The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md
International Nuclear Information System (INIS)
Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.
1986-01-01
We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)
International Nuclear Information System (INIS)
Hulet, E.K.; Wild, J.F.; Lougheed, R.W.; Baisden, P.A.; Landrum, J.H.; Dougan, R.J.; Mustafa, M.; Ghiorso, A.; Nitschke, J.M.
1979-01-01
The mass and kinetic energy distributions of fission fragments from the spontaneous fission of th newly discovered nuclide 259 Md were obtained. 259 Md was identified as the E. C. daughter of 259 No, and was found to decay entirely (> 95%) by spontaneous fission with a 95-min half-life. From the kinetic energies measured for 397 pairs of coincident fragments, a mass distribution was derived that is symmetric with sigma = 13 amu. 259 Md, together with 258 Fm and 259 Fm, form a select group of three nuclides whose mass division in spontaneous fission is highly symmetric. Unlike the total-kinetic-energy (TKE) distributions of 258 Fm and 259 Fm, which peak at approx. = to 240 MeV, this distribution for 259 Md is broad and is 50 MeV lower in energy. Analysis of the mass and energy distributions shows that events near mass symmetry also exhibit a broad TKE distribution, with one-third of the symmetric events having TKEs less than 200 MeV. The associated of low TKEs with symmetric mass division in the fission of very heavy actinides is anomalous and inconsistent with theories based upon the emergence of fragment shells near the scission point. Either three-body fragmentation or peculiar fragment shapes are assumed as the cause for the large consumption of Coulomb energy observed for a significant fraction of symmetric fissions in 259 Md. 6 figures
30 CFR 259.001 - Purpose and scope.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Purpose and scope. 259.001 Section 259.001 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE MINERAL LEASING: DEFINITIONS § 259.001 Purpose and scope. The purpose of this part 259 is to define various terms appearing in...
16 CFR 259.2 - Advertising disclosures.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Advertising disclosures. 259.2 Section 259.2... ADVERTISING FOR NEW AUTOMOBILES § 259.2 Advertising disclosures. (a) No manufacturer or dealer shall make any express or implied representation in advertising concerning the fuel economy of any new automobile 1...
49 CFR 234.259 - Warning time.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Warning time. 234.259 Section 234.259..., Inspection, and Testing Inspections and Tests § 234.259 Warning time. Each crossing warning system shall be tested for the prescribed warning time at least once every 12 months and when the warning system is...
14 CFR 259.5 - Customer service plan.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Customer service plan. 259.5 Section 259.5... REGULATIONS ENHANCED PROTECTIONS FOR AIRLINE PASSENGERS § 259.5 Customer service plan. (a) Adoption of Plan. Each covered carrier shall adopt a Customer Service Plan applicable to its scheduled flights and shall...
7 CFR 1924.259 - Handling dwelling construction complaints.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Handling dwelling construction complaints. 1924.259 Section 1924.259 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING... Construction Defects § 1924.259 Handling dwelling construction complaints. This section describes the procedure...
24 CFR 207.259 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 207.259 Section... Contract of Insurance § 207.259 Insurance benefits. (a) Method of payment. Upon either an assignment of the... of mortgage. If the mortgage is assigned to the Commissioner, the insurance benefits shall be paid in...
17 CFR 259.0-1 - Availability of forms.
2010-04-01
... may inspect the forms at this address and at the Commission's regional and district offices. (See... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 259.0-1 Section 259.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS...
2010-04-01
... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums-in General § 203.259a Scope... Insurance Premiums—Periodic Payment ...
2010-01-01
... economy of the particular new automobile on which the label is affixed, as determined in accordance with... for the class of new automobiles. The estimated city and highway fuel economy values of the class of... FOR NEW AUTOMOBILES § 259.1 Definitions. For the purposes of this part, the following definitions...
7 CFR 2.59 - Deputy Under Secretaries for Natural Resources and Environment.
2010-01-01
... Environment. 2.59 Section 2.59 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Natural Resources and Environment § 2.59 Deputy Under Secretaries for Natural Resources and Environment. Pursuant to § 2.20(a), subject to reservations in § 2.20(b), and subject to...
50 CFR 216.259 - Modifications to Letters of Authorization.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.259 Modifications to Letters of Authorization. (a) Except as provided in...
24 CFR 213.259a - Premiums-mortgages insured pursuant to section 238(c) of the Act.
2010-04-01
.... All of the provisions of §§ 213.253 through 213.259 governing mortgage insurance premiums shall apply... mortgage insurance premiums due on such mortgages in accordance with §§ 213.253 through 213.259 shall be... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...
14 CFR 259.4 - Contingency plan for lengthy tarmac delays.
2010-01-01
... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ENHANCED PROTECTIONS FOR AIRLINE PASSENGERS § 259.4 Contingency..., assurance that the air carrier will provide adequate food and potable water no later than two hours after... flights covered in paragraph (b)(2) of this section, and for the trigger point for food and water covered...
17 CFR 259.5s - Form U5S, for annual reports filed under section 5(c) of the Act.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form U5S, for annual reports filed under section 5(c) of the Act. 259.5s Section 259.5s Commodity and Securities Exchanges SECURITIES... 1935 Forms for Registration and Annual Supplements § 259.5s Form U5S, for annual reports filed under...
28 CFR 25.9 - Retention and destruction of records in the system.
2010-07-01
... INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.9 Retention and destruction of... receives communication of the determination that the transfer may proceed. All other information, except...
Cleanup Verification Package for the 600-259 Waste Site
Energy Technology Data Exchange (ETDEWEB)
J. M. Capron
2006-02-09
This cleanup verification package documents completion of remedial action for the 600-259 waste site. The site was the former site of the Special Waste Form Lysimeter, consisting of commercial reactor isotope waste forms in contact with soils within engineered caissons, and was used by Pacific Northwest National Laboratory to collect data regarding leaching behavior for target analytes. A Grout Waste Test Facility also operated at the site, designed to test leaching rates of grout-solidified low-level radioactive waste.
Cleanup Verification Package for the 600-259 Waste Site
International Nuclear Information System (INIS)
Capron, J.M.
2006-01-01
This cleanup verification package documents completion of remedial action for the 600-259 waste site. The site was the former site of the Special Waste Form Lysimeter, consisting of commercial reactor isotope waste forms in contact with soils within engineered caissons, and was used by Pacific Northwest National Laboratory to collect data regarding leaching behavior for target analytes. A Grout Waste Test Facility also operated at the site, designed to test leaching rates of grout-solidified low-level radioactive waste
20 CFR 1002.259 - How does USERRA protect an employee's pension benefits?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does USERRA protect an employee's pension... REEMPLOYMENT RIGHTS ACT OF 1994 Reemployment Rights and Benefits Pension Plan Benefits § 1002.259 How does USERRA protect an employee's pension benefits? On reemployment, the employee is treated as not having a...
DEFF Research Database (Denmark)
Peters, Günther H.j.; Iversen, L.F.; Andersen, H.S.
2004-01-01
To study the flexibility of the substrate-binding site and in particular of Gln262, we have performed adiabatic conformational search and molecular dynamics simulations on the crystal structure of the catalytic domain of wild-type protein-tyrosine phosphatase (PTP) 1B, a mutant PTP1B(R47V),(D48N...... and second step of the phosphate hydrolysis. Analyses of the trajectories revealed that in the cysteine-phosphor complex of PTP1B, Gln262 oscillates freely between the bound phosphate group and Gly259 frequently forming, as observed in the crystal structure, a hydrogen bond with the backbone oxygen of Gly259...... around Gln262 and the active site Cys215 reveals that the probability of finding a water molecule correctly positioned for catalysis is much larger in PTP1B than in PTP1B(R47V),(D48N),(M258C),(G259Q) and PTPalpha, in accordance with experiments....
Zhuang, Ziheng; Li, Min; Liu, Hui; Luo, Libo; Gu, Weidong; Wu, Qiuli; Wang, Dayong
2016-08-01
Caenorhabditis elegans is an important non-mammalian alternative assay model for toxicological study. Previous study has indicated that exposure to multi-walled carbon nanotubes (MWCNTs) dysregulated the transcriptional expression of mir-259. In this study, we examined the molecular basis for mir-259 in regulating MWCNTs toxicity in nematodes. Mutation of mir-259 induced a susceptible property to MWCNTs toxicity, and MWCNTs exposure induced a significant increase in mir-259::GFP in pharyngeal/intestinal valve and reproductive tract, implying that mir-259 might mediate a protection mechanisms for nematodes against MWCNTs toxicity. RSKS-1, a putative ribosomal protein S6 kinase, acted as the target for mir-259 in regulating MWCNTs toxicity, and mutation of rsks-1 suppressed the susceptible property of mir-259 mutant to MWCNTs toxicity. Moreover, mir-259 functioned in pharynx-intestinal valve and RSKS-1 functioned in pharynx to regulate MWCNTs toxicity. Furthermore, RSKS-1 regulated MWCNTs toxicity by suppressing the function of AAK-2-DAF-16 signaling cascade. Our results will strengthen our understanding the microRNAs mediated protection mechanisms for animals against the toxicity from certain nanomaterials.
DEFF Research Database (Denmark)
Sørensen, Jens Benn; Badsberg, Jens Henrik; Olsen, Jens
1989-01-01
The prognostic factors for survival in advanced adenocarcinoma of the lung were investigated in a consecutive series of 259 patients treated with chemotherapy. Twenty-eight pretreatment variables were investigated by use of Cox's multivariate regression model, including histological subtypes and ...
24 CFR 207.259a - Waiver of title objection; mortgages formerly Commissioner-held.
2010-04-01
... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of Mortgagee Under the Contract of Insurance § 207.259a Waiver of... any lien or other adverse interest that was senior to the mortgage on the date of the original sale of...
17 CFR 259.604 - Form TH-Notification of reliance on temporary hardship exemption.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... OF 1935 Forms for Electronic Filing § 259.604 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by any electronic filer who submits to the Commission, pursuant to a...
Tulini, Fabrício Luiz; Winkelströter, Lizziane Kretli; De Martinis, Elaine C P
2013-08-01
This study aimed to identify a bacteriocinogenic Lactobacillus isolate (FT259) obtained from Brazilian semi-hard Minas type cheese and to evaluate its probiotic and antimicrobial potentials. The strain was identified by biochemical tests (at genus level), and by 16S rDNA sequencing combined with recA gene amplification (for species). To determine the inhibitory spectrum towards food borne pathogens and lactic acid bacteria, the spot-on-the-lawn assay was carried out. Moreover, the proteinaceous nature of the antimicrobial compound produced was evaluated by susceptibility to degradation by proteolytic enzymes. The isolated strain was tested for survival in acidified culture media (pH 2.0, 2.5 and 3.5), in vitro tolerance to bile salts and viability under gastric conditions. Adhesion of Lactobacillus paraplantarum FT259 to Caco-2 cells was evaluated by surface plate count on De Man, Rogosa, and Sharpe (MRS) agar and also by FISH method (fluorescent in situ hybridization) with the aid of Eub338 probe for fluorescence microscopy analysis. The isolate was identified as L. paraplantarum FT259 and it produced bacteriocins that inhibited the growth of Listeria monocytogenes, Listeria innocua and several lactic acid bacteria. It was also observed that L. paraplantarum FT259 tolerated exposure to pH 3.5, and bile salts 0.3% for up to 180 min. In experiments with simulated gastric juice, viable cells of L. paraplantarum FT259 decreased from 8.6 log CFU/mL to 3.5 log CFU/mL after 180 min. For the same strain, in studies with Caco-2 cells, 74% of adhesion was observed through plate count and FISH assays. It was also demonstrated isolated FT259 was susceptible to the majority the antibiotics tested. Overall, the results indicated L. paraplantarum FT259 is a potential probiotic and the production of bacteriocin may be an interesting feature for food applications. Copyright © 2013 Elsevier Ltd. All rights reserved.
2010-04-01
... of security issues exempt under section 6(b) of the Act. 259.206 Section 259.206 Commodity and... security issues exempt under section 6(b) of the Act. This form shall be filed pursuant to section 6(b) of the Act as the certificate of notification of the issue, sale, renewal, or guaranty of securities...
The Ly Alpha Reference Sample. I. Survey Outline and First Results for Markarian 259
Czech Academy of Sciences Publication Activity Database
Ostlin, G.; Hayes, M.; Duval, F.; Sandberg, A.; Rivera-Thorsen, T.; Marquart, T.; Orlitová, Ivana; Adamo, A.; Melinder, J.; Guaita, L.; Atek, H.; Cannon, J.M.; Gruyters, P.; Herenz, E.Ch.; Kunth, D.; Laursen, P.; Más-Hesse, J. M.; Micheva, G.; Oti-Floranes, H.; Pardy, S.; Roth, M.; Schaerer, D.; Verhamme, A.
2014-01-01
Roč. 797, č. 1 (2014), 11/1-11/23 ISSN 0004-637X R&D Projects: GA ČR(CZ) GP14-20666P Institutional support: RVO:67985815 Keywords : cosmology: observations * galaxies: evolution * galaxies: individual: Mrk 259 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.993, year: 2014
Chemical properties of mendelevium
International Nuclear Information System (INIS)
Hulet, E.K.
1980-01-01
The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V
Chemical properties of mendelevium
International Nuclear Information System (INIS)
Hulet, E.K.
1980-11-01
Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+
Non-LTE analysis of extremely helium-rich stars. The hot sdO stars LSE 153, 259 and 263
Husfeld, D.; Butler, K.; Heber, U.; Drilling, J. S.
1989-01-01
Results of a non-LTE fine analysis based mainly on high-resolution CASPEC spectra for three extremely helium-rich sdO stars are discussed in order to explain hydrogen deficiency in single stars. High temperature (Teff = 70,000 to 75,000 K) and a position in the log Teff - log g diagram were found close to the Eddington limit. Various abundance estimates are derived for hydrogen (upper limits only), carbon, nitrogen, and magnesium. Hydrogen is reduced to less than 10 percent by number in LSE 153 and LSE 263, and to less than 5 percent in LSE 259. The hydrogen deficiency is accompanied by nitrogen- and carbon-enrichment in LSE 153 and LSE 259 only. In LSE 263, carbon is depleted by about 1 dex. Stellar masses obtained by assuming that a core mass-luminosity relation holds for these stars, were found to be in the range 0.6-0.9 solar mass, yielding luminosities log L/L:solar = 3.7-4.5. Two of the program stars (LSE 153 and 259) appear to be possible successors of the R CrB and helium B stars, whereas the third star (LSE 263) displays a much lower carbon content in its photosphere making it an exceptional case among the known hydrogen deficient stars.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Time sharing between NOAA meteorological... SATELLITE COMMUNICATIONS Technical Standards § 25.259 Time sharing between NOAA meteorological satellite... Atmospheric Administration (“NOAA”) satellite systems. When calculating the protection areas for a NOAA...
Fragrance material review on methyl-2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone.
Scognamiglio, J; Letizia, C S; Api, A M
2013-12-01
A toxicologic and dermatologic review of methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone when used as a fragrance ingredient is presented. Methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all available toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone were evaluated then summarized and includes physical properties, acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (Belsito, D., Bickers, D., Bruze, M., Calow, P., Dagli, M., Fryer, A.D., Greim, H., Miyachi, Y., Saurat, J.H., Sipes, I.G., 2013. A Toxicologic and Dermatologic Assessment of Alkyl Cyclic Ketones When Used as Fragrance Ingredients (submitted for publication)) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Koffman, Jennifer Skaarup; Christensen, Eva Arnspang; Marlar, Saw
2015-01-01
Aquaporin-5 (AQP5) facilitates passive water transport in glandular epithelia in response to secretory stimuli via intracellular pathways involving calcium release, cAMP and protein kinase A (PKA). In epithelial plasma membranes, AQP5 may be acutely regulated to facilitate water transport...... in the plasma membrane diffusion coefficient of AQP5. We aimed to test the short-term regulatory effects of the above pathways, by measuring lateral diffusion of AQP5 and an AQP5 phospho-mutant, T259A, using k-space Image Correlation Spectroscopy of quantum dot- and EGFP-labeled AQP5. Elevated cAMP and PKA...... inhibition significantly decreased lateral diffusion of AQP5, whereas T259A mutation showed opposing effects; slowing diffusion without stimulation and increasing diffusion to basal levels after cAMP elevation. Thus, lateral diffusion of AQP5 is significantly regulated by cAMP, PKA, and T259 phosphorylation...
Lejeune, Claude; Simmat-Durand, Laurence; Gourarier, Laurent; Aubisson, Sandrine
2006-05-20
Specialized prenatal care and substitution programs improve the perinatal prognoses of pregnant drug-abusers and their infants. Although methadone is well documented, little is known about high-dose buprenorphine (HDB). This prospective, multicenter (n = 35) observational study included 259 women on maintenance during pregnancy: 39% on methadone and 61% on HDB. Major findings were: 46% of them received good prenatal care; 62% had peridural analgesia; 12.3% delivered prematurely (hydrochloride. No baby died. Newborns were discharged with their mothers (96%) or placed in foster care (4%). Comparing methadone with HDB, respectively, mean age at the maximum Lipsitz score was 81 h versus 66 h (P = 0.066). The perinatal medical and social prognoses for these 259 drug addicts and their infants appeared to be improved by specialized prenatal care and was similar for methadone or BHD substitution during pregnancy.
International Nuclear Information System (INIS)
Hoffman, D.C.
1976-01-01
Recent measurements have shown that 259 Fm gives the highest total kinetic energy release and the most symmetric mass division so far observed for spontaneous fission. These results continue the trends observed previously in the fermium isotopes toward higher total kinetic energies and more symmetric mass division with increasing mass of the fermium isotopes. The transition from asymmetric mass division ( 254 Fm) to highly favored symmetric mass division ( 259 Fm) now appears to have been completed. These features are consistent with the simple postulate that the more neutron-rich fermium isotopes show an increase in the yield of symmetric fragments and in the total kinetic energy because symmetric mass division of fermium (Z = 100) nuclei results in two fragments which have the magic proton number of 50 and are close to the magic neutron number of 82. The proximity of the fragments to the doubly magic configuration seems to have a profound effect on the mass division and total kinetic energy release in fission
International Nuclear Information System (INIS)
Hookfin, J.D.
1995-01-01
The T Plant facilities in the 200-West Area of the Hanford site were constructed in the early 1940s to produce nuclear materials in support of national defense activities. T Plant includes the 271-T facility, the 221-T facility, and several support facilities (eg, 2706-T), utilities, and tanks/piping systems. T Plant has been recommended as the primary interim decontamination facility for the Hanford site. Project W-259 will provide capital upgrades to the T Plant facilities to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. This document provides an advanced conceptual design concept that complies with functional requirements for the T Plant Secondary Containment and Leak Detection upgrades
The Reactivations of Main-Belt Comets 238P/READ, 259P/Garradd, and 288P/(300163) 2006 VW139
Hsieh, Henry H.; Ishiguro, Masateru; Kim, Yoonyoung; Knight, Matthew M.; Lin, Zhong-Yi; Micheli, Marco; Moskovitz, Nicholas; Sheppard, Scott S.; Thirouin, Audrey; Trujillo, Chadwick
2017-10-01
We report on the confirmation and monitoring of recurrent activity for main-belt comets (MBCs) 238P/Read and 288P/(300163) 2006 VW139 in 2016 (cf. Agarwal et al. 2016, CBET 4306; Hsieh et al. 2016, CBET 4307), as well as the identification of activity for 288P in Sloan Digital Sky Survey images from November 2000. We will also report on the confirmation of recurrent activity in 2017 (Hsieh et al. 2017, CBET 4388) and the progress of the ongoing monitoring campaign (April 2017 through December 2017) that we are conducting for MBC 259P/Garradd. With these observations, 238P and 288P have now each been observed to be active on three separate orbit passages with intervening periods of inactivity and 259P has been observed to be active on two separate orbit passages, firmly establishing the cometary (i.e., sublimation-driven) nature of their activity. We are currently conducting a multi-facility observing campaign to monitor the photometric and morphological evolution of these objects, using the Canada-France-Hawaii Telescope, the Gemini North and South telescopes (under a Gemini Large and Long Program), the Magellan telescopes, the Discovery Channel Telescope, and the Lulin One-meter Telescope. During their most recent perihelion encounters, 238P was observed to be active as early as 2016 July 8 at a true anomaly of 329 degrees, 288P was observed to be active as early as 2016 June 8 at a true anomaly of 318 degrees, and 259P was observed to be active as early at 2017 April 26 at a true anomaly of 315 degrees. We also report on the results of numerical modeling analyses of the morphological evolution of all three objects aimed at assessing both the properties of their current active episodes and changes in activity strength from one epoch to the next to help constrain the active lifetimes of MBCs, a key parameter for inferring the total number of MBCs in the asteroid belt from survey results. This work was supported by the NASA Solar System Observations program under
Chemistry of the heaviest elements--one atom at a time
International Nuclear Information System (INIS)
Hoffman, Darleane C.; Lee, Diana M.
2000-01-01
In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising
40 CFR 264.259 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.
2010-07-01
... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Waste Piles § 264.259 Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27. (a) Hazardous Wastes FO20, FO21, FO22, FO23, FO26... requirements are necessary for piles managing hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27 in order...
DEFF Research Database (Denmark)
Jayanthi, Lankupalle D; Annamalai, Balasubramaniam; Samuvel, Devadoss J
2006-01-01
. Most interestingly, the plasma membrane insertion of the WT-hNET and hNET double mutant were not affected by beta-PMA. Although the WT-hNET showed increased endocytosis and redistribution from caveolin-rich plasma membrane domains following beta-PMA treatment, the hNET double mutant was completely......-regulation. These results suggest that Thr-258 and Ser-259 serve as a PKC-specific phospho-acceptor site and that phosphorylation of this motif is linked to PKC-induced NET internalization....
The role of Glu259 in Escherichia coli elongation factor Tu in ternary complex formation
DEFF Research Database (Denmark)
Nautrup Pedersen, Gitte; Rattenborg, Thomas; Knudsen, Charlotte Rohde
1998-01-01
Determination of the crystal structure of the ternary complex formed between elongation factor Tu:GTP and aminoacylated tRNA revealed three regions of interaction between elongation factor Tu and tRNA. The structure indicates that the conserved glutamic acid at position 271 in Thermus aquaticus EF-Tu...... could be involved in the binding of the 3' CCA-Phe end of the aminoacylated tRNA. Therefore, the corresponding residue, Glu259, of Escherichia coli EF-Tu was mutated into alanine, aspartic acid, glutamine and tyrosine, in order to substantiate the crystallographic structural evidence and to obtain...... of interaction with tRNA, while mutation to tyrosine abolished completely the interaction with tRNA. Finally, mutation to glutamine resulted in an elongation factor Tu variant behaving like the wild type. In conclusion, the environment around the site binding the CCA-Phe end of the tRNA is very restricted...
Studies of neutron-deficient mendelevium isotopes at SHIP
Energy Technology Data Exchange (ETDEWEB)
Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)
2010-01-15
The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Mesia, Kahunu; Cimanga, Kanyanga; Tona, Lutete; Mampunza, Ma Miezi; Ntamabyaliro, Nsengi; Muanda, Tsobo; Muyembe, Tamfum; Totté, Jozef; Mets, Tony; Pieters, Luc; Vlietinck, Arnold
2011-01-01
The aim of this study was to evaluate the short-term safety and tolerability of an antimalarial herbal medicinal product (PR 259 CT1) consisting of a quantified 80 % ethanol extract from the stem bark of Nauclea pobeguinii when given orally to healthy adult male volunteers. The amount of the major alkaloid strictosamide in the extract was determined by a validated HPLC method and was shown to be 5.6 %. The herbal preparation was formulated in a gelatine capsule form containing 500 mg of PCR 259 CT1. A sample of 15 healthy male volunteers, selected using the Lot Quality Assurance of Sampling (LQAS) method, was eligible for inclusion after fulfillment of the inclusion criteria and clinical examination by a physician. The volunteers were treated in an outpatient clinic with a drug regimen of two 500 mg capsules three times daily (each eight hours) for seven days, during meals. Safety and tolerability were monitored clinically, haematologically, biochemically and by electrocardiographic (ECG) examination at days 0, 1, 3, 7 and 14. Adverse effects were recorded by self-reporting of the participants or by detection of abnormalities in clinical examinations by a physician. The oral administration of PR 259 CT1 at high doses of 2 × 500 mg/capsule/day for 7 days was found to induce no significant changes in the concentration levels of all investigated haematological, biochemical, electrocardiogram and vital sign parameters and physical characteristics after 14 days of treatment compared to those seen in the baseline data. The concentration levels of all evaluated parameters were within the normal limits as reported in the literature. All adverse events noted were mild and self-resolving including increase of appetite (33 %), headache (20 %) and nausea (20 %). Other minor side effects were insomnia, somnolence and asthenia (7 %). Thus, PR 259 CT1 presented a significant safety and tolerability in healthy volunteers to allow its further development by starting a phase II
The Lyα reference sample. I. Survey outline and first results for Markarian 259
International Nuclear Information System (INIS)
Östlin, Göran; Hayes, Matthew; Duval, Florent; Sandberg, Andreas; Rivera-Thorsen, Thøger; Marquart, Thomas; Adamo, Angela; Melinder, Jens; Guaita, Lucia; Micheva, Genoveva; Orlitová, Ivana; Atek, Hakim; Cannon, John M.; Pardy, Stephen A.; Gruyters, Pieter; Herenz, Edmund Christian; Kunth, Daniel; Laursen, Peter; Mas-Hesse, J. Miguel; Otí-Floranes, Héctor
2014-01-01
The Lyα Reference Sample (LARS) is a substantial program with the Hubble Space Telescope (HST) that provides a sample of local universe laboratory galaxies in which to study the detailed astrophysics of the visibility and strength of the Lyαline of neutral hydrogen. Lyα is the dominant spectral line in use for characterizing high-redshift (z) galaxies. This paper presents an overview of the survey, its selection function, and HST imaging observations. The sample was selected from the combined GALEX+Sloan Digital Sky Survey catalog at z = 0.028-0.19, in order to allow Lyα to be captured with combinations of long-pass filters in the Solar Blind Channel (SBC) of the Advanced Camera for Surveys (ACS) onboard HST. In addition, LARS utilizes Hα and Hβ narrowband and u, b, i broadband imaging with ACS and the Wide Field Camera 3 (WFC3). In order to study galaxies in which large numbers of Lyα photons are produced (whether or not they escape), we demanded an Hα equivalent width W(Hα) ≥100 Å. The final sample of 14 galaxies covers far-UV (FUV, λ ∼ 1500 Å) luminosities that overlap with those of high-z Lyα emitters (LAEs) and Lyman break galaxies (LBGs), making LARS a valid comparison sample. We present the reduction steps used to obtain the Lyα images, including our LARS eXtraction software (LaXs), which utilizes pixel-by-pixel spectral synthesis fitting of the energy distribution to determine and subtract the continuum at Lyα. We demonstrate that the use of SBC long-pass-filter combinations increase the signal-to-noise ratio by an order of magnitude compared to the nominal Lyα filter available in SBC. To exemplify the science potential of LARS, we also present some first results for a single galaxy, Mrk 259 (LARS #1). This irregular galaxy shows bright and extended (indicative of resonance scattering) but strongly asymmetric Lyα emission. Spectroscopy from the Cosmic Origins Spectrograph on board HST centered on the brightest UV knot shows a moderate
The Lyα reference sample. I. Survey outline and first results for Markarian 259
Energy Technology Data Exchange (ETDEWEB)
Östlin, Göran; Hayes, Matthew; Duval, Florent; Sandberg, Andreas; Rivera-Thorsen, Thøger; Marquart, Thomas; Adamo, Angela; Melinder, Jens; Guaita, Lucia; Micheva, Genoveva [Department of Astronomy, Stockholm University, Oscar Klein Centre, AlbaNova, Stockholm SE-106 91 (Sweden); Orlitová, Ivana [Observatoire de Genève, Université de Genève, Chemin des Maillettes 51, 1290 Versoix (Switzerland); Atek, Hakim [Laboratoire d' Astrophysique, Ecole Polytechnique Fédérale de Lausanne, Observatoire de Sauverny, CH-1290 Versoix (Switzerland); Cannon, John M.; Pardy, Stephen A. [Department of Physics and Astronomy, Macalester College, 1600 Grand Avenue, Saint Paul, MN 55105 (United States); Gruyters, Pieter [Department of Physics and Astronomy, Division of Astronomy and Space Physics, Uppsala University, Box 516, 75120 Uppsala (Sweden); Herenz, Edmund Christian [Leibniz-Institute for Astrophysics Potsdam (AIP), innoFSPEC, An der Sternwarte 16, D-14482 Potsdam (Germany); Kunth, Daniel [Institut d' Astrophysique Paris, 98bis Bd Arago, F-75014 Paris (France); Laursen, Peter [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, DK-2100 Copenhagen (Denmark); Mas-Hesse, J. Miguel [Centro de Astrobiologa (CSIC-INTA), Departamento de Astrofsica, POB 78, E-28691, Villanueva de la Cañada (Spain); Otí-Floranes, Héctor [Instituto de Astronoma, Universidad Nacional Autnoma de Mxico, Apdo. Postal 106, Ensenada B. C. 22800 (Mexico); and others
2014-12-10
The Lyα Reference Sample (LARS) is a substantial program with the Hubble Space Telescope (HST) that provides a sample of local universe laboratory galaxies in which to study the detailed astrophysics of the visibility and strength of the Lyαline of neutral hydrogen. Lyα is the dominant spectral line in use for characterizing high-redshift (z) galaxies. This paper presents an overview of the survey, its selection function, and HST imaging observations. The sample was selected from the combined GALEX+Sloan Digital Sky Survey catalog at z = 0.028-0.19, in order to allow Lyα to be captured with combinations of long-pass filters in the Solar Blind Channel (SBC) of the Advanced Camera for Surveys (ACS) onboard HST. In addition, LARS utilizes Hα and Hβ narrowband and u, b, i broadband imaging with ACS and the Wide Field Camera 3 (WFC3). In order to study galaxies in which large numbers of Lyα photons are produced (whether or not they escape), we demanded an Hα equivalent width W(Hα) ≥100 Å. The final sample of 14 galaxies covers far-UV (FUV, λ ∼ 1500 Å) luminosities that overlap with those of high-z Lyα emitters (LAEs) and Lyman break galaxies (LBGs), making LARS a valid comparison sample. We present the reduction steps used to obtain the Lyα images, including our LARS eXtraction software (LaXs), which utilizes pixel-by-pixel spectral synthesis fitting of the energy distribution to determine and subtract the continuum at Lyα. We demonstrate that the use of SBC long-pass-filter combinations increase the signal-to-noise ratio by an order of magnitude compared to the nominal Lyα filter available in SBC. To exemplify the science potential of LARS, we also present some first results for a single galaxy, Mrk 259 (LARS #1). This irregular galaxy shows bright and extended (indicative of resonance scattering) but strongly asymmetric Lyα emission. Spectroscopy from the Cosmic Origins Spectrograph on board HST centered on the brightest UV knot shows a moderate
International Nuclear Information System (INIS)
Tarvainen, A.-M.
2011-08-01
Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)
Directory of Open Access Journals (Sweden)
Luis Cisneros-Zevallos
2013-09-01
Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: http://www.mdpi.com/2077-0472/2/3/259. Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:
International Nuclear Information System (INIS)
Hubener, S.; Zvara, I.
1982-01-01
The adsorption of the heavy actinoids Cf, Es, Fm, and Md on polycrystalline titanium and molybdenum has been studied by thermochromatography in comparison with several well-known metallic elements, in trace amounts. The data lead us to suggest that Es, Fm, and Md are divalent in the metallic state and, moreover, that the position of their f energy levels relativg to the Fermi-energy is lower than in the cases of Cf and Yb. A correlation was found between the experimental enthalpies of adsorption of the heavy actinoids and their predicted enthalpies of sublimation
Ito, Ryousuke; Nakada, Chika; Hoshino, Tsutomu
2017-01-18
Correction for 'β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade' by Ryousuke Ito et al., Org. Biomol. Chem., 2017, 15, 177-188.
African Journals Online (AJOL)
Administrator
Peltier CA, Omes C, Ndimubanzi PC et al. Validation of 2006 WHO Prediction Scores for. True HIV Infection in Children less than 18 months with a positive serological HIV test. PLoS ONE I www.plosone.org April 2009; 4. (4): I e5312. 28. Mayaux MJ, Burgard M, Teglas JP,et al. Neonatal characteristics in rapidly progressive ...
50 CFR 259.38 - Miscellaneous.
2010-10-01
....38 Miscellaneous. (a) Wherever the Secretary prescribes time constraints herein for the submission of... actual date of submission. All required materials may be submitted to any Financial Assistance Division office of the National Marine Fisheries Service. (b) All CCF information received by the Secretary shall...
2010-01-01
... Director, Division of Facilities and Security, Mail Stop T7-D57, and sent either by mail to the U.S... Rockville Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the...
