  13. Vavraia culicis (Weiser, 1947) Weiser, 1977 revisited: cytological characterisation of a Vavraia culicis-like microsporidium isolated from mosquitoes in Florida and the establishment of Vavraia culicis floridensis subsp. n

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Becnel, J. J.

    2007-01-01

    Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquitoes * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

  14. Frequency and type of toenail tumors in the dromedary camel ...

    African Journals Online (AJOL)

    total of 275 dromedary camels (16 males and 259 females) of local “Arabiyat” breed suffering from different types and degrees of severity of toenail tumors were surgically treated. Histopathological examination of the tissue samples removed from 50 tumor-like growths (2 males and 48 females) revealed three types of ...

  15. Microwave Assisted Synthesis of Magnetically Responsive Composite Materials

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Pospišková, K.; Maděrová, Zdeňka; Baldíková, E.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 239-243 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA ČR(CZ) GAP503/11/2263 Institutional support: RVO:67179843 Keywords : saccharomyces cerevisiae * cells immobilization * chitosan * magnetite * microwave irradiation * yeast Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2015

  16. Chemically different non-thermal plasmas target distinct cell death pathways

    Czech Academy of Sciences Publication Activity Database

    Lunov, O.; Zablotskyy, V.; Chrupina, O.; Lunova, M.; Jirsa, M.; Dejneka, A.; Kubinová, Šárka

    2017-01-01

    Roč. 7, apr (2017), s. 600 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : chemically different * non-thermal plasmas * target distinct cell death pathways Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  17. Central Gi(2) proteins, sympathetic nervous system and blood pressure regulation

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef

    2016-01-01

    Roč. 216, č. 3 (2016), s. 258-259 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : inhibitory G proteins * sympathetic nervous system * central blood pressure control Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.867, year: 2016

  18. Student Council, Volunteering, Basketball, or Marching Band: What Kind of Extracurricular Involvement Matters?

    Science.gov (United States)

    Eccles, Jacquelynne S.; Barber, Bonnie L.

    1999-01-01

    Examined benefits/risks of participation in five types of extracurricular activities (prosocial, team sports, school involvement, performing arts, academic clubs). Data for 1,259 adolescents were drawn from the Michigan Study of Adolescent Life Transitions. Found that prosocial involvement was linked to positive educational trajectories and low…

  19. Enhanced activity of massive black holes by stellar capture assisted by a self-gravitating accretion disc

    Czech Academy of Sciences Publication Activity Database

    Karas, Vladimír; Šubr, L.

    2007-01-01

    Roč. 470, č. 1 (2007), s. 11-19 ISSN 0004-6361 R&D Projects: GA ČR GA205/07/0052; GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : black hole physics * accretion Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  20. Outcomes of repeated exposure of the carp (Cyprinus carpio L.) to cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Krejčí, R.; Štěrba, F.; Tichý, F.; Kubala, Lukáš; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, č. 2 (2004), s. 259-265 ISSN 0001-7213 R&D Projects: GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z5004920 Keywords : erythrocytes * leukocytes * plasma enzymes Subject RIV: BO - Biophysics Impact factor: 0.449, year: 2004

  1. The Effect of Participation in Professional Development on Perceived Change in Teaching Practice by Minnesota K-12 Physical Education Teachers

    Science.gov (United States)

    Sertich, Sally Krause

    2013-01-01

    This study used a conceptual framework of professional development theory to identify characteristics of effective learning activities specific to 259 Minnesota K-12 public school physical education and developmental adapted physical education (PE/DAPE) teachers during 2012-2013. Study results confirmed that as PE/DAPE teacher participation in…

  2. Robustness of one-dimensional viscous fluid motion under multidimensional perturbations

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Sun, Y.

    2015-01-01

    Roč. 259, č. 12 (2015), s. 7529-7539 ISSN 0022-0396 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : compressible Navier - Stokes equations * 1-D compressible fluid flow * relative energy Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022039615004325

  3. CASE STUDY

    African Journals Online (AJOL)

    2011-06-02

    Jun 2, 2011 ... complained of progressive dysphagia for solids for 2 months and a weight loss of 5 kg during the same period. He denied loss of appetite, haematemesis or symptoms of gastro-oesophageal reflux disease. He weighed 76 kg with a body mass index of 25.9. Clinical examination was unremarkable, with no.

  4. Variability of space-use patterns in a free living eusocial rodent, Ansell’s mole-rat indicates age-based rather than caste polyethism

    Czech Academy of Sciences Publication Activity Database

    Šklíba, Jan; Lövy, M.; Burda, H.; Šumbera, R.

    2016-01-01

    Roč. 6, DEC 06 (2016), č. článku 37497. ISSN 2045-2322 EU Projects: European Commission(XE) 669609 - Diversity6continents Institutional support: RVO:60077344 Keywords : eusocial rodent * mole-rats * Fukomys anselli Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep37497

  5. Genomic study of the Ket: a Paleo-Eskimo-related ethnic group with significant ancient North Eurasian ancestry

    Czech Academy of Sciences Publication Activity Database

    Flegontov, P.; Changmai, P.; Zidkova, A.; Logacheva, M.D.; Altınışık, N. E.; Flegontova, Olga; Gelfand, M. S.; Gerasimov, E. S.; Khrameeva, E. E.; Konovalova, O. P.; Neretina, T.; Nikolsky, Y. V.; Starostin, G.; Stepanova, V. V.; Travinsky, I. V.; Tříska, M.; Tříska, P.; Tatarinova, T. V.

    2016-01-01

    Roč. 6, FEB 11 (2016), č. článku 20768. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : human populations * genetic variation * wide patterns * sequence * association * europeans * admixture * history * origin * tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  6. Transport properties of CeCo.sub.12./sub. B.sub.6./sub. in vicinity of phase transition

    Czech Academy of Sciences Publication Activity Database

    Skorokhod, Yuriy; Arnold, Zdeněk; Isnard, O.; Mayot, H.; Míšek, M.; Kamarád, Jiří

    2008-01-01

    Roč. 113, - (2008), s. 259-262 ISSN 0587-4246 R&D Projects: GA ČR(CZ) GA106/06/0368 Institutional research plan: CEZ:AV0Z10100521 Keywords : rare-earth compounds * specific heat * high pressure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.321, year: 2008

  7. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309122 >1qhhB 31 259 333 567 1e-16 ... gb|AAQ19135.1| putative UvrD/REP helicase [Escheric...NNGSLEFITGDFSEITNKILELKNQG--YENK--------DILILAATERICK 485 ... + ... L ... G ... E ... + ... ++ ... E + ... E +

  8. Arginine side chain interactions and the role of arginine as a gating charge carrier in voltage sensitive ion channels

    Czech Academy of Sciences Publication Activity Database

    Armstrong, C. T.; Mason, Philip E.; Anderson, J. L. R.; Dempsey, Ch. E.

    2016-01-01

    Roč. 6, Feb 22 (2016), č. článku 21759. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : K+ channel * potassium channels * sensing domain Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep21759

  9. Determination of iodine in Asian diets by epithermal and radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Iyengar, GV.; Řanda, Zdeněk; Parr, RM.

    2004-01-01

    Roč. 259, č. 3 (2004), s. 505-509 ISSN 0236-5731 R&D Projects: GA AV ČR IAA4048301 Institutional research plan: CEZ:AV0Z1048901 Keywords : iodine * Asian diets Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.457, year: 2004

  10. The Physical Structure of Protoplanetary Disks : The Serpens Cluster Compared with Other Regions

    NARCIS (Netherlands)

    Oliveira, I.; Merín, B.; Pontoppidan, K.; Dishoeck, van E.F.

