WorldWideScience

Sample records for mendelevium 259

  1. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  2. Spontaneous fission of 259Md

    International Nuclear Information System (INIS)

    Hulet, E.K.; Wild, J.F.; Lougheed, R.W.; Baisden, P.A.; Landrum, J.H.; Dougan, R.J.; Mustafa, M.; Ghiorso, A.; Nitschke, J.M.

    1979-01-01

    The mass and kinetic energy distributions of fission fragments from the spontaneous fission of th newly discovered nuclide 259 Md were obtained. 259 Md was identified as the E. C. daughter of 259 No, and was found to decay entirely (> 95%) by spontaneous fission with a 95-min half-life. From the kinetic energies measured for 397 pairs of coincident fragments, a mass distribution was derived that is symmetric with sigma = 13 amu. 259 Md, together with 258 Fm and 259 Fm, form a select group of three nuclides whose mass division in spontaneous fission is highly symmetric. Unlike the total-kinetic-energy (TKE) distributions of 258 Fm and 259 Fm, which peak at approx. = to 240 MeV, this distribution for 259 Md is broad and is 50 MeV lower in energy. Analysis of the mass and energy distributions shows that events near mass symmetry also exhibit a broad TKE distribution, with one-third of the symmetric events having TKEs less than 200 MeV. The associated of low TKEs with symmetric mass division in the fission of very heavy actinides is anomalous and inconsistent with theories based upon the emergence of fragment shells near the scission point. Either three-body fragmentation or peculiar fragment shapes are assumed as the cause for the large consumption of Coulomb energy observed for a significant fraction of symmetric fissions in 259 Md. 6 figures

  3. 30 CFR 259.001 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Purpose and scope. 259.001 Section 259.001 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE MINERAL LEASING: DEFINITIONS § 259.001 Purpose and scope. The purpose of this part 259 is to define various terms appearing in...

  4. 16 CFR 259.2 - Advertising disclosures.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Advertising disclosures. 259.2 Section 259.2... ADVERTISING FOR NEW AUTOMOBILES § 259.2 Advertising disclosures. (a) No manufacturer or dealer shall make any express or implied representation in advertising concerning the fuel economy of any new automobile 1...

  5. 49 CFR 234.259 - Warning time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Warning time. 234.259 Section 234.259..., Inspection, and Testing Inspections and Tests § 234.259 Warning time. Each crossing warning system shall be tested for the prescribed warning time at least once every 12 months and when the warning system is...

  6. 14 CFR 259.5 - Customer service plan.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Customer service plan. 259.5 Section 259.5... REGULATIONS ENHANCED PROTECTIONS FOR AIRLINE PASSENGERS § 259.5 Customer service plan. (a) Adoption of Plan. Each covered carrier shall adopt a Customer Service Plan applicable to its scheduled flights and shall...

  7. 7 CFR 1924.259 - Handling dwelling construction complaints.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Handling dwelling construction complaints. 1924.259 Section 1924.259 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING... Construction Defects § 1924.259 Handling dwelling construction complaints. This section describes the procedure...

  8. 24 CFR 207.259 - Insurance benefits.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 207.259 Section... Contract of Insurance § 207.259 Insurance benefits. (a) Method of payment. Upon either an assignment of the... of mortgage. If the mortgage is assigned to the Commissioner, the insurance benefits shall be paid in...

  9. 17 CFR 259.0-1 - Availability of forms.

    Science.gov (United States)

    2010-04-01

    ... may inspect the forms at this address and at the Commission's regional and district offices. (See... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 259.0-1 Section 259.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS...

  10. 24 CFR 203.259a - Scope.

    Science.gov (United States)

    2010-04-01

    ... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums-in General § 203.259a Scope... Insurance Premiums—Periodic Payment ...

  11. 16 CFR 259.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... economy of the particular new automobile on which the label is affixed, as determined in accordance with... for the class of new automobiles. The estimated city and highway fuel economy values of the class of... FOR NEW AUTOMOBILES § 259.1 Definitions. For the purposes of this part, the following definitions...

  12. 7 CFR 2.59 - Deputy Under Secretaries for Natural Resources and Environment.

    Science.gov (United States)

    2010-01-01

    ... Environment. 2.59 Section 2.59 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Natural Resources and Environment § 2.59 Deputy Under Secretaries for Natural Resources and Environment. Pursuant to § 2.20(a), subject to reservations in § 2.20(b), and subject to...

  13. 50 CFR 216.259 - Modifications to Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.259 Modifications to Letters of Authorization. (a) Except as provided in...

  14. 24 CFR 213.259a - Premiums-mortgages insured pursuant to section 238(c) of the Act.

    Science.gov (United States)

    2010-04-01

    .... All of the provisions of §§ 213.253 through 213.259 governing mortgage insurance premiums shall apply... mortgage insurance premiums due on such mortgages in accordance with §§ 213.253 through 213.259 shall be... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...

  15. 14 CFR 259.4 - Contingency plan for lengthy tarmac delays.

    Science.gov (United States)

    2010-01-01

    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ENHANCED PROTECTIONS FOR AIRLINE PASSENGERS § 259.4 Contingency..., assurance that the air carrier will provide adequate food and potable water no later than two hours after... flights covered in paragraph (b)(2) of this section, and for the trigger point for food and water covered...

  16. 17 CFR 259.5s - Form U5S, for annual reports filed under section 5(c) of the Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form U5S, for annual reports filed under section 5(c) of the Act. 259.5s Section 259.5s Commodity and Securities Exchanges SECURITIES... 1935 Forms for Registration and Annual Supplements § 259.5s Form U5S, for annual reports filed under...

  17. 28 CFR 25.9 - Retention and destruction of records in the system.

    Science.gov (United States)

    2010-07-01

    ... INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.9 Retention and destruction of... receives communication of the determination that the transfer may proceed. All other information, except...

  18. Cleanup Verification Package for the 600-259 Waste Site

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron

    2006-02-09

    This cleanup verification package documents completion of remedial action for the 600-259 waste site. The site was the former site of the Special Waste Form Lysimeter, consisting of commercial reactor isotope waste forms in contact with soils within engineered caissons, and was used by Pacific Northwest National Laboratory to collect data regarding leaching behavior for target analytes. A Grout Waste Test Facility also operated at the site, designed to test leaching rates of grout-solidified low-level radioactive waste.

  19. Cleanup Verification Package for the 600-259 Waste Site

    International Nuclear Information System (INIS)

    Capron, J.M.

    2006-01-01

    This cleanup verification package documents completion of remedial action for the 600-259 waste site. The site was the former site of the Special Waste Form Lysimeter, consisting of commercial reactor isotope waste forms in contact with soils within engineered caissons, and was used by Pacific Northwest National Laboratory to collect data regarding leaching behavior for target analytes. A Grout Waste Test Facility also operated at the site, designed to test leaching rates of grout-solidified low-level radioactive waste

  20. 20 CFR 1002.259 - How does USERRA protect an employee's pension benefits?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does USERRA protect an employee's pension... REEMPLOYMENT RIGHTS ACT OF 1994 Reemployment Rights and Benefits Pension Plan Benefits § 1002.259 How does USERRA protect an employee's pension benefits? On reemployment, the employee is treated as not having a...

  1. Residue 259 in protein-tyrosine phosphatase PTP1B and PTPα determines the flexibility of glutamine 262

    DEFF Research Database (Denmark)

    Peters, Günther H.j.; Iversen, L.F.; Andersen, H.S.

    2004-01-01

    To study the flexibility of the substrate-binding site and in particular of Gln262, we have performed adiabatic conformational search and molecular dynamics simulations on the crystal structure of the catalytic domain of wild-type protein-tyrosine phosphatase (PTP) 1B, a mutant PTP1B(R47V),(D48N...... and second step of the phosphate hydrolysis. Analyses of the trajectories revealed that in the cysteine-phosphor complex of PTP1B, Gln262 oscillates freely between the bound phosphate group and Gly259 frequently forming, as observed in the crystal structure, a hydrogen bond with the backbone oxygen of Gly259...... around Gln262 and the active site Cys215 reveals that the probability of finding a water molecule correctly positioned for catalysis is much larger in PTP1B than in PTP1B(R47V),(D48N),(M258C),(G259Q) and PTPalpha, in accordance with experiments....

  2. Function of RSKS-1-AAK-2-DAF-16 signaling cascade in enhancing toxicity of multi-walled carbon nanotubes can be suppressed by mir-259 activation in Caenorhabditis elegans

    Science.gov (United States)

    Zhuang, Ziheng; Li, Min; Liu, Hui; Luo, Libo; Gu, Weidong; Wu, Qiuli; Wang, Dayong

    2016-08-01

    Caenorhabditis elegans is an important non-mammalian alternative assay model for toxicological study. Previous study has indicated that exposure to multi-walled carbon nanotubes (MWCNTs) dysregulated the transcriptional expression of mir-259. In this study, we examined the molecular basis for mir-259 in regulating MWCNTs toxicity in nematodes. Mutation of mir-259 induced a susceptible property to MWCNTs toxicity, and MWCNTs exposure induced a significant increase in mir-259::GFP in pharyngeal/intestinal valve and reproductive tract, implying that mir-259 might mediate a protection mechanisms for nematodes against MWCNTs toxicity. RSKS-1, a putative ribosomal protein S6 kinase, acted as the target for mir-259 in regulating MWCNTs toxicity, and mutation of rsks-1 suppressed the susceptible property of mir-259 mutant to MWCNTs toxicity. Moreover, mir-259 functioned in pharynx-intestinal valve and RSKS-1 functioned in pharynx to regulate MWCNTs toxicity. Furthermore, RSKS-1 regulated MWCNTs toxicity by suppressing the function of AAK-2-DAF-16 signaling cascade. Our results will strengthen our understanding the microRNAs mediated protection mechanisms for animals against the toxicity from certain nanomaterials.

  3. Prognostic factorsin inoperable adenocarcinoma of the lung: A multivariate regression analysis of 259 patiens

    DEFF Research Database (Denmark)

    Sørensen, Jens Benn; Badsberg, Jens Henrik; Olsen, Jens

    1989-01-01

    The prognostic factors for survival in advanced adenocarcinoma of the lung were investigated in a consecutive series of 259 patients treated with chemotherapy. Twenty-eight pretreatment variables were investigated by use of Cox's multivariate regression model, including histological subtypes and ...

  4. 24 CFR 207.259a - Waiver of title objection; mortgages formerly Commissioner-held.

    Science.gov (United States)

    2010-04-01

    ... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of Mortgagee Under the Contract of Insurance § 207.259a Waiver of... any lien or other adverse interest that was senior to the mortgage on the date of the original sale of...

  5. 17 CFR 259.604 - Form TH-Notification of reliance on temporary hardship exemption.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... OF 1935 Forms for Electronic Filing § 259.604 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by any electronic filer who submits to the Commission, pursuant to a...

  6. Identification and evaluation of the probiotic potential of Lactobacillus paraplantarum FT259, a bacteriocinogenic strain isolated from Brazilian semi-hard artisanal cheese.

    Science.gov (United States)

    Tulini, Fabrício Luiz; Winkelströter, Lizziane Kretli; De Martinis, Elaine C P

    2013-08-01

    This study aimed to identify a bacteriocinogenic Lactobacillus isolate (FT259) obtained from Brazilian semi-hard Minas type cheese and to evaluate its probiotic and antimicrobial potentials. The strain was identified by biochemical tests (at genus level), and by 16S rDNA sequencing combined with recA gene amplification (for species). To determine the inhibitory spectrum towards food borne pathogens and lactic acid bacteria, the spot-on-the-lawn assay was carried out. Moreover, the proteinaceous nature of the antimicrobial compound produced was evaluated by susceptibility to degradation by proteolytic enzymes. The isolated strain was tested for survival in acidified culture media (pH 2.0, 2.5 and 3.5), in vitro tolerance to bile salts and viability under gastric conditions. Adhesion of Lactobacillus paraplantarum FT259 to Caco-2 cells was evaluated by surface plate count on De Man, Rogosa, and Sharpe (MRS) agar and also by FISH method (fluorescent in situ hybridization) with the aid of Eub338 probe for fluorescence microscopy analysis. The isolate was identified as L. paraplantarum FT259 and it produced bacteriocins that inhibited the growth of Listeria monocytogenes, Listeria innocua and several lactic acid bacteria. It was also observed that L. paraplantarum FT259 tolerated exposure to pH 3.5, and bile salts 0.3% for up to 180 min. In experiments with simulated gastric juice, viable cells of L. paraplantarum FT259 decreased from 8.6 log CFU/mL to 3.5 log CFU/mL after 180 min. For the same strain, in studies with Caco-2 cells, 74% of adhesion was observed through plate count and FISH assays. It was also demonstrated isolated FT259 was susceptible to the majority the antibiotics tested. Overall, the results indicated L. paraplantarum FT259 is a potential probiotic and the production of bacteriocin may be an interesting feature for food applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  7. 17 CFR 259.206 - Form U-6B-2, for notification of security issues exempt under section 6(b) of the Act.