Publications | Page 259 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
South Africa has developed considerable expertise in mining and mining ... Exporters incur search costs in identifying a suitable agreement, each with its own ... The prevailing view is that Chinese companies operating in African countries do ...
Publications | Page 259 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Use this search tool to locate a specific publication for your field of research. ... from a local treatment plant is being used for supplemental irrigation of cereal crops, ... generation of water leaders" (NGWL) by the International Water Resources.
2010-07-01
... each other, as follows: (1) The Red Cross will use Form 3575, Change of Address Order, as a standard... disaster relief efforts, the Postal Service will establish a separate file of change of address forms... and complete the forms, it will distribute the forms to disaster victims who need them, and it will...
50 CFR 259.32 - Conditional fisheries.
2010-10-01
... extends to past, present, and future withdrawals in an amount representing up to 100 percent of the cost... causes (within 1 year after the delivery of vessel “Y”) to be permanently removed from all fishing, or... question at the time vessel “Z” was constructed (or, if constructed for a different fishery, the average...
Di Saverio, Salomone; Catena, Fausto; Santini, Donatella; Ansaloni, Luca; Fogacci, Tommaso; Mignani, Stefano; Leone, Antonio; Gazzotti, Filippo; Gagliardi, Stefano; De Cataldis, Angelo; Taffurelli, Mario
2008-06-01
The Van Nuys Prognostic Index (VNPI) is a simple score for predicting the risk of local recurrence (LR) in patients with Ductal Carcinoma In Situ (DCIS) conservatively treated. This score combines three independent predictors of Local Recurrence. The VNPI has recently been updated with the addition of age as a fourth parameter into the scoring system (University of Southern California/ VNPI). Our database consisted of 408 women with DCIS. Applying the USC/VNPI we reviewed retrospectively 259 patients who were treated with breast conserving surgery with or without radiotherapy (RT). Of these patients 63.5% had a low VNPI score, 32% intermediate and 4.5% a high score. In the low score group, the majority of the patients underwent Conservative Surgery (CS) without RT while in the intermediate group, almost half of the patients received RT. Eighty-three percent (83%) of the patients with high VNPI were treated with Conservative Surgery plus RT. Nodal assessment by Sentinel Lymph Node Biopsy was obtained in 32 patients since 2002. Twenty-one Local Recurrences were observed (8%) with a mean follow up of 130 months: sixteen were invasive. No statistically significant differences in Disease Free Survival were reached in all groups of VNPI score between patients treated with Conservative Surgery or Conservative Surgery plus RT. However it was noted that the higher the VNPI score, the lower was the risk of local recurrence in the group treated additionally with RT, even though it was not statistically significant. Further analysis included those patients treated with Conservative Surgery alone and followed up. Disease-free survival (DFS) at 10 years was 94% with low VNPI and 83% in both intermediate and high score (P USC/VNPI is still a simple and reliable scoring system for therapeutic management of DCIS. We did not find any statistically significant advantage in groups treated with the addition of RT. Obtaining wide surgical margins appears to be the strongest prognostic
Transuranium elements: Past, present, and future
International Nuclear Information System (INIS)
Seaborg, G.T.
1995-01-01
In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs
Dentovskaya, Svetlana V; Platonov, Mikhail E; Svetoch, Tat'yana E; Kopylov, Pavel Kh; Kombarova, Tat'yana I; Ivanov, Sergey A; Shaikhutdinova, Rima Z; Kolombet, Lyubov' V; Chauhan, Sadhana; Ablamunits, Vitaly G; Motin, Vladimir L; Uversky, Vladimir N; Anisimov, Andrey P
2016-01-01
It has been shown previously that several endemic Y. pestis isolates with limited virulence contained the I259 isoform of the outer membrane protease Pla, while the epidemic highly virulent strains possessed only the T259 Pla isoform. Our sequence analysis of the pla gene from 118 Y. pestis subsp. microtus strains revealed that the I259 isoform was present exclusively in the endemic strains providing a convictive evidence of more ancestral origin of this isoform. Analysis of the effects of the I259T polymorphism on the intrinsic disorder propensity of Pla revealed that the I259T mutation slightly increases the intrinsic disorder propensity of the C-terminal tail of Pla and makes this protein slightly more prone for disorder-based protein-protein interactions, suggesting that the T259 Pla could be functionally more active than the I259 Pla. This assumption was proven experimentally by assessing the coagulase and fibrinolytic activities of the two Pla isoforms in human plasma, as well as in a direct fluorometric assay with the Pla peptide substrate. The virulence testing of Pla-negative or expressing the I259 and T259 Pla isoforms Y. pestis subsp. microtus and subsp. pestis strains did not reveal any significant difference in LD50 values and dose-dependent survival assays between them by using a subcutaneous route of challenge of mice and guinea pigs or intradermal challenge of mice. However, a significant decrease in time-to-death was observed in animals infected with the epidemic T259 Pla-producing strains as compared to the parent Pla-negative variants. Survival curves of the endemic I259 Pla+ strains fit between them, but significant difference in mean time to death post infection between the Pla-strains and their I259 Pla+ variants could be seen only in the isogenic set of subsp. pestis strains. These findings suggest an essential role for the outer membrane protease Pla evolution in Y. pestis bubonic infection exacerbation that is necessary for intensification
Dynamics Determine Signaling in a Multicomponent System Associated with Rheumatoid Arthritis.
Lindgren, Cecilia; Tyagi, Mohit; Viljanen, Johan; Toms, Johannes; Ge, Changrong; Zhang, Naru; Holmdahl, Rikard; Kihlberg, Jan; Linusson, Anna
2018-05-24
Strategies that target multiple components are usually required for treatment of diseases originating from complex biological systems. The multicomponent system consisting of the DR4 major histocompatibility complex type II molecule, the glycopeptide CII259-273 from type II collagen, and a T-cell receptor is associated with development of rheumatoid arthritis (RA). We introduced non-native amino acids and amide bond isosteres into CII259-273 and investigated the effect on binding to DR4 and the subsequent T-cell response. Molecular dynamics simulations revealed that complexes between DR4 and derivatives of CII259-273 were highly dynamic. Signaling in the overall multicomponent system was found to depend on formation of an appropriate number of dynamic intramolecular hydrogen bonds between DR4 and CII259-273, together with the positioning of the galactose moiety of CII259-273 in the DR4 binding groove. Interestingly, the system tolerated modifications at several positions in CII259-273, indicating opportunities to use analogues to increase our understanding of how rheumatoid arthritis develops and for evaluation as vaccines to treat RA.
Lifescience Database Archive (English)
Full Text Available *fqstssrcfl*ndcrei*fnk r*nr*ilw*isrisr*--- ---**r*ryscssrl*ekcql*kppfkpngkisaanasqisdgasavllvsgrlvkklgl kprarivtctvvgsdpeymllgpipatik...aleksgltkdqidlyeineafasvvlgwkke lnidldkinpnggaiahghplgatgcilmtkmvnelersnkkyalqtmcig
40 CFR 180.259 - Propargite; tolerances for residues.
2010-07-01
..., meat 0.1 Hog, meat byproducts 0.1 Hop, dried cones 100.0 Horse, fat 0.1 Horse, meat 0.1 Horse, meat... Cattle, fat 0.1 Cattle, meat 0.1 Cattle, meat byproducts 0.1 Citrus, oil 30.0 Corn, field, forage 10.0..., forage 10.0 Corn, sweet, stover 10.0 Cotton, undelinted seed 0.1 Egg 0.1 Goat, fat 0.1 Goat, meat 0.1...
1935 15' Quad #259 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
Lifescience Database Archive (English)
Full Text Available skdfnyililnk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshqll vvqdtlxlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkks...nk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshqll vvqdtlxlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkksgiilfimnfx
24 CFR 960.259 - Family information and verification.
2010-04-01
... source of income, or any Federal, State or local agency, to furnish or release to the PHA or HUD such...) Other factors that affect the determination of adjusted income or income-based rent. ... scheduled reexamination or an interim reexamination of family income and composition in accordance with HUD...
30 CFR 206.259 - Determination of washing allowances.
2010-07-01
... market the production for the mutual benefit of the lessee and the lessor, then MMS shall require that... reported period, including operating and maintenance expenses, overhead, and either depreciation and a... other alternative without approval of the MMS. (A) To compute depreciation, the lessee may elect to use...
Gclust Server: 40687 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 40687 HSA_51460703 Cluster Sequences Related Sequences(259) 278 XP_292889.3 PREDICTED: similar to notochord...s(259) Sequence length 278 Representative annotation XP_292889.3 PREDICTED: similar to notochord
All projects related to | Page 259 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2011-10-20
Project. Different countries are at different stages of demographic change. Start Date: October 20, 2011. End Date: April 20, 2014. Topic: INTERNATIONAL FINANCE, INTERNATIONAL FINANCIAL MARKET, FINANCIAL POLICY, DEMOGRAPHY, DEMOGRAPHIC CHANGE, DEMOGRAPHIC TRANSITION. Region: Brazil ...
24 CFR 203.259 - Method of payment of MIP.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums-in General...
Distribution of iron, cobalt , zinc and selenium in macrofungi
Czech Academy of Sciences Publication Activity Database
Borovička, Jan; Řanda, Zdeněk
2007-01-01
Roč. 6, č. 4 (2007), s. 249-259 ISSN 1617-416X Institutional research plan: CEZ:AV0Z10480505 Keywords : ectomycorrhizal fungi * instrumental neutron activation analysis * terrestrial saprobes Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.259, year: 2007
Seasonal variations in carbon budget in water column off Princess Astrid coast, Antarctica
Digital Repository Service at National Institute of Oceanography (India)
Dhargalkar, V.K.; Matondkar, S.G.P.; Verlecar, X.N.
stream_size 8 stream_content_type text/plain stream_name DOD_Tech_Pub_1996_10_259.pdf.txt stream_source_info DOD_Tech_Pub_1996_10_259.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
International Nuclear Information System (INIS)
Dechery, Fabien
2012-01-01
In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 113; Issue 3. Volume 113, Issue 3. September 2004, pages 259-515. pp 259-267. Delineation of structures favourable to groundwater occurrence employing seismic refraction method — A case study from Tiruvuru, Krishna district, Andhra Pradesh · N Sundararajan ...
Tsuji, Takao; Yamaguchi, Kazuhiro; Kikuchi, Ryota; Itoh, Masayuki; Nakamura, Hiroyuki; Nagai, Atsushi; Aoshiba, Kazutetsu
2014-08-01
Body weight loss is a common manifestation in patients with chronic obstructive pulmonary disease (COPD), particularly those with severe emphysema. Adipose angiogenesis is a key mediator of adipogenesis and use of pro-angiogenic agents may serve as a therapeutic option for lean COPD patients. Since angiogenesis is stimulated by PGE2, we examined whether ONO-AE1-259, a selective E-prostanoid (EP) 2 receptor agonist, might promote adipose angiogenesis and adipogenesis in a murine model of elastase-induced pulmonary emphysema (EIE mice). Mice were intratracheally instilled with elastase or saline, followed after 4 weeks by intraperitoneal administration of ONO-AE1-259 for 4 weeks. The subcutaneous adipose tissue (SAT) weight decreased in the EIE mice, whereas in the EIE mice treated with ONO-AE1-259, the SAT weight was largely restored, which was associated with significant increases in SAT adipogenesis, angiogenesis, and VEGF protein production. In contrast, ONO-AE1-259 administration induced no alteration in the weight of the visceral adipose tissue. These results suggest that in EIE mice, ONO-AE1-259 stimulated adipose angiogenesis possibly via VEGF production, and thence, adipogenesis. Our data pave the way for the development of therapeutic interventions for weight loss in emphysema patients, e.g., use of pro-angiogenic agents targeting the adipose tissue vascular component. Copyright © 2014 Elsevier Inc. All rights reserved.
The Attitudes of Israeli Arab and Jewish High School Students towards Extrinsic and Intrinsic Values
Gross, Zehavit
2013-01-01
The aim of this research was to investigate the attitudes of Israeli Arab (n = 259) and Jewish (n = 259) high school students toward extrinsic and intrinsic values. A questionnaire, which consisted of eight value scales in two groups--extrinsic and intrinsic values--was administered. Participants were asked to state whether they agreed or…
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, Naoko [Univ. of Nebraska, Lincoln, NE (United States); Barnes, Austin [Univ. of Nebraska, Lincoln, NE (United States); Jensen, Travis [Univ. of Nebraska, Lincoln, NE (United States); Noel, Eric [Univ. of Nebraska, Lincoln, NE (United States); Andlay, Gunjan [Synaptic Research, Baltimore, MD (United States); Rosenberg, Julian N. [Johns Hopkins Univ., Baltimore, MD (United States); Betenbaugh, Michael J. [Johns Hopkins Univ., Baltimore, MD (United States); Guarnieri, Michael T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Oyler, George A. [Univ. of Nebraska, Lincoln, NE (United States); Johns Hopkins Univ., Baltimore, MD (United States); Synaptic Research, Baltimore, MD (United States)
2015-09-01
Chlorella species from the UTEX collection, classified by rDNA-based phylogenetic analysis, were screened based on biomass and lipid production in different scales and modes of culture. Lead candidate strains of C. sorokiniana UTEX 1230 and C. vulgaris UTEX 395 and 259 were compared between conditions of vigorous aeration with filtered atmospheric air and 3% CO2 shake-flask cultivation. We found that the biomass of UTEX 1230 produced 2 times higher at 652 mg L-1 dry weight under both ambient CO2 vigorous aeration and 3% CO2 conditions, while UTEX 395 and 259 under 3% CO2 increased to 3 times higher at 863 mg L-1 dry weight than ambient CO2 vigorous aeration. The triacylglycerol contents of UTEX 395 and 259 increased more than 30 times to 30% dry weight with 3% CO2, indicating that additional CO2 is essential for both biomass and lipid accumulation in UTEX 395 and 259.
People and things. CERN Courier Nov 1985, v. 25(9)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1985-11-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The European Committee for Future Accelerators (ECFA) meets in plenary session twice a year. At the meeting at CERN earlier this year, ECFA Chariman Jean Sacton described the trend towards even greater internationalization of partide physics research and how arrangement have been completed to allow the exchange of observers between meetings of Plenary ECFA and the US High Energy Physics Advisory Panel (HEPAP). After the success of the ESO (European Southern Observatory) CERN Symposium on Cosmology, Astronomy and Fundamental Physics, held at CERN in November 1983, the second Symposium is to be held at ESO, Garching bei Munchen, West Germany, from 17 to 21 March next year.
People and things. CERN Courier Nov 1985, v. 25(9)
International Nuclear Information System (INIS)
Anon.
1985-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The European Committee for Future Accelerators (ECFA) meets in plenary session twice a year. At the meeting at CERN earlier this year, ECFA Chariman Jean Sacton described the trend towards even greater internationalization of partide physics research and how arrangement have been completed to allow the exchange of observers between meetings of Plenary ECFA and the US High Energy Physics Advisory Panel (HEPAP). After the success of the ESO (European Southern Observatory) CERN Symposium on Cosmology, Astronomy and Fundamental Physics, held at CERN in November 1983, the second Symposium is to be held at ESO, Garching bei Munchen, West Germany, from 17 to 21 March next year
259 “Team Pair Solo” Cooperative Learning and Personality Type ...
African Journals Online (AJOL)
User
learning strategy and students' personality type on achievement and attitude to Chemistry. 175 SS2 ... There is increasing concern among practitioners and educational researchers about the .... Teachers' role in a cooperative learning classroom involves a careful design of meaningful ..... Classroom Management. Harry K.
Czech Academy of Sciences Publication Activity Database
Godunko, Roman J.; Sroka, Pavel; Soldán, Tomáš; Bojková, J.
2015-01-01
Roč. 73, č. 2 (2015), s. 259-280 ISSN 1863-7221 R&D Projects: GA ČR GA206/08/1389 Institutional support: RVO:60077344 Keywords : Calliarcyinae * systematics * phylogeny Subject RIV: EG - Zoology Impact factor: 1.655, year: 2015 http://www.senckenberg.de/files/content/forschung/publikationen/arthropodsystematics/asp_73_2/03_asp_73_2_godunko_259-279.pdf
Mutations in SOX17 are Associated with Congenital Anomalies of the Kidney and the Urinary Tract
Gimelli, Stefania; Caridi, Gianluca; Beri, Silvana; McCracken, Kyle; Bocciardi, Renata; Zordan, Paola; Dagnino, Monica; Fiorio, Patrizia; Murer, Luisa; Benetti, Elisa; Zuffardi, Orsetta; Giorda, Roberto; Wells, James M; Gimelli, Giorgio; Ghiggeri, Gian Marco
2010-01-01
Congenital anomalies of the kidney and the urinary tract (CAKUT) represent a major source of morbidity and mortality in children. Several factors (PAX, SOX,WNT, RET, GDFN, and others) play critical roles during the differentiation process that leads to the formation of nephron epithelia. We have identified mutations in SOX17, an HMG-box transcription factor and Wnt signaling antagonist, in eight patients with CAKUT (seven vesico-ureteric reflux, one pelvic obstruction). One mutation, c.775T>A (p.Y259N), recurred in six patients. Four cases derived from two small families; renal scars with urinary infection represented the main symptom at presentation in all but two patients. Transfection studies indicated a 5–10-fold increase in the levels of the mutant protein relative to wild-type SOX17 in transfected kidney cells. Moreover we observed a corresponding increase in the ability of SOX17 p.Y259N to inhibit Wnt/β-catenin transcriptional activity, which is known to regulate multiple stages of kidney and urinary tract development. In conclusion, SOX17 p.Y259N mutation is recurrent in patients with CAKUT. Our data shows that this mutation correlates with an inappropriate accumulation of SOX17-p.Y259N protein and inhibition of the β-catenin/Wnt signaling pathway. These data indicate a role of SOX17 in human kidney and urinary tract development and implicate the SOX17–p.Y259N mutation as a causative factor in CAKUT. Hum Mutat 31:1352–1359, 2010. © 2010 Wiley-Liss, Inc. PMID:20960469
29 CFR 779.259 - What is included in annual gross volume.
2010-07-01
... requirements for exemption from the pay provisions of the Act under section 13(a)(2), does not exclude the... establishment is a part. (c) Likewise, where franchise or other arrangements result in the creation of a larger... integral part of the related activities of the enterprise which grants the franchise, right, or concession...
: tous les projets | Page 259 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Date de début : 6 mai 2011. End Date: 6 novembre 2013. Sujet: WOMEN'S PARTICIPATION, POLITICS, POLITICAL LEADERSHIP, WOMEN'S RIGHTS, GENDER EQUALITY. Région: Chile, South America, North and Central America, Argentina. Programme: Gouvernance et justice. Financement total : CA$ 210,900.00.
Risk factors of severe pneumonia among children aged 2-59 months ...
African Journals Online (AJOL)
Introduction Globally, pneumonia is the leading cause of death in children under the age of 5 years. In Kenya, it is the second leading cause of mortality, accounting for greater than 30,000 deaths in this age group annually. This study sought to identify risk factors for severe pneumonia in children under the age of five years.
Jak vzniká něco nového? Založení a transcendence
Czech Academy of Sciences Publication Activity Database
Puc, Jan
2017-01-01
Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf
Contributing to the Global Agenda
DEFF Research Database (Denmark)
Enemark, Stig
2008-01-01
Stig Enemark, President of the International Federation of Surveyors, explains the organisation's role in the areas of geospatial information and land management. Link to full text: http://www.euinfrastructure.com/currentissue/article.asp?art=273895&issue=259......Stig Enemark, President of the International Federation of Surveyors, explains the organisation's role in the areas of geospatial information and land management. Link to full text: http://www.euinfrastructure.com/currentissue/article.asp?art=273895&issue=259...
Lifescience Database Archive (English)
Full Text Available ides f... 35 0.20 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 34 0.34 sp|O94386|YGS9...EL----QAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLEKQKSR 258 Query: 145 L 143 L Sbjct: 259 L 259 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizoph...renia 1 protein OS=Homo sapiens GN=DISC1 PE=1 SV=3 Length = 854 Score = 34.3 bits (
Ashford, Robert D; Lynch, Kevin; Curtis, Brenda
2018-03-06
Substance use disorder research and practice have not yet taken advantage of emerging changes in communication patterns. While internet and social media use is widespread in the general population, little is known about how these mediums are used in substance use disorder treatment. The aims of this paper were to provide data on patients' with substance use disorders mobile phone ownership rates, usage patterns on multiple digital platforms (social media, internet, computer, and mobile apps), and their interest in the use of these platforms to monitor personal recovery. We conducted a cross-sectional survey of patients in 4 intensive outpatient substance use disorder treatment facilities in Philadelphia, PA, USA. Logistic regressions were used to examine associations among variables. Survey participants (N=259) were mostly male (72.9%, 188/259), African American (62.9%, 163/259), with annual incomes less than US $10,000 (62.5%, 161/259), and averaged 39 (SD 12.24) years of age. The vast majority of participants (93.8%, 243/259) owned a mobile phone and about 64.1% (166/259) owned a mobile phone with app capabilities, of which 85.1% (207/243) accessed the internet mainly through their mobile phone. There were no significant differences in age, gender, ethnicity, or socio-economic status by computer usage, internet usage, number of times participants changed their phone, type of mobile phone contract, or whether participants had unlimited calling plans. The sample was grouped into 3 age groups (Millennials, Generation Xers, and Baby Boomers). The rates of having a social media account differed across these 3 age groups with significant differences between Baby Boomers and both Generation Xers and Millennials (Psocial media account (73.6%, 190/259), most (76.1%, 144/190) reported using it daily and nearly all (98.2%, 186/190) used Facebook. Nearly half of participants (47.4%, 90/190) reported viewing content on social media that triggered substance cravings and an
Femoropopliteal laser recanalization - a multicenterstudy
International Nuclear Information System (INIS)
Lammer, J.; Pilger, E.; Karnel, F.; Schurawitzki, H.; Horvath, W.; Oertl, M.; Riedl, M.; Umek, H.; Klein, G.E.; Schreyer, H.; Neumayer, K.; Einspieler, R.; Olbert, F.; Polterauer, P.; Haidinger, D.; Partsch, H.; Graz Univ.; Vienna Univ.; Vienna Univ.; Krankenhaus der Barmherzigen Brueder, Linz; Wilhelminenspital, Vienna
1990-01-01
Laser-assisted angioplasty was performed in four different hospitalcenters, following the same treatment protocol and using a Nd-YAG laser with a sapphire-probe catheter. The initial recanalization rate of 259 femoro-popliteal occlusions with a mean length of 7.5 cm was 84%. Dissections or perforations were observed in 10%. An emergency surgical intervention was required in 1.1%. The long-term patency rate of the successfully recanalized arteries was 74% after 2 years. The cumulative cure rate of all 259 patients was 62%. (orig.) [de
ORF Alignment: NC_003305 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ] ... Length = 259 ... Query: 7 ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN 66 ... ... ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN Sbjct: 1 ... CFSTLGCSELSLHETADLTERHGIANVELRA
ORF Alignment: NC_003063 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ] ... Length = 259 ... Query: 7 ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN 66 ... ... ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN Sbjct: 1 ... CFSTLGCSELSLHETADLTERHGIANVELRA
ORF Alignment: NC_004369 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available RGRYLQHLADAVPTDLSGITVVVDA 180 ... Query: 259 XXXXRCLAVDSDGNIVDGDQIMAILAIAMKENSELRKNTLVATVMSNLGLKLAMEKADIQ 318 ... ... ... RCLAVDSDGNIVDGDQIMAILAIAMKENSELRKNTLVATVMSNLGLKLAMEKADIQ Sbjct: 241 GDADRCLAVDSDGNIVDGDQIMAILA
ORF Alignment: NC_004668 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Length = 259 ... Query: 1 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHEAQETVSFNDETAIPVFQ...RLEEVL 60 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHEAQETVSFNDETAIPVFQRLEEVL Sbjct: 1 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHE
La inútil añoranza de la normalidad
Directory of Open Access Journals (Sweden)
Margarita Valencia
2012-01-01
Full Text Available Litchis de Madagascar. Aquiles Cuervo. Editorial Elfin de la noche. Buenos Aires, 2011, 91 págs. El ruido de las cosas al caer. Juan Gabriel Vásquez. Premio Alfaguara de novela 2011. Alfaguara. Bogotá. 2011, 259 págs. Tres ataúdes blancos. Antonio Ungar. Premio Herralde de Novela. Editorial Anagrama. Barcelona. 2010, 259 págs. Suicídame. Andrés Arias. Ediciones B. Bogotá, 2010, 261 págs. C.M. no récord. Juan Álvarez. Alfaguara. Bogotá, 2010, 262 págs.
SU-E-J-259: Quantification of Rotational Localization Offset in Radiation Therapy
International Nuclear Information System (INIS)
Huang, Y; Nguyen, N; Lee, S; Liu, F
2014-01-01
Purpose: To verify the necessity of 6D localization detection and correction in radiation therapy. Methods: An anthropomorphic head and neck phantom was used to test the BrainLab ExacTrac x-ray imaging system. After initial positioning, both ExacTrac and the on-board kV CBCT were used to detect the offset at the same position, using both manual and automatic registration algorithms. Then 6D offset including rotational errors up to 5 degree were introduced. Both ExacTrac and CBCT were used to correct the offsets and the residual errors were evaluated. Finally, 6D offset detected by ExacTrac for a C-Spine patient was reported. Results: The differences in 3D offset detected by ExacTrac and CBCT were 1.5 ± 1.2(Lateral), 2.7 ± 2.7(Vertical), and 4.0 ± 6.3(longitudinal) mm with manual registration while the corresponding differences decreased to 0.6 ± 0.3, 1.0 ± 0.3, and 0.3 ± 0.3 when automatic registration were used. CBCT corrected the translational offset to within 0.5 mm but the rotational errors remained and detected by the ExacTrac system (Yaw=2.1, Roll=1.1, Pitch=1.4 degree). When similar offset was introduced and corrected using ExacTrac, the residual error detected by both CBCT and ExacTrac were within 0.5 mm / 0.5 degree. The average offset from the 112 ExacTrac x-ray corrections for the C-Spine patient was 0.6 ± 1.6 (lateral), 5.4 ± 8(vertical), 1.6±1.1(longitudinal) mm, and 0.7 ± 0.6 (pitch), 0.7 ± 0.4(roll), 1.2 ± 0.7 (yaw) degree. Larger rotational errors, with a maximum of 2.7 degree (corresponds to about 1.5 to 4.5 mm offset for a POI 10 to 30 cm away from the isocenter), were observed when couch rotational were involved. Conclusion: Rotational errors are common in patient localization, especially when couch rotation is involved. Both appropriate imaging system and 6D robotic couch are necessary to detect and correct the rotational localization errors
SU-E-T-259: Development of a Primary Standard for LDR Brachytherapy
Energy Technology Data Exchange (ETDEWEB)
Shen, H; McEwen, M [National Research Council, Ottawa, ON (Canada)
2015-06-15
Purpose: The National Research Council initiated a program in 2012 to develop a primary standard to calibrate I-125 and Pd-103 sources used for LDR brachytherapy and disseminate this through calibration services to Canadian users. This will simplify procedures as Canadian cancer centres currently have to ship instruments to the US. Methods: The standard is based on a commercial version of the wide-angle free air chamber (WAFAC) pioneered by NIST. Significant enhancements were implemented to improve signal-to-noise and measurement reproducibility and eliminate electric field effects. Validation of this ionization chamber was then carried out in a low-energy X -ray beam (∼ 31 keV) where the dose rate had been previously established using the existing NRC primary standard free-air chamber. As a final component of this initial testing, measurements were made with a set of I-125 seeds (with air kerma strength traceable to NIST). Results: Excellent agreement of the two NRC free-air chambers was obtained within the combined standard uncertainty of 0.5 %. However, it was found that the WAFAC response is very sensitive to the beam geometry (distance from the source, diameter of the beam-defining aperture, etc) and Monte Carlo calculations, carried out to evaluate these geometry corrections, have confirmed the experimental results. The results for the seed measurements indicated a precision of better than 1 % is achievable for a reasonable acquisition time and the air kerma strength agreed with the manufacturer (NIST-traceable) value within 2 %. Conclusion: The prototype primary standard for LDR brachytherapy has met accuracy target of 3 % for the determination of air kerma strength. Work is ongoing to refine operation of the device and develop the calibration protocol for clinical users, with an anticipated launch of a calibration service in late 2015.
50 CFR 259.34 - Minimum and maximum deposits; maximum time to deposit.
2010-10-01
... B objective. A time longer than 10 years, either by original scheduling or by subsequent extension... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE AID TO FISHERIES CAPITAL CONSTRUCTION FUND...) Minimum annual deposit. The minimum annual (based on each party's taxable year) deposit required by the...
ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NMVQGVLSHQLKR 180 ... Query: 259 YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSY...PVITERQGE 318 ... YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSYPVITERQGE Sbjct: 241 YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSYPVITERQGE 300 ...
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available MAFF303099] ... Length = 942 ... Query: 200 ... ISHAMAIAAQALDHVGLPAIIRPSFTMGGTGGGIAYNRAEFYDIVQSGLDASPTTEVL...IE 259 ... ISHAMAIAAQALDHVGLPAIIRPSFTMGGTGGGIAYNRAEFYDIVQSGLDASPTTEVLIE Sbjct: 1 ... ISHAMAIAAQALDHVGLPAIIRPSFTM
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... 110] ... Length = 44 ... Query: 219 HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 259 ... HFVNRGDTLASIARKNHIS...AAELARANGLDPSAKLKLGTKL Sbjct: 1 ... HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 41
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment
International Nuclear Information System (INIS)
Nitschke, J.M.
1983-05-01
Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission
ORF Alignment: NC_002942 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LNELDLIRIRNAAR Sbjct: 121 GYTHVSAPFDGRMGRHLVDVGNLVGHGAATDLATIEQIDPIYVYFNLNELDLIRIRNAAR 180 ... Query: 299 LFVQVRVPISEPS...PKLTIP 317 ... LFVQVRVPISEPSPKLTIP Sbjct: 241 LFVQVRVPISEPSPKLTIP 259
ORF Alignment: NC_006369 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LNELDLIRIRNAAR Sbjct: 121 GYTHVSAPFDGRMGRHLVDVGNLVGHGAATDLATIEQIDPIYVYFNLNELDLIRIRNAAR 180 ... Query: 295 LFVQVRVPISEPS...PKLTIP 313 ... LFVQVRVPISEPSPKLTIP Sbjct: 241 LFVQVRVPISEPSPKLTIP 259
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
The list of errata was prepared for the data book of the international measures project for rational energy use (Survey project of the analysis tool of Asian energy consumption efficiency). Corrected pages of the data book 1 (1990) are as follows: 187-190, 223-226, 259-262, 295- 298, 369-370, 387-388 and 405-406 on Malaysian data. Corrected pages of the data book 2 (1985) are as follows: 102-105 on Chinese data, 154 on common data, and 187-190, 223-226, 259-262, 295-298, 369-370, 387-388 and 405-406 on Malaysian data. (NEDO)
Review of climatic input data for wind load design in accordance with SANS 10160-3
CSIR Research Space (South Africa)
Goliger, Adam MW
2017-12-01
Full Text Available factor QWE that provides for the wind engineering procedures, such as the wind speed profile and pressure coefficients. The characteristic wind load is then given by Equation 4, where CoV is the coefficient of variation (σV/µV): QW,k = QWE (µV + 2....59 σV)2 = QWE µVk2(1+ 2.59 CoVV)2 (6) Design wind load The design wind load can be obtained by determining the wind speed according to Equation 4 for an exceedance probability (PF) that corresponds with the appropriate target reliability (β...
[Increasing incidence of community-acquired pneumonia caused by atypical microorganisms].
Tazón-Varela, M A; Alonso-Valle, H; Muñoz-Cacho, P; Gallo-Terán, J; Piris-García, X; Pérez-Mier, L A
2017-09-01
Knowing the most common microorganisms in our environment can help us to make proper empirical treatment decisions. The aim is to identify those microorganisms causing community-acquired pneumonia. An observational, descriptive and prospective study was conducted, including patients over 14 years with a clinical and radiographic diagnosis of community-acquired pneumonia during a 383 consecutive day period. A record was made of sociodemographic variables, personal history, prognostic severity scales, progress, and pathogenic agents. The aetiological diagnosis was made using blood cultures, detection of Streptococcus pneumoniae and Legionella pneumophila urinary antigens, sputum culture, influenza virus and Streptococcus pyogenes detection. Categorical variables are presented as absolute values and percentages, and continuous variables as their means and standard deviations. Of the 287 patients included in the study (42% women, mean age 66±22 years), 10.45% died and 70% required hospital admission. An aetiological diagnosis was achieved in 43 patients (14.98%), with 16 microorganisms found in 59 positive samples. The most frequently isolated pathogen was Streptococcus pneumonia (24/59, 41%), followed by gram-negative enteric bacilli, Klebsiella pneumonia, Escherichia coli, Serratia marcescens and Enterobacter cloacae isolated in 20% of the samples (12/59), influenza virus (5/59, 9%), methicillin-resistant Staphylococcus aureus (3/59, 5%), Pseudomonas aeruginosa (2/59, 3%), Moraxella catarrhalis (2/59, 3%), Legionella pneumophila (2/59, 3%), and Haemophilus influenza (2/59, 3%). Polymicrobial infections accounted for 14% (8/59). A high percentage of atypical microorganisms causing community-acquired pneumonia were found. Copyright © 2016 Sociedad Española de Médicos de Atención Primaria (SEMERGEN). Publicado por Elsevier España, S.L.U. All rights reserved.