    2013-01-01

    Spectral energy distributions are presented for 94 young stars surrounded by disks in the Serpens Molecular Cloud, based on photometry and Spitzer/IRS spectra. Most of the stars have spectroscopically determined spectral types. Taking a distance to the cloud of 415 pc rather than 259 pc, the

  11. The correlation theory of the chemical bond

    Czech Academy of Sciences Publication Activity Database

    Szalay, S.; Barcza, G.; Szilvási, T.; Veis, Libor; Legeza, Ö.

    2017-01-01

    Roč. 7, MAY 2017 (2017), č. článku 2237. ISSN 2045-2322 R&D Projects: GA ČR GA16-12052S Institutional support: RVO:61388955 Keywords : density matrix * quantum chemistry * theoretical model Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  12. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. A Sestieri. Articles written in Sadhana. Volume 25 Issue 3 June 2000 pp 247-259. Structural dynamic modification · A Sestieri · More Details Abstract Fulltext PDF. Vibration and acoustic requirements are becoming increasingly important in the design of mechanical structures, but they are not ...

  13. Bikshandarkoil R srinivasan

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Bikshandarkoil R srinivasan. Articles written in Journal of Chemical Sciences. Volume 116 Issue 5 August 2004 pp 251-259. Does an all-sulphur analogue of heptamolybdate exist? Bikshandarkoil R Srinivasan · More Details Abstract Fulltext PDF. The complexes [MoX4]2- (M ...

  14. Determination of dissociation constants of cytokinins by capillary zone electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Barták, P.; Bednář, P.; Stránský, Z.; Boček, Petr; Vespalec, Radim

    2000-01-01

    Roč. 878, č. 2 (2000), s. 249-259 ISSN 0021-9673 R&D Projects: GA MŠk VS96021; GA AV ČR IAA4031703; GA ČR GA203/99/0044 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.551, year: 2000

  15. Extraction and Configuration of an Isolate from Chrysanthellum ...

    African Journals Online (AJOL)

    MBI

    2014-09-23

    Sep 23, 2014 ... ABSTRACT. Bioactivity guided column chromatography of the ethylacetate fraction of the plant chrysanthellum indicum led to the isolation of a white chrystaline compound which melted at a temperature range of (257-259°C) with decomposition 1H nmr, 13C nmr, DEPT and IR spectroscopic techniques ...

  16. Draft genome sequence of Xylella fastidiosa pear leaf scorch strain in Taiwan

    Science.gov (United States)

    The draft genome sequence of Xylella fastidiosa pear leaf scorch strain (PLS229) isolated from pear cultivar Hengshan (Pyrus pyrifolia) in Taiwan is reported. The bacterium has a genome size of 2,733,013 bp with a G+C content of 53.1%. The PLS229 strain genome was annotated to have 3,259 open readin...

  17. Egyptian Journal of Medical Human Genetics - Vol 14, No 3 (2013)

    African Journals Online (AJOL)

    Conservative therapy versus intra-gastric balloon in treatment of Prader-Willi Syndrome morbid obesity · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HN Ashem, SH Nagib, NS Thabet, 259–265. http://dx.doi.org/10.1016/j.ejmhg.2013.01.003 ...

  18. Climatic potential for passive cooling of buildings by night-time ventilation in Europe

    DEFF Research Database (Denmark)

    Artmann, Nikolai; Manz, H.; Heiselberg, Per

    2006-01-01

    , without considering any building-specific parameters. An approach for calculating degree-hours based on a variable building temperature - within a standardized range of thermal comfort - is presented and applied to climatic data of 259 stations all over Europe. The results show a high potential for night......-time ventilation alone might not be sufficient to guarantee thermal comfort....

  19. How do lay people assess the quality of physicians' communicative responses to patients' emotional cues and concerns? An international multicentre study based on videotaped medical consultations.

    NARCIS (Netherlands)

    Mazzi, M.A.; Bensing, J.; Rimondini, M.; Fletcher, I.; Vliet, L. van; Zimmermann, C.; Deveugele, M.

    2013-01-01

    Objective: To establish which kind of physician communicative responses to patient cues and concerns are appreciated by lay people. Methods: A balanced sample (259 people) was recruited in public places to participate in a full day observation of four videotaped standardized medical consultations.

  20. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 213-226. Crack arrest model for a piezoelectric plate – A generalised Dugdale model · R R Bhargava ... Detection of bearing defects in three-phase induction motors using Park's transform and radial basis function neural networks · Izzet Y Önel K Burak ... pp 259-276. New methodology for a person identification system.

  1. Social Adjustment of College Freshmen: The Importance of Gender and Living Environment

    Science.gov (United States)

    Enochs, Wendy K.; Roland, Catherine B.

    2006-01-01

    The relationship between living environment, gender and both overall adjustment to college and social adjustment in freshmen students was examined in this study. The College Adjustment Scales were administered to 511 freshmen students living in on-campus housing. There were 259 students living in Freshmen Year Experience (FYE) Halls verses 252…

  2. Discovery of the first dual inhibitor of the 5-lipoxygenase-activating protein and soluble epoxide hydrolase using pharmacophore-based virtual screening

    Czech Academy of Sciences Publication Activity Database

    Temml, V.; Garscha, U.; Romp, E.; Schubert, G.; Gerstmeier, J.; Kutil, Zsófia; Matuszczak, B.; Waltenberger, B.; Stuppner, H.; Werz, O.; Schuster, D.

    2017-01-01

    Roč. 7, FEB 20 (2017), č. článku 42751. ISSN 2045-2322 Institutional support: RVO:61389030 Keywords : activating protein * drug discovery * leukotriene biosynthesis * inflammatory diseases * conformer generation * arachidonic-acid * flap * challenges * asthma * risk Subject RIV: CE - Biochemistry OBOR OECD: Physiology (including cytology) Impact factor: 4.259, year: 2016

  3. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Elementary? Question Answering, IBM's Watson, and the Jeopardy! Challenge · Raman Chandrasekar · More Details Fulltext PDF. pp 242-258 General Article. Cloud Computing · V Rajaraman · More Details Fulltext PDF. pp 259-282 General Article. Drug Metabolism: A Fascinating Link Between Chemistry and Biology.

  4. Accessibility of women farmers to agricultural information in South ...

    African Journals Online (AJOL)

    Furthermore, the women farmers were accessible to technical information on improved seeds (x = 2.59), storage methods (x = 2.44), but poor access to operating farm machinery (x =0.49) and weather forecast (x =0.68). With regard to economic information they were accessible to market locations (x =2.40), but had low ...

  5. Influence of seeing effects on cloud model inversions

    Czech Academy of Sciences Publication Activity Database

    Tziotziou, K.; Heinzel, Petr; Tsiropoula, G.

    2007-01-01

    Roč. 472, č. 1 (2007), s. 287-292 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : cloud model * inversions * seeing effects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  6. Variation in annual pollen accumulation rates of Fagus along a N-S transect in Europe based on pollen traps

    Czech Academy of Sciences Publication Activity Database

    Pidek, I. A.; Svitavská-Svobodová, Helena; van der Knaap, W. O.; Noryskiewicz, A. M.; Filbrandt-Czaja, A.; Noryskiewicz, B.; Latalova, M.; Zimny, M.; Swieta-Musznicka, J.; Bozilova, E.; Tonkov, S.; Filipova-Marinova, M.; Poska, A.; Giesecke, T.; Gikov, A.