    Science.gov (United States)

    2010-04-01

    ... of security issues exempt under section 6(b) of the Act. 259.206 Section 259.206 Commodity and... security issues exempt under section 6(b) of the Act. This form shall be filed pursuant to section 6(b) of the Act as the certificate of notification of the issue, sale, renewal, or guaranty of securities...

  8. The Ly Alpha Reference Sample. I. Survey Outline and First Results for Markarian 259

    Czech Academy of Sciences Publication Activity Database

    Ostlin, G.; Hayes, M.; Duval, F.; Sandberg, A.; Rivera-Thorsen, T.; Marquart, T.; Orlitová, Ivana; Adamo, A.; Melinder, J.; Guaita, L.; Atek, H.; Cannon, J.M.; Gruyters, P.; Herenz, E.Ch.; Kunth, D.; Laursen, P.; Más-Hesse, J. M.; Micheva, G.; Oti-Floranes, H.; Pardy, S.; Roth, M.; Schaerer, D.; Verhamme, A.

    2014-01-01

    Roč. 797, č. 1 (2014), 11/1-11/23 ISSN 0004-637X R&D Projects: GA ČR(CZ) GP14-20666P Institutional support: RVO:67985815 Keywords : cosmology: observations * galaxies: evolution * galaxies: individual: Mrk 259 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.993, year: 2014

  9. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  10. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  11. Non-LTE analysis of extremely helium-rich stars. The hot sdO stars LSE 153, 259 and 263

    Science.gov (United States)

    Husfeld, D.; Butler, K.; Heber, U.; Drilling, J. S.

    1989-01-01

    Results of a non-LTE fine analysis based mainly on high-resolution CASPEC spectra for three extremely helium-rich sdO stars are discussed in order to explain hydrogen deficiency in single stars. High temperature (Teff = 70,000 to 75,000 K) and a position in the log Teff - log g diagram were found close to the Eddington limit. Various abundance estimates are derived for hydrogen (upper limits only), carbon, nitrogen, and magnesium. Hydrogen is reduced to less than 10 percent by number in LSE 153 and LSE 263, and to less than 5 percent in LSE 259. The hydrogen deficiency is accompanied by nitrogen- and carbon-enrichment in LSE 153 and LSE 259 only. In LSE 263, carbon is depleted by about 1 dex. Stellar masses obtained by assuming that a core mass-luminosity relation holds for these stars, were found to be in the range 0.6-0.9 solar mass, yielding luminosities log L/L:solar = 3.7-4.5. Two of the program stars (LSE 153 and 259) appear to be possible successors of the R CrB and helium B stars, whereas the third star (LSE 263) displays a much lower carbon content in its photosphere making it an exceptional case among the known hydrogen deficient stars.

  12. 47 CFR 25.259 - Time sharing between NOAA meteorological satellite systems and non-voice, non-geostationary...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Time sharing between NOAA meteorological... SATELLITE COMMUNICATIONS Technical Standards § 25.259 Time sharing between NOAA meteorological satellite... Atmospheric Administration (“NOAA”) satellite systems. When calculating the protection areas for a NOAA...

  13. Fragrance material review on methyl-2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone.

    Science.gov (United States)

    Scognamiglio, J; Letizia, C S; Api, A M

    2013-12-01

    A toxicologic and dermatologic review of methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone when used as a fragrance ingredient is presented. Methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all available toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone were evaluated then summarized and includes physical properties, acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (Belsito, D., Bickers, D., Bruze, M., Calow, P., Dagli, M., Fryer, A.D., Greim, H., Miyachi, Y., Saurat, J.H., Sipes, I.G., 2013. A Toxicologic and Dermatologic Assessment of Alkyl Cyclic Ketones When Used as Fragrance Ingredients (submitted for publication)) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Opposing effects of cAMP and T259 phosphorylation on plasma membrane diffusion of the water channel aquaporin-5 in Madin-Darby canine kidney cells

    DEFF Research Database (Denmark)

    Koffman, Jennifer Skaarup; Christensen, Eva Arnspang; Marlar, Saw

    2015-01-01

    Aquaporin-5 (AQP5) facilitates passive water transport in glandular epithelia in response to secretory stimuli via intracellular pathways involving calcium release, cAMP and protein kinase A (PKA). In epithelial plasma membranes, AQP5 may be acutely regulated to facilitate water transport...... in the plasma membrane diffusion coefficient of AQP5. We aimed to test the short-term regulatory effects of the above pathways, by measuring lateral diffusion of AQP5 and an AQP5 phospho-mutant, T259A, using k-space Image Correlation Spectroscopy of quantum dot- and EGFP-labeled AQP5. Elevated cAMP and PKA...... inhibition significantly decreased lateral diffusion of AQP5, whereas T259A mutation showed opposing effects; slowing diffusion without stimulation and increasing diffusion to basal levels after cAMP elevation. Thus, lateral diffusion of AQP5 is significantly regulated by cAMP, PKA, and T259 phosphorylation...

  15. Prospective multicenter observational study of 260 infants born to 259 opiate-dependent mothers on methadone or high-dose buprenophine substitution.

    Science.gov (United States)

    Lejeune, Claude; Simmat-Durand, Laurence; Gourarier, Laurent; Aubisson, Sandrine

    2006-05-20

    Specialized prenatal care and substitution programs improve the perinatal prognoses of pregnant drug-abusers and their infants. Although methadone is well documented, little is known about high-dose buprenorphine (HDB). This prospective, multicenter (n = 35) observational study included 259 women on maintenance during pregnancy: 39% on methadone and 61% on HDB. Major findings were: 46% of them received good prenatal care; 62% had peridural analgesia; 12.3% delivered prematurely (hydrochloride. No baby died. Newborns were discharged with their mothers (96%) or placed in foster care (4%). Comparing methadone with HDB, respectively, mean age at the maximum Lipsitz score was 81 h versus 66 h (P = 0.066). The perinatal medical and social prognoses for these 259 drug addicts and their infants appeared to be improved by specialized prenatal care and was similar for methadone or BHD substitution during pregnancy.

  16. Low-energy fission systematics of the fermium isotopes: the transition from mass asymmetry at fermium-254 to symmetry at fermium-259

    International Nuclear Information System (INIS)

    Hoffman, D.C.

    1976-01-01

    Recent measurements have shown that 259 Fm gives the highest total kinetic energy release and the most symmetric mass division so far observed for spontaneous fission. These results continue the trends observed previously in the fermium isotopes toward higher total kinetic energies and more symmetric mass division with increasing mass of the fermium isotopes. The transition from asymmetric mass division ( 254 Fm) to highly favored symmetric mass division ( 259 Fm) now appears to have been completed. These features are consistent with the simple postulate that the more neutron-rich fermium isotopes show an increase in the yield of symmetric fragments and in the total kinetic energy because symmetric mass division of fermium (Z = 100) nuclei results in two fragments which have the magic proton number of 50 and are close to the magic neutron number of 82. The proximity of the fragments to the doubly magic configuration seems to have a profound effect on the mass division and total kinetic energy release in fission

  17. Advanced conceptual design report: T Plant secondary containment and leak detection upgrades. Project W-259

    International Nuclear Information System (INIS)

    Hookfin, J.D.

    1995-01-01

    The T Plant facilities in the 200-West Area of the Hanford site were constructed in the early 1940s to produce nuclear materials in support of national defense activities. T Plant includes the 271-T facility, the 221-T facility, and several support facilities (eg, 2706-T), utilities, and tanks/piping systems. T Plant has been recommended as the primary interim decontamination facility for the Hanford site. Project W-259 will provide capital upgrades to the T Plant facilities to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. This document provides an advanced conceptual design concept that complies with functional requirements for the T Plant Secondary Containment and Leak Detection upgrades

  18. The Reactivations of Main-Belt Comets 238P/READ, 259P/Garradd, and 288P/(300163) 2006 VW139

    Science.gov (United States)

    Hsieh, Henry H.; Ishiguro, Masateru; Kim, Yoonyoung; Knight, Matthew M.; Lin, Zhong-Yi; Micheli, Marco; Moskovitz, Nicholas; Sheppard, Scott S.; Thirouin, Audrey; Trujillo, Chadwick

    2017-10-01

    We report on the confirmation and monitoring of recurrent activity for main-belt comets (MBCs) 238P/Read and 288P/(300163) 2006 VW139 in 2016 (cf. Agarwal et al. 2016, CBET 4306; Hsieh et al. 2016, CBET 4307), as well as the identification of activity for 288P in Sloan Digital Sky Survey images from November 2000. We will also report on the confirmation of recurrent activity in 2017 (Hsieh et al. 2017, CBET 4388) and the progress of the ongoing monitoring campaign (April 2017 through December 2017) that we are conducting for MBC 259P/Garradd. With these observations, 238P and 288P have now each been observed to be active on three separate orbit passages with intervening periods of inactivity and 259P has been observed to be active on two separate orbit passages, firmly establishing the cometary (i.e., sublimation-driven) nature of their activity. We are currently conducting a multi-facility observing campaign to monitor the photometric and morphological evolution of these objects, using the Canada-France-Hawaii Telescope, the Gemini North and South telescopes (under a Gemini Large and Long Program), the Magellan telescopes, the Discovery Channel Telescope, and the Lulin One-meter Telescope. During their most recent perihelion encounters, 238P was observed to be active as early as 2016 July 8 at a true anomaly of 329 degrees, 288P was observed to be active as early as 2016 June 8 at a true anomaly of 318 degrees, and 259P was observed to be active as early at 2017 April 26 at a true anomaly of 315 degrees. We also report on the results of numerical modeling analyses of the morphological evolution of all three objects aimed at assessing both the properties of their current active episodes and changes in activity strength from one epoch to the next to help constrain the active lifetimes of MBCs, a key parameter for inferring the total number of MBCs in the asteroid belt from survey results. This work was supported by the NASA Solar System Observations program under

  19. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  20. 40 CFR 264.259 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.

    Science.gov (United States)

    2010-07-01

    ... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Waste Piles § 264.259 Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27. (a) Hazardous Wastes FO20, FO21, FO22, FO23, FO26... requirements are necessary for piles managing hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27 in order...

  1. Phosphorylation of the norepinephrine transporter at threonine 258 and serine 259 is linked to protein kinase C-mediated transporter internalization

    DEFF Research Database (Denmark)

    Jayanthi, Lankupalle D; Annamalai, Balasubramaniam; Samuvel, Devadoss J

    2006-01-01

    . Most interestingly, the plasma membrane insertion of the WT-hNET and hNET double mutant were not affected by beta-PMA. Although the WT-hNET showed increased endocytosis and redistribution from caveolin-rich plasma membrane domains following beta-PMA treatment, the hNET double mutant was completely......-regulation. These results suggest that Thr-258 and Ser-259 serve as a PKC-specific phospho-acceptor site and that phosphorylation of this motif is linked to PKC-induced NET internalization....