International Nuclear Information System (INIS)
Black, C.G.; Fyfe, J.A.M.; Davies, J.K.
1997-01-01
A recombinant plasmid capable of restoring UV resistance to an Escherichia coli uvrA mutant was isolated from a genomic library of Neisseria gonorrhoeae. Sequence analysis revealed an open reading frame whose deduced amino acid sequence displayed significant similarity to those of the UvrA proteins of other bacterial species. A second open reading frame (ORF259) was identified upstream from, and in the opposite orientation to the gonococcal uvrA gene. Transcriptional fusions between portions of the gonococcal uvrA upstream region and a reporter gene were used to localise promoter activity in both E. coli and N. gonorrhoeae. The transcriptional starting points of uvrA and ORF259 were mapped in E. coli by primer extension analysis, and corresponding σ 70 promoters were identified. The arrangement of the uvrA-ORF259 intergenic region is similar to that of the gonococcal recA-aroD intergenic region. Both contain inverted copies of the 10 bp neisserial DNA uptake sequence situated between divergently transcribed genes. However, there is no evidence that either the uptake sequence or the proximity of the promoters influences expression of these genes. (author)
Endothelial ERK signaling controls lymphatic fate specification
Deng, Yong; Atri, Deepak; Eichmann, Anne; Simons, Michael
2013-01-01
Lymphatic vessels are thought to arise from PROX1-positive endothelial cells (ECs) in the cardinal vein in response to induction of SOX18 expression; however, the molecular event responsible for increased SOX18 expression has not been established. We generated mice with endothelial-specific, inducible expression of an RAF1 gene with a gain-of-function mutation (RAF1S259A) that is associated with Noonan syndrome. Expression of mutant RAF1S259A in ECs activated ERK and induced SOX18 and PROX1 expression, leading to increased commitment of venous ECs to the lymphatic fate. Excessive production of lymphatic ECs resulted in lymphangiectasia that was highly reminiscent of abnormal lymphatics seen in Noonan syndrome and similar “RASopathies.” Inhibition of ERK signaling during development abrogated the lymphatic differentiation program and rescued the lymphatic phenotypes induced by expression of RAF1S259A. These data suggest that ERK activation plays a key role in lymphatic EC fate specification and that excessive ERK activation is the basis of lymphatic abnormalities seen in Noonan syndrome and related diseases. PMID:23391722
Energy Technology Data Exchange (ETDEWEB)
Bustos, A.; Corredoira, J.; Ferreiros, J.; Cabeza, B.; Jorquera, M.; Pedrosa, I.; Martinez, R.; Fernandez, C. [Hospital Clinico San Carlos. Madrid (Spain)
2002-07-01
To analyze the initial thoracic involvement by CT in a consecutive series of patients with lymphoma. A retrospective analysis was made of thoracic CT studies made at the time of diagnosis of 259 patients with lymphoma. Mediastinal pulmonary, pleural, pericardial and chest wall involvement was assessed by CT. Of 259 patients (129 men y 130 women), 56 had Hodgkin's disease (HD) and 203 had non-Hodgkin lymphoma (NHL). Forty-two percent (42.5%, 110/259) of the patients had chest involvement on CT: 33 of 56 patients with HD (58.9%) and 77 of 203 patients with NHL (37.9%). All the patients with thoracic HD and 71.4% of patients with thoracic NHL, had mediastinal lymph node involvement. of the patients with thoracic involvement 12.1% (4/33) of the patient with HD and 23.3% (18/77) of the patients with NHL had pulmonary involvement. Thoracic involvement on CT was more frequent in HD. Mediastinal lymph node involvement was the most common finding fundamentally in HD. Pulmonary disease always occurred in the presence of mediastinal lymph node involvement in HD but could occur as an isolated finding in NHL. (Author) 24 refs.
Initial thoracic involvement in lymphoma. CT assessment
International Nuclear Information System (INIS)
Bustos, A.; Corredoira, J.; Ferreiros, J.; Cabeza, B.; Jorquera, M.; Pedrosa, I.; Martinez, R.; Fernandez, C.
2002-01-01
To analyze the initial thoracic involvement by CT in a consecutive series of patients with lymphoma. A retrospective analysis was made of thoracic CT studies made at the time of diagnosis of 259 patients with lymphoma. Mediastinal pulmonary, pleural, pericardial and chest wall involvement was assessed by CT. Of 259 patients (129 men y 130 women), 56 had Hodgkin's disease (HD) and 203 had non-Hodgkin lymphoma (NHL). Forty-two percent (42.5%, 110/259) of the patients had chest involvement on CT: 33 of 56 patients with HD (58.9%) and 77 of 203 patients with NHL (37.9%). All the patients with thoracic HD) and 71.4% of patients with thoracic NHL, had mediastinal lymph node involvement. of the patients with thoracic involvement 12.1% (4/33) of the patient with HD and 23.3% (18/77) of the patients with NHL had pulmonary involvement. Thoracic involvement on CT was more frequent in HD. Mediastinal lymph node involvement was the most common finding fundamentally in HD. Pulmonary disease always occurred in the presence of mediastinal lymph node involvement in HD but could occur as an isolated finding in NHL. (Author) 24 refs
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available pseudomallei K96243] ... Length = 259 ... Query: 12 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPR...TLAACAGRRV 71 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACA...GRRV Sbjct: 1 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACAGRRV 60 ... Query: 132 EFASACDALITESAQA
Nuclear structure studies in the seaborgium region at SHIP
Energy Technology Data Exchange (ETDEWEB)
Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)
2015-10-15
New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.
6 CFR 25.9 - Procedures for certification of approved products for Homeland Security.
2010-01-01
... Procedures for certification of approved products for Homeland Security. (a) Application Procedure. An applicant seeking a Certification of anti-terrorism Technology as an Approved Product for Homeland Security... application for renewal must be made using the “Application for Certification of an Approved Product for...
Oral History Project: Advanced ESL Class, Local 259 U.A.W. 1985-86.
Colon, Maria, Comp.; And Others
A class project undertaken in an English-as-a-Second-Language class is described and presented. Students participating in the project were union employees in a Manhattan electronics factory, and most were native Spanish speakers. The project's objective was to produce an illustrated book and tapes to document work and union experience in the…
Obesity, bariatric surgery and nutritional implications - doi:10.5020/18061230.2007.p259
Directory of Open Access Journals (Sweden)
Michele Novaes Ravelli
2012-01-01
Full Text Available Obesity is an important nutritional deviation that is exponentially increasing in Brazil and in the world, becoming a public health problem. The World Health Organization verified in 2005 that 1.6 billion people above 15 years old were overweight and 400 million were obese. Among children, 20 million were overweight. Amongst the different treatments for the obesity the bariatric surgery has been used very often nowadays, for being effective against weight excess and associated co-morbidities, both for the adult and youngster populations. The surgical techniques are divided in restrictive, disabsorptive and mixed procedures. Each technique promotes digestive and absorptive distinct alterations, needing, therefore, an exclusive multidisciplinary educational program, directed both to pre and postsurgery periods, emphasizing the habits of physical activity and the necessity to adhere to the restricted dietary recommendations. The surgeries promote a severe reduction in the consumption, which induces to the ingestion of diets that are hypocaloric and deficient in micronutrients, with consequent nutritional complications.
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available h = 155 ... Query: 200 HTQMAPAASKPPEVANLATKMFQALMPSRSGAIQKPAGSQTIGRATDNDIVIQDVLASRH 259 ... HTQMAPA...ASKPPEVANLATKMFQALMPSRSGAIQKPAGSQTIGRATDNDIVIQDVLASRH Sbjct: 5 ... HTQMAPAASKPPEVANLATK... ... protein MAP3465 [Mycobacterium avium subsp. ... paratuberculosis str. k10] ... Lengt
Kearns, Cristin E.; Apollonio, Dorie
2017-01-01
In 1965, the Sugar Research Foundation (SRF) secretly funded a review in the New England Journal of Medicine that discounted evidence linking sucrose consumption to blood lipid levels and hence coronary heart disease (CHD). SRF subsequently funded animal research to evaluate sucrose’s CHD risks. The objective of this study was to examine the planning, funding, and internal evaluation of an SRF-funded research project titled “Project 259: Dietary Carbohydrate and Blood Lipids in Germ-Free Rats,” led by Dr. W.F.R. Pover at the University of Birmingham, Birmingham, United Kingdom, between 1967 and 1971. A narrative case study method was used to assess SRF Project 259 from 1967 to 1971 based on sugar industry internal documents. Project 259 found a statistically significant decrease in serum triglycerides in germ-free rats fed a high sugar diet compared to conventional rats fed a basic PRM diet (a pelleted diet containing cereal meals, soybean meals, whitefish meal, and dried yeast, fortified with a balanced vitamin supplement and trace element mixture). The results suggested to SRF that gut microbiota have a causal role in carbohydrate-induced hypertriglyceridemia. A study comparing conventional rats fed a high-sugar diet to those fed a high-starch diet suggested that sucrose consumption might be associated with elevated levels of beta-glucuronidase, an enzyme previously associated with bladder cancer in humans. SRF terminated Project 259 without publishing the results. The sugar industry did not disclose evidence of harm from animal studies that would have (1) strengthened the case that the CHD risk of sucrose is greater than starch and (2) caused sucrose to be scrutinized as a potential carcinogen. The influence of the gut microbiota in the differential effects of sucrose and starch on blood lipids, as well as the influence of carbohydrate quality on beta-glucuronidase and cancer activity, deserve further scrutiny. PMID:29161267
Using snowball sampling method with nurses to understand medication administration errors.
Sheu, Shuh-Jen; Wei, Ien-Lan; Chen, Ching-Huey; Yu, Shu; Tang, Fu-In
2009-02-01
We aimed to encourage nurses to release information about drug administration errors to increase understanding of error-related circumstances and to identify high-alert situations. Drug administration errors represent the majority of medication errors, but errors are underreported. Effective ways are lacking to encourage nurses to actively report errors. Snowball sampling was conducted to recruit participants. A semi-structured questionnaire was used to record types of error, hospital and nurse backgrounds, patient consequences, error discovery mechanisms and reporting rates. Eighty-five nurses participated, reporting 328 administration errors (259 actual, 69 near misses). Most errors occurred in medical surgical wards of teaching hospitals, during day shifts, committed by nurses working fewer than two years. Leading errors were wrong drugs and doses, each accounting for about one-third of total errors. Among 259 actual errors, 83.8% resulted in no adverse effects; among remaining 16.2%, 6.6% had mild consequences and 9.6% had serious consequences (severe reaction, coma, death). Actual errors and near misses were discovered mainly through double-check procedures by colleagues and nurses responsible for errors; reporting rates were 62.5% (162/259) vs. 50.7% (35/69) and only 3.5% (9/259) vs. 0% (0/69) were disclosed to patients and families. High-alert situations included administration of 15% KCl, insulin and Pitocin; using intravenous pumps; and implementation of cardiopulmonary resuscitation (CPR). Snowball sampling proved to be an effective way to encourage nurses to release details concerning medication errors. Using empirical data, we identified high-alert situations. Strategies for reducing drug administration errors by nurses are suggested. Survey results suggest that nurses should double check medication administration in known high-alert situations. Nursing management can use snowball sampling to gather error details from nurses in a non
Kearns, Cristin E; Apollonio, Dorie; Glantz, Stanton A
2017-11-01
In 1965, the Sugar Research Foundation (SRF) secretly funded a review in the New England Journal of Medicine that discounted evidence linking sucrose consumption to blood lipid levels and hence coronary heart disease (CHD). SRF subsequently funded animal research to evaluate sucrose's CHD risks. The objective of this study was to examine the planning, funding, and internal evaluation of an SRF-funded research project titled "Project 259: Dietary Carbohydrate and Blood Lipids in Germ-Free Rats," led by Dr. W.F.R. Pover at the University of Birmingham, Birmingham, United Kingdom, between 1967 and 1971. A narrative case study method was used to assess SRF Project 259 from 1967 to 1971 based on sugar industry internal documents. Project 259 found a statistically significant decrease in serum triglycerides in germ-free rats fed a high sugar diet compared to conventional rats fed a basic PRM diet (a pelleted diet containing cereal meals, soybean meals, whitefish meal, and dried yeast, fortified with a balanced vitamin supplement and trace element mixture). The results suggested to SRF that gut microbiota have a causal role in carbohydrate-induced hypertriglyceridemia. A study comparing conventional rats fed a high-sugar diet to those fed a high-starch diet suggested that sucrose consumption might be associated with elevated levels of beta-glucuronidase, an enzyme previously associated with bladder cancer in humans. SRF terminated Project 259 without publishing the results. The sugar industry did not disclose evidence of harm from animal studies that would have (1) strengthened the case that the CHD risk of sucrose is greater than starch and (2) caused sucrose to be scrutinized as a potential carcinogen. The influence of the gut microbiota in the differential effects of sucrose and starch on blood lipids, as well as the influence of carbohydrate quality on beta-glucuronidase and cancer activity, deserve further scrutiny.
Directory of Open Access Journals (Sweden)
Cristin E Kearns
2017-11-01
Full Text Available In 1965, the Sugar Research Foundation (SRF secretly funded a review in the New England Journal of Medicine that discounted evidence linking sucrose consumption to blood lipid levels and hence coronary heart disease (CHD. SRF subsequently funded animal research to evaluate sucrose's CHD risks. The objective of this study was to examine the planning, funding, and internal evaluation of an SRF-funded research project titled "Project 259: Dietary Carbohydrate and Blood Lipids in Germ-Free Rats," led by Dr. W.F.R. Pover at the University of Birmingham, Birmingham, United Kingdom, between 1967 and 1971. A narrative case study method was used to assess SRF Project 259 from 1967 to 1971 based on sugar industry internal documents. Project 259 found a statistically significant decrease in serum triglycerides in germ-free rats fed a high sugar diet compared to conventional rats fed a basic PRM diet (a pelleted diet containing cereal meals, soybean meals, whitefish meal, and dried yeast, fortified with a balanced vitamin supplement and trace element mixture. The results suggested to SRF that gut microbiota have a causal role in carbohydrate-induced hypertriglyceridemia. A study comparing conventional rats fed a high-sugar diet to those fed a high-starch diet suggested that sucrose consumption might be associated with elevated levels of beta-glucuronidase, an enzyme previously associated with bladder cancer in humans. SRF terminated Project 259 without publishing the results. The sugar industry did not disclose evidence of harm from animal studies that would have (1 strengthened the case that the CHD risk of sucrose is greater than starch and (2 caused sucrose to be scrutinized as a potential carcinogen. The influence of the gut microbiota in the differential effects of sucrose and starch on blood lipids, as well as the influence of carbohydrate quality on beta-glucuronidase and cancer activity, deserve further scrutiny.
RADIOIODINE TREATMENT OF GRAVES’ DISEASE – DOSE/RESPONSE ANALYSIS
Directory of Open Access Journals (Sweden)
Jitka Čepková
2014-01-01
Full Text Available The clinical outcome of 153 Graves’ disease patients treated with a wide dose range of radioactive iodine-131 (RAI was analyzed retrospectively. Six to nine months after the first dose of RAI 60 patients (39% were hypothyroid (or rather thyroxine-substituted and 26 (17% were euthyroid, while 67 patients (44% did not respond properly: in 32 (21% their antithyroid drug (ATD dose could be reduced but not withdrawn (partial response and 35 (23% remained hyperthyroid or the same dose of ATD was necessary (no response. The outcome did not correspond significantly to the administered activity of RAI (medians 259, 259, 222, and 259 MBq for hypothyroid, euthyroid, partial, and no response subgroups, respectively, or the activity retained in the gland at 24 h (medians 127, 105, 143, and 152 MBq. The effect was, however, clearly, and in a stepwise pattern, dependent on initial thyroid volume (17, 26, 33 and 35 ml, P 6 MBq/g, cure rate 80% and lower (≤ 6 MBq/g, cure rate 46% doses gave highly significant difference (P < 0.001. With our dosing range we found a dose-dependent clinical outcome that suggests an optimum delivered dose near 6.5 MBq/g, resulting in successful treatment of ca 80% patients.
Stout, Jeffrey R; Fukuda, David H; Kendall, Kristina L; Smith-Ryan, Abbie E; Moon, Jordan R; Hoffman, Jay R
2015-04-01
The effects of 12-weeks of HMB ingestion and resistance training (RT) on abdominal adiposity were examined in 48 men (66-78 yrs). All participants were randomly assigned to 1 of 4 groups: no-training placebo (NT-PL), HMB only (NT-HMB), RT with PL (RT-PL), or HMB with RT (RT-HMB). DXA was used to estimate abdominal fat mass (AFM) by placing the region of interest over the L1-L4 region of the spine. Outcomes were assessed by ANCOVA, with Bonferroni-corrected pairwise comparisons. Baseline AFM values were used as the covariate. The ANCOVA indicated a significant difference (p = 0.013) between group means for the adjusted posttest AFM values (mean (kg) ± SE: NT-PL = 2.59 ± 0.06; NT-HMB = 2.59 ± 0.61; RT-PL = 2.59 ± 0.62; RT-HMB = 2.34 ± 0.61). The pairwise comparisons indicated that AFM following the intervention period in the RT-HMB group was significantly less than NT-PL (p = 0.013), NT-HMB (p = 0.011), and RT-PL (p = 0.010). These data suggested that HMB in combination with 12 weeks of RT decreased AFM in elderly men. Copyright © 2015. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Cristiana M. Nascimento-Carvalho
2004-06-01
Full Text Available OBJECTIVE: To describe the frequency of etiologic agents of bacterial meningitis (BM among children aged 2-59 months in a sample of patients in Salvador, Northeast Brazil, with emphasis on the frequency of BM of unknown etiology (BMUE, just before, during and after the implementation of routine immunization of infants with Haemophilus influenzae type b (Hib vaccination. METHOD: Demographic, clinical and cerebrospinal fluid (CSF information was collected from the chart of every patient, aged 2-59 months, whose CSF exam was performed at the CSF Lab - José Silveira Foundation, between January 1989 and December 2001. Every CSF exam was completely performed according to standard methods. The etiologic diagnosis was based on either culture and/or latex-agglutination test. When the agent was only seen on Gram stained smear, the diagnosis was descriptive. BMUE was defined as: glucose 100 mg / dl, white blood cell count > 20 cells / mm³, percentage of neutrophils > 80%. RESULTS: Of 1519 patients, 894 (58.9% had normal exams and BM was diagnosed in 95 (6.2%. Etiologic agents were: Hib (44.2%, meningococcus (13.7%, Gram-negative bacilli (11.6%, Mycobacterium tuberculosis (6.3%, pneumococcus (4.2%, other agents (4.2%; BMUE was diagnosed in 15.8% of cases with BM. By analysing the frequency of BMUE and Hib among all exams performed yearly, the peaks were recorded in 1989 (5.3% and 1990 (16.9%, respectively, decreasing to 0.7% and 0% in 2001. CONCLUSION: It is possible that the implementation of the conjugate Hib vaccine during the 1990's has been decreasing not only the occurrence of Hib meningitis but also of BMUE.OBJETIVO: Descrever a freqüência dos agentes etiológicos de meningite bacteriana (MB em amostra das crianças com idade entre 2 e 59 meses, em Salvador, Nordeste do Brasil, com ênfase na freqüência de MB de etiologia indeterminada (MBEI, antes, durante e após a implementação da imunização rotineira de lactentes com vacina para
Human Estimation of Slope, Distance, and Height of Terrain in Simulated Lunar Conditions
2009-02-01
9643 APPENDIX J DEVON ISLAND DISTANCE REFERENCE 259 Distance References NBA Basketball Court Width 15 meters 50 feet...Cockpit Hours: Simulator Airframe: Hours: Sports Baseball Years: Beginner Intermediate Advanced Basketball Years: Beginner
Czech Academy of Sciences Publication Activity Database
Komárek, Jiří
2016-01-01
Roč. 764, č. 1 (2016), s. 259-270 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * plankton * taxonomic revisions Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016
Rodriguez-Garcia, Isela; Cruz-Valenzuela, M Reynaldo; Silva-Espinoza, Brenda A; Gonzalez-Aguilar, Gustavo A; Moctezuma, Edgar; Gutierrez-Pacheco, M Melissa; Tapia-Rodriguez, Melvin R; Ortega-Ramirez, Luis A; Ayala-Zavala, J Fernando
2016-08-01
Tomato is a fruit widely consumed due to its flavor and nutritional value; however, it is susceptible to fungi contamination. Oregano essential oil (OEO) is a fungicide whose constituents are volatile; therefore, their incorporation within edible coatings can protect them and maintain their efficacy. In this context, this study evaluated the effect of OEO applied within pectin coatings on the inhibition of Alternaria alternata growth, antioxidant content and sensorial acceptability of tomatoes. The major volatile compounds of OEO were carvacrol (47.41%), p-cymene (26.44%) and thymol (3.02%). All the applied OEO concentrations (15.7, 25.9 and 36.1 g L(-1) ) inhibited the in vitro growth of A. alternata, whereas the in vivo effective concentrations were 25.9 and 36.1 g L(-1) . Additionally, there was an increment of total phenols and antioxidant activity in coated tomatoes compared to controls. Aroma acceptability of tomatoes was not affected by the pectin-OEO coating; additionally, the pectin, pectin-OEO 15.7 g L(-1) treatments and control tomatoes showed higher flavor acceptability than those coated with pectin-OEO 25.9 and 36.1 g L(-1) . Pectin-OEO coatings showed antifungal effect and increased the antioxidant activity without negative effects on the sensorial acceptability of tomatoes. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
Characterization of HIV Transmission in South-East Austria.
Hoenigl, Martin; Chaillon, Antoine; Kessler, Harald H; Haas, Bernhard; Stelzl, Evelyn; Weninger, Karin; Little, Susan J; Mehta, Sanjay R
2016-01-01
To gain deeper insight into the epidemiology of HIV-1 transmission in South-East Austria we performed a retrospective analysis of 259 HIV-1 partial pol sequences obtained from unique individuals newly diagnosed with HIV infection in South-East Austria from 2008 through 2014. After quality filtering, putative transmission linkages were inferred when two sequences were ≤1.5% genetically different. Multiple linkages were resolved into putative transmission clusters. Further phylogenetic analyses were performed using BEAST v1.8.1. Finally, we investigated putative links between the 259 sequences from South-East Austria and all publicly available HIV polymerase sequences in the Los Alamos National Laboratory HIV sequence database. We found that 45.6% (118/259) of the sampled sequences were genetically linked with at least one other sequence from South-East Austria forming putative transmission clusters. Clustering individuals were more likely to be men who have sex with men (MSM; pAustria had at least one putative inferred linkage with sequences from a total of 69 other countries. In conclusion, analysis of HIV-1 sequences from newly diagnosed individuals residing in South-East Austria revealed a high degree of national and international clustering mainly within MSM. Interestingly, we found that a high number of heterosexual males clustered within MSM networks, suggesting either linkage between risk groups or misrepresentation of sexual risk behaviors by subjects.
Directory of Open Access Journals (Sweden)
Janet Floyd
2009-11-01
Full Text Available A review of 'Transatlantic Print Culture, 1880-1940: Emerging Media, Emerging Modernisms', edited by Ann Ardis and Patrick Collier (London: Palgrave Macmillan, 2008. Hardback, 259 pages, £50, ISBN 9780554269.
EHR Incentive Programs - Data and Reports
U.S. Department of Health & Human Services — As of March 2013, more than 259,000 health care providers received payment for participating in the Medicare and Medicaid Electronic Health Record (EHR) Incentive...
78 FR 57889 - Notice of Quarterly Report (April 1 2013-June 30, 2013)
2013-09-20
... time; hours per week. Restructure and rehabilitate primary and secondary pipelines (kilometers... Project $42,045,259 Increase the $31,725,167 Screening for adoption of hypertension (percent). behaviors... management and implementation. [[Page 57901
Indian Academy of Sciences (India)
259. Gopalakrishna G S. Hydrothermal synthesis, structure and characterization of new .... Silver nanoparticles of variable morphology synthesized in aqueous foams as ... Thermal and structural properties of spray pyrolysed CdS thin film. 233.
Czech Academy of Sciences Publication Activity Database
Masi, E.; Ciszak, M.; Colzi, I.; Adamec, Lubomír; Mancuso, S.
2016-01-01
Roč. 6, e24989 (2016), s. 1-11 ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : electrophysiology * multielectrode array * aquatic carnivorous plants Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016
Directory of Open Access Journals (Sweden)
FAM Mulyani
2014-11-01
Full Text Available Penelitian ini bertujuan untuk mengetahui Nilai LC50-96 jam pada uji toksisitas ikan Nila Larasati yang dipapar timbal; mengetahui perubahan struktur mikroanatomi dan mengetahui pada konsentrasi berapa timbal menyebabkan perubahan struktur mikroanatomi insang. Sampel uji toksisitas sebanyak 120 ekor untuk mengetahui tingkat kematian ikan hingga 50% dalam 96 jam, dan uji perlakuan sebanyak 80 ekor dengan konsentrasi 0 ppm; 259,51 ppm; 291,94 ppm; dan 324,38 ppm. Pada akhir minggu ke empat diambil sampel insang dan dilakukan analisis gambaran struktur mikroanatomi insang secara diskriptif. Hasil analisis menunjukkan kerusakan edema 0%-25%, fusi lamela antara 1%-75%, hiperplasia 0%-50%, epithelial lifting 0%-50%, dan nekrosis 0%-50%. Dari hasil penelitian dapat disimpulkan bahwa nilai LC50-96 jam pada uji toksisitas ikan Nila Larasati sebesar 324,38 ppm dan mulai terjadi perubahan struktur mikroanatomi insang pada konsentrasi 259,51 ppm. The objective of thje study was to determine the value of LC50-96 hours in a toxicity test of Nila Larasati fish exposed to lead acetate; to determine the changes in the microanatomy structure and to determine the concentration of lead acetate which causes microanatomy structure changes in the gills of Nila Larasati fish. The samples were 120 fish to find out the 50% fish mortality within 96 hours, and 80 fish in treatment test with the lead acetate concentrations of 0 ppm; 259.51 ppm; 291.94 ppm; and 324.38 ppm. At the end of the 4th week of the research, the gill samples were taken and the analysis of the microanatomy structure was carried out descriptively. The result of the analysis showed that there were 0%-25% edema, 1%-75% lamella fusion, 0%-50% hyperplasia, 0%-50% epithelial lifting and 0%-50% necrosis. It was concluded that the value of LC50-96 hours in Nila Larasati fish toxicity test was 324.38 ppm; and microanatomy changes started to occur in the lead acetate concentration of 259.51 ppm.
Satellite gravity gradient grids for geophysics
Czech Academy of Sciences Publication Activity Database
Bouman, J.; Ebbing, J.; Fuchs, M.; Sebera, Josef; Lieb, V.; Szwillus, W.; Haagmans, R.; Novák, P.
2016-01-01
Roč. 6, February (2016), 21050/1-21050/11 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : atlantic region * GOCE * model Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2016
Asymmetric Preorganization of Inverted Pair Residues in the Sodium-Calcium Exchanger
Czech Academy of Sciences Publication Activity Database
Giladi, M.; Almagor, L.; Van Dijk, L.; Hiller, R.; Man, Petr; Forest, E.; Khananshvili, D.
2016-01-01
Roč. 6, FEB15 (2016), s. 20753 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : MASS-SPECTROMETRY * STRUCTURAL BASIS * NA+/CA2+ EXCHANGER Subject RIV: CE - Biochemistry Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Ota, S.; Yoshihara, M.; Yamazaki, T.; Takeshita, T.; Hirata, A.; Konomi, M.; Oshima, K.; Hattori, M.; Bišová, Kateřina; Zachleder, Vilém; Kawano, S.
2016-01-01
Roč. 6, MAY 16 (2016), s. 25731 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : electron-dense body * lipid accumulation * Parachlorella kessleri Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016
Herbivory in the soft coral Sinularia flexibilis (Alcyoniidae)
Czech Academy of Sciences Publication Activity Database
Piccinetti, C.C.; Ricci, R.; Pennesi, C.; Radaelli, G.; Totti, C.; Norici, A.; Giordano, Mario; Olivotto, I.
2016-01-01
Roč. 6, MAR 8 (2016), s. 22679 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : DIATOM THALASSIOSIRA-PSEUDONANA * STYLOPHORA-PISTILLATA * SCLERACTINIAN CORALS Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Kratochvíl, Matěj
2006-01-01
Roč. 93, č. 3 (2006), s. 259-267 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : folk music * sound recording * phonograph * technology * media Subject RIV: AC - Archeology, Anthropology, Ethnology
Intercalation of tartrazine into ZnAl and MgAl layered double hydroxides
Czech Academy of Sciences Publication Activity Database
Beneš, L.; Melánová, Klára; Zima, Vítězslav; Svoboda, Jan
2005-01-01
Roč. 70, č. 2 (2005), s. 259-267 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40500505 Keywords : intercalation * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.949, year: 2005
Czech Academy of Sciences Publication Activity Database
Rais, R.; Jančařík, Andrej; Tenora, Lukáš; Nedelcovych, M.; Alt, J.; Englert, J.; Rojas, C.; Le, A.; Elgogary, A.; Tan, J.; Monincová, Lenka; Pate, K.; Adams, R.; Ferraris, D.; Powell, J.; Majer, Pavel; Slusher, B. S.
2016-01-01
Roč. 59, č. 18 (2016), s. 8621-8633 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : phase I * glutamine metabolism * adjuvant temozolomide Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016
Effects of elevated CO2 and ozone on phenolic glycosides of trembling aspen
James K. Nitao; Muraleedharan G. Nair; William J. Mattson; Daniel A. Herms; Bruce A. Birr; Mark D. Coleman; Terry M. Trier; J. G. Isebrands
1996-01-01
We tested the effects of elevated CO2 and ozone on concentrations of the phenolic glycosides salicortin and tremulacin in immature and mature foliage of the trembling aspen (Populus tremuloides) clones 216, 259, and 271.
Czech Academy of Sciences Publication Activity Database
Majer, Pavel; Jančařík, Andrej; Krečmerová, Marcela; Tichý, Tomáš; Tenora, Lukáš; Wozniak, K.; Wu, Y.; Pommier, E.; Ferraris, D.; Rais, R.; Slusher, B. S.
2016-01-01
Roč. 59, č. 6 (2016), s. 2810-2819 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : glutamate carboxypeptidase II * glutamate * 2-PMPA * prodrug Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Schreier, Luděk; Chomát, Miroslav; Doležel, Ivo
2001-01-01
Roč. 176, č. 1500 (2001), s. 259-266 ISSN 0072-4688 R&D Projects: GA ČR GA102/01/0181 Keywords : synchronous reluctance machine * torque pulsation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering
Cerium oxide for the destruction of chemical warfare agents: A comparison of synthetic routes
Czech Academy of Sciences Publication Activity Database
Janos, P.; Henych, Jiří; Pelant, O.; Pilařová, V.; Vrtoch, L.; Kormunda, M.; Mazanec, K.; Štengl, Václav
2016-01-01
Roč. 304, MAR (2016), s. 259-268 ISSN 0304-3894 Institutional support: RVO:61388980 Keywords : Cerium oxide * Chemical warfare agents * Organophosphate compounds * Decontamination Subject RIV: CA - Inorganic Chemistry Impact factor: 6.065, year: 2016
Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes
Czech Academy of Sciences Publication Activity Database
Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.
2015-01-01
Roč. 15, č. 2 (2015), s. 259-271 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015
Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP
Elementõ polititsheskoi mifologii Tjuttsheva (kommentari k state 1844 g.) / Aleksandr Ospovat
Ospovat, Aleksandr
1999-01-01
Bibl. lk. 259-263. Kokkuvõte inglise k. lk. 321. Kiri ajalehe "Allgemeine Zeitung" (Augsburg) toimetajale Gustav Kolbile (1844, prantsuse k.). Artikli venek. versioon (pealk. "Venemaa ja Saksamaa") publitseeriti ajakirjas Russki arhiv (1873, nr. 10)
Temperature-Dependent Kinetics of Grape Seed Phenolic Compounds Extraction: Experiment and Model
Czech Academy of Sciences Publication Activity Database
Bucic´-Kojic´, A.; Sovová, Helena; Planinic´, M.; Tomas, S.