    2010-01-01

    Roč. 19, č. 4 (2010), s. 259-270 ISSN 0939-6314 R&D Projects: GA AV ČR IAAX00130801; GA AV ČR IAAX00050801 Institutional research plan: CEZ:AV0Z60050516 Keywords : Fagus * Europe * pollen monitoring Subject RIV: EF - Botanics Impact factor: 1.656, year: 2010

  7. TALE-directed local modulation of H3K9 methylation shapes exon recognition

    Czech Academy of Sciences Publication Activity Database

    Bieberstein, Nicole; Kozáková, Eva; Huranová, Martina; Thakur, P.K.; Krchňáková, Zuzana; Krausová, Michaela; Oesterreich, F.C.; Staněk, David

    2016-01-01

    Roč. 6, jaro (2016), č. článku 29961. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GBP305/12/G034 Institutional support: RVO:68378050 Keywords : histone h3 * human genome * efficient design * chromatin * methyltransferase * transcription * trimethylation * identification * recruitment * annotation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  8. Coupling of seasonal variations in the zooplankton community within the limnetic and littoral zones of a shallow pond

    Czech Academy of Sciences Publication Activity Database

    Šorf, M.; Devetter, Miloslav

    2011-01-01

    Roč. 47, č. 3 (2011), s. 259-268 ISSN 0003-4088 Institutional research plan: CEZ:AV0Z60660521 Keywords : limnetic zone * littoral zone * seasonal succession Subject RIV: EH - Ecology, Behaviour Impact factor: 0.930, year: 2011

  9. review of article palliative care in nigeria: challenges and prospects

    African Journals Online (AJOL)

    Zamzar

    as an individual with physical ,psychological, and. 7 social needs .The World Health Organization. (WHO) has named palliative care as one of four strategies to .... Schug S.A, Zech D, Grond S, Jung H ,Meuser. T ,Stible B. A. Long Term use of morphine in cancer patients. J Pain Symptom Manage,. 1992;7: 259- 266. 11.

  10. Application of the information, motivation and behavioural skills ...

    African Journals Online (AJOL)

    This paper discusses the application of an information, motivation and behavioural skills (IMB) model in a school-based programme for the reduction of HIV risk behaviour among 259 Grade 11 learners in two high schools in Alexandra township, Johannesburg. School 1 was the Experimental group, while School 2 was the ...

  11. Mapping of industrial effluent on coastal sediments using EDX

    CSIR Research Space (South Africa)

    Gregory, MA

    2003-01-01

    Full Text Available ?165. [11] G.J.M. Copeland (1992). Water Sci. and Technol., 25(9), 189?195. [12] A.S. Arcilla, A. Rodriguez and M. Mestres (1998). J. Mar. Environ. Eng., 4, 217?243. [13] C.M.G. Vivian(1986). Sci. Total Environ., 53, 5?40. [14] G. Courtois (1967...

  12. Miscibility of CuO, NiO, and ZnO in their binary mixtures and its impact for reprocessing industrial wastes

    Czech Academy of Sciences Publication Activity Database

    Grygar, Tomáš; Salátová, Z.; Vorm, Petr

    2001-01-01

    Roč. 45, č. 4 (2001), s. 121-127 ISSN 0862-5468 R&D Projects: GA AV ČR IBS4032004 Institutional research plan: CEZ:AV0Z4032918 Keywords : CuO * NiO * ZnO Subject RIV: CA - Inorganic Chemistry Impact factor: 0.259, year: 2001

  13. Voltammetric and X-ray diffraction analysis of the early stages of the thermal crystallization of mixed Cu,Mn oxides

    Czech Academy of Sciences Publication Activity Database

    Grygar, Tomáš; Rojka, T.; Bezdička, Petr; Večerníková, Eva; Kovanda, F.

    2004-01-01

    Roč. 8, č. 4 (2004), s. 252-259 ISSN 1432-8488 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : amorphous phases * Cu,Mn oxides * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.984, year: 2004

  14. Novel structural aspect of the diatom thylakoid membrane: lateral segregation of photosystem I under red-enhanced illumination

    Czech Academy of Sciences Publication Activity Database

    Bína, David; Herbstová, Miroslava; Gardian, Zdenko; Vácha, František; Litvín, Radek

    2016-01-01

    Roč. 6, MAY 2016 (2016), č. článku 25583. ISSN 2045-2322 R&D Projects: GA ČR GBP501/12/G055 Institutional support: RVO:60077344 Keywords : Light-harvesting complexes * Supramolecular organization * Protein complexes Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  15. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Anurag Kumar Mishra. Articles written in Journal of Biosciences. Volume 27 Issue 3 June 2002 pp 251-259 Articles. Cloning and sequencing of complete -crystallin cDNA from embryonic lens of Crocodylus palustris · Raman Agrawal Reena Chandrashekhar Anurag Kumar Mishra ...

  16. Cyclin a down - regulation in TGFb1 - arrested follicular lymphoma cells

    Czech Academy of Sciences Publication Activity Database

    Djaborkhel, Rashed; Tvrdík, Daniel; Eckschlager, T.; Raška, Ivan; Müller, Julius

    2000-01-01

    Roč. 261, - (2000), s. 250-259 ISSN 0014-4827 R&D Projects: GA ČR GA304/00/1481 Institutional research plan: CEZ:AV0Z5039906 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.860, year: 2000

  17. Novel electrochemical route to cleaner fuel dimethyl ether

    Czech Academy of Sciences Publication Activity Database

    Cassone, Giuseppe; Pietrucci, F.; Saija, F.; Guyot, Y.; Šponer, Jiří; Šponer, Judit E.; Saitta, A. M.

    2017-01-01

    Roč. 7, JUL2017 (2017), č. článku 6901. ISSN 2045-2322 Institutional support: RVO:68081707 Keywords : initio molecular-dynamics * solid-acid catalysts * electric-fields Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.259, year: 2016

  18. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 74, Issue 2. February 2010, pages 169-330. pp 169-175 Research Articles ... pp 177-188 Research Articles. Bidirectional communication using delay coupled .... 247-259 Research Articles. Design studies of a high-current radiofrequency quadrupole for accelerator-driven systems programme · S V L S Rao P Singh.

  19. Bidirectional Influences between Maternal Parenting and Children's Peer Problems: A Longitudinal Monozygotic Twin Difference Study

    Science.gov (United States)

    Yamagata, Shinji; Takahashi, Yusuke; Ozaki, Koken; Fujisawa, Keiko K.; Nonaka, Koichi; Ando, Juko

    2013-01-01

    This twin study examined the bidirectional relationship between maternal parenting behaviors and children's peer problems that were not confounded by genetic and family environmental factors. Mothers of 259 monozygotic twin pairs reported parenting behaviors and peer problems when twins were 42 and 48 months. Path analyses on monozygotic twin…

  20. Borehole depth and regolith aquifer hydraulic characteristics of ...

    African Journals Online (AJOL)

    In this study, the performance of regolith aquifers derived from the different bedrock types was examined using information on depth of borehole, depth to the static water level, yield of borehole and drawdown in 259 boreholes covering the different bedrock types. Results show that mean depth of wells varies from about 37 ...

  1. European survey on sterigmatocystin in cereals, cereals-based products, beer and nuts

    NARCIS (Netherlands)

    Mol, H.G.J.; MacDonald, S.J.; Anagnostopoulos, C.; Spanjer, M.; Bertuzzi, T.; Pietri, A.

    2016-01-01

    Based on the EFSA proposal 'Survey on sterigmatocystin in food' (GP/EFSA/CONTAM/2013/02), this study provides a survey on the occurrence of this mycotoxin. A total of 1,259 samples of cereal grains (429), cereal products (713), beer (53) and nuts (64) were analysed for the presence of

  2. Survey on sterigmatocystin in food

    NARCIS (Netherlands)

    Mol, J.G.J.; Pietri, A.; MacDonald, S.J.; Anagnostopoulos, C.; Spanjer, M.