  2. The role of Glu259 in Escherichia coli elongation factor Tu in ternary complex formation

    DEFF Research Database (Denmark)

    Nautrup Pedersen, Gitte; Rattenborg, Thomas; Knudsen, Charlotte Rohde

    1998-01-01

    Determination of the crystal structure of the ternary complex formed between elongation factor Tu:GTP and aminoacylated tRNA revealed three regions of interaction between elongation factor Tu and tRNA. The structure indicates that the conserved glutamic acid at position 271 in Thermus aquaticus EF-Tu...... could be involved in the binding of the 3' CCA-Phe end of the aminoacylated tRNA. Therefore, the corresponding residue, Glu259, of Escherichia coli EF-Tu was mutated into alanine, aspartic acid, glutamine and tyrosine, in order to substantiate the crystallographic structural evidence and to obtain...... of interaction with tRNA, while mutation to tyrosine abolished completely the interaction with tRNA. Finally, mutation to glutamine resulted in an elongation factor Tu variant behaving like the wild type. In conclusion, the environment around the site binding the CCA-Phe end of the tRNA is very restricted...

  3. Studies of neutron-deficient mendelevium isotopes at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)

    2010-01-15

    The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)

  4. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  5. Assessment of the short-term safety and tolerability of a quantified 80 % ethanol extract from the stem bark of Nauclea pobeguinii (PR 259 CT1) in healthy volunteers: a clinical phase I study.

    Science.gov (United States)

    Mesia, Kahunu; Cimanga, Kanyanga; Tona, Lutete; Mampunza, Ma Miezi; Ntamabyaliro, Nsengi; Muanda, Tsobo; Muyembe, Tamfum; Totté, Jozef; Mets, Tony; Pieters, Luc; Vlietinck, Arnold

    2011-01-01

    The aim of this study was to evaluate the short-term safety and tolerability of an antimalarial herbal medicinal product (PR 259 CT1) consisting of a quantified 80 % ethanol extract from the stem bark of Nauclea pobeguinii when given orally to healthy adult male volunteers. The amount of the major alkaloid strictosamide in the extract was determined by a validated HPLC method and was shown to be 5.6 %. The herbal preparation was formulated in a gelatine capsule form containing 500 mg of PCR 259 CT1. A sample of 15 healthy male volunteers, selected using the Lot Quality Assurance of Sampling (LQAS) method, was eligible for inclusion after fulfillment of the inclusion criteria and clinical examination by a physician. The volunteers were treated in an outpatient clinic with a drug regimen of two 500 mg capsules three times daily (each eight hours) for seven days, during meals. Safety and tolerability were monitored clinically, haematologically, biochemically and by electrocardiographic (ECG) examination at days 0, 1, 3, 7 and 14. Adverse effects were recorded by self-reporting of the participants or by detection of abnormalities in clinical examinations by a physician. The oral administration of PR 259 CT1 at high doses of 2 × 500 mg/capsule/day for 7 days was found to induce no significant changes in the concentration levels of all investigated haematological, biochemical, electrocardiogram and vital sign parameters and physical characteristics after 14 days of treatment compared to those seen in the baseline data. The concentration levels of all evaluated parameters were within the normal limits as reported in the literature. All adverse events noted were mild and self-resolving including increase of appetite (33 %), headache (20 %) and nausea (20 %). Other minor side effects were insomnia, somnolence and asthenia (7 %). Thus, PR 259 CT1 presented a significant safety and tolerability in healthy volunteers to allow its further development by starting a phase II

  6. The Lyα reference sample. I. Survey outline and first results for Markarian 259

    International Nuclear Information System (INIS)

    Östlin, Göran; Hayes, Matthew; Duval, Florent; Sandberg, Andreas; Rivera-Thorsen, Thøger; Marquart, Thomas; Adamo, Angela; Melinder, Jens; Guaita, Lucia; Micheva, Genoveva; Orlitová, Ivana; Atek, Hakim; Cannon, John M.; Pardy, Stephen A.; Gruyters, Pieter; Herenz, Edmund Christian; Kunth, Daniel; Laursen, Peter; Mas-Hesse, J. Miguel; Otí-Floranes, Héctor

    2014-01-01

    The Lyα Reference Sample (LARS) is a substantial program with the Hubble Space Telescope (HST) that provides a sample of local universe laboratory galaxies in which to study the detailed astrophysics of the visibility and strength of the Lyαline of neutral hydrogen. Lyα is the dominant spectral line in use for characterizing high-redshift (z) galaxies. This paper presents an overview of the survey, its selection function, and HST imaging observations. The sample was selected from the combined GALEX+Sloan Digital Sky Survey catalog at z = 0.028-0.19, in order to allow Lyα to be captured with combinations of long-pass filters in the Solar Blind Channel (SBC) of the Advanced Camera for Surveys (ACS) onboard HST. In addition, LARS utilizes Hα and Hβ narrowband and u, b, i broadband imaging with ACS and the Wide Field Camera 3 (WFC3). In order to study galaxies in which large numbers of Lyα photons are produced (whether or not they escape), we demanded an Hα equivalent width W(Hα) ≥100 Å. The final sample of 14 galaxies covers far-UV (FUV, λ ∼ 1500 Å) luminosities that overlap with those of high-z Lyα emitters (LAEs) and Lyman break galaxies (LBGs), making LARS a valid comparison sample. We present the reduction steps used to obtain the Lyα images, including our LARS eXtraction software (LaXs), which utilizes pixel-by-pixel spectral synthesis fitting of the energy distribution to determine and subtract the continuum at Lyα. We demonstrate that the use of SBC long-pass-filter combinations increase the signal-to-noise ratio by an order of magnitude compared to the nominal Lyα filter available in SBC. To exemplify the science potential of LARS, we also present some first results for a single galaxy, Mrk 259 (LARS #1). This irregular galaxy shows bright and extended (indicative of resonance scattering) but strongly asymmetric Lyα emission. Spectroscopy from the Cosmic Origins Spectrograph on board HST centered on the brightest UV knot shows a moderate

  7. The Lyα reference sample. I. Survey outline and first results for Markarian 259

    Energy Technology Data Exchange (ETDEWEB)

    Östlin, Göran; Hayes, Matthew; Duval, Florent; Sandberg, Andreas; Rivera-Thorsen, Thøger; Marquart, Thomas; Adamo, Angela; Melinder, Jens; Guaita, Lucia; Micheva, Genoveva [Department of Astronomy, Stockholm University, Oscar Klein Centre, AlbaNova, Stockholm SE-106 91 (Sweden); Orlitová, Ivana [Observatoire de Genève, Université de Genève, Chemin des Maillettes 51, 1290 Versoix (Switzerland); Atek, Hakim [Laboratoire d' Astrophysique, Ecole Polytechnique Fédérale de Lausanne, Observatoire de Sauverny, CH-1290 Versoix (Switzerland); Cannon, John M.; Pardy, Stephen A. [Department of Physics and Astronomy, Macalester College, 1600 Grand Avenue, Saint Paul, MN 55105 (United States); Gruyters, Pieter [Department of Physics and Astronomy, Division of Astronomy and Space Physics, Uppsala University, Box 516, 75120 Uppsala (Sweden); Herenz, Edmund Christian [Leibniz-Institute for Astrophysics Potsdam (AIP), innoFSPEC, An der Sternwarte 16, D-14482 Potsdam (Germany); Kunth, Daniel [Institut d' Astrophysique Paris, 98bis Bd Arago, F-75014 Paris (France); Laursen, Peter [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, DK-2100 Copenhagen (Denmark); Mas-Hesse, J. Miguel [Centro de Astrobiologa (CSIC-INTA), Departamento de Astrofsica, POB 78, E-28691, Villanueva de la Cañada (Spain); Otí-Floranes, Héctor [Instituto de Astronoma, Universidad Nacional Autnoma de Mxico, Apdo. Postal 106, Ensenada B. C. 22800 (Mexico); and others

    2014-12-10

    The Lyα Reference Sample (LARS) is a substantial program with the Hubble Space Telescope (HST) that provides a sample of local universe laboratory galaxies in which to study the detailed astrophysics of the visibility and strength of the Lyαline of neutral hydrogen. Lyα is the dominant spectral line in use for characterizing high-redshift (z) galaxies. This paper presents an overview of the survey, its selection function, and HST imaging observations. The sample was selected from the combined GALEX+Sloan Digital Sky Survey catalog at z = 0.028-0.19, in order to allow Lyα to be captured with combinations of long-pass filters in the Solar Blind Channel (SBC) of the Advanced Camera for Surveys (ACS) onboard HST. In addition, LARS utilizes Hα and Hβ narrowband and u, b, i broadband imaging with ACS and the Wide Field Camera 3 (WFC3). In order to study galaxies in which large numbers of Lyα photons are produced (whether or not they escape), we demanded an Hα equivalent width W(Hα) ≥100 Å. The final sample of 14 galaxies covers far-UV (FUV, λ ∼ 1500 Å) luminosities that overlap with those of high-z Lyα emitters (LAEs) and Lyman break galaxies (LBGs), making LARS a valid comparison sample. We present the reduction steps used to obtain the Lyα images, including our LARS eXtraction software (LaXs), which utilizes pixel-by-pixel spectral synthesis fitting of the energy distribution to determine and subtract the continuum at Lyα. We demonstrate that the use of SBC long-pass-filter combinations increase the signal-to-noise ratio by an order of magnitude compared to the nominal Lyα filter available in SBC. To exemplify the science potential of LARS, we also present some first results for a single galaxy, Mrk 259 (LARS #1). This irregular galaxy shows bright and extended (indicative of resonance scattering) but strongly asymmetric Lyα emission. Spectroscopy from the Cosmic Origins Spectrograph on board HST centered on the brightest UV knot shows a moderate

  8. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-08-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  9. Jacobo-Velázquez, D.A and Cisneros-Zevallos, L. An Alternative Use of Horticultural Crops: Stressed Plants as Biofactories of Bioactive Phenolic Compounds. Agriculture 2012, 2, 259-271

    Directory of Open Access Journals (Sweden)

    Luis Cisneros-Zevallos

    2013-09-01

    Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: http://www.mdpi.com/2077-0472/2/3/259. Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:

  10. Characteristic of metallic state preperties of mendelevium and other actinoids by thermochcomatography

    International Nuclear Information System (INIS)

    Hubener, S.; Zvara, I.

    1982-01-01

    The adsorption of the heavy actinoids Cf, Es, Fm, and Md on polycrystalline titanium and molybdenum has been studied by thermochromatography in comparison with several well-known metallic elements, in trace amounts. The data lead us to suggest that Es, Fm, and Md are divalent in the metallic state and, moreover, that the position of their f energy levels relativg to the Fermi-energy is lower than in the cases of Cf and Yb. A correlation was found between the experimental enthalpies of adsorption of the heavy actinoids and their predicted enthalpies of sublimation

  11. Correction: β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade.

    Science.gov (United States)

    Ito, Ryousuke; Nakada, Chika; Hoshino, Tsutomu

    2017-01-18

    Correction for 'β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade' by Ryousuke Ito et al., Org. Biomol. Chem., 2017, 15, 177-188.

  12. Pages 259 - 267.pmd

    African Journals Online (AJOL)

    Administrator

    Peltier CA, Omes C, Ndimubanzi PC et al. Validation of 2006 WHO Prediction Scores for. True HIV Infection in Children less than 18 months with a positive serological HIV test. PLoS ONE I www.plosone.org April 2009; 4. (4): I e5312. 28. Mayaux MJ, Burgard M, Teglas JP,et al. Neonatal characteristics in rapidly progressive ...

  13. 50 CFR 259.38 - Miscellaneous.

    Science.gov (United States)

    2010-10-01

    ....38 Miscellaneous. (a) Wherever the Secretary prescribes time constraints herein for the submission of... actual date of submission. All required materials may be submitted to any Financial Assistance Division office of the National Marine Fisheries Service. (b) All CCF information received by the Secretary shall...

  14. 10 CFR 25.9 - Communications.

    Science.gov (United States)

    2010-01-01

    ... Director, Division of Facilities and Security, Mail Stop T7-D57, and sent either by mail to the U.S... Rockville Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the...

  15. Publications | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    South Africa has developed considerable expertise in mining and mining ... Exporters incur search costs in identifying a suitable agreement, each with its own ... The prevailing view is that Chinese companies operating in African countries do ...

  16. Publications | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Use this search tool to locate a specific publication for your field of research. ... from a local treatment plant is being used for supplemental irrigation of cereal crops, ... generation of water leaders" (NGWL) by the International Water Resources.

  17. 39 CFR 259.2 - Red Cross.