2013-01-01
Roč. 136, 3-4 (2013), s. 1136-1140 ISSN 0308-8146 Institutional support: RVO:67985858 Keywords : kinetics modelling * temperature * grape seed Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.259, year: 2013
Enabling Teachers to Develop Pedagogically Sound and Technically Executable Learning Designs
Miao, Yongwu; Van der Klink, Marcel; Boon, Jo; Sloep, Peter; Koper, Rob
2008-01-01
Miao, Y., Van der Klink, M., Boon, J., Sloep, P. B., & Koper, R. (2009). Enabling Teachers to Develop Pedagogically Sound and Technically Executable Learning Designs [Special issue: Learning Design]. Distance Education, 30(2), 259-276.
Czech Academy of Sciences Publication Activity Database
Ramírez-Herrera, M.-T.; Bógalo, M.-F.; Černý, Jan; Goguitchaichvili, A.; Corona, N.; Machain, M. L.; Edwards, A. C.; Sosa, S.
2016-01-01
Roč. 259, April 15 (2016), s. 90-104 ISSN 0169-555X Institutional support: RVO:67985831 Keywords : Earthquake * magnetic properties * Mexican subduction * tsunami deposit Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.958, year: 2016
... range of counseling options and policies related to sales and access. Yet, while school officials should be ... 18–24: changes from 1998 to 2001. Annual Review of Public Health 26: 259–279, 2005. PMID: ...
Impact of ICTs on Local Democracy : Transparency and Citizen ...
International Development Research Centre (IDRC) Digital Library (Canada)
Impact of ICTs on Local Democracy : Transparency and Citizen Participation in the ... is characterized by great socioeconomic diversity and strong social networks ... of the population has access to computers, 25.9% of which use the Internet.
Czech Academy of Sciences Publication Activity Database
Lubecka, E. A.; Sikorska, E.; Sobolewski, D.; Prahl, A.; Slaninová, Jiřina; Ciarkowski, J.
2016-01-01
Roč. 106, č. 3 (2016), s. 245-259 ISSN 0006-3525 Institutional support: RVO:61388963 Keywords : desmopressin * deamino-vasopressin * anionic-zwitterionic micelles * liposomes * inverso analogs Subject RIV: CE - Biochemistry Impact factor: 1.908, year: 2016
Tetra(3,4-pyrido)porphyrazines Caught in the Cationic Cage: Toward Nanomolar Active Photosensitizers
Czech Academy of Sciences Publication Activity Database
Macháček, M.; Demuth, J.; Čermák, P.; Vavrečková, M.; Hrubá, L.; Jedličková, A.; Kubát, Pavel; Šimůnek, T.; Nováková, V.; Zimčík, P.
2016-01-01
Roč. 59, č. 20 (2016), s. 9443-9456 ISSN 0022-2623 Institutional support: RVO:61388955 Keywords : TARGETED PHOTODYNAMIC THERAPY * SINGLET OXYGEN * PHOTOPHYSICAL PROPERTIES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.259, year: 2016
2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Rota.
National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 16-17 September 2003 (JD 259-260) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Rota Island in...
... Testing Triglycerides Troponin Tryptase Tumor Markers Uric Acid Urinalysis Urine Albumin and Albumin/Creatinine Ratio Urine Culture ... 2010) 2536–259. Centers for Disease Control Hormone Standardization website(HoST). Available online at http://www.cdc. ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
RESEARCH ARTICLE Volume 96 Issue 2 June 2017 pp 251-259 ... is a chronic immuno-inflammatory disease characterized by inflammatory mediators and ... no notable differences between the multiple comparisons of rs28362491– rs696 ...
Philipp Weselsky - profesor chemie vídeňské techniky z Českomoravské vysočiny
Czech Academy of Sciences Publication Activity Database
Jindra, Jiří
2010-01-01
Roč. 43, č. 4 (2010), s. 255-259 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Vienna Technical university 1854-1884 * tuition of analytical chemistry * Philipp Weselsky Subject RIV: AB - History
beta-1,2,3-Triazolyl-Nucleosides as Nicotinamide Riboside Mimics
Czech Academy of Sciences Publication Activity Database
Amigues, E.J.; Armstrong, E.; Dvořáková, Marcela; Migaud, M.E.; Huang, M.
2009-01-01
Roč. 28, č. 3 (2009), s. 238-259 ISSN 1525-7770 Institutional research plan: CEZ:AV0Z50380511 Keywords : Nucleoside * nucleotide * sirtuin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.768, year: 2009
African Journals Online (AJOL)
2010-03-05
–93; Viljoen 2007:259). Scholars have noticed the co-existence of universalism and particularism (Guthrie 1990:29–30). Readers too would have been prepared regarding this matter (Hubbard 1974:86). For example, we may ...
Czech Academy of Sciences Publication Activity Database
Nováková, Z.; Bobálová, Janette; Vidová, M.; Hapala, I.; Šmigáň, P.
2009-01-01
Roč. 298, č. 2 (2009), s. 255-259 ISSN 0378-1097 Institutional research plan: CEZ:AV0Z40310501 Keywords : methanoarchaea * bioenergetics * tributyltin resistance Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.199, year: 2009
Progress and prospects in rat genetics: a community view
Czech Academy of Sciences Publication Activity Database
Aitman, T. J.; Critser, J.K.; Cuppen, E.; Dominiczak, A.; Fernandez-Suarez, X.M.; Flint, J.; Gauguier, D.; Geurts, A.M.; Gould, M.; Harris, P.C.; Holmdahl, R.; Hubner, N.; Izsvák, Z.; Jacob, H. J.; Kuramoto, T.; Kwitek, A.E.; Marrone, A.; Mashimo, T.; Moreno, C.; Mullins, J.; Mullins, L.; Olsson, T.; Pravenec, Michal; Riley, L.; Saar, K.; Serikawa, T.; Shull, J.D.; Szpirer, C.; Twigger, S.N.; Voigt, B.; Worley, K.
2008-01-01
Roč. 40, č. 5 (2008), s. 516-522 ISSN 1061-4036 Institutional research plan: CEZ:AV0Z50110509 Keywords : white paper * rat * genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008
Indian Academy of Sciences (India)
symmetric po- tentials. 323. Arpornthip Tanwa. Conduction bands in classical periodic potentials. 259. Asfaw A see Chaudhary A K. 731. Aslan Ö see Özdemir Z Guven. 755. Asnani Himanshu. Effective mass theory of a two-dimen-.
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte
Digital Repository Service at National Institute of Oceanography (India)
Achuthankutty, C.T.
fragment length polymorphism (RFLP) analysis. An oilgonucleotide sequence designed from the 18S ribosomal RNA gene (nucleotide position 259-276) provided a sensitive probe for the Family Mactridae, to which S. solidissima belongs. DNA of unknown larvae...
Seismic communication in demon African mole rat Tachyoryctes daemon from Tanzania
Czech Academy of Sciences Publication Activity Database
Hrouzková, E.; Dvořáková, V.; Jedlička, Petr; Šumbera, R.
2013-01-01
Roč. 31, č. 3 (2013), s. 255-259 ISSN 0289-0771 Institutional support: RVO:67985530 Keywords : seismic communication * substrate-borne vibration * subterranean mammal Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.790, year: 2013
Directory of Open Access Journals (Sweden)
Ida E Andersson
Full Text Available The glycopeptide fragment CII259-273 from type II collagen (CII binds to the murine A(q and human DR4 class II Major Histocompatibility Complex (MHC II proteins, which are associated with development of murine collagen-induced arthritis (CIA and rheumatoid arthritis (RA, respectively. It has been shown that CII259-273 can be used in therapeutic vaccination of CIA. This glycopeptide also elicits responses from T-cells obtained from RA patients, which indicates that it has an important role in RA as well. We now present a methodology for studies of (glycopeptide-receptor interactions based on a combination of structure-based virtual screening, ligand-based statistical molecular design and biological evaluations. This methodology included the design of a CII259-273 glycopeptide library in which two anchor positions crucial for binding in pockets of A(q and DR4 were varied. Synthesis and biological evaluation of the designed glycopeptides provided novel structure-activity relationship (SAR understanding of binding to A(q and DR4. Glycopeptides that retained high affinities for these MHC II proteins and induced strong responses in panels of T-cell hybridomas were also identified. An analysis of all the responses revealed groups of glycopeptides with different response patterns that are of high interest for vaccination studies in CIA. Moreover, the SAR understanding obtained in this study provides a platform for the design of second-generation glycopeptides with tuned MHC affinities and T-cell responses.
Susceptibility of Some Bacterial Contaminants Recovered from ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research February 2014; 13 (2): 255-259. ISSN: 1596-5996 (print); .... buffer pH 7. ... of each container are also given in Table 1. .... This investigation was performed to find out .... Microbiological quality of.
Czech Academy of Sciences Publication Activity Database
Šorf, M.; Devetter, Miloslav
2011-01-01
Roč. 47, č. 3 (2011), s. 259-268 ISSN 0003-4088 Institutional research plan: CEZ:AV0Z60660521 Keywords : limnetic zone * littoral zone * seasonal succession Subject RIV: EH - Ecology, Behaviour Impact factor: 0.930, year: 2011
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 3. Drug Metabolism: A Fascinating Link Between Chemistry and Biology. Nikhil Taxak Prasad V Bharatam. General Article Volume 19 Issue 3 March 2014 pp 259-282 ...
Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva
Czech Academy of Sciences Publication Activity Database
Psota, V.; Čmelík, Richard; Sachambula, L.
2011-01-01
Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...
Socio-Cultural Dimensions and Attitude of Women and Community ...
African Journals Online (AJOL)
Toshiba
freedom = 6, P < 0.01 and Contingency coefficient (C) of 0.259. Vol. ..... For the sake of marital harmony in the contemporary time when .... mental view or disposition. Attitudes are .... Integrating the Prevention and Management of the Health.
Qualitative study on maternal referrals in rural Tanzania: Decision ...
African Journals Online (AJOL)
Administrator
discussions (FGDs) with health workers and community members, stratified by age and ..... health facilities and not listening carefully ..... Projects. Int J Gynaecol Obstet. 1997(59). S259-S265. 22. Campbell O, Koblinsky M, Taylor P. Off to.
Empirical evidence for large X-effects in animals with undifferentiated sex chromosomes
Czech Academy of Sciences Publication Activity Database
Dufresnes, C.; Majtyka, T.; Baird, Stuart J. E.; Gerchen, J. F.; Borzée, A.; Savary, R.; Ogielska, M.; Perrin, N.; Stöck, M.
2016-01-01
Roč. 6, č. 21029 (2016), s. 21029 ISSN 2045-2322 Institutional support: RVO:68081766 Keywords : controlled study * genetic marker * hybrid zone * Hyla * introgression * sex chromosome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016
Dicty_cDB: Contig-U13120-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available id:none) Chromocleista malachitea isolate C... 311 2e-83 FJ358413_1( FJ358413 |pid:none) Leucothecium emdeni...pid:none) Gymnoascus reesii isolate CBS 259.... 312 1e-83 FJ358409_1( FJ358409 |p
Czech Academy of Sciences Publication Activity Database
Sejkora, J.; Novotný, P.; Novák, M.; Šrein, Vladimír; Berlepsch, P.
2005-01-01
Roč. 43, č. 4 (2005), 1393-1400 ISSN 0008-4476 Institutional research plan: CEZ:AV0Z30460519 Keywords : calciopetersite * new mineral species * X-ray poder diffraction Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.259, year: 2005
Tallink võttis kompromissi vastu, ametiühing mitte / Helga Koger
Koger, Helga, 1945-
2008-01-01
Tallink võttis vastu riikliku lepitaja kompromissettepaneku ja on valmis tõstma Eesti lipu all sõitvate laevade töötajate eelmises palgaleppes fikseeritud palka järgmisel kolmel aastal vastavalt 25,9 ja 6 protsendi võrra
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
Influence of seeing effects on cloud model inversions
Czech Academy of Sciences Publication Activity Database
Tziotziou, K.; Heinzel, Petr; Tsiropoula, G.
2007-01-01
Roč. 472, č. 1 (2007), s. 287-292 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : cloud model * inversions * seeing effects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007
Maximum effort in the minimum-effort game
Czech Academy of Sciences Publication Activity Database
Engelmann, Dirk; Normann, H.-T.
2010-01-01
Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
Eestlased riisusid Balti fotovõistlusel koore
2011-01-01
Eesti, Läti ja Leedu fotovõistlusest, kus valiti Baltikumi parimad loodusfotod ja maaelu kajastavad fotod. Osales 259 fotograafi. Parim loodusfoto oli Kaido Haageni "Kus sa oled, mu sõber" ning parim foto maaelu kategoorias Arne Aderi "Jõuluks koju"
2010-10-01
... of the applicant's actual intentions. Vague or contingent objectives will not be acceptable. (b...-carrying capacity, age, length, type of fishing gear, number of passengers carried or in the case of...) General characteristics (i.e., net tonnage, fish-carrying capacity, age, length, type of fishing gear...
SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID
International Nuclear Information System (INIS)
Annamalai, Gopiraj; Watanabe, Yoichi
2016-01-01
Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm 2 – 25×25 cm 2 at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship
SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID
Energy Technology Data Exchange (ETDEWEB)
Annamalai, Gopiraj [Government Arignar Anna Memorial Cancer Hospital & Research Institute, Kanchipuram, TAMILNADU (India); Watanabe, Yoichi [University of Minnesota, Minneapolis, MN (United States)
2016-06-15
Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm{sup 2} – 25×25 cm{sup 2} at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship.
liver cirrhosis from autoimmune hepatitis in a nigerian woman
African Journals Online (AJOL)
Autoimmune hepatitis (AIH) is a rare cause of chronic liver disease (CLD). It presents with ... chronic viral hepatitis and alcoholic liver disease, making it difficult to diagnose in .... effects.2,5,9 We opted for the Budesonide/AZA therapy because ...
Central Gi(2) proteins, sympathetic nervous system and blood pressure regulation
Czech Academy of Sciences Publication Activity Database
Zicha, Josef
2016-01-01
Roč. 216, č. 3 (2016), s. 258-259 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : inhibitory G proteins * sympathetic nervous system * central blood pressure control Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.867, year: 2016
African Journals Online (AJOL)
Owner
and consensual sex is shown to be problematic in the relationship between David ... Sheila Jeffreys (Prostitution 259) does not use the word rape, but calls ... The canzone or ballad “La donna è mobile” is from Verdi's opera Rigoletto and can.
New taxa and new records of oribatid mites of the family Galumnidae (Acari: Oribatida) from Ecuador
Czech Academy of Sciences Publication Activity Database
Ermilov, S.G.; Starý, Josef; Sandmann, D.; Marian, F.; Maraun, M.
2013-01-01
Roč. 3700, č. 2 (2013), s. 259-270 ISSN 1175-5326 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : Oribatida * Galumnidae * new species * Ecuador Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013
ETHNOBOTANICAL STUDIES OF WEST AFRICAN OKRA ...
African Journals Online (AJOL)
Administrator
18-87 years old. Of this number, 259 (48%) ... Traditional uses of the crop include food (100%) and non- ... inter-relationship studies between people and plants in the ..... of economic plants sold in the market of Benin City (Edo State). Nigeria.
New mixed ligand complexes of ruthenium(II) that incorporate a ...
Indian Academy of Sciences (India)
Unknown
infrared, UV-Vis, steady-state emission and 1H NMR spectroscopic methods. Results ... Deionised, triply distilled water was used for preparing various buffers. .... 259 nm in CH3CN containing a drop of HCl (acid was added to ensure complete.
Effect of enzyme/substrate ratio on the antioxidant properties of ...
African Journals Online (AJOL)
Dr (Mrs) O.Fasasi
2012-06-21
Jun 21, 2012 ... Department of Food Science and Technology, P. M. B. 704, Federal University of Technology, ... of East Africa and it is cultivated for both its seeds and ..... inhibit lipid oxidation in cooked pork patties, Meat Sci., 64: 259-263.
Halogen Bonding in Nucleic Acid Complexes
Czech Academy of Sciences Publication Activity Database
Kolář, Michal H.; Tabarrini, O.
2017-01-01
Roč. 60, č. 21 (2017), s. 8681-8690 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : aldose reductase inhibition * minor groove binders * medicinal chemistry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.259, year: 2016
Human-Centered Technology for Maintainability: Workshop Proceedings
1991-06-01
INT E RNAL) POPLITEAL STATION-ANKLE JOINT-- -* A (LOCATOR) AFTANKLE .... -. REANKLE ANKLE JOINT HT., STANDING---... - , FOREFOOT AFTFOOT...to strike down missile containers in the weapons elevator nwd stack them within the confines of the magazine. 259 Mechanized support equipment models
Evolutionary plasticity of restorer-of-fertility-like proteins in rice
Czech Academy of Sciences Publication Activity Database
Melonek, J.; Stone, James D.; Small, I.
2016-01-01
Roč. 6, Oct 24 (2016), s. 1-12, č. článku 35152. ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : cytoplasmic male-sterility * genome-wide analysis * PPR protein Subject RIV: EF - Botanics Impact factor: 4.259, year: 2016
Letopis na cestě ke kronice. Počátky beletrizace analistického textu
Czech Academy of Sciences Publication Activity Database
Černá, Alena M.
2012-01-01
Roč. 4, č. 2 (2012), s. 259-270 ISSN 1804-0977 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : Old Bohemian Annals * Old Czech * historical stylistics Subject RIV: AI - Linguistics
Czech Academy of Sciences Publication Activity Database
Adamík, P.; Emmenegger, T.; Briedis, M.; Gustafsson, L.; Henshaw, I.; Krist, M.; Laaksonen, T.; Liechti, F.; Procházka, Petr; Salewski, V.; Hahn, S.
2016-01-01
Roč. 6, č. 21560 (2016), s. 21560 ISSN 2045-2322 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : Animal behaviour * Animal migration Subject RIV: EG - Zoology Impact factor: 4.259, year: 2016
Probiotic activities of Rhizobium laguerreae on growth and quality of spinach
Czech Academy of Sciences Publication Activity Database
Jimenez-Gomez, A.; Flores-Felix, J.D.; García-Fraile, Paula; Mateos, P.F.; Menéndez, E.; Velazquez, E.; Rivas, R.
2018-01-01
Roč. 8, JAN 10 (2018), č. článku 295. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : ZEA-MAYS L. * PROMOTING RHIZOBACTERIA * MEDITERRANEAN DIET Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016
Nitrate reducing activity pervades surface waters during upwelling.
Digital Repository Service at National Institute of Oceanography (India)
Fernandes, S.O.; Halarnekar, R.; Malik, A.; Vijayan, V.; Varik, S.; RituKumari; Jineesh V.K.; Gauns, M.U.; Nair, S.; LokaBharathi, P.A.
.A., Roson, G., Perez, F.F., Figueiras, F.G., Pazos, Y., 1996. Nitrogen cycling in an estuarine upwelling system, the Ria de Arousa (NW Spain). Short-time-scale patterns of hydrodynamic and biogeochemical circulation. Mar. Ecol. Prog. Ser. 135, 259...
78 FR 31599 - Notice of Quarterly Report (January 2013-March 31, 2013)
2013-05-24
... and secondary pipelines (kilometers). Restructure and rehabilitate tertiary pipelines (kilometers...,259 Increase the $30,030,971 Screening for adoption of hypertension behaviors that (percent). reduce... implementation. Secondary National Roads $214,493,000 Reduce $27,440,528 Kilometers of road Development Project...
Cyclin a down - regulation in TGFb1 - arrested follicular lymphoma cells
Czech Academy of Sciences Publication Activity Database
Djaborkhel, Rashed; Tvrdík, Daniel; Eckschlager, T.; Raška, Ivan; Müller, Julius
2000-01-01
Roč. 261, - (2000), s. 250-259 ISSN 0014-4827 R&D Projects: GA ČR GA304/00/1481 Institutional research plan: CEZ:AV0Z5039906 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.860, year: 2000
Czech Academy of Sciences Publication Activity Database
Arkhipov, Ie.I.; Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.
2016-01-01
Roč. 6, Sep (2016), 1-12, č. článku 33802. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : four-mode Gaussian states * parametric down-conversion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Šárovcová, Martina
Suppl., č. 2 (2015), s. 259-278 ISSN 0015-1831 Institutional support: RVO:68378033 Keywords : music manuscripts * Utraquism * Bohemian Reformation * illuminated fragments * Jan Hus * Fabián Puléř * early modern illuminated manuscripts Subject RIV: AL - Art, Architecture, Cultural Heritage
Lee, Seon Hwa; Matsushima, Keita; Miyamoto, Kohei; Oe, Tomoyuki
2016-02-05
Ultraviolet (UV) radiation is the major environmental factor that causes oxidative skin damage. Keratins are the main constituents of human skin and have been identified as oxidative target proteins. We have recently developed a mass spectrometry (MS)-based non-invasive proteomic methodology to screen oxidative modifications in human skin keratins. Using this methodology, UV effects on methionine (Met) oxidation in human skin keratins were investigated. The initial screening revealed that Met(259), Met(262), and Met(296) in K1 keratin were the most susceptible oxidation sites upon UVA (or UVB) irradiation of human tape-stripped skin. Subsequent liquid chromatography/electrospray ionization-MS and tandem MS analyses confirmed amino acid sequences and oxidation sites of tryptic peptides D(290)VDGAYMTK(298) (P1) and N(258)MQDMVEDYR(267) (P2). The relative oxidation levels of P1 and P2 increased in a time-dependent manner upon UVA irradiation. Butylated hydroxytoluene was the most effective antioxidant for artifactual oxidation of Met residues. The relative oxidation levels of P1 and P2 after UVA irradiation for 48 h corresponded to treatment with 100mM hydrogen peroxide for 15 min. In addition, Met(259) was oxidized by only UVA irradiation. The Met sites identified in conjunction with the current proteomic methodology can be used to evaluate skin damage under various conditions of oxidative stress. We demonstrated that the relative Met oxidation levels in keratins directly reflected UV-induced damages to human tape-stripped skin. Human skin proteins isolated by tape stripping were analyzed by MS-based non-invasive proteomic methodology. Met(259), Met(262), and Met(296) in K1 keratin were the most susceptible oxidation sites upon UV irradiation. Met(259) was oxidized by only UVA irradiation. Quantitative LC/ESI-SRM/MS analyses confirmed a time-dependent increase in the relative oxidation of target peptides (P1 and P2) containing these Met residues, upon UVA irradiation
Bartels-Velthuis, A. A.; Blijd-Hoogewys, E. M. A.; van Os, J.
Objective: To examine the social cognitive vulnerabilities mediating delusion formation in children presenting with hallucinatory experiences. Method: A sample of 259 12- and 13-year-old children, from a baseline case-control sample of children with and without auditory hallucinations (AH), were
Emslie, Graham J.; Ventura, Daniel; Korotzer, Andrew; Tourkodimitris, Stavros
2009-01-01
A randomized, double-blind, placebo-controlled trial that involves 312 male and female patients aged 12-17 reveal the effectiveness of escitalopram in the treatment of depressed adolescents. Eighty-three percent of the participants or 259 participants completed the 8 weeks therapy period.
Spindle Cell Metaplastic Breast Cancer: Case Report
Directory of Open Access Journals (Sweden)
Dursun Ozgur Karakas
2013-08-01
Conclusion: Spindle cell metaplastic breast cancer must be considered in differential diagnosis of breast cancers, and preoperative immunohistochemical examination, including cytokeratin and vimentin, must be added to pathological examination in intervening cases. [Arch Clin Exp Surg 2013; 2(4.000: 259-262
Czech Academy of Sciences Publication Activity Database
Kozáková, Radka; Pokorný, Petr
2007-01-01
Roč. 79, - (2007), s. 259-281 ISSN 0032-7786 R&D Projects: GA AV ČR(CZ) IAAX00020701 Institutional research plan: CEZ:AV0Z80020508 Keywords : pollen analysis Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.064, year: 2007
Czech Academy of Sciences Publication Activity Database
Dvorský, Miroslav; Chlumská, Zuzana; Altman, Jan; Čapková, K.; Řeháková, Klára; Macek, Martin; Kopecký, Martin; Liancourt, Pierre; Doležal, Jiří
2016-01-01
Roč. 6, č. 24440 (2016), s. 1-10 ISSN 2045-2322 R&D Projects: GA ČR GA13-13368S Institutional support: RVO:67985939 Keywords : Tibetan Plateau * warming * elevational limit Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016
Experimental study and thermodynamic modelling of the B-Fe-Mn ternary system
Czech Academy of Sciences Publication Activity Database
Repovský, P.; Homolová, V.; Čiripová, L.; Kroupa, Aleš; Zemanová, Adéla
2016-01-01
Roč. 55, DEC (2016), s. 252-259 ISSN 0364-5916 R&D Projects: GA ČR GA14-15576S Institutional support: RVO:68081723 Keywords : thermodynamic modelling * phase diagram * borides Subject RIV: BJ - Thermodynamic s Impact factor: 1.600, year: 2016
Pillai, Prof. Valliyil Narayanan Rajasekharan
Indian Academy of Sciences (India)
Date of birth: 20 October 1949. Specialization: Bio-organic Chemistry, Synthetic Organic Chemistry & Macromolecular Science Address: Harishree, S-31, Medical College Road, Gandhinagar P.O., Kottayam 686 008, Kerala Contact: Residence: (0481) 259 7885. Mobile: 99958 24472. Email: rajasekharpillai@gmail.com, ...
Czech Academy of Sciences Publication Activity Database
Kroneková, Z.; Pelach, M.; Mazancová, P.; Uhelská, L.; Treľová, D.; Rázga, F.; Némethová, V.; Szalai, S.; Chorvát, D.; McGarrigle, J. J.; Omami, M.; Isa, D.; Ghani, S.; Majková, E.; Oberholzer, J.; Raus, Vladimír; Šiffalovič, P.; Lacík, I.
2018-01-01
Roč. 8, 26 January (2018), s. 1-12, č. článku 1637. ISSN 2045-2322 Institutional support: RVO:61389013 Keywords : confocal Raman microscopy * alginate * microcapsule Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Jahanban-Esfahlan, R.; Seidi, K.; Monhemi, H.; Adli, A.D.F.; Minofar, Babak; Zare, P.; Farajzadeh, D.; Farajnia, S.; Behzadi, R.; Abbasi, M.M.; Zarghami, N.; Javaheri, T.
2017-01-01
Roč. 7, AUG 15 (2017), s. 1-14, č. článku 8126. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : TISSUE-FACTOR * FACTOR-VIIA * STAPHYLOCOAGULASE Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016
Photoacoustic Sounds from Meteors
Czech Academy of Sciences Publication Activity Database
Spalding, R.; Tencer, J.; Sweatt, W.; Conley, B.; Hogan, R.; Boslough, M.B.; Gonzales, G.; Spurný, Pavel
2017-01-01
Roč. 7, February (2017), 41251/1-41251/6 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : photoacoustic coupling * experimental results * numerical models Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.259, year: 2016
Success factors in new ventures : A meta-analysis
Song, Michael; Podoynitsyna, Ksenia; van der Bijl, H.M.; Halman, Johannes I.M.
2008-01-01
Technology entrepreneurship is key to economic development. New technology ventures (NTVs) can have positive effects on employment and could rejuvenate industries with disruptive technologies. However, NTVs have a limited survival rate. In our most recent empirical study of 11,259 NTVs established
Success factors in new ventures : a meta-analysis
Song, Michael; Podoynitsyna, K.S.; Bij, van der J.D.; Halman, J.I.M.
2008-01-01
Technology entrepreneurship is key to economic development. New technology ventures (NTVs) can have positive effects on employment and could rejuvenate industries with disruptive technologies. However, NTVs have a limited survival rate. In our most recent empirical study of 11,259 NTVs established
Mazzi, M.A.; Bensing, J.; Rimondini, M.; Fletcher, I.; Vliet, L. van; Zimmermann, C.; Deveugele, M.
2013-01-01
Objective: To establish which kind of physician communicative responses to patient cues and concerns are appreciated by lay people. Methods: A balanced sample (259 people) was recruited in public places to participate in a full day observation of four videotaped standardized medical consultations.
A Gateway((R)) -compatible bacterial adenylate cyclase-based two-hybrid system
Czech Academy of Sciences Publication Activity Database
Ouellette, S. P.; Gauliard, E.; Antošová, Zuzana; Ladant, D.
2014-01-01
Roč. 6, č. 3 (2014), s. 259-267 ISSN 1758-2229 Institutional support: RVO:67985823 Keywords : bacterial two-hybrid system * protein–protein interactions * cell division * Gateway((R))(GW) cloning system Subject RIV: EE - Microbiology, Virology Impact factor: 3.293, year: 2014
In-situ prepared polyaniline-silver composites: single- and two-step strategies
Czech Academy of Sciences Publication Activity Database
Bober, Patrycja; Stejskal, Jaroslav; Trchová, Miroslava; Prokeš, J.
2014-01-01
Roč. 122, 10 March (2014), s. 259-266 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : composites * conducting polymer * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.504, year: 2014
Intergenerational Solidarity and Support Between Adult Siblings
Voorpostel, Marieke; Blieszner, Rosemary
2008-01-01
Using a Dutch national sample containing 1,259 triads (two siblings, one parent), we examined whether practical support and emotional support between siblings are enhanced by intergenerational solidarity and how this differs for brothers and sisters. Sibling support was affected by sibling dyad
D.F. Karnosky; B. Mankovska; K. Percy; R.E. Dickson; G.K. Podila; J. Sober; A. Noormets; G. Hendrey; Mark D. Coleman; M. Kubiske; K.S. Pregitzer; J.G. Isebrands
1999-01-01
Abstract. Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[(O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3...
Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti
Czech Academy of Sciences Publication Activity Database
Ďurďovič, Martin
2014-01-01
Roč. 36, č. 3 (2014), s. 259-281 ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281
African Zoology - Vol 24, No 4 (1989)
African Journals Online (AJOL)
Fine structure of endogenous stages of Eimeria turcicus developing in gall bladder epithelium of the gecko Hemidactylus turcicus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I Paperna, J.H. Landsberg, 251-259 ...
African Journals Online (AJOL)
AUNTY TEE
people as well as other peoples in Nigeria and the world over. These cultural ... This very popular global story connects us, the Benin people, to other parts of ..... for Local History, Cultural Heritage and Folk Studies, 6 (2), 259-. 279. Omoera ...
Mathematical description of the nonlinear chemical reactions with ...
Indian Academy of Sciences (India)
more complex and different. In this paper, we ... for complex oscillations with an autocatalytic stage in .... A) with sodium hydroxide (used as a reagent X). 0. 10. 20. 30 ... Time [a.u.] ..... Decroly O and Goldbeter A 1984 Physics Letters 105A. 259.
Directory of Open Access Journals (Sweden)
Faustino Núñez Batalla
2018-06-01
Full Text Available Núñez, F. et al. (2018: “Diagnóstico y tratamiento precoz de la hipoacusia unilateral o asimétrica en la infancia: recomendaciones CODEPEH 2017”. Revista Española de Discapacidad, 6 (I: 259-280.
Czech Academy of Sciences Publication Activity Database
Malina, Jaroslav; Hannon, Michael J.; Brabec, Viktor
2016-01-01
Roč. 6, JUL2016 (2016) ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA16-03517S Institutional support: RVO:68081707 Keywords : DINUCLEAR RUTHENIUM(II) COMPLEX * METALLOSUPRAMOLECULAR CYLINDERS * BIOLOGICAL EVALUATION Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016
Directory of Open Access Journals (Sweden)
Maria Zirra
2017-12-01
Full Text Available James L. Baughman, Jennifer Ratner-Rosenhagen, and James P. Danky, eds, Protest on the Page: Essays on Print and the Culture of Dissent since 1865 (Madison: University of Wisconsin Press, 2015. xv + 259 pp. ISBN 978-0-299-30284-9.
Use of indigenous knowledge in the management of field and ...
African Journals Online (AJOL)
EJIRO
African Journal of Environmental Science and Technology Vol. 3 (9), pp. 251-259 .... that an acre can to produce between 3 and 72 bags ..... Leaves of Eucalyptus are taken, air dried and grinded, and the resulting powder is mixed with the ...
Hypersaline sapropels act as hotspots for microbial dark matter
Czech Academy of Sciences Publication Activity Database
Andrei, Adrian-Stefan; Baricz, A.; Robeson, M. S.; Pauşan, M. R.; Tamaş, T.; Chiriac, C.; Szekeres, E.; Barbu-Tudoran, L.; Levei, E. A.; Coman, C.; Podar, M.; Banciu, H.L.
2017-01-01
Roč. 7, č. 1 (2017), č. článku 6150. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : 16S RIBOSOMAL-RNA * HALOPHILIC ARCHAEA * lake-sediments Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Ali, A. H.
2014-01-01
Roč. 87, č. 3 (2014), s. 259-271 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : systematic status * India * Philometridae Subject RIV: EA - Cell Biology Impact factor: 1.336, year: 2014
Studies on improved Agrobacterium-mediated transformation in two ...