    2015-01-01

    A total of 1 259 samples of cereal grains, cereal products, beer and nuts were analysed for the presence of the mycotoxin sterigmatocystin. Samples were mainly collected at processing plants, storage facilities, wholesale and retail between August 2013 and November 2014, in nine European countries

  3. Paradoxical Effects of Warning in the Production of Children's False Memories

    Science.gov (United States)

    Del Prete, Francesco; Mirandola, Chiara; Konishi, Mahiko; Cornoldi, Cesare; Ghetti, Simona

    2014-01-01

    The effects of warning on false recognition and associated subjective experience of false recollection and familiarity were investigated in 7-to 13-year-old children and young adults (N = 259) using the Deese-Roediger-McDermott (DRM) paradigm. Two warning conditions (warning with an example of a critical lure and warning without an example of a…

  4. Combined astrometric catalogue EOC-3 An improved reference frame for long-term Earth rotation studies

    Czech Academy of Sciences Publication Activity Database

    Vondrák, Jan; Štefka, Vojtěch

    2007-01-01

    Roč. 463, č. 2 (2007), s. 783-788 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC506 Institutional research plan: CEZ:AV0Z10030501 Keywords : reference systems * astrometry * catalogs Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  5. New taxa and new records of oribatid mites of the family Galumnidae (Acari: Oribatida) from Ecuador

    Czech Academy of Sciences Publication Activity Database

    Ermilov, S.G.; Starý, Josef; Sandmann, D.; Marian, F.; Maraun, M.

    2013-01-01

    Roč. 3700, č. 2 (2013), s. 259-270 ISSN 1175-5326 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : Oribatida * Galumnidae * new species * Ecuador Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  6. Biomonitoring of occupational exposure: Neutron activation determination of selected metals in the body tissues and fluids of workers manufacturing stainless steel vessels

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Bencko, V.; Tejral, J.; Borská, L.; Soukal, L.; Řanda, Zdeněk

    2004-01-01

    Roč. 259, č. 1 (2004), s. 7-11 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Institutional research plan: CEZ:AV0Z1048901 Keywords : occupational exposure * biomonitoring * neutron activation analysis Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.457, year: 2004

  7. Cystathionine .gamma.-lyase: Clinical, metabolic, genetic, and structural studies

    Czech Academy of Sciences Publication Activity Database

    Kraus, J. P.; Hašek, Jindřich; Kožich, V.; Collard, R.; Venezia, S.; Janošíková, B.; Wang, J.; Stabler, S. P.; Allen, R. H.; Jakobs, C.; Finn, C. T.; Chien, Y. H.; Hwu, W. L.; Hegele, R. A.; Mudd, S. H.

    2009-01-01

    Roč. 97, č. 4 (2009), s. 250-259 ISSN 1096-7192 R&D Projects: GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : cystathionine gamma-lyase * cystathioninuria * hypercystathioninemia Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.897, year: 2009

  8. Development of the University Center for Disaster Preparedness and Emergency Response (UCDPER)

    Science.gov (United States)

    2011-09-30

    cloud computing (cloud communications) solution, XWARP, in partnership with Citrix , a US based information technology Solution Company [10]. XWARP is...based on integration of various technologies from both companies including Citrix Virtualization, a zero-latency engine, 259 an intelligent

  9. Parenting and Family Stress as Mediators of the Long-Term Effects of Child Abuse.

    Science.gov (United States)

    Wind, Tiffany Weissmann; Silvern, Louise

    1994-01-01

    Data on child physical/sexual abuse, family stress histories, perceived parental warmth, and current psychological functioning were gathered from 259 working women. Multiple regression analyses showed that parental warmth strongly influenced or mediated the relationship of intrafamilial child abuse to depression and self-esteem levels. However,…

  10. Numerical modelling of permafrost in bedrock in northern Fennoscandia during the Holocene

    Czech Academy of Sciences Publication Activity Database

    Kukkonen, I. T.; Šafanda, Jan

    2001-01-01

    Roč. 29, 3/4 (2001), s. 259-273 ISSN 0921-8181 Institutional research plan: CEZ:AV0Z3012916 Keywords : permafrost * Holocene * climate change * freezing * thawing * Fennoscandia Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.381, year: 2001

  11. Trace elements in higher fungi (mushrooms) determined by activation analysis

    Czech Academy of Sciences Publication Activity Database

    Řanda, Zdeněk; Kučera, Jan

    2004-01-01

    Roč. 259, č. 1 (2004), s. 99-107 ISSN 0236-5731 R&D Projects: GA ČR GV202/97/K038 Institutional research plan: CEZ:AV0Z1048901 Keywords : trace elements * activation analysis * mushrooms Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.457, year: 2004

  12. Trace elements in higher fungi (mushrooms) determined by activation analysis

    Czech Academy of Sciences Publication Activity Database

    Řanda, Zdeněk; Kučera, Jan

    2004-01-01

    Roč. 259, č. 1 (2004), s. 99-107 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-activation * edible mushrooms * heavy metals Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.457, year: 2004

  13. Magnetic order, hysteresis, and phase coexistence in magnetoelectric LiCoPO4

    DEFF Research Database (Denmark)

    Fogh, Ellen; Toft-Petersen, Rasmus; Ressouche, Eric

    2017-01-01

    The magnetic phase diagram of magnetoelectric LiCoPO4 is established using neutron diffraction and magnetometry in fields up to 25.9 T applied along the crystallographic b axis. For fields greater than 11.9 T, the magnetic unit cell triples in size with propagation vector Q = (0, 1...

  14. Review: Julie Coleman: A History of Cant and Slang Dictionaries ...

    African Journals Online (AJOL)

    Julie Coleman. A History of Cant and Slang Dictionaries. Volume I: 1567– 1784. 2004, xii + 259 pp. ISBN 0 19 925471 0 (Hb.). Oxford: Oxford University Press. Price: £115. Julie Coleman. A History of Cant and Slang Dictionaries. Volume II: 1785– 1858. 2004, xiv + 338 pp. ISBN 0 19 925470 2 (Hb.). Oxford: Oxford ...

  15. Potent Antidiuretic Agonists, Deamino-Vasopressin and Desmopressin, and Their Inverso Analogs: NMR Structure and Interactions With Micellar and Liposomic Models of Cell Membrane

    Czech Academy of Sciences Publication Activity Database

    Lubecka, E. A.; Sikorska, E.; Sobolewski, D.; Prahl, A.; Slaninová, Jiřina; Ciarkowski, J.

    2016-01-01

    Roč. 106, č. 3 (2016), s. 245-259 ISSN 0006-3525 Institutional support: RVO:61388963 Keywords : desmopressin * deamino-vasopressin * anionic-zwitterionic micelles * liposomes * inverso analogs Subject RIV: CE - Biochemistry Impact factor: 1.908, year: 2016

  16. Genotype dependent callus induction and shoot regeneration in ...

    African Journals Online (AJOL)

    This study aims to observe the effect of genotype, hormone and culture conditions on sunflower (Helianthus annuus L.) callus induction and indirect plant regeneration. Calli were obtained from hypocotyl and cotyledon explants of five different sunflower genotypes; Trakya 80, Trakya 129, Trakya 259, Trakya 2098 and ...