    Science.gov (United States)

    2010-07-01

    ... each other, as follows: (1) The Red Cross will use Form 3575, Change of Address Order, as a standard... disaster relief efforts, the Postal Service will establish a separate file of change of address forms... and complete the forms, it will distribute the forms to disaster victims who need them, and it will...

  18. 50 CFR 259.32 - Conditional fisheries.

    Science.gov (United States)

    2010-10-01

    ... extends to past, present, and future withdrawals in an amount representing up to 100 percent of the cost... causes (within 1 year after the delivery of vessel “Y”) to be permanently removed from all fishing, or... question at the time vessel “Z” was constructed (or, if constructed for a different fishery, the average...

  19. 259 Patients with DCIS of the breast applying USC/Van Nuys prognostic index: a retrospective review with long term follow up.

    Science.gov (United States)

    Di Saverio, Salomone; Catena, Fausto; Santini, Donatella; Ansaloni, Luca; Fogacci, Tommaso; Mignani, Stefano; Leone, Antonio; Gazzotti, Filippo; Gagliardi, Stefano; De Cataldis, Angelo; Taffurelli, Mario

    2008-06-01

    The Van Nuys Prognostic Index (VNPI) is a simple score for predicting the risk of local recurrence (LR) in patients with Ductal Carcinoma In Situ (DCIS) conservatively treated. This score combines three independent predictors of Local Recurrence. The VNPI has recently been updated with the addition of age as a fourth parameter into the scoring system (University of Southern California/ VNPI). Our database consisted of 408 women with DCIS. Applying the USC/VNPI we reviewed retrospectively 259 patients who were treated with breast conserving surgery with or without radiotherapy (RT). Of these patients 63.5% had a low VNPI score, 32% intermediate and 4.5% a high score. In the low score group, the majority of the patients underwent Conservative Surgery (CS) without RT while in the intermediate group, almost half of the patients received RT. Eighty-three percent (83%) of the patients with high VNPI were treated with Conservative Surgery plus RT. Nodal assessment by Sentinel Lymph Node Biopsy was obtained in 32 patients since 2002. Twenty-one Local Recurrences were observed (8%) with a mean follow up of 130 months: sixteen were invasive. No statistically significant differences in Disease Free Survival were reached in all groups of VNPI score between patients treated with Conservative Surgery or Conservative Surgery plus RT. However it was noted that the higher the VNPI score, the lower was the risk of local recurrence in the group treated additionally with RT, even though it was not statistically significant. Further analysis included those patients treated with Conservative Surgery alone and followed up. Disease-free survival (DFS) at 10 years was 94% with low VNPI and 83% in both intermediate and high score (P USC/VNPI is still a simple and reliable scoring system for therapeutic management of DCIS. We did not find any statistically significant advantage in groups treated with the addition of RT. Obtaining wide surgical margins appears to be the strongest prognostic

  20. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1995-01-01

    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  1. Two Isoforms of Yersinia pestis Plasminogen Activator Pla: Intraspecies Distribution, Intrinsic Disorder Propensity, and Contribution to Virulence.

    Science.gov (United States)

    Dentovskaya, Svetlana V; Platonov, Mikhail E; Svetoch, Tat'yana E; Kopylov, Pavel Kh; Kombarova, Tat'yana I; Ivanov, Sergey A; Shaikhutdinova, Rima Z; Kolombet, Lyubov' V; Chauhan, Sadhana; Ablamunits, Vitaly G; Motin, Vladimir L; Uversky, Vladimir N; Anisimov, Andrey P

    2016-01-01

    It has been shown previously that several endemic Y. pestis isolates with limited virulence contained the I259 isoform of the outer membrane protease Pla, while the epidemic highly virulent strains possessed only the T259 Pla isoform. Our sequence analysis of the pla gene from 118 Y. pestis subsp. microtus strains revealed that the I259 isoform was present exclusively in the endemic strains providing a convictive evidence of more ancestral origin of this isoform. Analysis of the effects of the I259T polymorphism on the intrinsic disorder propensity of Pla revealed that the I259T mutation slightly increases the intrinsic disorder propensity of the C-terminal tail of Pla and makes this protein slightly more prone for disorder-based protein-protein interactions, suggesting that the T259 Pla could be functionally more active than the I259 Pla. This assumption was proven experimentally by assessing the coagulase and fibrinolytic activities of the two Pla isoforms in human plasma, as well as in a direct fluorometric assay with the Pla peptide substrate. The virulence testing of Pla-negative or expressing the I259 and T259 Pla isoforms Y. pestis subsp. microtus and subsp. pestis strains did not reveal any significant difference in LD50 values and dose-dependent survival assays between them by using a subcutaneous route of challenge of mice and guinea pigs or intradermal challenge of mice. However, a significant decrease in time-to-death was observed in animals infected with the epidemic T259 Pla-producing strains as compared to the parent Pla-negative variants. Survival curves of the endemic I259 Pla+ strains fit between them, but significant difference in mean time to death post infection between the Pla-strains and their I259 Pla+ variants could be seen only in the isogenic set of subsp. pestis strains. These findings suggest an essential role for the outer membrane protease Pla evolution in Y. pestis bubonic infection exacerbation that is necessary for intensification

  2. Dynamics Determine Signaling in a Multicomponent System Associated with Rheumatoid Arthritis.

    Science.gov (United States)

    Lindgren, Cecilia; Tyagi, Mohit; Viljanen, Johan; Toms, Johannes; Ge, Changrong; Zhang, Naru; Holmdahl, Rikard; Kihlberg, Jan; Linusson, Anna

    2018-05-24

    Strategies that target multiple components are usually required for treatment of diseases originating from complex biological systems. The multicomponent system consisting of the DR4 major histocompatibility complex type II molecule, the glycopeptide CII259-273 from type II collagen, and a T-cell receptor is associated with development of rheumatoid arthritis (RA). We introduced non-native amino acids and amide bond isosteres into CII259-273 and investigated the effect on binding to DR4 and the subsequent T-cell response. Molecular dynamics simulations revealed that complexes between DR4 and derivatives of CII259-273 were highly dynamic. Signaling in the overall multicomponent system was found to depend on formation of an appropriate number of dynamic intramolecular hydrogen bonds between DR4 and CII259-273, together with the positioning of the galactose moiety of CII259-273 in the DR4 binding groove. Interestingly, the system tolerated modifications at several positions in CII259-273, indicating opportunities to use analogues to increase our understanding of how rheumatoid arthritis develops and for evaluation as vaccines to treat RA.

  3. Dicty_cDB: CFE259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *fqstssrcfl*ndcrei*fnk r*nr*ilw*isrisr*--- ---**r*ryscssrl*ekcql*kppfkpngkisaanasqisdgasavllvsgrlvkklgl kprarivtctvvgsdpeymllgpipatik...aleksgltkdqidlyeineafasvvlgwkke lnidldkinpnggaiahghplgatgcilmtkmvnelersnkkyalqtmcig

  4. 40 CFR 180.259 - Propargite; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., meat 0.1 Hog, meat byproducts 0.1 Hop, dried cones 100.0 Horse, fat 0.1 Horse, meat 0.1 Horse, meat... Cattle, fat 0.1 Cattle, meat 0.1 Cattle, meat byproducts 0.1 Citrus, oil 30.0 Corn, field, forage 10.0..., forage 10.0 Corn, sweet, stover 10.0 Cotton, undelinted seed 0.1 Egg 0.1 Goat, fat 0.1 Goat, meat 0.1...

  5. 1935 15' Quad #259 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  6. Dicty_cDB: AFO259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available skdfnyililnk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshqll vvqdtlxlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkks...nk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshqll vvqdtlxlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkksgiilfimnfx

  7. 24 CFR 960.259 - Family information and verification.

    Science.gov (United States)

    2010-04-01

    ... source of income, or any Federal, State or local agency, to furnish or release to the PHA or HUD such...) Other factors that affect the determination of adjusted income or income-based rent. ... scheduled reexamination or an interim reexamination of family income and composition in accordance with HUD...

  8. 30 CFR 206.259 - Determination of washing allowances.

    Science.gov (United States)

    2010-07-01

    ... market the production for the mutual benefit of the lessee and the lessor, then MMS shall require that... reported period, including operating and maintenance expenses, overhead, and either depreciation and a... other alternative without approval of the MMS. (A) To compute depreciation, the lessee may elect to use...

  9. Gclust Server: 40687 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 40687 HSA_51460703 Cluster Sequences Related Sequences(259) 278 XP_292889.3 PREDICTED: similar to notochord...s(259) Sequence length 278 Representative annotation XP_292889.3 PREDICTED: similar to notochord

  10. All projects related to | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-10-20

    Project. Different countries are at different stages of demographic change. Start Date: October 20, 2011. End Date: April 20, 2014. Topic: INTERNATIONAL FINANCE, INTERNATIONAL FINANCIAL MARKET, FINANCIAL POLICY, DEMOGRAPHY, DEMOGRAPHIC CHANGE, DEMOGRAPHIC TRANSITION. Region: Brazil ...

  11. 24 CFR 203.259 - Method of payment of MIP.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums-in General...

  12. Distribution of iron, cobalt , zinc and selenium in macrofungi

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jan; Řanda, Zdeněk

    2007-01-01

    Roč. 6, č. 4 (2007), s. 249-259 ISSN 1617-416X Institutional research plan: CEZ:AV0Z10480505 Keywords : ectomycorrhizal fungi * instrumental neutron activation analysis * terrestrial saprobes Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.259, year: 2007

  13. Seasonal variations in carbon budget in water column off Princess Astrid coast, Antarctica

    Digital Repository Service at National Institute of Oceanography (India)

    Dhargalkar, V.K.; Matondkar, S.G.P.; Verlecar, X.N.

    stream_size 8 stream_content_type text/plain stream_name DOD_Tech_Pub_1996_10_259.pdf.txt stream_source_info DOD_Tech_Pub_1996_10_259.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  14. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  15. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 113; Issue 3. Volume 113, Issue 3. September 2004, pages 259-515. pp 259-267. Delineation of structures favourable to groundwater occurrence employing seismic refraction method — A case study from Tiruvuru, Krishna district, Andhra Pradesh · N Sundararajan ...

  16. Promotion of adipogenesis by an EP2 receptor agonist via stimulation of angiogenesis in pulmonary emphysema.

    Science.gov (United States)

    Tsuji, Takao; Yamaguchi, Kazuhiro; Kikuchi, Ryota; Itoh, Masayuki; Nakamura, Hiroyuki; Nagai, Atsushi; Aoshiba, Kazutetsu

    2014-08-01

    Body weight loss is a common manifestation in patients with chronic obstructive pulmonary disease (COPD), particularly those with severe emphysema. Adipose angiogenesis is a key mediator of adipogenesis and use of pro-angiogenic agents may serve as a therapeutic option for lean COPD patients. Since angiogenesis is stimulated by PGE2, we examined whether ONO-AE1-259, a selective E-prostanoid (EP) 2 receptor agonist, might promote adipose angiogenesis and adipogenesis in a murine model of elastase-induced pulmonary emphysema (EIE mice). Mice were intratracheally instilled with elastase or saline, followed after 4 weeks by intraperitoneal administration of ONO-AE1-259 for 4 weeks. The subcutaneous adipose tissue (SAT) weight decreased in the EIE mice, whereas in the EIE mice treated with ONO-AE1-259, the SAT weight was largely restored, which was associated with significant increases in SAT adipogenesis, angiogenesis, and VEGF protein production. In contrast, ONO-AE1-259 administration induced no alteration in the weight of the visceral adipose tissue. These results suggest that in EIE mice, ONO-AE1-259 stimulated adipose angiogenesis possibly via VEGF production, and thence, adipogenesis. Our data pave the way for the development of therapeutic interventions for weight loss in emphysema patients, e.g., use of pro-angiogenic agents targeting the adipose tissue vascular component. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. The Attitudes of Israeli Arab and Jewish High School Students towards Extrinsic and Intrinsic Values

    Science.gov (United States)

    Gross, Zehavit

    2013-01-01

    The aim of this research was to investigate the attitudes of Israeli Arab (n = 259) and Jewish (n = 259) high school students toward extrinsic and intrinsic values. A questionnaire, which consisted of eight value scales in two groups--extrinsic and intrinsic values--was administered. Participants were asked to state whether they agreed or…