African Journals Online (AJOL)
Administrator
168-169. Saharan V,Yadav RC,Yadav NR, Chapagain BP (2004). High frequency plant regeneration from desiccated calli of indica rice. (Oryza sativa L.). Afr. J. Biotechnol. 3:256-259. Sivamani E, Huet H, Shen P, Ong C, Kochko A, Beachy RN ...
African Journals Online (AJOL)
Femi
Only about half of surveyed men were found to use ... Influencing men's attitude towards the uptake of ... survey of 259 men aged 15-65 years with at least one child less than 3 years of age was conducted ... been fully explored in Nigeria.
Salvage radiation therapy following radical prostatectomy. A national Danish study
DEFF Research Database (Denmark)
Ervandian, Maria; Høyer, Morten; Petersen, Stine Elleberg
2015-01-01
BACKGROUND: The purpose of this observational cohort study was to evaluate the outcome and prognostic factors following salvage radiotherapy (SRT) in a consecutive national cohort. MATERIAL AND METHODS: Between 2006 and 2010, 259 patients received SRT in Denmark. Patient- and cancer-related chara...
Coding accuracy on the psychophysical scale
Czech Academy of Sciences Publication Activity Database
Košťál, Lubomír; Lánský, Petr
2016-01-01
Roč. 6, Mar 29 (2016), s. 23810 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-08066S Institutional support: RVO:67985823 Keywords : cortex * neural decoding * senzory processing Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Donkeng Dazie, Joel; Liška, Alan; Ludvík, Jiří
2016-01-01
Roč. 163, č. 9 (2016), G127-G132 ISSN 0013-4651 R&D Projects: GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : electrochemistry * quantum chemical study * amines Subject RIV: CG - Electrochemistry Impact factor: 3.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Nedelcovych, M. T.; Tenora, Lukáš; Kim, B. H.; Kelschenbach, J.; Chao, W.; Hadas, E.; Jančařík, Andrej; Prchalová, Eva; Zimmermann, S. C.; Dash, R. P.; Gadiano, A. J.; Garrett, C.; Furtmüller, G.; Oh, B.; Brandacher, G.; Alt, J.; Majer, Pavel; Volsky, D.J.; Rais, R.; Slusher, B. S.
2017-01-01
Roč. 60, č. 16 (2017), s. 7186-7198 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : long-term potentiation * magnetic resonance spectroscopy * virus type 1 encephalitis Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Baron, I.; Plan, L.; Grasemann, B.; Mitrovic, I.; Lenhardt, W.; Hausmann, H.; Stemberk, Josef
2016-01-01
Roč. 259, APR 15 (2016), 81-89 ISSN 0169-555X Grant - others:Austrian Science Fund(AT) P25884-N29 Institutional support: RVO:67985891 Keywords : tectonic strain * slope failure * earthquake Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.958, year: 2016
Estructura y funcionamiento de un servicio de cirugía mayor ambulatoria y de corta hospitalización
Directory of Open Access Journals (Sweden)
Juan Carlos Domínguez Lanuza
1999-04-01
Full Text Available Se realizó estudio de la estructura y funcionamiento del Servicio de Cirugía Ambulatoria y de Corta Hospitalización del Hospital Clinicoquirúrgico Docente "Miguel Enríquez", desde su creación en abril de 1989 hasta diciembre de 1995, donde se analizaron el total de intervenciones mayores (12 259 por las diferentes especialidades quirúrgicas, así como el organigrama de trabajo, y se constató un bajo índice de complicaciones (4,7 %A study of the structure and functioning of the Service of Ambulatory Surgery and of Short Hospitalization of the "Miguel Enríquez" Clinical and Surgical Teaching Hospital since its creation in April, 1989, to December, 1995, was conducted. The total amount of major procedures (12 259 by different surgical specialities and the working flowchart were analyzed. A low index of complications (4.7 % was obtained
Trotter, John; Johnston, Judith; Ng, Alvin; Gatt, Marcel; MacFie, John; McNaught, Clare
2018-05-01
Introduction Studies have reported on the use of frailty as a prognostic indicator in patients undergoing elective surgery. Similar data do not exist for patients undergoing emergency surgery. The aim of this study was to evaluate the effect of preoperative sarcopenia measured by computed tomography (CT) on outcome following emergency laparotomy. Materials and methods Data from the National Emergency Laparotomy Audit database were retrieved for patients who had undergone an emergency laparotomy over 12 months at York NHS Foundation Trust. Sarcopenia was assessed by psoas density and area on preoperative CT. Mortality rates at 30 days and 1 year were recorded. Secondary outcomes included discharge rates to non-independent living. Results A total of 259 patients were included. Overall cohort 30-day and 1-year mortality was 13.9% (36/259) and 28.2% (73/259), respectively. Sarcopenia measured by psoas density was associated with increased mortality compared with patients who did not develop sarcopenia at 30 days (29.7%, 19/64, vs. 8.7%, 17/195; P sarcopenia measured by psoas area at 30 days (21.3%, 13/61, vs. 9.1%, 17/187; OR 2.71; 95%CI 1.23-5.96, P = 0.013) and at 1 year (42.6%, 26/61, vs. 20.9%, 39/187; OR 2.82; 95% CI 1.52-5.23, P Sarcopenia assessed by measurement of psoas density and area on CT is associated with increased mortality following emergency laparotomy. The use of sarcopenia as a predictive tool merits further attention and may be useful in patients undergoing emergency surgery.
The application of surgical procedure manager (SPM): first experience with FESS.
Feige, Katharina; Gollnick, Iris; Schmitz, Pia; Strauss, Gero
2017-09-01
In our hypothesis, the newly developed program SPM (surgical procedure manager) will ensure successful standardization and efficiency of the FESS (functional endoscopic sinus surgery) and therefore make a decisive contribution in terms of economization and improvement of intraoperative quality. Between 27th March 2015 and 8th October 2015, data from 259 FESS procedures were collected using the SPM. The study took place at the surgical desk, an operating room in the ACQUA clinic in Leipzig, Germany. 233 FESS (90%) of the total FESS (n = 259, 100%) were conducted entirely with SPM. 26 SPM terminations (10%) of 259 FESS remain, which are classified as actual SPM terminations-when the surgeon intentionally stops the SPM. The maximum time slot decreased clearly from 1 h 39 min (period A) to 1 h 10 min (period B). A time reduction can also be seen with the minimum duration of 13.5 min compared to 11 min. The variability of the time slot also decreases since the standard deviation is reduced by 4.5 min. On the basis of available recordings it can be postulated that the application of SPM is suitable for standardization for FESS. Standardization by means of SPM and minimal development can be recognized over a period of time. The SPM makes it possible to transfer the general advantages of mechanization on a concrete FESS and do not influence the medical processes nor even restrict the medical freedom. The users are still entirely free in the implementation of the respective procedure.
Vegetable and animal products as determinants of colon cancer risk in Dutch men and women
Kampman, E.; Verhoeven, D.; Sloots, L.; Veer, P. van 't
1995-01-01
To examine the relationship between colon cancer and food groups from vegetable or animal sources and their possible interactions with gender, we analyzed data from a Dutch case-control study. Dietary patterns were assessed for 232 colon cancer cases and 259 population controls. In multivariate
Operational test report for 2706-T complex liquid transfer system
International Nuclear Information System (INIS)
BENZEL, H.R.
1999-01-01
This document is the Operational Test Report (OTR). It enters the Record Copy of the W-259 Operational Test Procedure (HNF-3610) into the document retrieval system. Additionally, the OTR summarizes significant issues associated with testing the 2706-T waste liquid transfer and storage system
78 FR 25939 - Submission for OMB Review; Comment Request
2013-05-03
...) is predominate, or designate land on which HEL is predominated to be set aside, diverted, devoted to... erosion. Description of Respondents: Individuals or households; Business or other for-profit; Not-for-profit institutions; Federal Government; State, Local or Tribal Government. Number of Respondents: 259...
Czech Academy of Sciences Publication Activity Database
Zhang, L.; Zhang, X.; Zhang, Y.; Wu, S.; Gelbič, Ivan; Xu, L.; Guan, X.
2016-01-01
Roč. 6, DEC 22 (2016), č. článku 39425. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * pest control * UV protection Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep39425
Determination of dissociation constants of cytokinins by capillary zone electrophoresis
Czech Academy of Sciences Publication Activity Database
Barták, P.; Bednář, P.; Stránský, Z.; Boček, Petr; Vespalec, Radim
2000-01-01
Roč. 878, č. 2 (2000), s. 249-259 ISSN 0021-9673 R&D Projects: GA MŠk VS96021; GA AV ČR IAA4031703; GA ČR GA203/99/0044 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.551, year: 2000
Czech Academy of Sciences Publication Activity Database
Štengl, Václav; Henych, Jiří; Matys Grygar, Tomáš; Pérez, Raul
2015-01-01
Roč. 61, JAN (2015), s. 259-269 ISSN 0025-5408 R&D Projects: GA ČR(CZ) GAP106/12/1116 Institutional support: RVO:61388980 Keywords : Nanostructured oxides * Stoichiometric degradation * Trimethyl phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015
Genetic Variation in the Leptin Receptor Gene, Leptin, and Weight Gain in Young Dutch Adults
Rossum, van C.T.M.; Hoebee, B.; Baak, van M.A.; Mars, M.; Saris, W.H.M.; Seidell, J.C.
2003-01-01
Objective: To investigate the association between leptin levels, polymorphisms in the leptin receptor (LEPR) gene, and weight gain. Research Methods and Procedures: From two large prospective cohorts in The Netherlands (n = 17, 500), we compared the baseline leptin of 259 subjects who had gained an
Czech Academy of Sciences Publication Activity Database
Masojídek, Jiří; Grobbelaar, J. U.; Pechar, Libor; Koblížek, Michal
2001-01-01
Roč. 23, č. 1 (2001), s. 57-66 ISSN 0142-7873 R&D Projects: GA ČR GA206/96/1222 Institutional research plan: CEZ:AV0Z5020903 Keywords : electron transport * evolution Subject RIV: CE - Biochemistry Impact factor: 1.259, year: 2001
Czech Academy of Sciences Publication Activity Database
Forgács, E.; Cserháti, T.; Mikšík, Ivan; Eckhardt, Adam; Deyl, Zdeněk
2004-01-01
Roč. 800, č. 1-2 (2004), s. 259-262 ISSN 1570-0232 Grant - others:CZ - HU(CZ) Cooperation programme Institutional research plan: CEZ:AV0Z5011922 Keywords : barbiturates * porous graphitized carbon Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.176, year: 2004
Czech Academy of Sciences Publication Activity Database
Strečková, M.; Füzer, J.; Kobera, Libor; Brus, Jiří; Fáberová, M.; Bureš, R.; Kollár, P.; Lauda, M.; Medvecký, L.; Girman, V.; Hadraba, Hynek; Baťková, M.; Baťko, I.
2014-01-01
Roč. 147, č. 3 (2014), s. 649-660 ISSN 0254-0584 Institutional support: RVO:61389013 ; RVO:68081723 Keywords : composite materials * magnetic materials * chemical synthesis Subject RIV: CD - Macromolecular Chemistry; JH - Ceramics, Fire-Resistant Materials and Glass (UFM-A) Impact factor: 2.259, year: 2014
Czech Academy of Sciences Publication Activity Database
Flegontov, P.; Changmai, P.; Zidkova, A.; Logacheva, M.D.; Altınışık, N. E.; Flegontova, Olga; Gelfand, M. S.; Gerasimov, E. S.; Khrameeva, E. E.; Konovalova, O. P.; Neretina, T.; Nikolsky, Y. V.; Starostin, G.; Stepanova, V. V.; Travinsky, I. V.; Tříska, M.; Tříska, P.; Tatarinova, T. V.
2016-01-01
Roč. 6, FEB 11 (2016), č. článku 20768. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : human populations * genetic variation * wide patterns * sequence * association * europeans * admixture * history * origin * tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Adolph, C.; Akhunzyanov, R.; Alexeev, M.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlák, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O.; Donskov, S. V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, E.; Hinterberger, F.; Höppner, Ch.; Horikawa, N.; d´Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jarý, V.; Jasinski, P.; Jörg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu. A.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Krämer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pesaro, G.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlüter, T.; Schmidt, K.; Schmieden, H.; Schönning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Steiger, L.; Stolarski, M.; Šulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.
2015-01-01
Roč. 744, MAY 11 (2015), s. 250-259 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : single spin asymmetries * scattering * distributions * ratio Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.787, year: 2015
Increased core body temperature in astronauts during long-duration space missions
Czech Academy of Sciences Publication Activity Database
Stahn, A. C.; Werner, A.; Opatz, O.; Maggioni, M. A.; Steinach, M.; von Ahlefeld, V. W.; Moore, A.; Crucian, B. E.; Smith, S. M.; Zwart, S. R.; Schlabs, T.; Mendt, S.; Trippel, T.; Koralewski, E.; Koch, J.; Chouker, A.; Reitz, Guenther; Shang, P.; Rocker, L.; Kirsch, K. A.; Gunga, H-C.
2017-01-01
Roč. 7, č. 11 (2017), č. článku 16180. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : core body temperature * astonauts' CBT * spaceflights Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering Impact factor: 4.259, year: 2016
A solution of David Galeďs lion and man problem
Czech Academy of Sciences Publication Activity Database
Sgall, Jiří
2001-01-01
Roč. 259, 1-2 (2001), s. 663-670 ISSN 0304-3975 R&D Projects: GA AV ČR IAA1019901; GA ČR GA201/97/P038 Keywords : combinatorial game theory Subject RIV: BA - General Mathematics Impact factor: 0.468, year: 2001
Rural Principal Leadership Skill Proficiency and Student Achievement
Winn, Pam; Erwin, Sue; Gentry, Jim; Cauble, Mary
2009-01-01
Because of the importance of developing highly skilled rural school leaders, statewide assessments of 259 rural Texas public school administrators were analyzed to determine principal confidence levels in leadership skill domains identified by the National Policy Board of Educational Administration (NPBEA). Important findings indicate differences…
Czech Academy of Sciences Publication Activity Database
Khalaji, A.D.; Ghoran, S.H.; Rohlíček, Jan; Dušek, Michal
2015-01-01
Roč. 56, č. 2 (2015), s. 259-265 ISSN 0022-4766 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : macrocyclic * Schiff base * spectroscopy * powder diffraction * orthorhombic Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.536, year: 2015
Czech Academy of Sciences Publication Activity Database
Covino, Stefano; Stella, Tatiana; D'Annibale, A.; Lladó, Salvador; Baldrian, Petr; Čvančarová, Monika; Cajthaml, Tomáš; Petruccioli, M.
2016-01-01
Roč. 566, OCT1 (2016), s. 250-259 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GA15-02328S Institutional support: RVO:61388971 Keywords : Oil-contaminated soil * Bioremediation * Contaminant bioavailability Subject RIV: EE - Microbiology, Virology Impact factor: 4.900, year: 2016
Three-dimensional 10-ring zeolites: The activities in toluene alkylation and disproportionation
Czech Academy of Sciences Publication Activity Database
Kubů, Martin; Žilková, Naděžda; Zones, S. I.; Chen, C.-Y.; Al-Khattaf, S.; Čejka, Jiří
2016-01-01
Roč. 259, JAN 2016 (2016), s. 97-106 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : 10-ring zeolites * TUN * IMF Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.636, year: 2016
An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials
Czech Academy of Sciences Publication Activity Database
Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.
2017-01-01
Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016
Junger, Marianne; Montoya, L.; Hartel, Pieter H.; Karemaker, M.
Dit onderzoek beschrijft de invloed van ICT op de 'traditionele' misdrijven door te onderzoeken hoe delicten als inbraak, overvallen en fraude doordrongen zijn van ICT. In totaal zijn 136 woninginbraken, 140 commerciële inbraken, 259 bedreigingen en 274 fraudeza-ken onderzocht. Uit de resultaten
Czech Academy of Sciences Publication Activity Database
Armstrong, C. T.; Mason, Philip E.; Anderson, J. L. R.; Dempsey, Ch. E.
2016-01-01
Roč. 6, Feb 22 (2016), č. článku 21759. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : K+ channel * potassium channels * sensing domain Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep21759
Characterization of natural leaf senescence in tobacco (Nicotiana tabacum) plants grown in vitro
Czech Academy of Sciences Publication Activity Database
Uzelac, B.; Janošević, D.; Simonović, A.; Motyka, Václav; Dobrev, Petre; Budimir, S.
2016-01-01
Roč. 253, č. 2 (2016), s. 259-275 ISSN 0033-183X R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Leaf senescence * Mesophyll ultrastructure * Phytohormones Subject RIV: EF - Botanics Impact factor: 2.870, year: 2016
2015-2016 Travel and Hospitality Expense Reports for Joanne ...
International Development Research Centre (IDRC) Digital Library (Canada)
Ruxandra Staicu
Destination(s):. Delhi (India). Airfare: $11,659.58. Other. Transportation: $106.70. Accommodation: $2,913.67. Meals and. Incidentals: $847.77. Other: $259.25. Total: $15,786.97. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.
Czech Academy of Sciences Publication Activity Database
Brabec, Viktor; Kašpárková, Jana; Kostrhunová, Hana; Farrell, N.P.
2016-01-01
Roč. 6, AUG2016 (2016), č. článku 28474. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LH13096 Institutional support: RVO:68081707 Keywords : interstrand cross-links * group domain proteins Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016
2013-06-26
... DEPARTMENT OF EDUCATION Applications for New Awards; Native Hawaiian Career and Technical Education Program (NHCTEP); Correction Catalog of Federal Domestic Assistance (CFDA), Number: 84.259A... Register and the Code of Federal Regulations is available via the Federal Digital System at: www.gpo.gov...
Czech Academy of Sciences Publication Activity Database
Ferreira, V.P.; Vale, V.F.; Pangburn, M.K.; Abdeladhim, M.; Mendes-Sousa, A.F.; Coutinho-Abreu, I.V.; Rasouli, M.; Brandt, E.A.; Meneses, C.; Lima, K.F.; Araújo, R.N.; Pereira, M.H.; Kotsyfakis, Michalis; Oliveira, F.; Kamhawi, S.; Ribeiro, J.M.C.; Gontijo, N.F.; Collin, N.; Valenzuela, J. G.
2016-01-01
Roč. 6, JAN 13 (2016), č. článku 19300. ISSN 2045-2322 R&D Projects: GA ČR GAP502/12/2409 Institutional support: RVO:60077344 Keywords : leishmania * immunity * glands Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016
PTPRD (protein tyrosine phosphatase receptor type delta) is associated with restless legs syndrome
Czech Academy of Sciences Publication Activity Database
Schormair, B.; Kemlink, D.; Roeske, D.; Eckstein, G.; Xiong, L.; Lichtner, P.; Ripke, S.; Trenkwalder, C.; Zimprich, A.; Stiasny-Kolster, K.; Oertel, W.; Bachmann, C. G.; Paulus, W.; Högl, B.; Frauscher, B.; Gschliesser, V.; Poewe, W.; Peglau, I.; Vodička, Pavel; Vávrová, J.; Šonka, K.; Nevšímalová, S.; Montplaisir, J.; Turecki, G.; Rouleau, G.; Gieger, Ch.; Illig, T.; Wichmann, H.E.; Holsboer, F.; Müller-Myhsok, B.; Meitinger, T.; Winkelmann, J.
2008-01-01
Roč. 40, č. 8 (2008), s. 946-948 ISSN 1061-4036 R&D Projects: GA MZd NR8563 Institutional research plan: CEZ:AV0Z50390703 Keywords : PTPRD * syndrom restless legs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008
Enhanced functional and structural domain assignments using
Indian Academy of Sciences (India)
Unknown
using remote similarity detection procedures for proteins encoded in the genome of Mycobacterium tuberculosis H37Rv” (J. Biosci. 29 (3) 245–. 259, 2004) by Seema Namboori, Natasha Mhatre, Sentivel Sujatha,. Narayanaswamy Srinivasan and Shashi Bhushan Pandit. The three-dimensional structure and subcellular ...
Prevalence of intestinal parasites among school children in a rural ...
African Journals Online (AJOL)
Prevalence of intestinal parasites among school children in a rural area close to the southeast of Lake Langano, Ethiopia. ... Ethiopian Journal of Health Development ... Methods: In April 2003, fresh stool samples were collected from 259 students enrolled in two primary schools located in southeast of Lake Langano.
Czech Academy of Sciences Publication Activity Database
Bříza, Jindřich; Pavingerová, Daniela; Vlasák, Josef; Ludvíková, V.; Niedermeierová, Hana
2007-01-01
Roč. 51, č. 2 (2007), s. 268-276 ISSN 0006-3134 R&D Projects: GA ČR GA521/05/2092 Institutional research plan: CEZ:AV0Z50510513 Keywords : transgenic plants * human papillomavirus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.259, year: 2007
The Hardy inequality with boundary or intermediate conditions
Czech Academy of Sciences Publication Activity Database
Kufner, Alois
2017-01-01
Roč. 8, č. 2 (2017), s. 105-109 ISSN 2077-9879 Institutional support: RVO:67985840 Keywords : Hardy's inequality * boundary conditions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics http://www.mathnet.ru/ php /archive.phtml?wshow=paper&jrnid=emj&paperid=259&option_lang=eng
Book Review Ngozi Ezenwa-Ohaeto* http://dx.doi.org/10.4314/og ...
African Journals Online (AJOL)
Dean SPGS NAU
When Dr. Paul Ifeanyi called me on phone, informing me about this book and requesting that ... indiscipline, brazen embezzlement of public funds by people in authority ... money laundering” (Ifeanyi, 259). OJY just .... devastating effects of societal lawlessness, of insecurity, of materialism ... accountable investment. It makes ...
Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..
Czech Academy of Sciences Publication Activity Database
Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.
259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999
Parenting and Family Stress as Mediators of the Long-Term Effects of Child Abuse.
Wind, Tiffany Weissmann; Silvern, Louise
1994-01-01
Data on child physical/sexual abuse, family stress histories, perceived parental warmth, and current psychological functioning were gathered from 259 working women. Multiple regression analyses showed that parental warmth strongly influenced or mediated the relationship of intrafamilial child abuse to depression and self-esteem levels. However,…
T Plant secondary containment and leak detection upgrades
International Nuclear Information System (INIS)
Carlson, T.A.
1995-01-01
The W-259 project will provide upgrades to the 2706-T/TA Facility to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. The project provides decontamination activities supporting the environmental restoration mission and waste management operations on the Hanford Site
30 CFR 250.242 - What information must accompany the DPP or DOCD?
2010-07-01
... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...
Czech Academy of Sciences Publication Activity Database
Kačer, P.; Kuzma, Marek; Červený, L.
2004-01-01
Roč. 259, - (2004), s. 179-183 ISSN 0926-860X R&D Projects: GA ČR GA104/00/1009 Institutional research plan: CEZ:AV0Z5020903 Keywords : adsorptivity * competitive hydrogenation * substituent effects Subject RIV: EE - Microbiology, Virology Impact factor: 2.378, year: 2004
Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?
Czech Academy of Sciences Publication Activity Database
Linek, Lukáš; Pecháček, Š.
2007-01-01
Roč. 23, č. 2 (2007), s. 259-275 ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences
Czech Academy of Sciences Publication Activity Database
Sláma, Karel; Lukáš, J.
2011-01-01
Roč. 57, č. 2 (2011), s. 251-259 ISSN 0022-1910 Grant - others:MZe ČR(CZ) 002 700 604 Institutional research plan: CEZ:AV0Z50070508 Keywords : autonomic heartbeat * myogenic heartbeat * anterograde heartbeat Subject RIV: ED - Physiology Impact factor: 2.236, year: 2011
2012-05-23
... DEPARTMENT OF EDUCATION Native Hawaiian Career and Technical Education Program; Final Waiver and... Career and Technical Education Program Catalog of Federal Domestic Assistance (CFDA) Number: 84.259A... Technical Education Program (NHCTEP), the Secretary hereby waives 34 CFR 75.261(c)(2) in order to extend the...
Inklaar, R.; Timmer, M.P.
Cross-country studies of economic growth have been hampered by the scarcity of reliable data on productivity at the industry level; see Bernard and Jones [American Economic Review, 91 (4) (2001) 1168-1169] and Rogerson [Journal of Political Economy, 116 (2) (2008), 235-259]. We bring together
Blood lactate levels as a biomarker for angling-induced stress in ...
African Journals Online (AJOL)
These data suggest that longer angling time significantly increases physiological stress, which may have an impact on breading success and mortality in tigerfish. Keywords: catch-and-release angling; fish; physiology; recreational fisheries management; stress. African Journal of Aquatic Science 2009, 34(3): 255–259 ...
Skill/Knowledge Commonalities in Selected Electronics Specialties.
1986-10-01
Maintenance Specialist 241 19 30750 Telecomunications Systems Control Specialist 498 35 30950A Missile Det and Warning Radar Specialistc 18 30 309506... Telecomunications Systems Control Specialist 59 ( 5) 125 (10) 259 (21) :. aNumbers in parenthesis are percentage of total possible (1,257). bBased on principles
Regional coherency of boreal forest growth defines Arctic driftwood provenancing
Czech Academy of Sciences Publication Activity Database
Hellmann, L.; Agafonov, L.; Churakova (Sidorova), O.; Düthorn, E.; Eggertsson, O.; Esper, J.; Kirdyanov, A. V.; Knorre, A. A.; Moiseev, P.; Myglan, V. S.; Nikolaev, A. N.; Reinig, F.; Schweingruber, F.; Solomina, O.; Tegel, W.; Büntgen, Ulf
2016-01-01
Roč. 39, sep (2016), s. 3-9 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : mackenzie river driftwood * tree-ring data * central siberia * origin * archipelago * holocene * ocean * sea * ice * circulation * Driftwood * Arctic * Dendro-provenancing * Boreal Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016
Millennial cycles of mean sea level excited by earth´s orbital variations
Czech Academy of Sciences Publication Activity Database
Chapanov, Y.; Ron, Cyril; Vondrák, Jan
2015-01-01
Roč. 12, č. 3 (2015), s. 259-266 ISSN 1214-9705 R&D Projects: GA ČR GA13-15943S Institutional support: RVO:67985815 Keywords : millenial cycles * mean sea level * Earth's insolation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.561, year: 2015
Outcomes of repeated exposure of the carp (Cyprinus carpio L.) to cyanobacteria extract
Czech Academy of Sciences Publication Activity Database
Palíková, M.; Navrátil, S.; Krejčí, R.; Štěrba, F.; Tichý, F.; Kubala, Lukáš; Maršálek, Blahoslav; Bláha, L.
2004-01-01
Roč. 73, č. 2 (2004), s. 259-265 ISSN 0001-7213 R&D Projects: GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z5004920 Keywords : erythrocytes * leukocytes * plasma enzymes Subject RIV: BO - Biophysics Impact factor: 0.449, year: 2004
Differential effects of v-Jun and c-Jun proteins on v-myb-transformed monoblasts
Czech Academy of Sciences Publication Activity Database
Ševčíková, S.; Souček, Karel; Kubala, Lukáš; Bryja, Vítězslav; Šmarda, J.
2002-01-01
Roč. 59, č. 10 (2002), s. 1690-1705 ISSN 1420-682X R&D Projects: GA ČR GA301/01/0040 Institutional research plan: CEZ:AV0Z5004920 Keywords : v-myb * Jun * differentiation Subject RIV: BO - Biophysics Impact factor: 5.259, year: 2002
Czech Academy of Sciences Publication Activity Database
Kukwa, M.; Kolanowska, Marta
2016-01-01
Roč. 6, dec (2016), č. článku 38779. ISSN 2045-2322 R&D Projects: GA ČR GB14-36098G Institutional support: RVO:67179843 Keywords : glacial refugia * prediction of future * Ochrolechia austroamericana Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016
The lateral distance between a proton pump and ATP synthase determines the ATP-synthesis rate
Czech Academy of Sciences Publication Activity Database
Sjöholm, C.; Bergstrand, J.; Nilsson, T.; Šachl, Radek; von Ballmoos, Ch.; Widengren, J.; Brzezinski, P.
2017-01-01
Roč. 7, č. 1 (2017), č. článku 2926. ISSN 2045-2322 Institutional support: RVO:61388955 Keywords : biological energy -conversion * cytochrome-c-oxidase * membrane-surface * rhodobacter-sphaeroides Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Federico, V.; Pompeiano, Antonio; Gu, Z.; Lo Presti, E.; Whitney, L.; Monti, M.; Di Miceli, G.; Giambalvo, D.; Ruisi, P.; Guglielminetti, L.; Mancuso, S.
2016-01-01
Roč. 6, oct (2016), č. článku 34619. ISSN 2045-2322 Institutional support: RVO:67179843 Keywords : PTR-TOF-MS * volatile compounds * gluten strength * rapid characterization * protein-composition * extrusion-cooking * quality * cultivars * flour * subunits Subject RIV: GC - Agronomy Impact factor: 4.259, year: 2016
Buckling of plate strip subjected to localized corrosion a stochastic model
Czech Academy of Sciences Publication Activity Database
Sadovský, Z.; Drdácký, Miloš
2001-01-01
Roč. 39, č. 3 (2001), s. 247-259 ISSN 0263-8231 R&D Projects: GA ČR GA103/97/S051 Grant - others:GA SR(SK) GA2/5102/20 Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.429, year: 2001
Czech Academy of Sciences Publication Activity Database
Ricken, B.; Kolvenbach, B.A.; Bergesch, C.; Benndorf, D.; Kroll, K.; Strnad, Hynek; Vlček, Čestmír; Adaixo, R.; Hammes, F.; Shahgaldian, P.; Schaeffer, A.; Kohler, H.P.E.; Corvini, P.F.X.
2017-01-01
Roč. 7, podzim (2017), č. článku 15783. ISSN 2045-2322 Institutional support: RVO:68378050 Keywords : resistance mechanism * clinical specimens * sulfamethoxazole * bacteria * degradation * benzylpenicillin * biodegradation * genes * sulfadiazine * arthrobacter Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016
How a high-gradient magnetic field could affect cell life
Czech Academy of Sciences Publication Activity Database
Zablotskyy, Vitaliy A.; Polyakova, Tetyana; Lunov, Oleg; Dejneka, Alexandr
2016-01-01
Roč. 6, Nov (2016), 1-12, č. článku 37407. ISSN 2045-2322 Grant - others:AV ČR(CZ) Fellowship J. E. Purkyně Institutional support: RVO:68378271 Keywords : high-gradient magnetic field * cell Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016
New methodology for a person identification system
Indian Academy of Sciences (India)
Home; Journals; Sadhana; Volume 31; Issue 3. New methodology for a person identification system. R Bremananth A Chitra. Volume 31 Issue 3 June 2006 pp 259-276 ... Experimental results illustrate that the proposed method has been easily espoused in elections, bank transactions and other security applications.
African Journals Online (AJOL)
presence of NaOEt led to d-diketones (1) in good yields compared to the ... (8) which further undergoes a Michael addition with a second molecule of acetophenone. .... 27. 12. - 1691, 1679. 其过. | ca81. | 259. 174L 165. | le,. NO.,. NO. 35. - f . F.
Cystathionine .gamma.-lyase: Clinical, metabolic, genetic, and structural studies
Czech Academy of Sciences Publication Activity Database
Kraus, J. P.; Hašek, Jindřich; Kožich, V.; Collard, R.; Venezia, S.; Janošíková, B.; Wang, J.; Stabler, S. P.; Allen, R. H.; Jakobs, C.; Finn, C. T.; Chien, Y. H.; Hwu, W. L.; Hegele, R. A.; Mudd, S. H.
2009-01-01
Roč. 97, č. 4 (2009), s. 250-259 ISSN 1096-7192 R&D Projects: GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : cystathionine gamma-lyase * cystathioninuria * hypercystathioninemia Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.897, year: 2009
Recent advances in the diagnosis of Cushing’s syndrome in dogs
Kooistra, H.S.; Galac, S.
2010-01-01
Vet Clin North Am Small Anim Pract. 2010 Mar;40(2):259-67. Recent advances in the diagnosis of Cushing's syndrome in dogs. Kooistra HS, Galac S. Department of Clinical Sciences of Companion Animals, Faculty of Veterinary Medicine, Utrecht University, Yalelaan 108, 3584 CM Utrecht, The Netherlands.
On the linear problem arising from motion of a fluid around a moving rigid body
Czech Academy of Sciences Publication Activity Database
Nečasová, Šárka; Wolf, J.
2015-01-01
Roč. 140, č. 2 (2015), s. 241-259 ISSN 0862-7959 R&D Projects: GA ČR(CZ) GAP201/11/1304 Institutional support: RVO:67985840 Keywords : incompressible fluid * rotating rigid body * strong solution Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144329
Czech Academy of Sciences Publication Activity Database
Kereiche, S.; Kováčik, L.; Bednár, J.; Pevala, V.; Kunová, N.; Ondrovičová, G.; Bauer, J.; Ambro, L.; Bellová, J.; Kutejová, Eva; Raška, I.