  17. A Static Model of Abiotic Predictors and Forest Ecosystem Receptor Designed Using Dimensionality Reduction and Regression Analysis

    Czech Academy of Sciences Publication Activity Database

    Samec, P.; Rychtecká, P.; Tuček, P.; Bojko, J.; Zapletal, Miloš; Cudlín, Pavel

    2016-01-01

    Roč. 22, č. 2 (2016), s. 259-274 ISSN 1392-1355 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : forest state monitoring * EMEP-LRTAP * floodplain * mountain forests * canonical correlation analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.635, year: 2016

  18. Characterization and crystal structure of a 17-membered macrocyclic Schiff base compound MeO-sal-pn-bn

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Ghoran, S.H.; Rohlíček, Jan; Dušek, Michal

    2015-01-01

    Roč. 56, č. 2 (2015), s. 259-265 ISSN 0022-4766 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : macrocyclic * Schiff base * spectroscopy * powder diffraction * orthorhombic Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.536, year: 2015

  19. Spatiotemporal variability of stone pine (Pinus pinea L.) growth response to climate across the Iberian Peninsula

    Czech Academy of Sciences Publication Activity Database

    Natalini, F.; Alejano, R.; Vazquez-Pique, J.; Pardos, M.; Calama, R.; Büntgen, Ulf

    2016-01-01

    Roč. 40, dec (2016), s. 72-84 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-rings * genetically depauperate * mediterranean climate * phenotypic plasticity * cambial activity * fagus-sylvatica * spain * drought * widespread * halepensis * Climate change * Dendroecology * Growth plasticity * Mediterranean * Tree rings * Drought Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2016

  20. Prevalence of Hemolivia mauritanica (Apicomplexa: Adeleina: Haemogregarinidae) in natural populations of tortoises of the genus Testudo in the east Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Široký, P.; Kamler, M.; Modrý, David

    2005-01-01

    Roč. 52, č. 4 (2005), s. 259-361 ISSN 0015-5683 R&D Projects: GA ČR GP524/03/D104 Grant - others:IGA VFU(CZ) 2/2004/FVHE Institutional research plan: CEZ:AV0Z60220518 Keywords : Apicomplexa * Hemolivia mauritanica Subject RIV: EG - Zoology Impact factor: 1.138, year: 2005

  1. Influence of Active Immunization Against Angiotensin AT1 or AT2 Receptor on Hypertension Development in Young and Adult SHR

    Czech Academy of Sciences Publication Activity Database

    Železná, Blanka; Veselský, Leopold; Velek, Jiří; Dobešová, Zdenka; Zicha, Josef; Kuneš, Jaroslav

    1999-01-01

    Roč. 48, č. 4 (1999), s. 259-265 ISSN 0862-8408 R&D Projects: GA MŠk OK 170; GA AV ČR IAA7011711; GA AV ČR IPP2020702 Grant - others:Coperincus(FR) CT94-0239 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.521, year: 1999

  2. Dgroup: DG00171 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 259 ... Coagulation Factor IXa D08794 ... Human blood-coagulation factor IX complex, dried ... D08797 ... Freeze-dried human blood-coagulation... factor IX ... Cardiovascular agent ... DG02016 ... Hemostatics ... DG02013 ... Blood coagulation... factor ... DG02014 ... Blood coagulation accelerant ... DG02013 ... Blood coagulation factor ATC code: B02BD04 Coagulants ...

  3. 76 FR 4250 - Operating Certain Railroad Tank Cars in Excess of 263,000 Pounds Gross Rail Load; Approval

    Science.gov (United States)

    2011-01-25

    ..., thicknesses, materials of construction, and working pressures were as follows: Working Tank car specification..., wheels, draft systems, springs and trucks. S-259, however, does not allow for the free interchange among...-jacketed tank cars constructed with ASTM 516-70 steel and having only the minimum plate thickness required...

  4. The co-evolutionary relationship between bitterling fishes and freshwater mussels: insights from interspecific comparisons

    Czech Academy of Sciences Publication Activity Database

    Reichard, Martin; Liu, H.; Smith, C.

    2007-01-01

    Roč. 9, č. 2 (2007), s. 239-259 ISSN 1522-0613 Grant - others:NSFC(CN) 30470237 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * co-evolution * egg ejection * host-parasite relationship * mutualism * oviposition Subject RIV: EG - Zoology Impact factor: 1.409, year: 2007

  5. European Science Notes Information Bulletin.

    Science.gov (United States)

    1992-12-01

    Office of Naval Research AD-A259 632 STr "., A European Office l illlillIIIIllllllil 92-06 NAVSO P-3678 ESN I NFORMATION BULLETIN European Science...Products ites, chocolates (for composites, abrasives Development Laboratory). The director of the can be added to the water to help it cut but laboratory

  6. Forensic Index and Substance Abuse among Psychiatric Patients ...

    African Journals Online (AJOL)

    Although forensic index and substance use are crucial issues in clinical work among mentally ill patients, studies emanating from psychiatric facilities in nonwestern cultures have been relatively scarce. This paper examines this issue in a tertiary health institution. Participants were 259 mentally ill patients (124 inpatients ...

  7. Hot star wind models with new solar abundances

    Czech Academy of Sciences Publication Activity Database

    Krtička, J.; Kubát, Jiří

    2007-01-01

    Roč. 464, č. 2 (2007), L17-L20 ISSN 0004-6361 R&D Projects: GA ČR GA205/04/1267 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * mass-loss * early-type * hydrodynamics * winds outflows Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  8. 49 CFR 538.8 - Gallon Equivalents for Gaseous Fuels.

    Science.gov (United States)

    2010-10-01

    ... VEHICLES § 538.8 Gallon Equivalents for Gaseous Fuels. The gallon equivalent of gaseous fuels, for purposes... Natural Gas 0.823 Liquefied Natural Gas 0.823 Liquefied Petroleum Gas (Grade HD-5)* 0.726 Hydrogen 0.259...

  9. Dynamics of the biotopes at the edge of a medieval town: pollen analysis of Vltava river sediments in Prague, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kozáková, Radka; Pokorný, Petr

    2007-01-01

    Roč. 79, - (2007), s. 259-281 ISSN 0032-7786 R&D Projects: GA AV ČR(CZ) IAAX00020701 Institutional research plan: CEZ:AV0Z80020508 Keywords : pollen analysis Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.064, year: 2007

  10. The Effects of Changes in Racial Identity and Self-Esteem on Changes in African American Adolescents' Mental Health

    Science.gov (United States)

    Mandara, Jelani; Gaylord-Harden, Noni K.; Richards, Maryse H.; Ragsdale, Brian L.

    2009-01-01

    This study assessed the unique effects of racial identity and self-esteem on 259 African American adolescents' depressive and anxiety symptoms as they transitioned from the 7th to 8th grades (ages 12-14). Racial identity and self-esteem were strongly correlated with each other for males but not for females. For both males and females, an increase…

  11. Rectal Carriage of Extended-Spectrum-Beta-Lactamase-Producing Enterobacteriaceae in Hospitalized Patients : Selective Preenrichment Increases Yield of Screening

    NARCIS (Netherlands)

    Kluijtmans-van den Bergh, Marjolein; Verhulst, C.; Willemsen, L. E.; Verkade, E.; Bonten, M. J. M.; Kluytmans, J. A. J. W.