  18. Comparison of Biomass and Lipid Production under Ambient Carbon Dioxide Vigorous Aeration and 3% Carbon Dioxide Condition Among the Lead Candidate Chlorella Strains Screened by Various Photobioreactor Scales

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Naoko [Univ. of Nebraska, Lincoln, NE (United States); Barnes, Austin [Univ. of Nebraska, Lincoln, NE (United States); Jensen, Travis [Univ. of Nebraska, Lincoln, NE (United States); Noel, Eric [Univ. of Nebraska, Lincoln, NE (United States); Andlay, Gunjan [Synaptic Research, Baltimore, MD (United States); Rosenberg, Julian N. [Johns Hopkins Univ., Baltimore, MD (United States); Betenbaugh, Michael J. [Johns Hopkins Univ., Baltimore, MD (United States); Guarnieri, Michael T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Oyler, George A. [Univ. of Nebraska, Lincoln, NE (United States); Johns Hopkins Univ., Baltimore, MD (United States); Synaptic Research, Baltimore, MD (United States)

    2015-09-01

    Chlorella species from the UTEX collection, classified by rDNA-based phylogenetic analysis, were screened based on biomass and lipid production in different scales and modes of culture. Lead candidate strains of C. sorokiniana UTEX 1230 and C. vulgaris UTEX 395 and 259 were compared between conditions of vigorous aeration with filtered atmospheric air and 3% CO2 shake-flask cultivation. We found that the biomass of UTEX 1230 produced 2 times higher at 652 mg L-1 dry weight under both ambient CO2 vigorous aeration and 3% CO2 conditions, while UTEX 395 and 259 under 3% CO2 increased to 3 times higher at 863 mg L-1 dry weight than ambient CO2 vigorous aeration. The triacylglycerol contents of UTEX 395 and 259 increased more than 30 times to 30% dry weight with 3% CO2, indicating that additional CO2 is essential for both biomass and lipid accumulation in UTEX 395 and 259.

  19. People and things. CERN Courier Nov 1985, v. 25(9)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1985-11-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The European Committee for Future Accelerators (ECFA) meets in plenary session twice a year. At the meeting at CERN earlier this year, ECFA Chariman Jean Sacton described the trend towards even greater internationalization of partide physics research and how arrangement have been completed to allow the exchange of observers between meetings of Plenary ECFA and the US High Energy Physics Advisory Panel (HEPAP). After the success of the ESO (European Southern Observatory) CERN Symposium on Cosmology, Astronomy and Fundamental Physics, held at CERN in November 1983, the second Symposium is to be held at ESO, Garching bei Munchen, West Germany, from 17 to 21 March next year.

  20. People and things. CERN Courier Nov 1985, v. 25(9)

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The European Committee for Future Accelerators (ECFA) meets in plenary session twice a year. At the meeting at CERN earlier this year, ECFA Chariman Jean Sacton described the trend towards even greater internationalization of partide physics research and how arrangement have been completed to allow the exchange of observers between meetings of Plenary ECFA and the US High Energy Physics Advisory Panel (HEPAP). After the success of the ESO (European Southern Observatory) CERN Symposium on Cosmology, Astronomy and Fundamental Physics, held at CERN in November 1983, the second Symposium is to be held at ESO, Garching bei Munchen, West Germany, from 17 to 21 March next year

  1. 259 “Team Pair Solo” Cooperative Learning and Personality Type ...

    African Journals Online (AJOL)

    User

    learning strategy and students' personality type on achievement and attitude to Chemistry. 175 SS2 ... There is increasing concern among practitioners and educational researchers about the .... Teachers' role in a cooperative learning classroom involves a careful design of meaningful ..... Classroom Management. Harry K.

  2. The higher phylogeny of Leptophlebiidae (Insecta: Ephemeroptera), with description of a new species of Calliarcys Eaton, 1881

    Czech Academy of Sciences Publication Activity Database

    Godunko, Roman J.; Sroka, Pavel; Soldán, Tomáš; Bojková, J.

    2015-01-01

    Roč. 73, č. 2 (2015), s. 259-280 ISSN 1863-7221 R&D Projects: GA ČR GA206/08/1389 Institutional support: RVO:60077344 Keywords : Calliarcyinae * systematics * phylogeny Subject RIV: EG - Zoology Impact factor: 1.655, year: 2015 http://www.senckenberg.de/files/content/forschung/publikationen/arthropodsystematics/asp_73_2/03_asp_73_2_godunko_259-279.pdf

  3. Mutations in SOX17 are Associated with Congenital Anomalies of the Kidney and the Urinary Tract

    Science.gov (United States)

    Gimelli, Stefania; Caridi, Gianluca; Beri, Silvana; McCracken, Kyle; Bocciardi, Renata; Zordan, Paola; Dagnino, Monica; Fiorio, Patrizia; Murer, Luisa; Benetti, Elisa; Zuffardi, Orsetta; Giorda, Roberto; Wells, James M; Gimelli, Giorgio; Ghiggeri, Gian Marco

    2010-01-01

    Congenital anomalies of the kidney and the urinary tract (CAKUT) represent a major source of morbidity and mortality in children. Several factors (PAX, SOX,WNT, RET, GDFN, and others) play critical roles during the differentiation process that leads to the formation of nephron epithelia. We have identified mutations in SOX17, an HMG-box transcription factor and Wnt signaling antagonist, in eight patients with CAKUT (seven vesico-ureteric reflux, one pelvic obstruction). One mutation, c.775T>A (p.Y259N), recurred in six patients. Four cases derived from two small families; renal scars with urinary infection represented the main symptom at presentation in all but two patients. Transfection studies indicated a 5–10-fold increase in the levels of the mutant protein relative to wild-type SOX17 in transfected kidney cells. Moreover we observed a corresponding increase in the ability of SOX17 p.Y259N to inhibit Wnt/β-catenin transcriptional activity, which is known to regulate multiple stages of kidney and urinary tract development. In conclusion, SOX17 p.Y259N mutation is recurrent in patients with CAKUT. Our data shows that this mutation correlates with an inappropriate accumulation of SOX17-p.Y259N protein and inhibition of the β-catenin/Wnt signaling pathway. These data indicate a role of SOX17 in human kidney and urinary tract development and implicate the SOX17–p.Y259N mutation as a causative factor in CAKUT. Hum Mutat 31:1352–1359, 2010. © 2010 Wiley-Liss, Inc. PMID:20960469

  4. 29 CFR 779.259 - What is included in annual gross volume.

    Science.gov (United States)

    2010-07-01

    ... requirements for exemption from the pay provisions of the Act under section 13(a)(2), does not exclude the... establishment is a part. (c) Likewise, where franchise or other arrangements result in the creation of a larger... integral part of the related activities of the enterprise which grants the franchise, right, or concession...

  5. : tous les projets | Page 259 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 6 mai 2011. End Date: 6 novembre 2013. Sujet: WOMEN'S PARTICIPATION, POLITICS, POLITICAL LEADERSHIP, WOMEN'S RIGHTS, GENDER EQUALITY. Région: Chile, South America, North and Central America, Argentina. Programme: Gouvernance et justice. Financement total : CA$ 210,900.00.

  6. Risk factors of severe pneumonia among children aged 2-59 months ...

    African Journals Online (AJOL)

    Introduction Globally, pneumonia is the leading cause of death in children under the age of 5 years. In Kenya, it is the second leading cause of mortality, accounting for greater than 30,000 deaths in this age group annually. This study sought to identify risk factors for severe pneumonia in children under the age of five years.

  7. Jak vzniká něco nového? Založení a transcendence

    Czech Academy of Sciences Publication Activity Database

    Puc, Jan

    2017-01-01

    Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf

  8. Contributing to the Global Agenda

    DEFF Research Database (Denmark)

    Enemark, Stig

    2008-01-01

    Stig Enemark, President of the International Federation of Surveyors, explains the organisation's role in the areas of geospatial information and land management. Link to full text: http://www.euinfrastructure.com/currentissue/article.asp?art=273895&issue=259......Stig Enemark, President of the International Federation of Surveyors, explains the organisation's role in the areas of geospatial information and land management. Link to full text: http://www.euinfrastructure.com/currentissue/article.asp?art=273895&issue=259...

  9. AcEST: BP916642 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ides f... 35 0.20 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 34 0.34 sp|O94386|YGS9...EL----QAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLEKQKSR 258 Query: 145 L 143 L Sbjct: 259 L 259 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizoph...renia 1 protein OS=Homo sapiens GN=DISC1 PE=1 SV=3 Length = 854 Score = 34.3 bits (

  10. Technology and Social Media Use Among Patients Enrolled in Outpatient Addiction Treatment Programs: Cross-Sectional Survey Study.

    Science.gov (United States)

    Ashford, Robert D; Lynch, Kevin; Curtis, Brenda

    2018-03-06

    Substance use disorder research and practice have not yet taken advantage of emerging changes in communication patterns. While internet and social media use is widespread in the general population, little is known about how these mediums are used in substance use disorder treatment. The aims of this paper were to provide data on patients' with substance use disorders mobile phone ownership rates, usage patterns on multiple digital platforms (social media, internet, computer, and mobile apps), and their interest in the use of these platforms to monitor personal recovery. We conducted a cross-sectional survey of patients in 4 intensive outpatient substance use disorder treatment facilities in Philadelphia, PA, USA. Logistic regressions were used to examine associations among variables. Survey participants (N=259) were mostly male (72.9%, 188/259), African American (62.9%, 163/259), with annual incomes less than US $10,000 (62.5%, 161/259), and averaged 39 (SD 12.24) years of age. The vast majority of participants (93.8%, 243/259) owned a mobile phone and about 64.1% (166/259) owned a mobile phone with app capabilities, of which 85.1% (207/243) accessed the internet mainly through their mobile phone. There were no significant differences in age, gender, ethnicity, or socio-economic status by computer usage, internet usage, number of times participants changed their phone, type of mobile phone contract, or whether participants had unlimited calling plans. The sample was grouped into 3 age groups (Millennials, Generation Xers, and Baby Boomers). The rates of having a social media account differed across these 3 age groups with significant differences between Baby Boomers and both Generation Xers and Millennials (Psocial media account (73.6%, 190/259), most (76.1%, 144/190) reported using it daily and nearly all (98.2%, 186/190) used Facebook. Nearly half of participants (47.4%, 90/190) reported viewing content on social media that triggered substance cravings and an

  11. Femoropopliteal laser recanalization - a multicenterstudy

    International Nuclear Information System (INIS)

    Lammer, J.; Pilger, E.; Karnel, F.; Schurawitzki, H.; Horvath, W.; Oertl, M.; Riedl, M.; Umek, H.; Klein, G.E.; Schreyer, H.; Neumayer, K.; Einspieler, R.; Olbert, F.; Polterauer, P.; Haidinger, D.; Partsch, H.; Graz Univ.; Vienna Univ.; Vienna Univ.; Krankenhaus der Barmherzigen Brueder, Linz; Wilhelminenspital, Vienna

    1990-01-01

    Laser-assisted angioplasty was performed in four different hospitalcenters, following the same treatment protocol and using a Nd-YAG laser with a sapphire-probe catheter. The initial recanalization rate of 259 femoro-popliteal occlusions with a mean length of 7.5 cm was 84%. Dissections or perforations were observed in 10%. An emergency surgical intervention was required in 1.1%. The long-term patency rate of the successfully recanalized arteries was 74% after 2 years. The cumulative cure rate of all 259 patients was 62%. (orig.) [de

  12. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ] ... Length = 259 ... Query: 7 ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN 66 ... ... ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN Sbjct: 1 ... CFSTLGCSELSLHETADLTERHGIANVELRA

  13. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ] ... Length = 259 ... Query: 7 ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN 66 ... ... ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN Sbjct: 1 ... CFSTLGCSELSLHETADLTERHGIANVELRA

  14. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RGRYLQHLADAVPTDLSGITVVVDA 180 ... Query: 259 XXXXRCLAVDSDGNIVDGDQIMAILAIAMKENSELRKNTLVATVMSNLGLKLAMEKADIQ 318 ... ... ... RCLAVDSDGNIVDGDQIMAILAIAMKENSELRKNTLVATVMSNLGLKLAMEKADIQ Sbjct: 241 GDADRCLAVDSDGNIVDGDQIMAILA

  15. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Length = 259 ... Query: 1 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHEAQETVSFNDETAIPVFQ...RLEEVL 60 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHEAQETVSFNDETAIPVFQRLEEVL Sbjct: 1 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHE

  16. La inútil añoranza de la normalidad

    Directory of Open Access Journals (Sweden)

    Margarita Valencia

    2012-01-01

    Full Text Available Litchis de Madagascar. Aquiles Cuervo. Editorial Elfin de la noche. Buenos Aires, 2011, 91 págs. El ruido de las cosas al caer. Juan Gabriel Vásquez. Premio Alfaguara de novela 2011. Alfaguara. Bogotá. 2011, 259 págs. Tres ataúdes blancos. Antonio Ungar. Premio Herralde de Novela. Editorial Anagrama. Barcelona. 2010, 259 págs. Suicídame. Andrés Arias. Ediciones B. Bogotá, 2010, 261 págs. C.M. no récord. Juan Álvarez. Alfaguara. Bogotá, 2010, 262 págs.