2016-01-01
Roč. 6, SEP 16 (2016), s. 33631 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : ESCHERICHIA-COLI LON * SUBSTRATE TRANSLOCATION * PROTEOLYTIC MACHINE Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016
Synthesis of the silky sifaka's distribution (Propithecus candidus )
African Journals Online (AJOL)
SR) in 2015 are also extremely low at 1.9 individuals. (indiv.)/km² (north-east near Ambodisatrana) and 0.29 indiv./km². (central-east near Camp Indri), though higher in the western ex- tension at 2.59 indiv./km² (south-west near Ampoanaomby).
Czech Academy of Sciences Publication Activity Database
Musil, T.; Matyáš, R.; Vala, R.; Růžička, A.; Vlček, Milan
2014-01-01
Roč. 39, č. 2 (2014), s. 251-259 ISSN 0721-3115 Institutional support: RVO:61389013 Keywords : primary explosive * AgDANT * silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine Subject RIV: CC - Organic Chemistry Impact factor: 1.604, year: 2014
Czech Academy of Sciences Publication Activity Database
del Campo, J.; James, E. R.; Hirakawa, Y.; Fiorito, R.; Kolísko, Martin; Irwin, N. A.T.; Mathur, V.; Boscaro, V.; Hehenberger, E.; Karnkowska, A.; Scheffrahn, R. H.; Keeling, P. J.
2017-01-01
Roč. 7, NOV 27 (2017), č. článku 16349. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : lower termites * phylogeny * symbiosis * protozoa * primers * tool Subject RIV: EB - Gene tics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. Anurag Kumar Mishra. Articles written in Journal of Biosciences. Volume 27 Issue 3 June 2002 pp 251-259 Articles. Cloning and sequencing of complete -crystallin cDNA from embryonic lens of Crocodylus palustris · Raman Agrawal Reena Chandrashekhar Anurag Kumar Mishra ...
On the hydrogen neutral outflowing disks of B[e] supergiants
Czech Academy of Sciences Publication Activity Database
Kraus, Michaela; Borges Fernandes, M.; de Araújo, F. X.
2007-01-01
Roč. 463, č. 2 (2007), s. 627-634 ISSN 0004-6361 R&D Projects: GA ČR GA205/04/1267 Institutional research plan: CEZ:AV0Z10030501 Keywords : supergiants * winds * outflows Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007
Czech Academy of Sciences Publication Activity Database
Vondrák, Jan; Štefka, Vojtěch
2007-01-01
Roč. 463, č. 2 (2007), s. 783-788 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC506 Institutional research plan: CEZ:AV0Z10030501 Keywords : reference systems * astrometry * catalogs Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007
Forensic Index and Substance Abuse among Psychiatric Patients ...
African Journals Online (AJOL)
Although forensic index and substance use are crucial issues in clinical work among mentally ill patients, studies emanating from psychiatric facilities in nonwestern cultures have been relatively scarce. This paper examines this issue in a tertiary health institution. Participants were 259 mentally ill patients (124 inpatients ...
Czech Academy of Sciences Publication Activity Database
Reichard, Martin; Liu, H.; Smith, C.
2007-01-01
Roč. 9, č. 2 (2007), s. 239-259 ISSN 1522-0613 Grant - others:NSFC(CN) 30470237 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * co-evolution * egg ejection * host-parasite relationship * mutualism * oviposition Subject RIV: EG - Zoology Impact factor: 1.409, year: 2007
Circulating nucleic acids as a new diagnostic tool
Czech Academy of Sciences Publication Activity Database
Urbanová, Markéta; Plzák, J.; Strnad, Hynek; Betka, J.
2010-01-01
Roč. 15, č. 2 (2010), s. 242-259 ISSN 1425-8153 R&D Projects: GA MŠk 2B06106 Institutional research plan: CEZ:AV0Z50520514 Keywords : circulating nucleic acids * diagnostics * cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.455, year: 2010
Czech Academy of Sciences Publication Activity Database
Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.
2016-01-01
Roč. 6, Jan (2016), 1-7, č. článku 19610. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : entangled photons * state tomography Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016
DEFF Research Database (Denmark)
Shaban, C.; Fosbury, J. A.; Cavan, D. A.
2009-01-01
259 adults with type 1 diabetes completed measure of anxiety, depression and diabetes specific distress, HbA1c from medical records. Anxiety not depression predicted HbA1c, this association was mediated by illness specific cognitions. Targeting illness specific cognitions may be more productive...
PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN
African Journals Online (AJOL)
GB
2Department of Health Management and Economics, School of Public Health, Tehran University of Medical Sciences, ... Algeria, Brazil, Colombia, Iran, and Syria. (5). ..... Statistics Center of Iran. 2013: 259- 60. [Persian]. 24. Reithinger R. Leishmaniases' burden of disease: ways forward for getting from speculation to reality.
Genome-wide association analysis of symbiotic nitrogen fixation in common bean
A genome-wide association study (GWAS) was conducted to explore the genetic basis of variation for symbiotic nitrogen fixation (SNF) and related traits in the Andean diversity panel (ADP) comprised of 259 common bean (Phaseolus vulgaris) genotypes. The ADP was evaluated for SNF and related traits in...
Phase morphology of PP/COC blends
Czech Academy of Sciences Publication Activity Database
Šlouf, Miroslav; Kolařík, Jan; Fambri, L.
2003-01-01
Roč. 91, č. 1 (2003), s. 253-259 ISSN 0021-8995 R&D Projects: GA ČR GP106/02/P029 Institutional research plan: CEZ:AV0Z4050913 Keywords : polypropylene * norbornene * polyolefin Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.017, year: 2003
Genotype dependent callus induction and shoot regeneration in ...
African Journals Online (AJOL)
This study aims to observe the effect of genotype, hormone and culture conditions on sunflower (Helianthus annuus L.) callus induction and indirect plant regeneration. Calli were obtained from hypocotyl and cotyledon explants of five different sunflower genotypes; Trakya 80, Trakya 129, Trakya 259, Trakya 2098 and ...
Czech Academy of Sciences Publication Activity Database
Pšenička, J.; Zodrow, E. L.; Mastalerz, M.; Bek, Jiří
2005-01-01
Roč. 61, 3-4 (2005), s. 259-280 ISSN 0166-5162 R&D Projects: GA AV ČR(CZ) IAA3013902 Institutional research plan: CEZ:AV0Z30130516 Keywords : interdisciplinary approach * functional groups * FTIR Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.397, year: 2005
Biederman, Joseph; Monuteaux, Michael C.; Doyle, Alysa E.; Seidman, Larry J.; Wilens, Timothy E.; Ferrero, Frances; Morgan, Christie L.; Faraone, Stephen V.
2004-01-01
The association between executive function deficits (EFDs) and functional outcomes were examined among children and adolescents with attention-deficit/hyperactivity disorder (ADHD). Participants were children and adolescents with (n = 259) and without (n = 222) ADHD, as ascertained from pediatric and psychiatric clinics. The authors defined EFD as…
The Hardy inequality with boundary or intermediate conditions
Czech Academy of Sciences Publication Activity Database
Kufner, Alois
2017-01-01
Roč. 8, č. 2 (2017), s. 105-109 ISSN 2077-9879 Institutional support: RVO:67985840 Keywords : Hardy's inequality * boundary conditions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics http://www.mathnet.ru/php/archive.phtml?wshow=paper&jrnid=emj&paperid=259&option_lang=eng
Climatic and environmental aspects of the Mongol withdrawal from Hungary in 1242 CE
Czech Academy of Sciences Publication Activity Database
Büntgen, Ulf; Di Cosmo, N.
2016-01-01
Roč. 6, MAY (2016), č. článku 25606. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : Central Europe * ice age * variability * Carpathians * plain Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016
DEFF Research Database (Denmark)
Friis, Ulla Glenert; Stubbe, Jane; Uhrenholt, Torben Rene
2005-01-01
/l), AE1-259-01 (1 nmol/l), EP4-selective agonist AE1-329 (1 nmol/l), and IP agonist iloprost (1 micromol/l) significantly increased C(m) mediated by PKA. The EP4 antagonist AE3-208 (10 nmol/l) blocked the effect of EP4 agonist but did not alter the response to PGE(2). Application of both EP4 antagonist....... The membrane potential hyperpolarized significantly after PGE(2), butaprost, AE1-329 and AE1-259 and outward current was augmented in a PKA-dependent fashion. PGE(2)-stimulated outward current, but not C(m) change, was abolished by the BK(Ca) channel inhibitor iberiotoxin (300 nmol/l). EP2 and EP4 m......RNA was detected in sampled JG cells, and the preglomerular and glomerular vasculature was immunopositive for EP4. Thus IP, EP2, and EP4 receptors are associated with JG cells, and their activation leads to rapid PKA-mediated exocytotic fusion and release of renin granules....
Estimating the number of unvaccinated Chinese workers against yellow fever in Angola.
Wilder-Smith, A; Massad, E
2018-04-17
A yellow fever epidemic occurred in Angola in 2016 with 884 laboratory confirmed cases and 373 deaths. Eleven unvaccinated Chinese nationals working in Angola were also infected and imported the disease to China, thereby presenting the first importation of yellow fever into Asia. In Angola, there are about 259,000 Chinese foreign workers. The fact that 11 unvaccinated Chinese workers acquired yellow fever suggests that many more Chinese workers in Angola were not vaccinated. We applied a previously developed model to back-calculate the number of unvaccinated Chinese workers in Angola in order to determine the extent of lack of vaccine coverage. Our models suggest that none of the 259,000 Chinese had been vaccinated, although yellow fever vaccination is mandated by the International Health Regulations. Governments around the world including China need to ensure that their citizens obtain YF vaccination when traveling to countries where such vaccines are required in order to prevent the international spread of yellow fever.
Variants of glycoside hydrolases
Teter, Sarah [Davis, CA; Ward, Connie [Hamilton, MT; Cherry, Joel [Davis, CA; Jones, Aubrey [Davis, CA; Harris, Paul [Carnation, WA; Yi, Jung [Sacramento, CA
2011-04-26
The present invention relates to variants of a parent glycoside hydrolase, comprising a substitution at one or more positions corresponding to positions 21, 94, 157, 205, 206, 247, 337, 350, 373, 383, 438, 455, 467, and 486 of amino acids 1 to 513 of SEQ ID NO: 2, and optionally further comprising a substitution at one or more positions corresponding to positions 8, 22, 41, 49, 57, 113, 193, 196, 226, 227, 246, 251, 255, 259, 301, 356, 371, 411, and 462 of amino acids 1 to 513 of SEQ ID NO: 2 a substitution at one or more positions corresponding to positions 8, 22, 41, 49, 57, 113, 193, 196, 226, 227, 246, 251, 255, 259, 301, 356, 371, 411, and 462 of amino acids 1 to 513 of SEQ ID NO: 2, wherein the variants have glycoside hydrolase activity. The present invention also relates to nucleotide sequences encoding the variant glycoside hydrolases and to nucleic acid constructs, vectors, and host cells comprising the nucleotide sequences.
DEFF Research Database (Denmark)
Iversen, L. F.; Andersen, H. S.; Møller, K. B.
2001-01-01
Utilizing structure-based design, we have previously demonstrated that it is possible to obtain selective inhibitors of protein-tyrosine phosphatase 1B (PTP1B). A basic nitrogen was introduced into a general PTP inhibitor to form a salt bridge to Asp48 in PTP1B and simultaneously cause repulsion...... in PTPs containing an asparagine in the equivalent position [Iversen, L. F., et al. (2000) J. Biol. Chem. 275, 10300−10307]. Further, we have recently demonstrated that Gly259 in PTP1B forms the bottom of a gateway that allows easy access to the active site for a broad range of substrates, while bulky...... in accessibility to the active site among various PTPs. We show that a general, low-molecular weight PTP inhibitor can be developed into a highly selective inhibitor for PTP1B and TC-PTP by introducing a substituent, which is designed to address the region around residues 258 and 259. Detailed enzyme kinetic...
Buldur, B
The aim of this qualitative study was to identify the conceptions of dentists and dental students (DSs) about pediatric dental patients (PDPs) using metaphor analysis. The study group (N = 259) consisted of dentists and DSs. Participants completed the sentence "A pediatric dental patient is like ... because …..." in order to reveal the metaphors they use about the concept of PDPs. The data were analyzed using the mixed-methods: qualitative (metaphor analysis) and quantitative (chi-square) data analysis techniques. The dentists and DSs produced 259 metaphors. These metaphors were gathered under six different conceptual categories that define a PDP as unpredictable, dangerous, uncontrollable, requiring care and sensitivity, valuable, and orientable. The most important factors leading to these conceptions were the uncooperativeness of some PDPs and the effectiveness of behavior management. The results of this study indicate that there was no significant difference among DSs, general dentists and specialist dentists with respect to six conceptual categories that identify the conceptions about PDPs.
Ft. Lewis/Gray, Washington. Revised Uniform Summary of Surface Weather Observations. Parts A-F.
1987-07-27
75.9 75.9 76.1 76.2 GE 30001 5.3 66.8 70.6 73.0 75.6 7.7 76.4 76.9 77.0 78.0 78.0 78.0 78.4 78.4 7R.7 78.8 IE 27001 5.3 69.3 73.1 75.7 78.2 78.3 79.1...25.1 25.2 25.2 25.6 25.6 25.7 26.0 26.0 26.0 26.0 26.0 2b.2 6.E ISO DO 16.8 25.9 26.S 26.9 27.0 27.2 27.3 27.7 27.7 27.9 26.1 28.1 28.1 28.1 ip.1 28.1...3.259 3.596 5.103 6.164 8.878 9.563 T.O7 ITO! 0BSf 309 282 310 299 310 300 310 310 300 309 300 298 3632 22 ISO 1 9.724 9.333 8.111 6.610 5.262 9.228
Klute, Mary; Apthorp, Helen; Harlacher, Jason; Reale, Marianne
2017-01-01
Formative assessment is a process that engages teachers and students in gathering, interpreting, and using evidence about what and how students are learning in order to facilitate further student learning during a short period of time. The process offers the potential to guide educator decisions about midstream adjustments to instruction that…
Sertich, Sally Krause
2013-01-01
This study used a conceptual framework of professional development theory to identify characteristics of effective learning activities specific to 259 Minnesota K-12 public school physical education and developmental adapted physical education (PE/DAPE) teachers during 2012-2013. Study results confirmed that as PE/DAPE teacher participation in…
Reproductive and hormonal factors in male and female colon cancer
Kampman, E.; Bijl, A.J.; Kok, C.; Veer, P. van 't
1994-01-01
We analysed data from a case-control study in the Netherlands in order to investigate whether reproductive events and hormonal factors are similarly related to colon cancer risk in men and women after adjustment for dietary factors. In total, 232 colon cancer cases (102 women, 130 men) and 259
Journal for Language Teaching - Vol 36, No 3-4 (2002)
African Journals Online (AJOL)
Shortcomings of the written survey questionnaire for discovering language learner perceptions: reflections of a researcher · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gary P. Barkhuizen, 259-272. http://dx.doi.org/10.4314/jlt.v36i3-4.5991 ...
Zhou, L.; Boot, M.D.; Goey, de L.P.H.
2012-01-01
In this paper the soot-NOx trade-off and fuel efficiency of various aromatic oxygenates is investigated in a modern DAF heavy-duty diesel engine. All oxygenates were blended to diesel fuel such that the blend oxygen concentration was 2.59 wt.-%. The oxygenates in question, anisole, benzyl alcohol
Kalivodův zápas o marxismus bez pověr a iluzí
Czech Academy of Sciences Publication Activity Database
Zumr, Josef
2012-01-01
Roč. 60, mimořádné číslo 2 (2012), s. 259-267 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Robert Kalivoda * Marx ism * Hussite movement * Karl Marx * Sigmund Freud Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology
Czech Academy of Sciences Publication Activity Database
Belmonte-Reche, E.; Martínez-García, M.; Guédin, A.; Zuffo, M.; Arevalo-Ruiz, M.; Doria, F.; Campos-Salinas, J.; Maynadier, M.; Lopez-Rubio, J.J.; Freccero, M.; Mergny, Jean-Louis; Maria Perez-Victoria, J.; Carlos Morales, J.
2018-01-01
Roč. 61, č. 3 (2018), s. 1231-1240 ISSN 0022-2623 R&D Projects: GA MŠk EF15_003/0000477 Institutional support: RVO:68081707 Keywords : terminal repeat promoter * plasmodium-falciparum Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016
Chemically different non-thermal plasmas target distinct cell death pathways
Czech Academy of Sciences Publication Activity Database
Lunov, O.; Zablotskyy, V.; Chrupina, O.; Lunova, M.; Jirsa, M.; Dejneka, A.; Kubinová, Šárka
2017-01-01
Roč. 7, apr (2017), s. 600 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : chemically different * non-thermal plasmas * target distinct cell death pathways Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016
Molzan, M.; Schumacher, B.; Ottmann, C.; Baljuls, A.; Polzien, L.; Weyand, M.; Thiel, P.; Rose, R.; Rose, M.; Kuhenne, P.; Kaiser, M.; Rapp, U.R.; Kuhlmann, J.; Ottmann, C.
2010-01-01
The Ras-RAF-mitogen-activated protein kinase (Ras-RAF-MAPK) pathway is overactive in many cancers and in some developmental disorders. In one of those disorders, namely, Noonan syndrome, nine activating C-RAF mutations cluster around Ser(259), a regulatory site for inhibition by 14-3-3 proteins. We
Novel electrochemical route to cleaner fuel dimethyl ether
Czech Academy of Sciences Publication Activity Database
Cassone, Giuseppe; Pietrucci, F.; Saija, F.; Guyot, Y.; Šponer, Jiří; Šponer, Judit E.; Saitta, A. M.
2017-01-01
Roč. 7, JUL2017 (2017), č. článku 6901. ISSN 2045-2322 Institutional support: RVO:68081707 Keywords : initio molecular-dynamics * solid-acid catalysts * electric-fields Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Belakovskiy, D. I.; Čejka, J.; Chernyshov, D.
2015-01-01
Roč. 60, č. 4 (2015), 259-267 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : ježekite * new mineral * uranyl carbonate-sulfate * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015
Investigation of the clinical features and therapeutic methods for the ...
African Journals Online (AJOL)
Purpose: To establish if there are different classes of inflammatory lacrimal punctum diseases (ILPDs) and to examine the various strategies by which they can be managed therapeutically. Methods: Two hundred and fifty nine (259) patients with inflammatory punctum lacrimal disease were identified and used as subjects for ...
2012-03-05
... Northrup, Project Manager, BLM Moab Field Office, 82 East Dogwood, Moab, UT 84532, telephone (435) 259-2151... Instruction Memorandum No. 2010-117. The MLP process will provide additional planning and analysis for areas... with varying mitigation levels for leasing. The planning area covers about 783,000 acres in east...
Determination of iodine in Asian diets by epithermal and radiochemical neutron activation analysis
Czech Academy of Sciences Publication Activity Database
Kučera, Jan; Iyengar, GV.; Řanda, Zdeněk; Parr, RM.
2004-01-01
Roč. 259, č. 3 (2004), s. 505-509 ISSN 0236-5731 R&D Projects: GA AV ČR IAA4048301 Institutional research plan: CEZ:AV0Z1048901 Keywords : iodine * Asian diets Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.457, year: 2004
Brown, Chris
1998-01-01
Explored aspects of assessment of extended investigation ("project") practiced in the operational examinations of The University of Cambridge Local Examinations Syndicate (UCLES) for the perspective of construct validity. Samples of the 1993 (n=333) and 1996 (n=259) biology test results reveal two methods of assessing the project. (MAK)
Effect of inhibition of biosynthesis of phenylpropanoids on sessile oak somatic embryogenesis
Czech Academy of Sciences Publication Activity Database
Cvikrová, Milena; Malá, J.; Hrubcová, Marie; Eder, Josef; Zoń, J.; Macháčková, Ivana
2003-01-01
Roč. 41, č. 3 (2003), s. 251-259 ISSN 0981-9428 R&D Projects: GA MŠk LN00A081 Institutional research plan: CEZ:AV0Z5038910 Keywords : Inhibition of phenylpropanoid biosynthesis * Somatic embryogenesis * Oak Subject RIV: CE - Biochemistry Impact factor: 1.729, year: 2003
Czech Academy of Sciences Publication Activity Database
Zhan, H.; Garrett, D.J.; Apollo, N.V.; Ganesan, K.; Lau, D.; Prawer, S.; Červenka, Jiří
2016-01-01
Roč. 6, Jan (2016), 1-8, č. článku 19822. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : double-layer capacitors * carbon nanotube arrays * amorphous-carbon * supercapacitor applications * Raman-spectroscopy * energy -storage Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016
75 FR 64781 - Additional Designations, Foreign Narcotics Kingpin Designation Act
2010-10-20
... framework for the President to impose sanctions against significant foreign narcotics traffickers and their...., Martin L. Guzman 259-3, Colonia Villa de Cortes, Delegacion Benito Juarez, Mexico City, Mexico; Folio Mercantil No. 325909 (Mexico); (ENTITY) [BPI-SDNTK] 2. TATES DESARROLLO, S.A. DE C.V., Mexico City, Mexico...
[Combined physiotherapy of chronic infectious prostatitis].
Churakov, A A; Popkov, V M; Zemskov, S P; Glybochko, P V; Bliumberg, B I
2007-01-01
Our experience with therapy of 259 outpatients with chronic infectious prostatitis (CIP) aged 16-55 years has demonstrated that combined treatment of CIP with rectal digital massage of the prostate, electrophoresis of chimotripsin solution with dimexide and local magnetotherapy (Intramag unit) significantly raises treatment efficacy, shortens treatment, prevents complications.
Czech Academy of Sciences Publication Activity Database
Fránová, Jana; Přibylová, Jaroslava; Šimková, Marie; Navrátil, M.; Válová, P.
2003-01-01
Roč. 109, - (2003), s. 883-887 ISSN 0929-1873 R&D Projects: GA ČR GA522/98/0792; GA AV ČR IBS5051014 Institutional research plan: CEZ:AV0Z5051902 Keywords : Helichrysum bracteatum Subject RIV: EE - Microbiology, Virology Impact factor: 1.259, year: 2003
Czech Academy of Sciences Publication Activity Database
Samec, P.; Rychtecká, P.; Tuček, P.; Bojko, J.; Zapletal, Miloš; Cudlín, Pavel
2016-01-01
Roč. 22, č. 2 (2016), s. 259-274 ISSN 1392-1355 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : forest state monitoring * EMEP-LRTAP * floodplain * mountain forests * canonical correlation analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.635, year: 2016
Malakostratigrafie holocenního pěnovce na Babině u Hradiště pod Vrátnom (jihozápadní Slovensko)
Czech Academy of Sciences Publication Activity Database
Ložek, Vojen
2013-01-01
Roč. 2012, Prosinec (2013), s. 259-262 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : SW Slovakia * Holocene * tufa * buried soils * molluscan succession Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-52.pdf
Příběh války. Vědecko-pedagogická konference v Poslanecké sněmovně Parlamentu ČR
Czech Academy of Sciences Publication Activity Database
Beranská, Veronika
2017-01-01
Roč. 104, č. 2 (2017), s. 259-261 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : World War II * Association of the Czechs from Volynia and their friends * Volynia Czechs * Chamber of deputies Parliament of the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology
Binary asteroid population. 1. Angular momentum content
Czech Academy of Sciences Publication Activity Database
Pravec, Petr; Harris, A. W.
2007-01-01
Roč. 190, č. 1 (2007), s. 250-259 ISSN 0019-1035 R&D Projects: GA ČR(CZ) GA205/05/0604 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.869, year: 2007
Czech Academy of Sciences Publication Activity Database
Bína, David; Herbstová, Miroslava; Gardian, Zdenko; Vácha, František; Litvín, Radek
2016-01-01
Roč. 6, MAY 2016 (2016), č. článku 25583. ISSN 2045-2322 R&D Projects: GA ČR GBP501/12/G055 Institutional support: RVO:60077344 Keywords : Light-harvesting complexes * Supramolecular organization * Protein complexes Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016
Nonlinear magnetoelectric effect in paraelectric state of Co4Nb2O9 single crystal
Czech Academy of Sciences Publication Activity Database
Cao, Ym.; Deng, Gc.; Beran, Přemysl; Feng, Zj.; Kang, Bj.; Zhang, Jc.; Guiblin, N.; Dkhil, B.; Ren, W.; Cao, Sx.
2017-01-01
Roč. 7, č. 10 (2017), č. článku 14079. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : magnetoelectric * single crystal * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Lyukmanova, E. N.; Shulepko, M. A.; Shenkarev, Z. O.; Bychkov, M. L.; Paramonov, A. S.; Chugunov, A. O.; Kulbatskii, D. S.; Arvaniti, M.; Dolejší, Eva; Schaer, T.; Arseniev, A. S.; Efremov, R. G.; Thomsen, M. S.; Doležal, Vladimír; Bertrand, D.; Dolgikh, D. A.; Kirpichnikov, M. P.
2016-01-01
Roč. 6, Aug 3 (2016), s. 30698 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA14-05696S Institutional support: RVO:67985823 Keywords : ion channel * signalling * molecular modelling * protein–protein interaction networks * solution-state NMR Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016
Gas stripping in galaxy clusters: a new SPH simulation approach
Czech Academy of Sciences Publication Activity Database
Jáchym, Pavel; Palouš, Jan; Köppen, J.; Combes, F.
2007-01-01
Roč. 472, č. 1 (2007), s. 5-20 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : galaxie s * interactions * intergalactic medium Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007
Czech Academy of Sciences Publication Activity Database
Grygar, Tomáš; Rojka, T.; Bezdička, Petr; Večerníková, Eva; Kovanda, F.
2004-01-01
Roč. 8, č. 4 (2004), s. 252-259 ISSN 1432-8488 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : amorphous phases * Cu,Mn oxides * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.984, year: 2004
FEM simulation of a sono-reactor accounting for vibrations of the boundaries
Czech Academy of Sciences Publication Activity Database
Louisnard, O.; González-Garcia, J.; Tudela, I.; Klíma, Jiří; Sáez, V.; Vargas-Hernandez, Y.
2009-01-01
Roč. 16, č. 2 (2009), s. 250-259 ISSN 1350-4177 R&D Projects: GA MŠk 1P05OC074 Institutional research plan: CEZ:AV0Z40400503 Keywords : finite elements * ultrasound * standing waves Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.993, year: 2009
African Journals Online (AJOL)
HP4510s
place the question is addressed how a monist or dualist approach regarding the ... humanitarian law, customary international law, and the law and practice of States. ... Law 171 et seq; Boothby 2006 Intervention 244-259; Cohn 1991 IJRL 100-111; ...... as victims because of their emotional, mental and intellectual immaturity.
African Journals Online (AJOL)
Mr Olusoji
(25.9%), Husband's opposition (24.2%), desire for more children (17.2%), Religious prohibition (13.8%), lack of ... Strategies to improving access and utilization to family planning methods should therefore include; the .... marketing of the condom in response to the HIV ... personnel towards building their capacity in offering.
Experimental temporal quantum steering
Czech Academy of Sciences Publication Activity Database
Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.; Nori, F.
2016-01-01
Roč. 6, Nov (2016), 1-8, č. článku 38076. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : temporal quantum steering * EPR steering Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016
2011-01-25
..., thicknesses, materials of construction, and working pressures were as follows: Working Tank car specification..., wheels, draft systems, springs and trucks. S-259, however, does not allow for the free interchange among...-jacketed tank cars constructed with ASTM 516-70 steel and having only the minimum plate thickness required...
Using Application-Domain Knowledge in the Runtime Support of Multi-Experiment Computational Studies
2009-01-01
259, 1993. [20] Carlos A Coello, David A Van Veldhuizen , and Gary B Lamont. Evolu- tionary Algorithms for Solving Multi-Objective Problems. Kluwer...Applications, 20(2):255–285, 2006. [56] Robert Van Liere, Jurriaan D. Mulder, and Jarke J. van Wijk. Compu- tational steering. Future Generation Computer
Czech Academy of Sciences Publication Activity Database
Effenberg, R.; Turánek Knötigová, P.; Zyka, D.; Čelechovská, H.; Mašek, J.; Bartheldyová, E.; Hubatka, F.; Koudelka, Š.; Lukáč, R.; Kovalová, Anna; Šaman, David; Křupka, M.; Barkocziova, L.; Kosztyu, P.; Šebela, M.; Drož, L.; Hučko, M.; Kanásová, M.; Miller, A.D.; Raška, M.; Ledvina, M.; Turánek, J.
2017-01-01
Roč. 60, č. 18 (2017), s. 7745-7763 ISSN 0022-2623 R&D Projects: GA MŠk(CZ) LO1304 Institutional support: RVO:61388963 Keywords : N-acetylmuramyl peptides * muramyl dipeptide * adamantylamide dipeptide Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016
Volume 11 No. 1 February 2011 4538 UTILIZATION OF STOVER ...
African Journals Online (AJOL)
user
2011-02-01
Feb 1, 2011 ... balance (3.0±0.98 g/d) was similar (P > 0.05) among cultivars, whereas available protein ranged (P ... solar radiation, and 25.9°C. (range: 22.6°C ..... Van Soest PJ Nutritional ecology of the ruminant, O & B Books, Inc. Oregon,.
Molecular MR imaging of fibrosis in a mouse model of pancreatic cancer
Czech Academy of Sciences Publication Activity Database
Polášek, Miloslav; Yang, Y.; Schühle, D. T.; Yaseen, M. A.; Kim, Y. R.; Sung, Y. S.; Guimaraes, A. R.; Caravan, P.
2017-01-01
Roč. 7, Aug 14 (2017), č. článku 8114. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : fibrosis * molecular imaging * pancreatic cancer Subject RIV: FD - Oncology ; Hematology OBOR OECD: Oncology Impact factor: 4.259, year: 2016 https://www.nature.com/ articles /s41598-017-08838-6
Efecto del encalado en la respuesta vegetal y fijación simbiótica del nitrógeno en frijol común
Directory of Open Access Journals (Sweden)
Aurelio Garc\\u00EDa
2003-01-01
Full Text Available En casa de cristales se evaluó mediante el método de valor A, utilizando el isótopo estable 15N, el efecto del encalado de un suelo Rhodic ferralsol sobre la fijación simbiótica de nitrógeno (FSN de los genotipos de frijol común (Phaseolus vulgaris L. BAT 58, BAT 477, DOR 364, CC 25-9 (N. La isolínea NN 125, genotipo de frijol no nodulante, fue utilizado como cultivo de referencia. El efecto del encalado incrementó la fracción de nitrógeno en planta derivado del aire, principalmente en CC 25-9 (N que posee muy poca capacidad de fijación de N atmosf érico cuando no se encala el suelo. Además, se encontró un efecto beneficioso del encalado sobre las reservas de N del suelo, visto que los incrementos de las extracciones totales de N por las plantas provienen del N del aire, e incluso, la cantidad de N en planta derivado del suelo disminuyó para todos los genotipos, principalmente en DOR 364 y CC 25-9(N. Por otra parte, la relación %Nddf/%Ndds, por ciento de N en planta derivado del fertilizante y por ciento de N en planta derivado del suelo respectivamente, varió debido a la aplicación de cal. Por consiguiente, es necesario utilizar dos tratamientos con el cultivo de referencia para evaluar acertadamente la FSN: cultivo de referencia con y sin suelo encalado. Se discute la interpretación del parámetro Eficiencia de Uso del N.
Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti
Directory of Open Access Journals (Sweden)
Vaščić, V.
2007-04-01
Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until
p53 Over-expression and p53 mutations in colon carcinomas: Relation to dietary risk factors
Voskuil, D.W.; Kampman, E.; Kraats, A.A. van; Balder, H.F.; Muijen, G.N.P. van; Goldbohm, R.A.; Veer, P. van 't
1999-01-01
Epidemiological studies have suggested that dietary factors may differently affect p53-dependent and p53-independent pathways to colon cancer. Results of such studies may depend on the method used to assess p53 status. This case-control study of 185 colon-cancer cases and 259 controls examines this
Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms
Czech Academy of Sciences Publication Activity Database
Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír
2006-01-01
Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006
Czech Academy of Sciences Publication Activity Database
Temml, V.; Garscha, U.; Romp, E.; Schubert, G.; Gerstmeier, J.; Kutil, Zsófia; Matuszczak, B.; Waltenberger, B.; Stuppner, H.; Werz, O.; Schuster, D.
2017-01-01
Roč. 7, FEB 20 (2017), č. článku 42751. ISSN 2045-2322 Institutional support: RVO:61389030 Keywords : activating protein * drug discovery * leukotriene biosynthesis * inflammatory diseases * conformer generation * arachidonic-acid * flap * challenges * asthma * risk Subject RIV: CE - Biochemistry OBOR OECD: Physiology (including cytology) Impact factor: 4.259, year: 2016
Status Of Strategic Management Practices Of Secondary School ...