    This study evaluated the added value of selective preenrichment for the detection of rectal carriage of extended-spectrum-beta-lactamase-producing Enterobacteriaceae (ESBL-E). ESBL-E rectal carriage was identified in 4.8% of hospitalized patients, and 25.9% of ESBL-E rectal carriers were identified

  12. N-terminal tetrapeptide T/SPLH motifs contribute to multimodal activation of human TRPA1 channel

    Czech Academy of Sciences Publication Activity Database

    Hynková, Anna; Maršáková, Lenka; Vašková, Jana; Vlachová, Viktorie

    2016-01-01

    Roč. 6, Jun 27 (2016), s. 28700 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-15839S Institutional support: RVO:67985823 Keywords : ankyrin receptor subtype 1 * transient receptor potential * gating * ankyrin repeat * whole-cell electrophysiology * N-terminus * mutagenesis Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016

  13. Kinetic speciation of mercury–humate complexes in aqueous solutions by using competing ligand exchange method

    Digital Repository Service at National Institute of Oceanography (India)

    Vudamala, K.; Chakraborty, P.

    river emptying into Cochin backwaters, Indian J. Mar. Sci. 15 (1986) 253–259. http://cat.inist.fr/?aModele=afficheN&cpsidt=8219806 (accessed September 4, 2015). [25] P.K. Krishnakumar, V.K. Pillai, Mercury Near a Caustic Soda plant at karwar,India, Mar...

  14. Characterization of natural leaf senescence in tobacco (Nicotiana tabacum) plants grown in vitro

    Czech Academy of Sciences Publication Activity Database

    Uzelac, B.; Janošević, D.; Simonović, A.; Motyka, Václav; Dobrev, Petre; Budimir, S.

    2016-01-01

    Roč. 253, č. 2 (2016), s. 259-275 ISSN 0033-183X R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Leaf senescence * Mesophyll ultrastructure * Phytohormones Subject RIV: EF - Botanics Impact factor: 2.870, year: 2016

  15. Click chemistry-based tracking reveals putative cell wall-located auxin binding sites in expanding cells

    Czech Academy of Sciences Publication Activity Database

    Mravec, J.; Kračun, S. K.; Zemlyanskaya, E.; Rydahl, M. G.; Guo, X.; Pičmanová, M.; Sørensen, K.; Růžička, Kamil; Willats, W.G.T.

    2017-01-01

    Roč. 7, NOV 22 (2017), č. článku 15988. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:61389030 Keywords : MEMBRANE H+-ATPASE * BIOLOGICAL-ACTIVITY * AZIDO AUXINS Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 4.259, year: 2016

  16. G-Quadruplex Identification in the Genome of Protozoan Parasites Points to Naphthalene Diimide Ligands as New Antiparasitic Agents

    Czech Academy of Sciences Publication Activity Database

    Belmonte-Reche, E.; Martínez-García, M.; Guédin, A.; Zuffo, M.; Arevalo-Ruiz, M.; Doria, F.; Campos-Salinas, J.; Maynadier, M.; Lopez-Rubio, J.J.; Freccero, M.; Mergny, Jean-Louis; Maria Perez-Victoria, J.; Carlos Morales, J.

    2018-01-01

    Roč. 61, č. 3 (2018), s. 1231-1240 ISSN 0022-2623 R&D Projects: GA MŠk EF15_003/0000477 Institutional support: RVO:68081707 Keywords : terminal repeat promoter * plasmodium-falciparum Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016

  17. Operational test report for 2706-T complex liquid transfer system

    International Nuclear Information System (INIS)

    BENZEL, H.R.

    1999-01-01

    This document is the Operational Test Report (OTR). It enters the Record Copy of the W-259 Operational Test Procedure (HNF-3610) into the document retrieval system. Additionally, the OTR summarizes significant issues associated with testing the 2706-T waste liquid transfer and storage system

  18. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  19. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  20. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  1. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  2. Photosystem II electron transport rates and oxygen production in natural waterblooms of freshwater cyanobacteria during a diel cycle

    Czech Academy of Sciences Publication Activity Database

    Masojídek, Jiří; Grobbelaar, J. U.; Pechar, Libor; Koblížek, Michal

    2001-01-01

    Roč. 23, č. 1 (2001), s. 57-66 ISSN 0142-7873 R&D Projects: GA ČR GA206/96/1222 Institutional research plan: CEZ:AV0Z5020903 Keywords : electron transport * evolution Subject RIV: CE - Biochemistry Impact factor: 1.259, year: 2001

  3. Spatial mapping of metals in tissue-sections using combination of mass-spectrometry and histology through image registration

    Czech Academy of Sciences Publication Activity Database

    Anýz, J.; Vysloužilová, L.; Vaculovič, T.; Tvrdoňová, M.; Kanický, V.; Haase, H.; Horák, Vratislav; Štěpánková, O.; Heger, Z.; Adam, V.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 40169. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1609 Institutional support: RVO:67985904 Keywords : melanoma patients * mixed effects models * bearing Libechov minipig Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemical research methods Impact factor: 4.259, year: 2016

  4. RGD delivery of truncated coagulase to tumor vasculature affords local thrombotic activity to induce infarction of tumors in mice

    Czech Academy of Sciences Publication Activity Database

    Jahanban-Esfahlan, R.; Seidi, K.; Monhemi, H.; Adli, A.D.F.; Minofar, Babak; Zare, P.; Farajzadeh, D.; Farajnia, S.; Behzadi, R.; Abbasi, M.M.; Zarghami, N.; Javaheri, T.

    2017-01-01

    Roč. 7, AUG 15 (2017), s. 1-14, č. článku 8126. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : TISSUE-FACTOR * FACTOR-VIIA * STAPHYLOCOAGULASE Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  5. Photoacoustic Sounds from Meteors

    Czech Academy of Sciences Publication Activity Database

    Spalding, R.; Tencer, J.; Sweatt, W.; Conley, B.; Hogan, R.; Boslough, M.B.; Gonzales, G.; Spurný, Pavel

    2017-01-01

    Roč. 7, February (2017), 41251/1-41251/6 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : photoacoustic coupling * experimental results * numerical models Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.259, year: 2016

  6. Application of 3D wavelet transforms for crack detection in rotor ...

    Indian Academy of Sciences (India)

    Sekhar A S, Prabhu B S 1994 Transient analysis of a cracked rotor passing through the critical speed. J. Sound and Vibration 173: 415–421. Sekhar A S 2003 Crack detection through wavelet transform for a run up rotor. J. Sound and Vibration. 259(2): 461–472. Wauer J 1990 Dynamics of cracked rotors: a literature survey.

  7. Galaxy number counts and implications for strong lensing

    NARCIS (Netherlands)

    Fassnacht, C. D.; Koopmans, L. V. E.; Wong, K. C.

    We compare galaxy number counts in Advanced Camera for Surveys (ACS) fields containing moderate-redshift (0.2 259 ACS fields and (2) 20 ‘pure-parallel’ fields randomly

  8. ADHD Medication Vacations and Parent-Child Interactions by Gender

    Science.gov (United States)

    Barnard-Brak, Lucy; Schmidt, Marcelo; Sulak, Tracey

    2013-01-01

    Objective: The purpose of the current study was to examine medication vacations among children with ADHD according to parent-child dyads (e.g., mother-son, father-daughter, mother-daughter, and father-son). Method: In a survey study of 259 parents of children with ADHD, the use of medication vacations according to parent-child sex dyads was…

  9. Fission properties and production mechanisms for the heaviest known elements

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, D.C.

    1981-01-01

    Mass yields of the spontaneous fission of Fm isotopes, Cf isotopes, and /sup 259/Md are discussed. Actinide yields were measured for bombardments of /sup 248/Cm with /sup 16/O, /sup 18/O, /sup 20/Ne, and /sup 22/Ne. A superheavy product might be produced by bombarding /sup 248/Cm with /sup 48/Ca ions. 12 figures. (DLC)

  10. SALO, a novel classical pathway complement inhibitor from saliva of the sand fly Lutzomyia longipalpis

    Czech Academy of Sciences Publication Activity Database

    Ferreira, V.P.; Vale, V.F.; Pangburn, M.K.; Abdeladhim, M.; Mendes-Sousa, A.F.; Coutinho-Abreu, I.V.; Rasouli, M.; Brandt, E.A.; Meneses, C.; Lima, K.F.; Araújo, R.N.; Pereira, M.H.; Kotsyfakis, Michalis; Oliveira, F.; Kamhawi, S.; Ribeiro, J.M.C.; Gontijo, N.F.; Collin, N.; Valenzuela, J. G.