  17. SU-E-J-259: Quantification of Rotational Localization Offset in Radiation Therapy

    International Nuclear Information System (INIS)

    Huang, Y; Nguyen, N; Lee, S; Liu, F

    2014-01-01

    Purpose: To verify the necessity of 6D localization detection and correction in radiation therapy. Methods: An anthropomorphic head and neck phantom was used to test the BrainLab ExacTrac x-ray imaging system. After initial positioning, both ExacTrac and the on-board kV CBCT were used to detect the offset at the same position, using both manual and automatic registration algorithms. Then 6D offset including rotational errors up to 5 degree were introduced. Both ExacTrac and CBCT were used to correct the offsets and the residual errors were evaluated. Finally, 6D offset detected by ExacTrac for a C-Spine patient was reported. Results: The differences in 3D offset detected by ExacTrac and CBCT were 1.5 ± 1.2(Lateral), 2.7 ± 2.7(Vertical), and 4.0 ± 6.3(longitudinal) mm with manual registration while the corresponding differences decreased to 0.6 ± 0.3, 1.0 ± 0.3, and 0.3 ± 0.3 when automatic registration were used. CBCT corrected the translational offset to within 0.5 mm but the rotational errors remained and detected by the ExacTrac system (Yaw=2.1, Roll=1.1, Pitch=1.4 degree). When similar offset was introduced and corrected using ExacTrac, the residual error detected by both CBCT and ExacTrac were within 0.5 mm / 0.5 degree. The average offset from the 112 ExacTrac x-ray corrections for the C-Spine patient was 0.6 ± 1.6 (lateral), 5.4 ± 8(vertical), 1.6±1.1(longitudinal) mm, and 0.7 ± 0.6 (pitch), 0.7 ± 0.4(roll), 1.2 ± 0.7 (yaw) degree. Larger rotational errors, with a maximum of 2.7 degree (corresponds to about 1.5 to 4.5 mm offset for a POI 10 to 30 cm away from the isocenter), were observed when couch rotational were involved. Conclusion: Rotational errors are common in patient localization, especially when couch rotation is involved. Both appropriate imaging system and 6D robotic couch are necessary to detect and correct the rotational localization errors

  18. SU-E-T-259: Development of a Primary Standard for LDR Brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Shen, H; McEwen, M [National Research Council, Ottawa, ON (Canada)

    2015-06-15

    Purpose: The National Research Council initiated a program in 2012 to develop a primary standard to calibrate I-125 and Pd-103 sources used for LDR brachytherapy and disseminate this through calibration services to Canadian users. This will simplify procedures as Canadian cancer centres currently have to ship instruments to the US. Methods: The standard is based on a commercial version of the wide-angle free air chamber (WAFAC) pioneered by NIST. Significant enhancements were implemented to improve signal-to-noise and measurement reproducibility and eliminate electric field effects. Validation of this ionization chamber was then carried out in a low-energy X -ray beam (∼ 31 keV) where the dose rate had been previously established using the existing NRC primary standard free-air chamber. As a final component of this initial testing, measurements were made with a set of I-125 seeds (with air kerma strength traceable to NIST). Results: Excellent agreement of the two NRC free-air chambers was obtained within the combined standard uncertainty of 0.5 %. However, it was found that the WAFAC response is very sensitive to the beam geometry (distance from the source, diameter of the beam-defining aperture, etc) and Monte Carlo calculations, carried out to evaluate these geometry corrections, have confirmed the experimental results. The results for the seed measurements indicated a precision of better than 1 % is achievable for a reasonable acquisition time and the air kerma strength agreed with the manufacturer (NIST-traceable) value within 2 %. Conclusion: The prototype primary standard for LDR brachytherapy has met accuracy target of 3 % for the determination of air kerma strength. Work is ongoing to refine operation of the device and develop the calibration protocol for clinical users, with an anticipated launch of a calibration service in late 2015.

  19. 50 CFR 259.34 - Minimum and maximum deposits; maximum time to deposit.

    Science.gov (United States)

    2010-10-01

    ... B objective. A time longer than 10 years, either by original scheduling or by subsequent extension... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE AID TO FISHERIES CAPITAL CONSTRUCTION FUND...) Minimum annual deposit. The minimum annual (based on each party's taxable year) deposit required by the...

  20. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NMVQGVLSHQLKR 180 ... Query: 259 YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSY...PVITERQGE 318 ... YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSYPVITERQGE Sbjct: 241 YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSYPVITERQGE 300 ...

  1. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MAFF303099] ... Length = 942 ... Query: 200 ... ISHAMAIAAQALDHVGLPAIIRPSFTMGGTGGGIAYNRAEFYDIVQSGLDASPTTEVL...IE 259 ... ISHAMAIAAQALDHVGLPAIIRPSFTMGGTGGGIAYNRAEFYDIVQSGLDASPTTEVLIE Sbjct: 1 ... ISHAMAIAAQALDHVGLPAIIRPSFTM

  2. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... 110] ... Length = 44 ... Query: 219 HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 259 ... HFVNRGDTLASIARKNHIS...AAELARANGLDPSAKLKLGTKL Sbjct: 1 ... HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 41

  3. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  4. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  5. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LNELDLIRIRNAAR Sbjct: 121 GYTHVSAPFDGRMGRHLVDVGNLVGHGAATDLATIEQIDPIYVYFNLNELDLIRIRNAAR 180 ... Query: 299 LFVQVRVPISEPS...PKLTIP 317 ... LFVQVRVPISEPSPKLTIP Sbjct: 241 LFVQVRVPISEPSPKLTIP 259

  6. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LNELDLIRIRNAAR Sbjct: 121 GYTHVSAPFDGRMGRHLVDVGNLVGHGAATDLATIEQIDPIYVYFNLNELDLIRIRNAAR 180 ... Query: 295 LFVQVRVPISEPS...PKLTIP 313 ... LFVQVRVPISEPSPKLTIP Sbjct: 241 LFVQVRVPISEPSPKLTIP 259

  7. International measures project for rational energy use (Survey project of the analysis tool of Asian energy consumption efficiency). List of errata; 1998 nendo kokusai energy shiyo gorika nado taisaku jigyo seigohyo. Asia energy shohi koritsuka bunseki tool chosa jigyo

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    The list of errata was prepared for the data book of the international measures project for rational energy use (Survey project of the analysis tool of Asian energy consumption efficiency). Corrected pages of the data book 1 (1990) are as follows: 187-190, 223-226, 259-262, 295- 298, 369-370, 387-388 and 405-406 on Malaysian data. Corrected pages of the data book 2 (1985) are as follows: 102-105 on Chinese data, 154 on common data, and 187-190, 223-226, 259-262, 295-298, 369-370, 387-388 and 405-406 on Malaysian data. (NEDO)

  8. Review of climatic input data for wind load design in accordance with SANS 10160-3

    CSIR Research Space (South Africa)

    Goliger, Adam MW

    2017-12-01

    Full Text Available factor QWE that provides for the wind engineering procedures, such as the wind speed profile and pressure coefficients. The characteristic wind load is then given by Equation 4, where CoV is the coefficient of variation (σV/µV): QW,k = QWE (µV + 2....59 σV)2 = QWE µVk2(1+ 2.59 CoVV)2 (6) Design wind load The design wind load can be obtained by determining the wind speed according to Equation 4 for an exceedance probability (PF) that corresponds with the appropriate target reliability (β...

  9. [Increasing incidence of community-acquired pneumonia caused by atypical microorganisms].

    Science.gov (United States)

    Tazón-Varela, M A; Alonso-Valle, H; Muñoz-Cacho, P; Gallo-Terán, J; Piris-García, X; Pérez-Mier, L A

    2017-09-01

    Knowing the most common microorganisms in our environment can help us to make proper empirical treatment decisions. The aim is to identify those microorganisms causing community-acquired pneumonia. An observational, descriptive and prospective study was conducted, including patients over 14 years with a clinical and radiographic diagnosis of community-acquired pneumonia during a 383 consecutive day period. A record was made of sociodemographic variables, personal history, prognostic severity scales, progress, and pathogenic agents. The aetiological diagnosis was made using blood cultures, detection of Streptococcus pneumoniae and Legionella pneumophila urinary antigens, sputum culture, influenza virus and Streptococcus pyogenes detection. Categorical variables are presented as absolute values and percentages, and continuous variables as their means and standard deviations. Of the 287 patients included in the study (42% women, mean age 66±22 years), 10.45% died and 70% required hospital admission. An aetiological diagnosis was achieved in 43 patients (14.98%), with 16 microorganisms found in 59 positive samples. The most frequently isolated pathogen was Streptococcus pneumonia (24/59, 41%), followed by gram-negative enteric bacilli, Klebsiella pneumonia, Escherichia coli, Serratia marcescens and Enterobacter cloacae isolated in 20% of the samples (12/59), influenza virus (5/59, 9%), methicillin-resistant Staphylococcus aureus (3/59, 5%), Pseudomonas aeruginosa (2/59, 3%), Moraxella catarrhalis (2/59, 3%), Legionella pneumophila (2/59, 3%), and Haemophilus influenza (2/59, 3%). Polymicrobial infections accounted for 14% (8/59). A high percentage of atypical microorganisms causing community-acquired pneumonia were found. Copyright © 2016 Sociedad Española de Médicos de Atención Primaria (SEMERGEN). Publicado por Elsevier España, S.L.U. All rights reserved.

  10. Cloning, nucleotide sequence and transcriptional analysis of the uvrA gene from Neisseria gonorrhoeae

    International Nuclear Information System (INIS)

    Black, C.G.; Fyfe, J.A.M.; Davies, J.K.