African Journals Online (AJOL)
The purpose of the study was to determine the extent to which principals practice strategic management skills in students' administration in secondary schools in Anambra State. All the two hundred and fifty-nine (259) secondary school principals of the six education zones of Anambra State were used for the study.
Czech Academy of Sciences Publication Activity Database
Kirschner, Jan; Štěpánek, Jan
2004-01-01
Roč. 39, č. 3 (2004), s. 259-274 ISSN 0015-5551 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/02/0346 Institutional research plan: CEZ:AV0Z6005908 Keywords : Asteraceae * Compositae * Lactuceae Subject RIV: EF - Botanics Impact factor: 0.968, year: 2004
Changes in white blood cells in sheep blood during selenium supplementation
Czech Academy of Sciences Publication Activity Database
Písek, L.; Trávníček, J.; Salát, Jiří; Kroupová, V.; Soch, M.
2008-01-01
Roč. 53, č. 5 (2008), s. 255-259 ISSN 0375-8427 R&D Projects: GA ČR GD523/03/H076 Institutional research plan: CEZ:AV0Z60220518 Keywords : ewes * immunity * T lymphocytes * CD4(+) * CD8(+) Subject RIV: GG - Livestock Rearing Impact factor: 0.659, year: 2008
Selenium protects the immature rat heart against ischemia/reperfusion injury
Czech Academy of Sciences Publication Activity Database
Ošťádalová, Ivana; Vobecký, Miloslav; Chvojková, Zuzana; Miková, D.; Hampl, V.; Wilhelm, J.; Ošťádal, Bohuslav
2007-01-01
Roč. 300, 1-2 (2007), s. 259-267 ISSN 0300-8177 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : selenium * immature heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.707, year: 2007
A rare-earth free magnesium alloy with improved intrinsic ductility
Czech Academy of Sciences Publication Activity Database
Sandlöbes, S.; Friák, Martin; Korte-Ketzel, S.; Pei, Z.; Neugebauer, J.; Raabe, D.
2017-01-01
Roč. 7, SEP (2017), č. článku 10458. ISSN 2045-2322 Institutional support: RVO:68081723 Keywords : MECHANICAL-PROPERTIES * MG-ZN * PRISMATIC-SLIP * DEFORMATION-BEHAVIOR Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...
Czech Academy of Sciences Publication Activity Database
Havelka, Daniel; Deriu, M.A.; Cifra, Michal; Kučera, Ondřej
2017-01-01
Roč. 7, č. 1 (2017), č. článku 4227. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-17102S Institutional support: RVO:67985882 Keywords : Continuum model * Protein microtubules * Molecular-dymamics Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Kučera, Jan; Bencko, V.; Tejral, J.; Borská, L.; Soukal, L.; Řanda, Zdeněk
2004-01-01
Roč. 259, č. 1 (2004), s. 7-11 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Institutional research plan: CEZ:AV0Z1048901 Keywords : occupational exposure * biomonitoring * neutron activation analysis Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.457, year: 2004
DEFF Research Database (Denmark)
Sørensen, Henning Osholm; Stuhr-Hansen, Nicolai
2009-01-01
The title compound, 1-bromo-4-methylselenobenzene, C7H7BrSe, was prepared by methylation of 4-bromoselenophenolate with methyl iodide, and crystals suitable for structure determination were obtained by sublimation. The molecule is essentially planar; the Se-Me bond is rotated by only 2.59 (19)° out...
affect rice in integrated rice-fish culture in Lake Victoria Basin, Kenya?
African Journals Online (AJOL)
AGHOGHO A
Rice field ecology and fish culture - an overview. Hydrobiologia 259:91-113. Fernando CH, Halwart M (2000). Fish farming in irrigation systems. Fisheries Management and Ecol. 7:45-54. Frei M, Razzak MA, Hossain MM, Ochme M, Dewan S, Becker K. (2007). Performance of common carp, Cyprinus carpio L. and Nile.
Cold tolerance is unaffected by oxygen availability despite changes in anaerobic metabolism
Czech Academy of Sciences Publication Activity Database
Boardman, L.; Sorensen, J. G.; Košťál, Vladimír; Šimek, Petr; Terblanche, J. S.
2016-01-01
Roč. 6, SEPT 13 (2016), č. článku 32856. ISSN 2045-2322 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : hypoxia * cold * insect Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep32856
1998-05-22
onset an average of 16-18 days after exposure. Parotitis may be preceded by fever, headache, malaise, myalgia, and anorexia . Only 30%-40% of mumps...six- " teen -year follow-up in the Hawaiian Islands. JAMA 1988;259:3133-6 98 Hillary IB, Griffith AH. Persistence of antibody 10 years after
Czech Academy of Sciences Publication Activity Database
Železná, Blanka; Veselský, Leopold; Velek, Jiří; Dobešová, Zdenka; Zicha, Josef; Kuneš, Jaroslav
1999-01-01
Roč. 48, č. 4 (1999), s. 259-265 ISSN 0862-8408 R&D Projects: GA MŠk OK 170; GA AV ČR IAA7011711; GA AV ČR IPP2020702 Grant - others:Coperincus(FR) CT94-0239 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.521, year: 1999
Magnetically responsive yeast cells: methods of preparation and applications
Czech Academy of Sciences Publication Activity Database
Šafařík, Ivo; Maděrová, Zdeňka; Pospišková, K.; Horská, Kateřina; Šafaříková, Miroslava
2015-01-01
Roč. 32, č. 1 (2015), s. 227-237 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA MŠk(CZ) LD13021 Institutional support: RVO:67179843 Keywords : yeast cells * Saccharomyces * Kluyveromyces * Rhodotorula * Yarrowia * magnetic modification Subject RIV: CE - Biochemistry Impact factor: 2.259, year: 2015
Czech Academy of Sciences Publication Activity Database
Habash, S.; Radakovic, Z.S.; Vaňková, Radomíra; Siddique, S.; Dobrev, Petre; Gleason, C.; Grundler, F.M.W.; Elashry, A.
2017-01-01
Roč. 7, JUL 31 (2017), č. článku 6874. ISSN 2045-2322 Institutional support: RVO:61389030 Keywords : arabidopsis-thaliana * cyst-nematode * parasitic nematode * transient expression * host plants * sequence * identification * infection * model * transformation Subject RIV: ED - Physiology OBOR OECD: Plant sciences, botany Impact factor: 4.259, year: 2016
2013-01-17
... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R3-R-2012-N259; FXRS1265030000-134-FF03R06000] Big Stone National Wildlife Refuge, Big Stone and Lac Qui Parle Counties, MN; Final Comprehensive... significant impact (FONSI) for the environmental assessment (EA) for Big Stone National Wildlife Refuge...
Lifescience Database Archive (English)
Full Text Available IC6|VGLG_LNYV Glycoprotein G OS=Lettuce necrotic yellows v... 29 9.4 sp|A6VMF8|MEND_ACTSZ 2-succinyl-5-enolp...SPQKVVIENSWAFRNGINY 259 Query: 218 WKD 210 W D Sbjct: 260 WND 262 >sp|Q9DIC6|VGLG_LNYV Glycoprotein G OS=Lettuce
Portfolio optimization with short-selling and spin-glass
Schianchi, A.; Bongini, L.; Degli Esposti, M.; Giardinà, C.
2002-01-01
n this paper, we solve a general problem of optimizing a portfolio in a futures markets framework, extending the previous work of Galluccio et al. [Physica A 259, 449 (1998)]. We allow for long buying/short selling of a relatively large number of assets, assuming a fixed level of margin requirement.
Czech Academy of Sciences Publication Activity Database
Stodůlková, Eva; Man, Petr; Kuzma, Marek; Černý, J.; Císařová, I.; Kubátová, A.; Chudíčková, Milada; Kolařík, Miroslav; Flieger, Miroslav
2015-01-01
Roč. 60, č. 3 (2015), s. 259-267 ISSN 0015-5632 R&D Projects: GA MŠk(CZ) LD13039; GA ČR GA13-16565S Institutional support: RVO:61388971 Keywords : NECTRIA-HAEMATOCOCCA * ASCOMYCETOUS FUNGUS * BIOLOGICAL-ACTIVITY Subject RIV: EE - Microbiology, Virology Impact factor: 1.335, year: 2015
Yamagata, Shinji; Takahashi, Yusuke; Ozaki, Koken; Fujisawa, Keiko K.; Nonaka, Koichi; Ando, Juko
2013-01-01
This twin study examined the bidirectional relationship between maternal parenting behaviors and children's peer problems that were not confounded by genetic and family environmental factors. Mothers of 259 monozygotic twin pairs reported parenting behaviors and peer problems when twins were 42 and 48 months. Path analyses on monozygotic twin…
FERO (Finding Extreme Relativistic Objects): statistics of relativistic broad Fe Kalpha lines in AGN
Czech Academy of Sciences Publication Activity Database
Longinotti, A. L.; de La Calle, I.; Bianchi, S.; Guainazzi, M.; Dovčiak, Michal
2008-01-01
Roč. 79, č. 1 (2008), s. 259-261 ISSN 0037-8720. [ Simbol -X: The hard X-ray Universe in focus. Bologna, 14.05.2007-16.05.2007] Institutional research plan: CEZ:AV0Z10030501 Keywords : active galaxies * X-raylLines-iron Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics
Vitamin B2 as a virulence factor in Pseudogymnoascus destructans skin infection
Czech Academy of Sciences Publication Activity Database
Flieger, Miroslav; Banďouchová, H.; Černý, J.; Chudíčková, Milada; Kolařík, Miroslav; Kováčová, V.; Martínková, Natália; Novák, Petr; Šebesta, O.; Stodůlková, Eva; Pikula, J.
2016-01-01
Roč. 6, č. 33200 (2016), s. 33200 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:61388971 ; RVO:68081766 Keywords : riboflavin * white-nose syndrome (WNS) * bats Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Macháčková, Kateřina; Collinsová, Michaela; Chrudinová, Martina; Selicharová, Irena; Pícha, Jan; Buděšínský, Miloš; Vaněk, Václav; Žáková, Lenka; Brzozowski, A. M.; Jiráček, Jiří
2017-01-01
Roč. 60, č. 24 (2017), s. 10105-10117 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : IGF-1 * receptor * synthesis * triazole Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016 http://pubs.acs.org/doi/full/10.1021/acs.jmedchem.7b01331
Perceptions of physical activity, activity preferences and health ...
African Journals Online (AJOL)
"Weight loss," "health concerns" and "increased energy," were top motivators for PA. "Can't find the time," "work/family obligations," and "don't have a facility" were top barriers. Presence of hypertension, hypercholesterolemia and prior weight loss correlated with the slimming motivator (adjusted odds ratio 2.59, p=0.008; ...
Is the dark matter halo of the Milky Way flattened?
Czech Academy of Sciences Publication Activity Database
Růžička, Adam; Palouš, Jan; Theis, Ch.
2007-01-01
Roč. 461, č. 1 (2007), s. 155-169 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : N-body simulations * galaxies * interactions * Magellanic clouds Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007
Beltramini, Richard F.; Bridge, Patrick D.
2001-01-01
The Hazards of Tobacco (C) program, which focuses on smoking prevention among youth, was completed by 259 suburban sixth graders (199 controls) and 166 urban fifth through seventh graders. Participation significantly changed understanding of the role of tobacco advertising and the intention to smoke in both samples. (Contains 49 references.) (SK)
Johnson, Donald M.
1996-01-01
Arkansas agriculture teachers (213 of 259 surveyed) expressed support for granting science credit for agriculture (88.8%); 65.6% supported science credit for a limited number of agriculture courses. Blanket endorsement for all certified agriculture teachers was favored by 71.5%; 56.6% preferred endorsement only for certified teachers completing an…
Application of the information, motivation and behavioural skills ...
African Journals Online (AJOL)
This paper discusses the application of an information, motivation and behavioural skills (IMB) model in a school-based programme for the reduction of HIV risk behaviour among 259 Grade 11 learners in two high schools in Alexandra township, Johannesburg. School 1 was the Experimental group, while School 2 was the ...
Czech Academy of Sciences Publication Activity Database
Zakharov, S.; Kotíková, K.; Nurieva, O.; Hlušička, J.; Kačer, P.; Urban, P.; Vaněčková, M.; Seidl, Z.; Diblík, P.; Kuthan, P.; Navrátil, Tomáš; Pelclová, D.
2017-01-01
Roč. 55, č. 4 (2017), s. 249-259 ISSN 1556-3650 Institutional support: RVO:61388955 Keywords : brain damage * leukotrienes * methanol poisoning * Neuroinflammation * nontraumatic brain injury * sequelae of poisoning Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 3.677, year: 2016
Czech Academy of Sciences Publication Activity Database
Semerdzhiev, S. A.; Shvadchak, Volodymyr V.; Subramaniam, V.; Claessens, M. M. A. E.
2017-01-01
Roč. 7, Aug 9 (2017), č. článku 7699. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : liquid crystal spherulites * Parkinson's disease * Alzheimer's disease Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-06532-1
Prevalence of Demodex spp among alcohol-dependent patients
Directory of Open Access Journals (Sweden)
Mehmet Hanifi Kokacya
2016-06-01
Conclusion: Demodex spp. are more common in alcohol-dependent patients due conditions of reduced self-care and immunosuppression. Demodex parasites should be considered in alcohol-dependent patients with skin lesions, especially on the face, and should to be treated if needed. [Cukurova Med J 2016; 41(2.000: 259-263
Background: The 776C-->G polymorphism of the vitamin B-12 transport protein transcobalamin gene (TCN2) (rs1801198; Pro259Arg) is associated with a lower holotranscobalamin concentration in plasma. This effect may reduce the availability of vitamin B-12 to tissues even when vitamin B-12 intake is ade...
Czech Academy of Sciences Publication Activity Database
Lunova, M.; Prokhorov, A.; Jirsa, M.; Hof, M.; Olžyńska, A.; Jurkiewicz, P.; Kubinová, Šárka; Lunov, O.; Dejneka, A.
2017-01-01
Roč. 7, č. 1 (2017), s. 16049 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : mesoporous silica nanoparticles * iron-oxide nanoparticles * double-stranded-rna * drug-delivery Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Di Giglio, M. G.; Muttenthaler, M.; Harpsoe, K.; Liutkeviciute, Z.; Keov, P.; Eder, T.; Rattei, T.; Arrowsmith, S.; Wray, S.; Marek, Aleš; Elbert, Tomáš; Alewood, P. F.; Gloriam, D. E.; Gruber, C. W.
2017-01-01
Roč. 7, Feb 1 (2017), č. článku 41002. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : neuropeptide * inotocin * V1aR-antagonist Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep41002
Field-induced exciton condensation in LaCoO.sub.3./sub.
Czech Academy of Sciences Publication Activity Database
Sotnikov, A.; Kuneš, Jan
2016-01-01
Roč. 6, Jul (2016), 1-6, č. článku 30510. ISSN 2045-2322 EU Projects: European Commission(XE) 646807 - EXMAG Institutional support: RVO:68378271 Keywords : exciton condensation * LaCoO 3 * dynamical mean-field theory Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016
Role of guard rings in improving the performance of silicon detectors
Indian Academy of Sciences (India)
number of free charge carriers thus produced is proportional to the energy deposited. 259 .... grounding the innermost guard ring of a strip detector of geometry 60 × 60 mm2. ... The guard ring was kept floating with no electrical connection .... ment of maintaining high-quality semiconductor properties during high temperature.
Proctor, Michael D.; Marks, Yaela
2013-01-01
This research reports and analyzes for archival purposes surveyed perceptions, use, and access by 259 United States based exemplar Primary and Secondary educators of computer-based games and technology for classroom instruction. Participating respondents were considered exemplary as they each won the Milken Educator Award during the 1996-2009…
The enigma of the lower gut-associated lymphoid tissue (GALT)
Czech Academy of Sciences Publication Activity Database
Butler, J. E.; Šinkora, Marek
2013-01-01
Roč. 94, č. 2 (2013), s. 259-270 ISSN 0741-5400 R&D Projects: GA ČR GAP502/10/0038; GA ČR GAP502/12/0110 Institutional support: RVO:61388971 Keywords : B lymphocytes * lymphogenesis * B cell development Subject RIV: EC - Immunology Impact factor: 4.304, year: 2013
Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines
Czech Academy of Sciences Publication Activity Database
Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír
2013-01-01
Roč. 68, č. 2013 (2013), s. 253-259 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013
Assessment of the nutritional quality of smoked catfish ( Clarias ...
African Journals Online (AJOL)
This study examined the nutritional quality of smoked Catfish Clarias gariepinus obtained in three different markets in Lapai, Niger State, Nigeria for a period of three months. Proximate compositions of smoked Clarias gariepinus were determined. The highest protein content (49.27 ± 2.59) was recorded in smoked fish ...
Prevalence and severity of malnutrition in pre-school children in a rural area of western Kenya
Kwena, Arthur M.; Terlouw, Dianne J.; de Vlas, Sake J.; Phillips-Howard, Penelope A.; Hawley, William A.; Friedman, Jennifer F.; Vulule, John M.; Nahlen, Bernard L.; Sauerwein, Robert W.; ter Kuile, Feiko O.
2003-01-01
We determined the nutritional status of children less than five years of age in an area in rural western Kenya with intense malaria transmission, a high prevalence of severe anemia and human immunodeficiency virus, and high infant and under-five mortality (176/1,000 and 259/1,000). No information is
Czech Academy of Sciences Publication Activity Database
Pidek, I. A.; Svitavská-Svobodová, Helena; van der Knaap, W. O.; Noryskiewicz, A. M.; Filbrandt-Czaja, A.; Noryskiewicz, B.; Latalova, M.; Zimny, M.; Swieta-Musznicka, J.; Bozilova, E.; Tonkov, S.; Filipova-Marinova, M.; Poska, A.; Giesecke, T.; Gikov, A.
2010-01-01
Roč. 19, č. 4 (2010), s. 259-270 ISSN 0939-6314 R&D Projects: GA AV ČR IAAX00130801; GA AV ČR IAAX00050801 Institutional research plan: CEZ:AV0Z60050516 Keywords : Fagus * Europe * pollen monitoring Subject RIV: EF - Botanics Impact factor: 1.656, year: 2010
1988-11-16
on an operational classification (Robinson- Steiner , A.M., Beebe, S.J., Rannels, S.R., and Corbin, J.D. (1984) J. Biol. Chem. 259, 10595). RIIA forms... Rudolf -Bucheim-Institut flir Phariakologie, D-6300 Giessen, F.R.G. Botulimnm C2 tocin (BtcxC2), which causes hypotnic effects, increase in vascular
Pattern of gastrointestinal opportunistic infections among HIV ...
African Journals Online (AJOL)
Twenty-two per cent (22%) of these had mixed parasitosis of cryptosporidium and hookworm. There was no significant association of CD4 cells count with intestinal parasitosis. x2 = 5.286 and p=0.259. However marital status was significantly associated with gastrointestinal opportunistic parasitosis with x2 of 12.693, ...
N-terminal tetrapeptide T/SPLH motifs contribute to multimodal activation of human TRPA1 channel
Czech Academy of Sciences Publication Activity Database
Hynková, Anna; Maršáková, Lenka; Vašková, Jana; Vlachová, Viktorie
2016-01-01
Roč. 6, Jun 27 (2016), s. 28700 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-15839S Institutional support: RVO:67985823 Keywords : ankyrin receptor subtype 1 * transient receptor potential * gating * ankyrin repeat * whole-cell electrophysiology * N-terminus * mutagenesis Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016
Sourcing in Professional Education: Do Text Factors Make Any Difference?
Bråten, Ivar; Strømsø, Helge I.; Andreassen, Rune
2016-01-01
The present study investigated the extent to which the text factors of source salience and emphasis on risk might influence readers' attention to and use of source information when reading single documents to make behavioral decisions on controversial health-related issues. Participants (n = 259), who were attending different bachelor-level…
Back-transformation of treatment differences - an approximate method
DEFF Research Database (Denmark)
Laursen, Rikke Pilmann; Dalskov, Stine-Mathilde; Damsgaard, Camilla Trab
2014-01-01
Background/Objectives:Transformation of outcomes is frequently used in the analysis of studies in clinical nutrition. However, back-transformation of estimated treatment means and differences is complicated by the nonlinear nature of the transformations. It is not straightforward to obtain an est...... publication, 11 December 2013; doi:10.1038/ejcn.2013.259....
Czech Academy of Sciences Publication Activity Database
Alves, A. C.; Magarkar, Aniket; Horta, M.; Lima, J. L. F. C.; Bunker, A.; Nunes, C.; Reis, S.
2017-01-01
Roč. 7, Jul 24 (2017), č. článku 6343. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : P-glycoprotein * molecular dynamics * multidrug resistance Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-06445-z
Czech Academy of Sciences Publication Activity Database
Villena, J. A.; Carmona, M. C.; Rodriguez de la Concepción, M.; Rossmeisl, Martin; Vinas, O.; Mampel, T.; Iglesias, R.; Giralt, M.; Villarroya, F.
2002-01-01
Roč. 59, č. 11 (2002), s. 1934-1944 ISSN 1420-682X Grant - others:Ministerio de Ciencia y Tecnología (ES) PM98.0188 Institutional research plan: CEZ:AV0Z5011922 Keywords : brown adipose tissue * mitochondria * transcription factors Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.259, year: 2002
Myocardial scintigraphy. Clinical use and consequence in a non-invasive cardiological department
DEFF Research Database (Denmark)
Dümcke, Christine Elisabeth; Graff, J; Rasmussen, SPL
2006-01-01
to analyse the clinical use of MPI in a university hospital without invasive cardiological laboratory. MATERIAL AND METHODS: In the period 01.01.2002 to 31.12.2003, 259 patients (141 women, 118 men) were referred to MPI from our department of cardiology. RESULTS: Normal MPI was seen in 111 patients (43...
The correlation theory of the chemical bond
Czech Academy of Sciences Publication Activity Database
Szalay, S.; Barcza, G.; Szilvási, T.; Veis, Libor; Legeza, Ö.
2017-01-01
Roč. 7, MAY 2017 (2017), č. článku 2237. ISSN 2045-2322 R&D Projects: GA ČR GA16-12052S Institutional support: RVO:61388955 Keywords : density matrix * quantum chemistry * theoretical model Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Vávra, Jiří; Becnel, J. J.
2007-01-01
Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquito es * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007
Czech Academy of Sciences Publication Activity Database
Špaček, Petr; Keough, D. T.; Chavchich, M.; Dračínský, Martin; Janeba, Zlatko; Naesens, L.; Edstein, M. D.; Guddat, L. W.; Hocková, Dana
2017-01-01
Roč. 60, č. 17 (2017), s. 7539-7554 ISSN 0022-2623 R&D Projects: GA ČR(CZ) GA16-06049S Institutional support: RVO:61388963 Keywords : hypoxanthine-guanine phosphoribosyltransferase * 2nd phosphonate group * 6-oxopurine phosphoribosyltransferases Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Koh, H.W.; Hur, M.; Kang, M.S.; Ku, Y.B.; Ghai, Rohit; Park, S.J.
2017-01-01
Roč. 7, Nov (2017), č. článku 15007. ISSN 2045-2322 R&D Projects: GA ČR GA17-04828S Institutional support: RVO:60077344 Keywords : sp-nov. * escherichia-coli * oxidative stress * molecular characterization * drinking-water Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016
Background: A common polymorphism, C776G, in the plasma B12 transport protein transcobalamin (TC), encodes for either proline or arginine at codon 259. This polymorphism may affect the affinity of TC for B12 and subsequent delivery of B12 to tissues. Methods: TC genotype and its associations with i...
Hyland, Philip E.; McLaughlin, Christopher G.; Boduszek, Daniel; Prentice, Garry R.
2012-01-01
The study set out to examine intentions to engage in counselling among at-risk Irish government employees and the differential utility of two alternative theory of planned behaviour (TPB) models of behaviour to explain intentions to participate in counselling. Individuals (N = 259) employed in a front-line, at-risk occupation for the Irish…
Cotton, grown mainly for its fiber, is a major crop in several developing and developed countries across the globe. In 2012, 48.8 million metric tons (MMT) of cottonseed was produced worldwide as a by-product of the 25.9 MMT of cotton lint production (FAO Production Statistics). This amount of cot...
Czech Academy of Sciences Publication Activity Database
Jiroušek, Ondřej; Jíra, J.; Hrdlička, Ondřej; Kunecký, Jiří; Kytýř, Daniel; Vyčichl, J.; Doktor, Tomáš
2010-01-01
Roč. 224, č. 4 (2010), s. 259-267 ISSN 0954-4097 Institutional research plan: CEZ:AV0Z20710524 Keywords : railway track bed * reinforcing geogrid * finite-element modelling * settlement reduction * contact analysis * ballast material Subject RIV: JN - Civil Engineering Impact factor: 0.389, year: 2010 http://journals.pepublishing.com/content/k561040632411117/
Czech Academy of Sciences Publication Activity Database
Weyhenmeyer, G. A.; Mackay, M.; Stockwell, J. D.; Thiery, W.; Grossart, H. P.; Augusto-Silva, P. B.; Baulch, H. M.; de Eyto, E.; Hejzlar, Josef; Kangur, K.; Kirillin, G.; Pierson, D. C.; Rusak, J. A.; Sadro, S.; Woolway, R. I.
2017-01-01
Roč. 7, March (2017), č. článku 43890. ISSN 2045-2322 R&D Projects: GA ČR GA15-13750S Institutional support: RVO:60077344 Keywords : dissolved organic-carbon * transfer velocity * energy fluxes * lake * evaporation Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 4.259, year: 2016
Proton irradiation: a key to the challenge of N-glycosidic bond formation in a prebiotic context
Czech Academy of Sciences Publication Activity Database
Saladino, R.; Bizzarri, B.M.; Botta, L.; Šponer, Jiří; Šponer, Judit E.; Georgelin, T.; Jaber, M.; Rigaud, B.; Kapralov, M.; Timoshenko, G. N.; Rozanov, A.; Krasavin, E.; Timperio, A.M.; Di Mauro, E.
2017-01-01
Roč. 7, NOV2017 (2017), č. článku 14709. ISSN 2045-2322 R&D Projects: GA ČR GA17-05076S Institutional support: RVO:68081707 Keywords : aqueous-solution * nucleic-acids * formamide * radicals Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016
2011-10-06
... shell). They may also feed on organic particles in sediment using the large, muscular foot (an organ... detritus (Yeager et al. 1994, pp. 253-259). Mussels tend to grow relatively rapidly for the first few years.... Juvenile freshwater mussels burrow into interstitial substrates and grow to a larger size that is less...
Neutron diffraction study of Lu.sub.2./sub.Fe.sub.17./sub. under pressure
Czech Academy of Sciences Publication Activity Database
Prokhnenko, Olexandr; Ritter, C.; Medvedeva, I.; Arnold, Zdeněk; Kamarád, Jiří; Kuchin, A.
258-259, - (2003), s. 564-566 ISSN 0304-8853 R&D Projects: GA ČR GA202/02/0739; GA AV ČR IAA1010018 Institutional research plan: CEZ:AV0Z1010914 Keywords : intermetallic compounds * neutron scattering * magnetic structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003
Czech Academy of Sciences Publication Activity Database
Natalini, F.; Alejano, R.; Vazquez-Pique, J.; Pardos, M.; Calama, R.; Büntgen, Ulf
2016-01-01
Roč. 40, dec (2016), s. 72-84 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-rings * genetically depauperate * mediterranean climate * phenotypic plasticity * cambial activity * fagus-sylvatica * spain * drought * widespread * halepensis * Climate change * Dendroecology * Growth plasticity * Mediterranean * Tree rings * Drought Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Mravec, J.; Kračun, S. K.; Zemlyanskaya, E.; Rydahl, M. G.; Guo, X.; Pičmanová, M.; Sørensen, K.; Růžička, Kamil; Willats, W.G.T.
2017-01-01
Roč. 7, NOV 22 (2017), č. článku 15988. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:61389030 Keywords : MEMBRANE H+-ATPASE * BIOLOGICAL-ACTIVITY * AZIDO AUXINS Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 4.259, year: 2016
Differential distribution of Y-chromosome haplotypes in Swiss and Southern European goat breeds
Czech Academy of Sciences Publication Activity Database
Vidal, O.; Drögemüller, C.; Obexer-Ruff, G.; Reber, I.; Jordana, J.; Martínez, A.; Bâlteanu, V. A.; Delgado, J. V.; Eghbalsaied, S.; Landi, V.; Goyache, F.; Traore, A.; Pazzola, M.; Vacca, G.M.; Badaoui, B.; Pilla, F.; D'Andrea, M.; Álvarez, I.; Capote, J.; Sharaf, Abdoallah; Pons, A.; Amills, M.
2017-01-01
Roč. 7, NOV 23 (2017), č. článku 16161. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : mitochondrial-dna * nucleotide diversity * genetic diversity * domestication * origins * phylogenies * east Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 4.259, year: 2016
Demand and Supply of Teachers to Secondary Schools in Anambra ...
African Journals Online (AJOL)
This study investigated the demand and supply of teachers to secondary schools in Anambra State of Nigeria due to school type. The survey design approach was adopted for this study. The population of the study comprised of all the secondary school principals, numbering 259 in the six education zones of Anambra State.
Elicitation threshold of cobalt chloride
DEFF Research Database (Denmark)
Fischer, Louise A; Johansen, Jeanne D; Voelund, Aage
2016-01-01
: On the basis of five included studies, the ED10 values of aqueous cobalt chloride ranged between 0.0663 and 1.95 µg cobalt/cm(2), corresponding to 30.8-259 ppm. CONCLUSIONS: Our analysis provides an overview of the doses of cobalt that are required to elicit allergic cobalt contactdermatitis in sensitized...
Regional Fears of Western Primacy and the Future of U.S. Middle Eastern Basing Policy
2006-12-01
8, 2006, internet. 166. “ Green Energy Gambit,” The Pearl (Magazine of the State of Qatar), March 2005, p. 4. 167. Michael R. Gordon and Lieutenant...The Middle East, October 2005, pp. 16-17. 259. Hamad Bin Isa al Khalifa, First Light: Modern Bahrain and Its Heritage, London and New York: Kegan
Social Adjustment of College Freshmen: The Importance of Gender and Living Environment
Enochs, Wendy K.; Roland, Catherine B.
2006-01-01
The relationship between living environment, gender and both overall adjustment to college and social adjustment in freshmen students was examined in this study. The College Adjustment Scales were administered to 511 freshmen students living in on-campus housing. There were 259 students living in Freshmen Year Experience (FYE) Halls verses 252…
Ormerod, Alayne J.; Collinsworth, Linda L.; Perry, Leigh Ann
2008-01-01
This study examined the relationships among peer-to-peer sexual harassment, school climate, adult-to-student harassment, and outcomes (psychological and physical well-being; school withdrawal and safety) for high school girls (n = 310) and boys (n = 259) recruited from seven public high schools in a Midwestern state. More frequent, severe peer…
Czech Academy of Sciences Publication Activity Database
Borovička, Jiří; Spurný, Pavel; Koten, Pavel
2007-01-01
Roč. 473, č. 2 (2007), s. 661-672 ISSN 0004-6361 R&D Projects: GA ČR GA205/05/0543; GA AV ČR KJB300030502 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor * meteoroid * comet Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007
Sickness absence and return to work rates in women with breast cancer
Roelen, Corne A. M.; Koopmans, Petra C.; de Graaf, Jan H.; Balak, Fulya; Groothoff, Johan W.
Most women are diagnosed with breast cancer when they are of working age. How long are breast cancer patients absent? How many of them return to work? ArboNed Occupational Health Services documents sickness absence data of 1 million workers of whom 40% were women. Between 2001 and 2005, 2,259 women
Czech Academy of Sciences Publication Activity Database
Galář, P.; Khun, J.; Kopecký, D.; Scholtz, V.; Trchová, Miroslava; Fučíková, A.; Jirešová, J.; Fišer, L.
2017-01-01
Roč. 7, 08 November (2017), s. 1-10, č. článku 15068. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA17-04109S Institutional support: RVO:61389013 Keywords : conductive polymer * polypyrrole * plasma Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016
Polyaniline cryogels: Biocompatibility of novel conducting macroporous material
Czech Academy of Sciences Publication Activity Database
Humpolíček, P.; Radaszkiewicz, K. A.; Capáková, Z.; Pacherník, J.; Bober, Patrycja; Kašpárková, V.; Rejmontová, P.; Lehocký, M.; Ponížil, P.; Stejskal, Jaroslav
2018-01-01
Roč. 8, 09 January (2018), s. 1-12, č. článku 135. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA17-05095S Institutional support: RVO:61389013 Keywords : polyaniline * cryogel * biocompatibility Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Frouz, Jan; Finer, L.