    2016-01-01

    Roč. 6, JAN 13 (2016), č. článku 19300. ISSN 2045-2322 R&D Projects: GA ČR GAP502/12/2409 Institutional support: RVO:60077344 Keywords : leishmania * immunity * glands Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  11. Mediação familiar : perspectiva de futuro

    OpenAIRE

    Ribeiro, Maria Saldanha Pinto

    2014-01-01

    Lusíada. Direito. - ISSN 2182-4118. - S. 2, n. 4-5 (2007). - p. 259-266. No âmbito dos problemas litigiosos familiares, sem o serviço de mediação, muito pouco do que se faz jurisdicionalmente vale a pena.

  12. 17 CFR 250.57 - Notices and reports to be filed under section 33.

    Science.gov (United States)

    2010-04-01

    ... section 33. (a) Notification of Status as Foreign Utility Company. Form U-57 (§ 259.207 of this chapter), notification of status as a foreign utility company, may be filed by, or on behalf of, an entity that seeks to... COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Regulation...

  13. The vascular endothelial growth factor receptor inhibitor sunitinib causes a preeclampsia-like syndrome with activation of the endothelin system

    DEFF Research Database (Denmark)

    Kappers, Mariëtte H W; Smedts, Frank M M; Horn, Thomas

    2011-01-01

    be prevented with the endothelin receptor antagonist macitentan (¿BP: 12.3±1.5 mm Hg) and only mildly with Tempol, a superoxide dismutase mimetic (¿BP: 25.9±2.3 mm Hg). Both compounds could not prevent the sunitinib-induced rise in serum creatinine or renal histological abnormalities and had no effect on urine...

  14. The vascular endothelial growth factor receptor inhibitor sunitinib causes a preeclampsia-like syndrome with activation of the endothelin system

    DEFF Research Database (Denmark)

    Kappers, Mariëtte H W; Smedts, Frank M M; Horn, Thomas

    2011-01-01

    be prevented with the endothelin receptor antagonist macitentan (ΔBP: 12.3±1.5 mm Hg) and only mildly with Tempol, a superoxide dismutase mimetic (ΔBP: 25.9±2.3 mm Hg). Both compounds could not prevent the sunitinib-induced rise in serum creatinine or renal histological abnormalities and had no effect on urine...

  15. and copper(II)

    Indian Academy of Sciences (India)

    Unknown

    characterization of several imidazolate-bridged binuclear copper(II) complexes have been reported 1–17. ... of the desired complex formed were collected, washed with ethanol and dried in vacuo at room temperature. .... 16. Sigel H (ed.) 1981 Metal ions in biological system (New York: Marcel Dekker) vol 13, p. 259. 17.

  16. Ruthenium Complexes with Vinyl, Styryl, and Vinylpyrenyl Ligands: A Case of Non-Innocence in Organometallic Chemistry

    Czech Academy of Sciences Publication Activity Database

    Maurer, J.; Linseis, M.; Sarkar, B.; Schwederski, B.; Niemeyer, M.; Kaim, W.; Záliš, Stanislav; Anson, Ch.; Zabel, M.; Winter, R. F.

    2008-01-01

    Roč. 130, č. 1 (2008), s. 259-268 ISSN 0002-7863 R&D Projects: GA AV ČR 1ET400400413; GA MŠk OC 139 Institutional research plan: CEZ:AV0Z40400503 Keywords : ruthenium complexes * organometallic chemistry * vinyl Subject RIV: CG - Electrochemistry Impact factor: 8.091, year: 2008

  17. Factors impacting on the nutritional status of population aged 45 ...

    African Journals Online (AJOL)

    Of the population assessed, 46.4% had normal nutritional status while 40.9% were overweight, and 12.7% underweight, with more females (48.0%) than males (25.9%) being overweight. Conclusion: Under nutrition and obesity are problems facing this population group aged 45 years and above in Nairobi. There is need for ...

  18. The relation between evil and transcendence: new possibilities ...

    African Journals Online (AJOL)

    In this article I will analyse the concept of evil in terms of the typology of transcendence that was developed by Wessel Stoker. I will argue that there are, within the (post-) modern discourse, and ... This notion of evil may enhance our ethical responsibility towards it. South African Journal of Philosophy 2014, 33(3): 259–269 ...

  19. Ticks infected via co-feeding transmission can transmit Lyme borreliosis to vertebrate hosts

    Czech Academy of Sciences Publication Activity Database

    Belli, A.; Sarr, A.; Rais, O.; Rego, Ryan O. M.; Voordouw, M.J.

    2017-01-01

    Roč. 7, JUL 10 (2017), č. článku 5006. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Ixodes ricinus ticks * disease spirochete * borne pathogens * r-0 model * vector * mice * immunity * persistence Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 4.259, year: 2016

  20. A genome-wide association study identifies colorectal cancer susceptibility loci on chromosomes 10p14 and 8q23.3

    Czech Academy of Sciences Publication Activity Database

    Tomlinson, I.P.M.; Webb, E.; Carvajal-Carmona, L.; Broderick, P.; Howarth, K.; Pittman, A.M.; Spain, S.; Lubbe, S.; Walter, A.; Sullivan, K.; Jaeger, E.; Fielding, S.; Rowan, A.; Vijayakrishnan, J.; Domingo, E.; Chandler, I.; Kemp, Z.; Qureshi, M.; Farrington, S.M.; Tenesa, A.; Prendergast, J.G.D.; Barnetson, R.A.; Penegar, S.; Barclay, E.; Wood, W.; Martin, L.; Gorman, M.; Thomas, H.; Peto, J.; Bishop, D.T.; Gray, R.; Maher, E.R.; Lucassen, A.; Kerr, D.; Evans, D.G.R.; Schafmayer, C.; Buch, S.; Völzke, H.; Hampe, J.; Schreber, S.; John, U.; Koessler, T.; Pharoah, P.; van Wezel, T.; Morreau, H.; Wijnen, J.T.; Hopper, J.L.; Southey, M.C.; Giles, G.G.; Severi, G.; Castellví-Bel, S.; Ruiz-Ponte, C.; Carracedo, A.; Castells, A.; Försti, A.; Hemminki, K.; Vodička, Pavel; Naccarati, Alessio; Lipton, L.; Ho, J.W.C.; Cheng, K.K.; Sham, P.C.; Luk, J.; Agúndez, J.A.G.; Ladero, J.M.; de la Hoya, M.; Caldés, T.; Niittymäki, I.; Tuupanene, S.; Karhu, A.; Aaltonen, L.; Cazier, J.B.; Campbell, H.; Dunlop, M.G.; Houlston, R.S.

    2008-01-01

    Roč. 40, č. 5 (2008), s. 623-630 ISSN 1061-4036 R&D Projects: GA ČR GA310/07/1430 Institutional research plan: CEZ:AV0Z50390703 Keywords : Colorectal cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008

  1. Ahn and Son Afr J Tradit Complement Altern Med. (2014) 11(1):28 ...

    African Journals Online (AJOL)

    cadewumi

    2Dept. of Oriental Internal Medicine, Daejeon Oriental Hospital of Daejeon Univ., Daejeon 301-724, South Korea. *E-mail: .... J. Korean Acad. Community Health. Nurs., 20:259-268. 5. Vergari, F., Tibuzzi, A. and Basile. G. (2010). An overview of the functional food market: from marketing issues and commercial players to.