    1997-01-01

    A recombinant plasmid capable of restoring UV resistance to an Escherichia coli uvrA mutant was isolated from a genomic library of Neisseria gonorrhoeae. Sequence analysis revealed an open reading frame whose deduced amino acid sequence displayed significant similarity to those of the UvrA proteins of other bacterial species. A second open reading frame (ORF259) was identified upstream from, and in the opposite orientation to the gonococcal uvrA gene. Transcriptional fusions between portions of the gonococcal uvrA upstream region and a reporter gene were used to localise promoter activity in both E. coli and N. gonorrhoeae. The transcriptional starting points of uvrA and ORF259 were mapped in E. coli by primer extension analysis, and corresponding σ 70 promoters were identified. The arrangement of the uvrA-ORF259 intergenic region is similar to that of the gonococcal recA-aroD intergenic region. Both contain inverted copies of the 10 bp neisserial DNA uptake sequence situated between divergently transcribed genes. However, there is no evidence that either the uptake sequence or the proximity of the promoters influences expression of these genes. (author)

  11. Endothelial ERK signaling controls lymphatic fate specification

    Science.gov (United States)

    Deng, Yong; Atri, Deepak; Eichmann, Anne; Simons, Michael

    2013-01-01

    Lymphatic vessels are thought to arise from PROX1-positive endothelial cells (ECs) in the cardinal vein in response to induction of SOX18 expression; however, the molecular event responsible for increased SOX18 expression has not been established. We generated mice with endothelial-specific, inducible expression of an RAF1 gene with a gain-of-function mutation (RAF1S259A) that is associated with Noonan syndrome. Expression of mutant RAF1S259A in ECs activated ERK and induced SOX18 and PROX1 expression, leading to increased commitment of venous ECs to the lymphatic fate. Excessive production of lymphatic ECs resulted in lymphangiectasia that was highly reminiscent of abnormal lymphatics seen in Noonan syndrome and similar “RASopathies.” Inhibition of ERK signaling during development abrogated the lymphatic differentiation program and rescued the lymphatic phenotypes induced by expression of RAF1S259A. These data suggest that ERK activation plays a key role in lymphatic EC fate specification and that excessive ERK activation is the basis of lymphatic abnormalities seen in Noonan syndrome and related diseases. PMID:23391722

  12. Initial thoracic involvement in lymphoma. CT assessment; Afectacion toracica inicial en el linfom. Valoracion con TC

    Energy Technology Data Exchange (ETDEWEB)

    Bustos, A.; Corredoira, J.; Ferreiros, J.; Cabeza, B.; Jorquera, M.; Pedrosa, I.; Martinez, R.; Fernandez, C. [Hospital Clinico San Carlos. Madrid (Spain)

    2002-07-01

    To analyze the initial thoracic involvement by CT in a consecutive series of patients with lymphoma. A retrospective analysis was made of thoracic CT studies made at the time of diagnosis of 259 patients with lymphoma. Mediastinal pulmonary, pleural, pericardial and chest wall involvement was assessed by CT. Of 259 patients (129 men y 130 women), 56 had Hodgkin's disease (HD) and 203 had non-Hodgkin lymphoma (NHL). Forty-two percent (42.5%, 110/259) of the patients had chest involvement on CT: 33 of 56 patients with HD (58.9%) and 77 of 203 patients with NHL (37.9%). All the patients with thoracic HD and 71.4% of patients with thoracic NHL, had mediastinal lymph node involvement. of the patients with thoracic involvement 12.1% (4/33) of the patient with HD and 23.3% (18/77) of the patients with NHL had pulmonary involvement. Thoracic involvement on CT was more frequent in HD. Mediastinal lymph node involvement was the most common finding fundamentally in HD. Pulmonary disease always occurred in the presence of mediastinal lymph node involvement in HD but could occur as an isolated finding in NHL. (Author) 24 refs.

  13. Initial thoracic involvement in lymphoma. CT assessment

    International Nuclear Information System (INIS)

    Bustos, A.; Corredoira, J.; Ferreiros, J.; Cabeza, B.; Jorquera, M.; Pedrosa, I.; Martinez, R.; Fernandez, C.

    2002-01-01

    To analyze the initial thoracic involvement by CT in a consecutive series of patients with lymphoma. A retrospective analysis was made of thoracic CT studies made at the time of diagnosis of 259 patients with lymphoma. Mediastinal pulmonary, pleural, pericardial and chest wall involvement was assessed by CT. Of 259 patients (129 men y 130 women), 56 had Hodgkin's disease (HD) and 203 had non-Hodgkin lymphoma (NHL). Forty-two percent (42.5%, 110/259) of the patients had chest involvement on CT: 33 of 56 patients with HD (58.9%) and 77 of 203 patients with NHL (37.9%). All the patients with thoracic HD) and 71.4% of patients with thoracic NHL, had mediastinal lymph node involvement. of the patients with thoracic involvement 12.1% (4/33) of the patient with HD and 23.3% (18/77) of the patients with NHL had pulmonary involvement. Thoracic involvement on CT was more frequent in HD. Mediastinal lymph node involvement was the most common finding fundamentally in HD. Pulmonary disease always occurred in the presence of mediastinal lymph node involvement in HD but could occur as an isolated finding in NHL. (Author) 24 refs

  14. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pseudomallei K96243] ... Length = 259 ... Query: 12 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPR...TLAACAGRRV 71 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACA...GRRV Sbjct: 1 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACAGRRV 60 ... Query: 132 EFASACDALITESAQA

  15. Nuclear structure studies in the seaborgium region at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)

    2015-10-15

    New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.

  16. 6 CFR 25.9 - Procedures for certification of approved products for Homeland Security.

    Science.gov (United States)

    2010-01-01

    ... Procedures for certification of approved products for Homeland Security. (a) Application Procedure. An applicant seeking a Certification of anti-terrorism Technology as an Approved Product for Homeland Security... application for renewal must be made using the “Application for Certification of an Approved Product for...

  17. Oral History Project: Advanced ESL Class, Local 259 U.A.W. 1985-86.

    Science.gov (United States)

    Colon, Maria, Comp.; And Others

    A class project undertaken in an English-as-a-Second-Language class is described and presented. Students participating in the project were union employees in a Manhattan electronics factory, and most were native Spanish speakers. The project's objective was to produce an illustrated book and tapes to document work and union experience in the…

  18. Obesity, bariatric surgery and nutritional implications - doi:10.5020/18061230.2007.p259

    Directory of Open Access Journals (Sweden)

    Michele Novaes Ravelli

    2012-01-01

    Full Text Available Obesity is an important nutritional deviation that is exponentially increasing in Brazil and in the world, becoming a public health problem. The World Health Organization verified in 2005 that 1.6 billion people above 15 years old were overweight and 400 million were obese. Among children, 20 million were overweight. Amongst the different treatments for the obesity the bariatric surgery has been used very often nowadays, for being effective against weight excess and associated co-morbidities, both for the adult and youngster populations. The surgical techniques are divided in restrictive, disabsorptive and mixed procedures. Each technique promotes digestive and absorptive distinct alterations, needing, therefore, an exclusive multidisciplinary educational program, directed both to pre and postsurgery periods, emphasizing the habits of physical activity and the necessity to adhere to the restricted dietary recommendations. The surgeries promote a severe reduction in the consumption, which induces to the ingestion of diets that are hypocaloric and deficient in micronutrients, with consequent nutritional complications.

  19. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available h = 155 ... Query: 200 HTQMAPAASKPPEVANLATKMFQALMPSRSGAIQKPAGSQTIGRATDNDIVIQDVLASRH 259 ... HTQMAPA...ASKPPEVANLATKMFQALMPSRSGAIQKPAGSQTIGRATDNDIVIQDVLASRH Sbjct: 5 ... HTQMAPAASKPPEVANLATK... ... protein MAP3465 [Mycobacterium avium subsp. ... paratuberculosis str. k10] ... Lengt

  20. Sugar industry sponsorship of germ-free rodent studies linking sucrose to hyperlipidemia and cancer: An historical analysis of internal documents

    Science.gov (United States)

    Kearns, Cristin E.; Apollonio, Dorie

    2017-01-01

    In 1965, the Sugar Research Foundation (SRF) secretly funded a review in the New England Journal of Medicine that discounted evidence linking sucrose consumption to blood lipid levels and hence coronary heart disease (CHD). SRF subsequently funded animal research to evaluate sucrose’s CHD risks. The objective of this study was to examine the planning, funding, and internal evaluation of an SRF-funded research project titled “Project 259: Dietary Carbohydrate and Blood Lipids in Germ-Free Rats,” led by Dr. W.F.R. Pover at the University of Birmingham, Birmingham, United Kingdom, between 1967 and 1971. A narrative case study method was used to assess SRF Project 259 from 1967 to 1971 based on sugar industry internal documents. Project 259 found a statistically significant decrease in serum triglycerides in germ-free rats fed a high sugar diet compared to conventional rats fed a basic PRM diet (a pelleted diet containing cereal meals, soybean meals, whitefish meal, and dried yeast, fortified with a balanced vitamin supplement and trace element mixture). The results suggested to SRF that gut microbiota have a causal role in carbohydrate-induced hypertriglyceridemia. A study comparing conventional rats fed a high-sugar diet to those fed a high-starch diet suggested that sucrose consumption might be associated with elevated levels of beta-glucuronidase, an enzyme previously associated with bladder cancer in humans. SRF terminated Project 259 without publishing the results. The sugar industry did not disclose evidence of harm from animal studies that would have (1) strengthened the case that the CHD risk of sucrose is greater than starch and (2) caused sucrose to be scrutinized as a potential carcinogen. The influence of the gut microbiota in the differential effects of sucrose and starch on blood lipids, as well as the influence of carbohydrate quality on beta-glucuronidase and cancer activity, deserve further scrutiny. PMID:29161267

  1. Using snowball sampling method with nurses to understand medication administration errors.

    Science.gov (United States)

    Sheu, Shuh-Jen; Wei, Ien-Lan; Chen, Ching-Huey; Yu, Shu; Tang, Fu-In

    2009-02-01

    We aimed to encourage nurses to release information about drug administration errors to increase understanding of error-related circumstances and to identify high-alert situations. Drug administration errors represent the majority of medication errors, but errors are underreported. Effective ways are lacking to encourage nurses to actively report errors. Snowball sampling was conducted to recruit participants. A semi-structured questionnaire was used to record types of error, hospital and nurse backgrounds, patient consequences, error discovery mechanisms and reporting rates. Eighty-five nurses participated, reporting 328 administration errors (259 actual, 69 near misses). Most errors occurred in medical surgical wards of teaching hospitals, during day shifts, committed by nurses working fewer than two years. Leading errors were wrong drugs and doses, each accounting for about one-third of total errors. Among 259 actual errors, 83.8% resulted in no adverse effects; among remaining 16.2%, 6.6% had mild consequences and 9.6% had serious consequences (severe reaction, coma, death). Actual errors and near misses were discovered mainly through double-check procedures by colleagues and nurses responsible for errors; reporting rates were 62.5% (162/259) vs. 50.7% (35/69) and only 3.5% (9/259) vs. 0% (0/69) were disclosed to patients and families. High-alert situations included administration of 15% KCl, insulin and Pitocin; using intravenous pumps; and implementation of cardiopulmonary resuscitation (CPR). Snowball sampling proved to be an effective way to encourage nurses to release details concerning medication errors. Using empirical data, we identified high-alert situations. Strategies for reducing drug administration errors by nurses are suggested. Survey results suggest that nurses should double check medication administration in known high-alert situations. Nursing management can use snowball sampling to gather error details from nurses in a non

  2. Sugar industry sponsorship of germ-free rodent studies linking sucrose to hyperlipidemia and cancer: An historical analysis of internal documents.

    Science.gov (United States)

    Kearns, Cristin E; Apollonio, Dorie; Glantz, Stanton A

    2017-11-01

    In 1965, the Sugar Research Foundation (SRF) secretly funded a review in the New England Journal of Medicine that discounted evidence linking sucrose consumption to blood lipid levels and hence coronary heart disease (CHD). SRF subsequently funded animal research to evaluate sucrose's CHD risks. The objective of this study was to examine the planning, funding, and internal evaluation of an SRF-funded research project titled "Project 259: Dietary Carbohydrate and Blood Lipids in Germ-Free Rats," led by Dr. W.F.R. Pover at the University of Birmingham, Birmingham, United Kingdom, between 1967 and 1971. A narrative case study method was used to assess SRF Project 259 from 1967 to 1971 based on sugar industry internal documents. Project 259 found a statistically significant decrease in serum triglycerides in germ-free rats fed a high sugar diet compared to conventional rats fed a basic PRM diet (a pelleted diet containing cereal meals, soybean meals, whitefish meal, and dried yeast, fortified with a balanced vitamin supplement and trace element mixture). The results suggested to SRF that gut microbiota have a causal role in carbohydrate-induced hypertriglyceridemia. A study comparing conventional rats fed a high-sugar diet to those fed a high-starch diet suggested that sucrose consumption might be associated with elevated levels of beta-glucuronidase, an enzyme previously associated with bladder cancer in humans. SRF terminated Project 259 without publishing the results. The sugar industry did not disclose evidence of harm from animal studies that would have (1) strengthened the case that the CHD risk of sucrose is greater than starch and (2) caused sucrose to be scrutinized as a potential carcinogen. The influence of the gut microbiota in the differential effects of sucrose and starch on blood lipids, as well as the influence of carbohydrate quality on beta-glucuronidase and cancer activity, deserve further scrutiny.

  3. Sugar industry sponsorship of germ-free rodent studies linking sucrose to hyperlipidemia and cancer: An historical analysis of internal documents.