2007-01-01
Roč. 54, - (2007), s. 251-259 ISSN 0020-1812 Grant - others:Academy of Finland(FI) 200870 Institutional research plan: CEZ:AV0Z60660521 Source of funding: V - iné verejné zdroje Keywords : ant nests * thermoregulation * Formica rufa group Subject RIV: EH - Ecology, Behaviour Impact factor: 1.391, year: 2007
Czech Academy of Sciences Publication Activity Database
Hofer, Michal; Falk, Martin; Komůrková, Denisa; Falková, Iva; Bačíková, Alena; Klejdus, B.; Pagáčová, Eva; Štefančíková, Lenka; Weiterová, Lenka; Angelis, Karel; Kozubek, Stanislav; Dušek, L.; Galbavy, S.
2016-01-01
Roč. 59, č. 7 (2016), s. 3003-3017 ISSN 0022-2623 R&D Projects: GA ČR GBP302/12/G157; GA ČR(CZ) GA16-12454S Institutional support: RVO:68081707 Keywords : alternative splicing variant * order chromatin -structure Subject RIV: BO - Biophysics Impact factor: 6.259, year: 2016
Intricate disorder in defect fluorite/pyrochlore: a concord of chemistry and crystallography
Czech Academy of Sciences Publication Activity Database
Simeone, D.; Thorogood, G.J.; Huo, D.; Luneville, L.; Baldinozzi, G.; Petříček, Václav; Porcher, F.; Ribis, J.; Mazerolles, L.; Largeau, L.; Berar, J.F.; Surble, S.
2017-01-01
Roč. 7, Jun (2017), 1-7, č. článku 3727. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : disorder * atomic scale * metallic allys * oxides * fluorite/pyrochlore Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. Sangappa. Articles written in Journal of Biosciences. Volume 30 Issue 2 March 2005 pp 259-268 Articles. Crystal structure of raw pure Mysore silk fibre based on (Ala-Gly)2-Ser-Gly peptide sequence using Linked-Atom-Least-Squares method · Sangappa S S Mahesh R Somashekar.
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. R Bremananth. Articles written in Sadhana. Volume 31 Issue 3 June 2006 pp 259-276. New methodology for a person identification system · R Bremananth A Chitra · More Details Abstract Fulltext PDF. Reliable person identification is a key factor for any safety measure. Unlike other biometrics ...
Male knowledge of danger signs of obstetric complications in an ...
African Journals Online (AJOL)
cannot be overlooked in this regard. The aim of this study was to determine men's knowledge of danger signs in pregnancy and their role in pregnancy related decision making. Methods: A cross sectional survey was conducted among 259 men aged 15-65 years in selected communities in Ibadan, Oyo State by multistage
HANSENULA WICKERHAMII SP. N., A NEW YEAST FROM FINNISH SOIL
Capriotti, Augusto
1961-01-01
Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638
Czech Academy of Sciences Publication Activity Database
Široký, P.; Kamler, M.; Modrý, David
2005-01-01
Roč. 52, č. 4 (2005), s. 259-361 ISSN 0015-5683 R&D Projects: GA ČR GP524/03/D104 Grant - others:IGA VFU(CZ) 2/2004/FVHE Institutional research plan: CEZ:AV0Z60220518 Keywords : Apicomplexa * Hemolivia mauritanica Subject RIV: EG - Zoology Impact factor: 1.138, year: 2005
Determination of radon concentration in spring gases with a portable semiconductor detector
International Nuclear Information System (INIS)
Endo, K.; Yanaga, M.; Yoshikawa, H.; Horiuchi, K.; Nakahara, H.; Murakami, Y.
1985-01-01
A portable integrating radon meter, alpha METER-400, was tested. The instrument detects α-rays of energy greater than 2.59 MeV. With this detector, the concentration of 222 Rn in spring gases at volcanic regions was determined. The results were compared with those observed by the liquid scintillation counting method. (author)
Ticks infected via co-feeding transmission can transmit Lyme borreliosis to vertebrate hosts
Czech Academy of Sciences Publication Activity Database
Belli, A.; Sarr, A.; Rais, O.; Rego, Ryan O. M.; Voordouw, M.J.
2017-01-01
Roč. 7, JUL 10 (2017), č. článku 5006. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Ixodes ricinus ticks * disease spirochete * borne pathogens * r-0 model * vector * mice * immunity * persistence Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 4.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Mohelníková-Duchoňová, B.; Strouhal, O.; Hughes, D. J.; Holcatová, I.; Oliverius, M.; Kala, Z.; Campa, D.; Rizzato, C.; Canzian, F.; Pezzilli, R.; Talar-Wojnarowska, R.; Malecka-Panas, E.; Sperti, C.; Federico Zambon, C.; Pedrazzoli, S.; Fogar, P.; Milanetto, A.C.; Capurso, G.; Fave, G.D.; Valente, R.; Gazouli, M.; Malleo, G.; Lawlor, R.T.; Strobel, O.; Hackert, T.; Giese, N.; Vodička, Pavel; Vodičková, Ludmila; Landi, S.; Tavano, F.; Gioffreda, D.; Piepoli, A.; Pazienza, V.; Mambrini, A.; Pedata, M.; Cantore, M.; Bambi, F.; Ermini, S.; Funel, N.; Lemstrová, R.; Souček, P.
2017-01-01
Roč. 7, MAR 2017 (2017), s. 43812 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP301/12/1734 Institutional support: RVO:68378041 Keywords : genome-wide association * genetic susceptibility * loci * transporters Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016
Secondary School Administration in Anambra State Today ...
African Journals Online (AJOL)
The study, a descriptive survey research design was used to identify the challenges that impede secondary school administration today in Anambra State. The population of the study was all the 259 public secondary school principals in the state. Two research questions and two null hypotheses guided the study. A 20-item ...
Energy Technology Data Exchange (ETDEWEB)
Fracchia, Fabrizio [Bocconi Univ., Milano (Italy). IDC Istituto di diritto comparato
2005-05-15
The aim of the research at issue is to understand the general aspects of administrative environmental proceedings in the electromagnetic pollution field, as they are regulated in Italy both by the Law of February 22, 2001, No. 36 and by the art. 87 of the Legislative Decree of August 1, 2003, No. 259 (by means of this decree, Italy implemented a package of EU Directives -2002/19/EC, 2002/20/EC, 2002/21/EC and 2002/22/EC - in the TLC sector; entered into force on September 16, 2003, it introduced the so-called Unique Code on Electronic Communications) [Italian] Il lavoro ha ad oggetto l'analisi delle procedure autorizzatorie nel settore dell'inquinamento da campi elettromagnetici disciplinate dalla legge 22 febbraio 2001, n. 36 e dall'art. 87, d.lgs. 1 agosto 2003, n. 259 (codice delle comunicazioni elettroniche). Dopo aver registrato la presenza, all'interno di siffatti procedimenti, delle tradizionali funzioni assegnate al procedimento amministrativo, l'indagine individua nel dettaglio i principi stabiliti dalla normativa e i caratteri dell'autorizzazione, indugiando in particolare sul profilo del margine di discrezionalita sussistente in capo all'amministrazione. L'angustia di questo spazio di discrezionalita viene tra l'altro collegato alla rilevanza che, nel settore in esame, risulta avere il principio di precauzione. Specifica attenzione e dedicata al procedimento delineato dall'art. 87, d.lgs. 259/2003, cit.: vengono analizzati i titoli di legittimazione ivi disciplinati, i rapporti con l'istituto della valutazione di impatto ambientale, le fasi procedimentali, la conferenza di servizi e i limiti di applicabilita del meccanismo del silenzio assenso, il tutto avendo come riferimento essenziale il tema della precauzione, il principio di doverosita e la loro valenza normativa.
Directory of Open Access Journals (Sweden)
Sudharsana R Ande
Full Text Available Prohibitin (PHB or PHB1 is an evolutionarily conserved, multifunctional protein which is present in various cellular compartments including the plasma membrane. However, mechanisms involved in various functions of PHB are not fully explored yet. Here we report for the first time that PHB interacts with O-linked beta-N-acetylglucosamine transferase (O-GlcNAc transferase, OGT and is O-GlcNAc modified; and also undergoes tyrosine phosphorylation in response to insulin. Tyrosine 114 (Tyr114 and tyrosine 259 (Tyr259 in PHB are in the close proximity of potential O-GlcNAc sites serine 121 (Ser121 and threonine 258 (Thr258 respectively. Substitution of Tyr114 and Tyr259 residues in PHB with phenylalanine by site-directed mutagenesis results in reduced tyrosine phosphorylation as well as reduced O-GlcNAc modification of PHB. Surprisingly, this also resulted in enhanced tyrosine phosphorylation and activity of OGT. This is attributed to the presence of similar tyrosine motifs in PHB and OGT. Substitution of Ser121 and Thr258 with alanine and isoleucine respectively resulted in attenuation of O-GlcNAc modification and increased tyrosine phosphorylation of PHB suggesting an association between these two dynamic modifications. Sequence analysis of O-GlcNAc modified proteins having known O-GlcNAc modification site(s or known tyrosine phosphorylation site(s revealed a strong potential association between these two posttranslational modifications in various proteins. We speculate that O-GlcNAc modification and tyrosine phosphorylation of PHB play an important role in tyrosine kinase signaling pathways including insulin, growth factors and immune receptors signaling. In addition, we propose that O-GlcNAc modification and tyrosine phosphorylation is a novel previously unidentified binary switch which may provide new mechanistic insights into cell signaling pathways and is open for direct experimental examination.
Two flagellar BAR domain proteins in Trypanosoma brucei with stage-specific regulation
Czech Academy of Sciences Publication Activity Database
Číčová, Z.; Dejung, M.; Skalický, Tomáš; Eisenhuth, N.; Hanselmann, S.; Morriswood, B.; Figueiredo, L.M.; Butter, F.; Janzen, C. J.
2016-01-01
Roč. 6, 25 October (2016), č. článku 35826. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : variant surface glycoprotein * attachment zone filament * blood stream forms * life cycle stages * paraflagellar rod * stable transformation * cell morphogenesis * ortholog groups * psi blast * membrane Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016
Network Inference and Maximum Entropy Estimation on Information Diagrams
Czech Academy of Sciences Publication Activity Database
Martin, E.A.; Hlinka, J.; Meinke, A.; Děchtěrenko, Filip; Tintěra, J.; Oliver, I.; Davidsen, J.
2017-01-01
Roč. 7, č. 1 (2017), s. 1-15, č. článku 7062. ISSN 2045-2322 R&D Projects: GA ČR GA13-23940S Institutional support: RVO:68081740 Keywords : complex networks * mutual information * entropy maximization * fMRI Subject RIV: AN - Psychology OBOR OECD: Cognitive sciences Impact factor: 4.259, year: 2016
High-yield fabrication and properties of 1.4 nm nanodiamonds with narrow size distribution
Czech Academy of Sciences Publication Activity Database
Stehlík, Štěpán; Varga, Marián; Ledinský, Martin; Miliaieva, Daria; Kozak, Halyna; Skakalova, V.; Mangler, C.; Pennycook, T. J.; Meyer, J.C.; Kromka, Alexander; Rezek, Bohuslav
2016-01-01
Roč. 6, Dec (2016), 1-8, č. článku 38419. ISSN 2045-2322 R&D Projects: GA ČR GA15-01809S Institutional support: RVO:68378271 Keywords : detonation nanodiamonds * Raman-spectroscopy * diamond nanoparticles * selective oxidation * ion-implantation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016
Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms
Czech Academy of Sciences Publication Activity Database
Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír
2006-01-01
Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30120515; CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006
effet de la macrofaune et des modes de gestion de la fertilité sur le ...
African Journals Online (AJOL)
crop in semi-arid West Africa. PhD Thesis. University and research centre, Wagenin- gen, The Netherland, 193 p. Ouédraogo E., Mando A., Brussaard L., 2004. Soil macrofaunal-mediated organic resource disappearance in semi-arid West Africa. Appl. Soil Ecol, 27 : 259 - 267. Ouédraogo E., Mando A., Stroosnijder L., 2006.
Czech Academy of Sciences Publication Activity Database
Šklíba, Jan; Lövy, M.; Burda, H.; Šumbera, R.
2016-01-01
Roč. 6, DEC 06 (2016), č. článku 37497. ISSN 2045-2322 EU Projects: European Commission(XE) 669609 - Diversity6continents Institutional support: RVO:60077344 Keywords : eusocial rodent * mole-rats * Fukomys anselli Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep37497
The Contribution of Counseling Providers to the Success or Failure of Marriages
Ansah-Hughes, Winifred
2015-01-01
This study is an investigation into the contribution of counseling providers to the success or failure of marriages. The purposive and the simple random sampling methods were used to select eight churches and 259 respondents (married people) in the Techiman Municipality. The instrument used to collect data was a 26-item questionnaire including a…
Czech Academy of Sciences Publication Activity Database
Anýz, J.; Vysloužilová, L.; Vaculovič, T.; Tvrdoňová, M.; Kanický, V.; Haase, H.; Horák, Vratislav; Štěpánková, O.; Heger, Z.; Adam, V.
2017-01-01
Roč. 7, č. 1 (2017), č. článku 40169. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1609 Institutional support: RVO:67985904 Keywords : melanoma patients * mixed effects models * bearing Libechov minipig Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemical research methods Impact factor: 4.259, year: 2016
Optical observations of enhanced activity of the 2005 Draconid meteor shower
Czech Academy of Sciences Publication Activity Database
Koten, Pavel; Borovička, Jiří; Spurný, Pavel; Štork, Rostislav
2007-01-01
Roč. 466, č. 2 (2007), s. 729-735 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030502; GA ČR GA205/05/0543 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteors * meteor shower s * Draconids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007
Internal dynamics of intense twin beams and their coherence
Czech Academy of Sciences Publication Activity Database
Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.
2016-01-01
Roč. 6, Feb (2016), 1-8, č. článku 22320. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : dynamics of intense * twin beams * pump-depleted parametric * down-conversion * coherence Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016
Robustness of one-dimensional viscous fluid motion under multidimensional perturbations
Czech Academy of Sciences Publication Activity Database
Feireisl, Eduard; Sun, Y.
2015-01-01
Roč. 259, č. 12 (2015), s. 7529-7539 ISSN 0022-0396 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes equations * 1-D compressible fluid flow * relative energy Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022039615004325
Universal growth modes of high-elevation conifers
Czech Academy of Sciences Publication Activity Database
Datsenko, N. M.; Sonechkin, D. M.; Büntgen, Ulf; Yang, B.
2016-01-01
Roč. 38, JUN (2016), s. 38-50 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-ring chronologies * summer temperature-variations * northeastern tibetan plateau * climate signal * fennoscandian summers * annual precipitation * density * variability * qinghai * Growth modes * Ring width and maximum latewood density * Eigenvector analysis Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Dannoon, S.; Ganguly, T.; Cahaya, H.; Geruntho, J. J.; Galliher, M. S.; Beyer, S. K.; Choy, C.J.; Hopkins, M.R.; Regan, M.; Blecha, J.E.; Škultétyová, Ĺubica; Drake, Ch.R.; Jivan, S.; Bařinka, Cyril; Jones, E. F.; Berkman, C.E.; VanBrocklin, H.F.
2016-01-01
Roč. 59, č. 12 (2016), s. 5684-5694 ISSN 0022-2623 R&D Projects: GA ČR GAP301/12/1513; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : GLUTAMATE CARBOXYPEPTIDASE-II * REACTION-MECHANISM * FOLATE-HYDROLASE Subject RIV: FD - Oncology ; Hematology Impact factor: 6.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Fikarová, J.; Kříženecká, S.; Elznicová, J.; Faměra, Martin; Lelková, T.; Matkovič, J.; Matys Grygar, Tomáš
2018-01-01
Roč. 18, č. 1 (2018), s. 259-275 ISSN 1439-0108 R&D Projects: GA ČR(CZ) GA15-00340S Institutional support: RVO:61388980 Keywords : Chemostratigraphy * Floodplain architecture * Organic pollutants * PAH * Pesticides Subject RIV: DD - Geochemistry OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 2.522, year: 2016
Czech Academy of Sciences Publication Activity Database
Zukal, Jan; Banďouchová, H.; Brichta, J.; Cmoková, A.; Jaron, K. S.; Kolařík, Miroslav; Kováčová, V.; Kubátová, A.; Nováková, Alena; Orlov, O.; Pikula, J.; Presetnik, P.; Šuba, J.; Zahradníková Jr., A.; Martínková, Natália
2016-01-01
Roč. 6, č. 19829 (2016), č. článku 19829. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:68081766 ; RVO:61388971 Keywords : White-nose syndrome * zoonotic viruses * emerging disease Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016
The perspectives for genetically modified cellulosic biofuels in the Central European conditions
Czech Academy of Sciences Publication Activity Database
Bláhová, P.; Janda, K.; Krištoufek, Ladislav
2014-01-01
Roč. 60, č. 6 (2014), s. 247-259 ISSN 0139-570X Grant - others:GA ČR(CZ) GAP402/11/0948 Program:GA Institutional support: RVO:67985556 Keywords : ellulosic biofuels * genetic modifications Subject RIV: AH - Economics Impact factor: 0.442, year: 2014 http://library.utia.cas.cz/separaty/2014/E/kristoufek-0433521.pdf
Czech Academy of Sciences Publication Activity Database
Janča, M.; Gvoždík, Lumír
2017-01-01
Roč. 7, č. 5177 (2017), č. článku 5177. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-07140S Institutional support: RVO:68081766 Keywords : interference competition * intraspecific variation * terrestrial salamander * energy metabolism * natural selection * newts Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.259, year: 2016
Ashour, Rateb; Khasawneh, Samer; Abu-Alruz, Jamal; Alsharqawi, Subhi
2012-01-01
The primary purpose of this study was to determine the curriculum orientations of pre-service teachers at a university in Jordan. Rigorous translation procedures were utilized to validate an Arabic version of the Curriculum Orientation Inventory (COI) for use in Jordan. The validated COI was administered to a sample of 259 pre-service teachers who…
Accessibility of women farmers to agricultural information in South ...
African Journals Online (AJOL)
Furthermore, the women farmers were accessible to technical information on improved seeds (x = 2.59), storage methods (x = 2.44), but poor access to operating farm machinery (x =0.49) and weather forecast (x =0.68). With regard to economic information they were accessible to market locations (x =2.40), but had low ...
Experimental Study of the Effect of Si/Al Composition on the Aluminum Distribution in (Al)MCM-41
Czech Academy of Sciences Publication Activity Database
Dědeček, Jiří; Žilková, Naděžda; Čejka, Jiří
44-45, 1/3 (2001), s. 259-266 ISSN 1387-1811 R&D Projects: GA AV ČR IAA4040001; GA AV ČR IBS4040017 Institutional research plan: CEZ:AV0Z4040901 Keywords : (Al)MCM-41 * Al distribution * VIS spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.497, year: 2001
Pán a pán, který běží – vývoj kresby v mladším školním věku
Czech Academy of Sciences Publication Activity Database
Vágnerová, M.; Janošová, Pavlína
2017-01-01
Roč. 51, č. 4 (2017), s. 240-259 ISSN 0555-5574 Grant - others:AV ČR(CZ) StrategieAV21/14 Program:StrategieAV Institutional support: RVO:68081740 Keywords : development of drawing * early school age * running human figure drawing * diagnostic possibilitie of drawing Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations)
Czech Academy of Sciences Publication Activity Database
Machara, A.; Lux, V.; Kožíšek, Milan; Grantz Šašková, Klára; Štěpánek, O.; Kotora, M.; Parkan, Kamil; Pávová, Marcela; Glass, B.; Sehr, P.; Lewis, J.; Müller, B.; Kräusslich, H. G.; Konvalinka, Jan
2016-01-01
Roč. 59, č. 2 (2016), s. 545-558 ISSN 0022-2623 R&D Projects: GA ČR GA13-19561S EU Projects: European Commission(XE) 201095 - HIV ACE Institutional support: RVO:61388963 Keywords : HIV -1 assembly * capsid * high-throughput screening * AlphaScreen assay Subject RIV: CE - Biochemistry Impact factor: 6.259, year: 2016
Nwimo, Ignatius O.; Onwunaka, Chinagorom
2015-01-01
The aim of the study was to determine the level of stress experienced by secondary school teachers in Ebonyi State. The dimensions of stress studied included physical stress, mental stress, emotional stress and social stress. The study adopted the cross-sectional survey design using a sample of 660 (male 259, female 401) teachers randomly drawn…
17 CFR 250.57 - Notices and reports to be filed under section 33.
2010-04-01
... section 33. (a) Notification of Status as Foreign Utility Company. Form U-57 (§ 259.207 of this chapter), notification of status as a foreign utility company, may be filed by, or on behalf of, an entity that seeks to... COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Regulation...
Lipid Driven Nanodomains in Giant Lipid Vesicles are Fluid and Disordered
Czech Academy of Sciences Publication Activity Database
Koukalová, Alena; Amaro, Mariana; Aydogan, Gokcan; Gröbner, G.; Williamson, P. T. F.; Mikhalyov, I.; Hof, Martin; Šachl, Radek
2017-01-01
Roč. 7, JUL 2017 (2017), č. článku 5460. ISSN 2045-2322 R&D Projects: GA ČR GA17-03160S Institutional support: RVO:61388955 Keywords : FLUORESCENCE CORRELATION SPECTROSCOPY * PLASMA-MEMBRANE VESICLES * RESONANCE ENERGY-TRANSFER Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016
Microwave Assisted Synthesis of Magnetically Responsive Composite Materials
Czech Academy of Sciences Publication Activity Database
Šafařík, Ivo; Pospišková, K.; Maděrová, Zdeňka; Baldíková, E.; Horská, Kateřina; Šafaříková, Miroslava
2015-01-01
Roč. 32, č. 1 (2015), s. 239-243 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA ČR(CZ) GAP503/11/2263 Institutional support: RVO:67179843 Keywords : saccharomyces cerevisiae * cells immobilization * chitosan * magnetite * microwave irradiation * yeast Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2015
International Uranium Resources Evaluation Project (IUREP) national favourability studies: Niue
International Nuclear Information System (INIS)
1977-12-01
Niue is described as a coral island containing 259 square kilometers, located between Tonga and the Southern Cook Islands in the Central Pacific. Geologically, little is known, or can be deduced from available information, therefore reported occurrences of uranium are the basis for a potential in category 1 (less than 1,000 tonnes U) . (author)
Emam, Mahmoud Mohamed; Abu-Serei, Usama Saad
2014-01-01
The study investigated whether family functioning can predict the self-concept and self-esteem of normally achieving (NA) and at risk for learning disabilities (LD) students in Oman regardless of parent education level and gender status. A total of 259 elementary school students were selected from schools in the main districts of Muscat, the…
The Burden of Pulmonary Hypertension in Patients with ...
African Journals Online (AJOL)
Results: A total of 1390 echocardiogram reports done at Conquest Medical Imaging, Enugu, from July 2009 to August 2013 were retrospectively reviewed. Degenerative mitral valve disease was noted in 18.7% of the patients, (259/1390) made up of 149 males and 110 females with a mean age of 68.3 (14.4) years.
Bibliography of publications and manuscripts relating to the Bohemian/Bavarian Forest lakes
Czech Academy of Sciences Publication Activity Database
Vrba, Jaroslav (ed.)
2000-01-01
Roč. 4, č. 4 (2000), s. 259-278 ISSN 1211-7420. [Acidified Lakes in the Bohemian/Bavarian Forest - History, Present and Future. Č. Budějovice, 21.03.2000-23.03.2000] R&D Projects: GA ČR GA206/97/0072; GA ČR GA206/98/0727 Subject RIV: DA - Hydrology ; Limnology
International Nuclear Information System (INIS)
Jo, Hye-Ryeong; Kim, Yong-Seok; Son, Hyeon
2016-01-01
Erythropoietin (EPO) produces neurotrophic effects in animal model of neurodegeneration. However, clinical use of EPO is limited due to thrombotic risk. Carbamylated EPO (cEPO), devoid of thrombotic risk, has been proposed as a novel neuroprotective and neurotrophic agent although the molecular mechanisms of cEPO remain incomplete. Here, we show a previously unidentified role of histone deacetylase 5 (HDAC5) in the actions of EPO and cEPO. EPO and cEPO regulate the HDAC5 phosphorylation at two critical sites, Ser259 and Ser498 through a protein kinase D (PKD) dependent pathway. In addition, EPO and cEPO rapidly stimulates nuclear export of HDAC5 in rat hippocampal neurons which expressing HDAC5-GFP. Consequently, EPO and cEPO enhanced the myocyte enhancer factor-2 (MEF2) target gene expression. Taken together, our results reveal that EPO and cEPO mediate MEF2 target gene expression via the regulation of HDAC5 phosphorylation at Ser259/498, and suggest that HDAC5 could be a potential mechanism contributing to the therapeutic actions of EPO and cEPO.
Energy Technology Data Exchange (ETDEWEB)
Wei, Z.S. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China)]. E-mail: weizaishan98@163.com; Du, Z.Y. [School of Light Industry and Chemical Engineering, Guangdong University of Technology, Guangzhou 510006 (China); Lin, Z.H. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China); He, H.M. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China); Qiu, R.L. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China)
2007-08-15
Microwave reactor with the mixture of ammonium bicarbonate (NH{sub 4}HCO{sub 3}) and Ga-A zeolites was set up to study the removal of nitrogen oxides (NO {sub x} ) from waste gas with excess oxygen concentration (14-19%) at low temperature (80-120 deg. C). The results showed that the microwave reactor filled with NH{sub 4}HCO{sub 3} and Ga-A zeolites could reduce NO {sub x} to nitrogen with the best purifying efficiency of 95.45% and the best denitrification amount of 89.28 mg h{sup -1}. The optimal microwave power and residence time (RT) on denitrification was 259-280 W and 0.259 s, respectively. Microwave denitrification effect of the experiment using ammonium bicarbonate and Ga-A zeolites was much higher than that using ammonium bicarbonate or Ga-A zeolites only. The mechanism for microwave-induced NO {sub x} reduction can be explained as the microwave-induced catalytic reaction between NO {sub x} and ammonium bicarbonate with Ga-A zeolites being the catalyst and microwave absorbent.
Choi, Miyeon; Lee, Seung Hoon; Wang, Sung Eun; Ko, Seung Yeon; Song, Mihee; Choi, June-Seek; Duman, Ronald S.; Son, Hyeon
2015-01-01
Ketamine produces rapid antidepressant-like effects in animal assays for depression, although the molecular mechanisms underlying these behavioral actions remain incomplete. Here, we demonstrate that ketamine rapidly stimulates histone deacetylase 5 (HDAC5) phosphorylation and nuclear export in rat hippocampal neurons through calcium/calmodulin kinase II- and protein kinase D-dependent pathways. Consequently, ketamine enhanced the transcriptional activity of myocyte enhancer factor 2 (MEF2), which leads to regulation of MEF2 target genes. Transfection of a HDAC5 phosphorylation-defective mutant (Ser259/Ser498 replaced by Ala259/Ala498, HDAC5-S/A), resulted in resistance to ketamine-induced nuclear export, suppression of ketamine-mediated MEF2 transcriptional activity, and decreased expression of MEF2 target genes. Behaviorally, viral-mediated hippocampal knockdown of HDAC5 blocked or occluded the antidepressant effects of ketamine both in unstressed and stressed animals. Taken together, our results reveal a novel role of HDAC5 in the actions of ketamine and suggest that HDAC5 could be a potential mechanism contributing to the therapeutic actions of ketamine. PMID:26647181
Energy Technology Data Exchange (ETDEWEB)
Jo, Hye-Ryeong [Department of Biomedical Sciences, Graduate School of Biomedical Science and Engineering (Korea, Republic of); Kim, Yong-Seok [Department of Biomedical Sciences, Graduate School of Biomedical Science and Engineering (Korea, Republic of); Department of Biochemistry and Molecular Biology, College of Medicine, Hanyang University, 17 Haengdang-dong, Sungdong-gu, Seoul 133-791 (Korea, Republic of); Son, Hyeon, E-mail: hyeonson@hanyang.ac.kr [Department of Biomedical Sciences, Graduate School of Biomedical Science and Engineering (Korea, Republic of); Department of Biochemistry and Molecular Biology, College of Medicine, Hanyang University, 17 Haengdang-dong, Sungdong-gu, Seoul 133-791 (Korea, Republic of)
2016-01-29
Erythropoietin (EPO) produces neurotrophic effects in animal model of neurodegeneration. However, clinical use of EPO is limited due to thrombotic risk. Carbamylated EPO (cEPO), devoid of thrombotic risk, has been proposed as a novel neuroprotective and neurotrophic agent although the molecular mechanisms of cEPO remain incomplete. Here, we show a previously unidentified role of histone deacetylase 5 (HDAC5) in the actions of EPO and cEPO. EPO and cEPO regulate the HDAC5 phosphorylation at two critical sites, Ser259 and Ser498 through a protein kinase D (PKD) dependent pathway. In addition, EPO and cEPO rapidly stimulates nuclear export of HDAC5 in rat hippocampal neurons which expressing HDAC5-GFP. Consequently, EPO and cEPO enhanced the myocyte enhancer factor-2 (MEF2) target gene expression. Taken together, our results reveal that EPO and cEPO mediate MEF2 target gene expression via the regulation of HDAC5 phosphorylation at Ser259/498, and suggest that HDAC5 could be a potential mechanism contributing to the therapeutic actions of EPO and cEPO.
Prevalence of Toxoplasma gondii infection in feral cats in Seoul, Korea.
Lee, Sang-Eun; Kim, Neung-Hee; Chae, Hee-Sun; Cho, Shin-Hyeong; Nam, Ho-Woo; Lee, Won-Ja; Kim, Sun-Heung; Lee, Jung-Hark
2011-02-01
The present study assessed the prevalence of Toxoplasma gondii infection in feral cat populations in Seoul using enzyme-linked immunosorbent assay (ELISA) and nested polymerase chain reaction (PCR). A total of 456 feral cats from 17 wards in Seoul was surveyed. The overall prevalence of T. gondii infection was 15.8% (69/456) by ELISA and 17.5% (80/456) by PCR; by gender, 17% (44/259) by ELISA and 16.2% (42/259) by PCR in males and 14.3% (28/196) by ELISA and 19.4% (38/196) by PCR in females. On a baseline of the Han River, prevalence was 15.1% (29/192) by ELISA and 15.6% (30/192) by PCR in the upper region and 16.4% (43/264) by ELISA and 18.9% (50/264) by PCR in the lower area. This suggested that toxoplasmosis is widespread throughout Seoul's feral cat population and it is critical that the city institute policies for the control of the feral cat population to reduce the risk of toxoplasmosis transmission to animals, including humans.
TiO2-catalyzed synthesis of sugars from formaldehyde in extraterrestrial impacts on the early Earth
Czech Academy of Sciences Publication Activity Database
Civiš, Svatopluk; Szabla, Rafal; Szyja, B. M.; Smykowsky, D.; Ivanek, Ondřej; Knížek, Antonín; Kubelík, Petr; Šponer, Jiří; Ferus, Martin; Šponer, Judit E.
2016-01-01
Roč. 6, MAR 2016 (2016), č. článku 23199. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LQ1601; GA MŠk LM2010014 Institutional support: RVO:61388955 ; RVO:68378271 ; RVO:68081707 Keywords : HIGH-ENERGY CHEMISTRY * CARBONACEOUS METEORITES * CHEMICAL-COMPOSITION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.259, year: 2016
Review: Julie Coleman: A History of Cant and Slang Dictionaries ...
African Journals Online (AJOL)
Julie Coleman. A History of Cant and Slang Dictionaries. Volume I: 1567– 1784. 2004, xii + 259 pp. ISBN 0 19 925471 0 (Hb.). Oxford: Oxford University Press. Price: £115. Julie Coleman. A History of Cant and Slang Dictionaries. Volume II: 1785– 1858. 2004, xiv + 338 pp. ISBN 0 19 925470 2 (Hb.). Oxford: Oxford ...
Czech Academy of Sciences Publication Activity Database
Košťál, Vladimír; Korbelová, Jaroslava; Štětina, Tomáš; Poupardin, Rodolphe; Colinet, H.; Zahradníčková, Helena; Opekarová, Iva; Moos, Martin; Šimek, Petr
2016-01-01
Roč. 6, 30 AUG (2016), č. článku 32346. ISSN 2045-2322 R&D Projects: GA ČR GA13-01057S EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : cold storage * thermal fluctuations * -omics Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep32346
Classification of weed vegetation of arable land in the Czech Republic and Slovakia
Czech Academy of Sciences Publication Activity Database
Lososová, Z.; Chytrý, M.; Cimalová, Š.; Otýpková, Z.; Pyšek, Petr; Tichý, L.
2006-01-01
Roč. 41, - (2006), s. 259-273 ISSN 1211-9520 R&D Projects: GA ČR(CZ) GA526/00/1443; GA ČR(CZ) GA206/05/0020 Institutional research plan: CEZ:AV0Z60050516 Keywords : weed vegetation * phytosociological classification * Česko a Slovensko Subject RIV: EF - Botanics Impact factor: 1.196, year: 2006