  2. Compositional variations of chromiferous spinel in Mg-rich rocks of ...

    Indian Academy of Sciences (India)

    basalts of Gujarat (India); Lithos 89 259–274. Melluso L, Morra V and Fedele L 2006b An overview of phase chemistry and magmatic evolution in the Cre- taceous flood basalt province of northern Madagascar;. Periodico di Mineralogia 75 175–188. Melluso L and Sethna S F 2010 Mineral composition of the Deccan Trap ...

  3. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  4. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30120515; CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  5. Ganesh, Prof. Subramaniam

    Indian Academy of Sciences (India)

    Ganesh, Prof. Subramaniam Ph.D. (Banaras), FNASc. Date of birth: 23 May 1968. Specialization: Human Molecular Genetics, Neurobiology of Disease, Stress Biology Address: Department of Biological Sciences & Bioengineering, Indian Institute of Technology, Kanpur 208 016, U.P.. Contact: Office: (0512) 259 4040

  6. Experimental temporal quantum steering

    Czech Academy of Sciences Publication Activity Database

    Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.; Nori, F.

    2016-01-01

    Roč. 6, Nov (2016), 1-8, č. článku 38076. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : temporal quantum steering * EPR steering Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  7. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  8. Genotypic variation in fruit ripening time and weight reduction ...

    African Journals Online (AJOL)

    Significant difference (P<0.05) was also observed in most of the hybrids compared to plantain landraces in their keeping qualities before senescence. Specifically, hybrids 23977-7 and SH 3362 kept for 25.9 days to stage 10. Fruits of FHIA 3 showed the shortest storage life (13.3days) before senescence. The weight of ...

  9. Impact of Executive Function Deficits and Attention-Deficit/Hyperactivity Disorder (ADHD) on Academic Outcomes in Children

    Science.gov (United States)

    Biederman, Joseph; Monuteaux, Michael C.; Doyle, Alysa E.; Seidman, Larry J.; Wilens, Timothy E.; Ferrero, Frances; Morgan, Christie L.; Faraone, Stephen V.

    2004-01-01

    The association between executive function deficits (EFDs) and functional outcomes were examined among children and adolescents with attention-deficit/hyperactivity disorder (ADHD). Participants were children and adolescents with (n = 259) and without (n = 222) ADHD, as ascertained from pediatric and psychiatric clinics. The authors defined EFD as…

  10. beta-1,2,3-Triazolyl-Nucleosides as Nicotinamide Riboside Mimics

    Czech Academy of Sciences Publication Activity Database

    Amigues, E.J.; Armstrong, E.; Dvořáková, Marcela; Migaud, M.E.; Huang, M.

    2009-01-01

    Roč. 28, č. 3 (2009), s. 238-259 ISSN 1525-7770 Institutional research plan: CEZ:AV0Z50380511 Keywords : Nucleoside * nucleotide * sirtuin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.768, year: 2009

  11. Coding accuracy on the psychophysical scale

    Czech Academy of Sciences Publication Activity Database

    Košťál, Lubomír; Lánský, Petr

    2016-01-01

    Roč. 6, Mar 29 (2016), s. 23810 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-08066S Institutional support: RVO:67985823 Keywords : cortex * neural decoding * senzory processing Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016

  12. Atmospheric deceleration and light curves of Draconid meteors and implications for the structure of cometary dust

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jiří; Spurný, Pavel; Koten, Pavel

    2007-01-01

    Roč. 473, č. 2 (2007), s. 661-672 ISSN 0004-6361 R&D Projects: GA ČR GA205/05/0543; GA AV ČR KJB300030502 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor * meteor oid * comet Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Vishwesha Guttal. Articles written in Resonance – Journal of Science Education. Volume 19 Issue ... Details Fulltext PDF. Volume 20 Issue 3 March 2015 pp 254-259 Classroom. Discovering Facts: Finding the Longest Day with School Children · Vishwesha Guttal.

  14. PTPRD (protein tyrosine phosphatase receptor type delta) is associated with restless legs syndrome

    Czech Academy of Sciences Publication Activity Database

    Schormair, B.; Kemlink, D.; Roeske, D.; Eckstein, G.; Xiong, L.; Lichtner, P.; Ripke, S.; Trenkwalder, C.; Zimprich, A.; Stiasny-Kolster, K.; Oertel, W.; Bachmann, C. G.; Paulus, W.; Högl, B.; Frauscher, B.; Gschliesser, V.; Poewe, W.; Peglau, I.; Vodička, Pavel; Vávrová, J.; Šonka, K.; Nevšímalová, S.; Montplaisir, J.; Turecki, G.; Rouleau, G.; Gieger, Ch.; Illig, T.; Wichmann, H.E.; Holsboer, F.; Müller-Myhsok, B.; Meitinger, T.; Winkelmann, J.

    2008-01-01

    Roč. 40, č. 8 (2008), s. 946-948 ISSN 1061-4036 R&D Projects: GA MZd NR8563 Institutional research plan: CEZ:AV0Z50390703 Keywords : PTPRD * syndrom restless legs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008

  15. Fulltext PDF

    Indian Academy of Sciences (India)

    Chromosomal evolution and phylogenetic analyses in Tayassu pecari and Pecari tajacu (Tayassuidae): tales from ... Drosophila simulans Lethal hybrid rescue mutation (Lhr) res- cues inviable hybrids by restoring X ... Construction of genetic linkage map of the medicinal and orna- mental plant Catharanthus roseus. 259.

  16. Production of secreted guar alpha-galactosidase by Lactococcus lactis

    NARCIS (Netherlands)

    Leenhouts, KJ; Bolhuis, A; Ledeboer, A; Venema, G; Kok, J

    1995-01-01

    A plant alpha-galactosidase gene was inserted in the expression vector pGKV259. The resulting plasmid pGAL2 consisted of the replication functions of the broad-host-range lactococcal plasmid pWVO1, the lactococcal promoter P59, and the DNA sequences encoding the alpha-amylase signal sequence from

  17. Search for supersymmetry at √s = 13 TeV in final states with jets and two same-sign leptons or three leptons with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2016-01-01

    Roč. 76, č. 5 (2016), s. 1-38, č. článku 259. ISSN 1434-6044 Institutional support: RVO:68378271 Keywords : ATLAS * supersymmetry * CERN LHC Coll * final states * background * data analysis method * experimental results Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 5.331, year: 2016

  18. T Plant secondary containment and leak detection upgrades

    International Nuclear Information System (INIS)

    Carlson, T.A.

    1995-01-01

    The W-259 project will provide upgrades to the 2706-T/TA Facility to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. The project provides decontamination activities supporting the environmental restoration mission and waste management operations on the Hanford Site

  19. Philipp Weselsky - profesor chemie vídeňské techniky z Českomoravské vysočiny

    Czech Academy of Sciences Publication Activity Database

    Jindra, Jiří

    2010-01-01

    Roč. 43, č. 4 (2010), s. 255-259 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Vienna Technical university 1854-1884 * tuition of analytical chemistry * Philipp Weselsky Subject RIV: AB - History

  20. The relationship between generic and diabetes specific psychological factors and glycaemic control in adults with type 1 diabetes

    DEFF Research Database (Denmark)

    Shaban, C.; Fosbury, J. A.; Cavan, D. A.

    2009-01-01

    259 adults with type 1 diabetes completed measure of anxiety, depression and diabetes specific distress, HbA1c from medical records. Anxiety not depression predicted HbA1c, this association was mediated by illness specific cognitions. Targeting illness specific cognitions may be more productive...... than treatment of general dysphoria in type 1 diabetes....