    Directory of Open Access Journals (Sweden)

    Cristin E Kearns

    2017-11-01

    Full Text Available In 1965, the Sugar Research Foundation (SRF secretly funded a review in the New England Journal of Medicine that discounted evidence linking sucrose consumption to blood lipid levels and hence coronary heart disease (CHD. SRF subsequently funded animal research to evaluate sucrose's CHD risks. The objective of this study was to examine the planning, funding, and internal evaluation of an SRF-funded research project titled "Project 259: Dietary Carbohydrate and Blood Lipids in Germ-Free Rats," led by Dr. W.F.R. Pover at the University of Birmingham, Birmingham, United Kingdom, between 1967 and 1971. A narrative case study method was used to assess SRF Project 259 from 1967 to 1971 based on sugar industry internal documents. Project 259 found a statistically significant decrease in serum triglycerides in germ-free rats fed a high sugar diet compared to conventional rats fed a basic PRM diet (a pelleted diet containing cereal meals, soybean meals, whitefish meal, and dried yeast, fortified with a balanced vitamin supplement and trace element mixture. The results suggested to SRF that gut microbiota have a causal role in carbohydrate-induced hypertriglyceridemia. A study comparing conventional rats fed a high-sugar diet to those fed a high-starch diet suggested that sucrose consumption might be associated with elevated levels of beta-glucuronidase, an enzyme previously associated with bladder cancer in humans. SRF terminated Project 259 without publishing the results. The sugar industry did not disclose evidence of harm from animal studies that would have (1 strengthened the case that the CHD risk of sucrose is greater than starch and (2 caused sucrose to be scrutinized as a potential carcinogen. The influence of the gut microbiota in the differential effects of sucrose and starch on blood lipids, as well as the influence of carbohydrate quality on beta-glucuronidase and cancer activity, deserve further scrutiny.

  4. RADIOIODINE TREATMENT OF GRAVES’ DISEASE – DOSE/RESPONSE ANALYSIS

    Directory of Open Access Journals (Sweden)

    Jitka Čepková

    2014-01-01

    Full Text Available The clinical outcome of 153 Graves’ disease patients treated with a wide dose range of radioactive iodine-131 (RAI was analyzed retrospectively. Six to nine months after the first dose of RAI 60 patients (39% were hypothyroid (or rather thyroxine-substituted and 26 (17% were euthyroid, while 67 patients (44% did not respond properly: in 32 (21% their antithyroid drug (ATD dose could be reduced but not withdrawn (partial response and 35 (23% remained hyperthyroid or the same dose of ATD was necessary (no response. The outcome did not correspond significantly to the administered activity of RAI (medians 259, 259, 222, and 259 MBq for hypothyroid, euthyroid, partial, and no response subgroups, respectively, or the activity retained in the gland at 24 h (medians 127, 105, 143, and 152 MBq. The effect was, however, clearly, and in a stepwise pattern, dependent on initial thyroid volume (17, 26, 33 and 35 ml, P  6 MBq/g, cure rate 80% and lower (≤ 6 MBq/g, cure rate 46% doses gave highly significant difference (P < 0.001. With our dosing range we found a dose-dependent clinical outcome that suggests an optimum delivered dose near 6.5 MBq/g, resulting in successful treatment of ca 80% patients.

  5. β-Hydroxy-β-methylbutyrate (HMB) supplementation and resistance exercise significantly reduce abdominal adiposity in healthy elderly men.

    Science.gov (United States)

    Stout, Jeffrey R; Fukuda, David H; Kendall, Kristina L; Smith-Ryan, Abbie E; Moon, Jordan R; Hoffman, Jay R

    2015-04-01

    The effects of 12-weeks of HMB ingestion and resistance training (RT) on abdominal adiposity were examined in 48 men (66-78 yrs). All participants were randomly assigned to 1 of 4 groups: no-training placebo (NT-PL), HMB only (NT-HMB), RT with PL (RT-PL), or HMB with RT (RT-HMB). DXA was used to estimate abdominal fat mass (AFM) by placing the region of interest over the L1-L4 region of the spine. Outcomes were assessed by ANCOVA, with Bonferroni-corrected pairwise comparisons. Baseline AFM values were used as the covariate. The ANCOVA indicated a significant difference (p = 0.013) between group means for the adjusted posttest AFM values (mean (kg) ± SE: NT-PL = 2.59 ± 0.06; NT-HMB = 2.59 ± 0.61; RT-PL = 2.59 ± 0.62; RT-HMB = 2.34 ± 0.61). The pairwise comparisons indicated that AFM following the intervention period in the RT-HMB group was significantly less than NT-PL (p = 0.013), NT-HMB (p = 0.011), and RT-PL (p = 0.010). These data suggested that HMB in combination with 12 weeks of RT decreased AFM in elderly men. Copyright © 2015. Published by Elsevier Inc.

  6. Etiology of bacterial meningitis among children aged 2-59 months in Salvador, Northeast Brazil, before and after routine use of Haemophilus influenzae type b vaccine Etiologia da meningite bacteriana em crianças com idade entre 2 e 59 meses em Salvador, Nordeste do Brasil, antes e depois do uso rotineiro da vacina para Haemophilus influenzae tipo b

    Directory of Open Access Journals (Sweden)

    Cristiana M. Nascimento-Carvalho

    2004-06-01

    Full Text Available OBJECTIVE: To describe the frequency of etiologic agents of bacterial meningitis (BM among children aged 2-59 months in a sample of patients in Salvador, Northeast Brazil, with emphasis on the frequency of BM of unknown etiology (BMUE, just before, during and after the implementation of routine immunization of infants with Haemophilus influenzae type b (Hib vaccination. METHOD: Demographic, clinical and cerebrospinal fluid (CSF information was collected from the chart of every patient, aged 2-59 months, whose CSF exam was performed at the CSF Lab - José Silveira Foundation, between January 1989 and December 2001. Every CSF exam was completely performed according to standard methods. The etiologic diagnosis was based on either culture and/or latex-agglutination test. When the agent was only seen on Gram stained smear, the diagnosis was descriptive. BMUE was defined as: glucose 100 mg / dl, white blood cell count > 20 cells / mm³, percentage of neutrophils > 80%. RESULTS: Of 1519 patients, 894 (58.9% had normal exams and BM was diagnosed in 95 (6.2%. Etiologic agents were: Hib (44.2%, meningococcus (13.7%, Gram-negative bacilli (11.6%, Mycobacterium tuberculosis (6.3%, pneumococcus (4.2%, other agents (4.2%; BMUE was diagnosed in 15.8% of cases with BM. By analysing the frequency of BMUE and Hib among all exams performed yearly, the peaks were recorded in 1989 (5.3% and 1990 (16.9%, respectively, decreasing to 0.7% and 0% in 2001. CONCLUSION: It is possible that the implementation of the conjugate Hib vaccine during the 1990's has been decreasing not only the occurrence of Hib meningitis but also of BMUE.OBJETIVO: Descrever a freqüência dos agentes etiológicos de meningite bacteriana (MB em amostra das crianças com idade entre 2 e 59 meses, em Salvador, Nordeste do Brasil, com ênfase na freqüência de MB de etiologia indeterminada (MBEI, antes, durante e após a implementação da imunização rotineira de lactentes com vacina para

  7. Human Estimation of Slope, Distance, and Height of Terrain in Simulated Lunar Conditions

    Science.gov (United States)

    2009-02-01

    9643 APPENDIX J DEVON ISLAND DISTANCE REFERENCE 259 Distance References NBA Basketball Court Width 15 meters 50 feet...Cockpit Hours: Simulator Airframe: Hours: Sports Baseball Years: Beginner Intermediate Advanced Basketball Years: Beginner

  8. Review of the cyanobacterial genera implaying planktic species after recent taxonomic revisions according to polyphasic methods: state as of 2014.

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 259-270 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * plankton * taxonomic revisions Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  9. Oregano (Lippia graveolens) essential oil added within pectin edible coatings prevents fungal decay and increases the antioxidant capacity of treated tomatoes.

    Science.gov (United States)

    Rodriguez-Garcia, Isela; Cruz-Valenzuela, M Reynaldo; Silva-Espinoza, Brenda A; Gonzalez-Aguilar, Gustavo A; Moctezuma, Edgar; Gutierrez-Pacheco, M Melissa; Tapia-Rodriguez, Melvin R; Ortega-Ramirez, Luis A; Ayala-Zavala, J Fernando

    2016-08-01

    Tomato is a fruit widely consumed due to its flavor and nutritional value; however, it is susceptible to fungi contamination. Oregano essential oil (OEO) is a fungicide whose constituents are volatile; therefore, their incorporation within edible coatings can protect them and maintain their efficacy. In this context, this study evaluated the effect of OEO applied within pectin coatings on the inhibition of Alternaria alternata growth, antioxidant content and sensorial acceptability of tomatoes. The major volatile compounds of OEO were carvacrol (47.41%), p-cymene (26.44%) and thymol (3.02%). All the applied OEO concentrations (15.7, 25.9 and 36.1 g L(-1) ) inhibited the in vitro growth of A. alternata, whereas the in vivo effective concentrations were 25.9 and 36.1 g L(-1) . Additionally, there was an increment of total phenols and antioxidant activity in coated tomatoes compared to controls. Aroma acceptability of tomatoes was not affected by the pectin-OEO coating; additionally, the pectin, pectin-OEO 15.7 g L(-1) treatments and control tomatoes showed higher flavor acceptability than those coated with pectin-OEO 25.9 and 36.1 g L(-1) . Pectin-OEO coatings showed antifungal effect and increased the antioxidant activity without negative effects on the sensorial acceptability of tomatoes. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  10. Characterization of HIV Transmission in South-East Austria.

    Science.gov (United States)

    Hoenigl, Martin; Chaillon, Antoine; Kessler, Harald H; Haas, Bernhard; Stelzl, Evelyn; Weninger, Karin; Little, Susan J; Mehta, Sanjay R

    2016-01-01

    To gain deeper insight into the epidemiology of HIV-1 transmission in South-East Austria we performed a retrospective analysis of 259 HIV-1 partial pol sequences obtained from unique individuals newly diagnosed with HIV infection in South-East Austria from 2008 through 2014. After quality filtering, putative transmission linkages were inferred when two sequences were ≤1.5% genetically different. Multiple linkages were resolved into putative transmission clusters. Further phylogenetic analyses were performed using BEAST v1.8.1. Finally, we investigated putative links between the 259 sequences from South-East Austria and all publicly available HIV polymerase sequences in the Los Alamos National Laboratory HIV sequence database. We found that 45.6% (118/259) of the sampled sequences were genetically linked with at least one other sequence from South-East Austria forming putative transmission clusters. Clustering individuals were more likely to be men who have sex with men (MSM; pAustria had at least one putative inferred linkage with sequences from a total of 69 other countries. In conclusion, analysis of HIV-1 sequences from newly diagnosed individuals residing in South-East Austria revealed a high degree of national and international clustering mainly within MSM. Interestingly, we found that a high number of heterosexual males clustered within MSM networks, suggesting either linkage between risk groups or misrepresentation of sexual risk behaviors by subjects.

  11. 'Transatlantic Print Culture, 1880-1940: Emerging Media, Emerging Modernisms', edited by Ann Ardis and Patrick Collier

    Directory of Open Access Journals (Sweden)

    Janet Floyd

    2009-11-01

    Full Text Available A review of 'Transatlantic Print Culture, 1880-1940: Emerging Media, Emerging Modernisms', edited by Ann Ardis and Patrick Collier (London: Palgrave Macmillan, 2008. Hardback, 259 pages, £50, ISBN 9780554269.

  12. EHR Incentive Programs - Data and Reports

    Data.gov (United States)

    U.S. Department of Health & Human Services — As of March 2013, more than 259,000 health care providers received payment for participating in the Medicare and Medicaid Electronic Health Record (EHR) Incentive...

  13. 78 FR 57889 - Notice of Quarterly Report (April 1 2013-June 30, 2013)

    Science.gov (United States)

    2013-09-20

    ... time; hours per week. Restructure and rehabilitate primary and secondary pipelines (kilometers... Project $42,045,259 Increase the $31,725,167 Screening for adoption of hypertension (percent). behaviors... management and implementation. [[Page 57901

  14. Fulltext PDF

    Indian Academy of Sciences (India)

    259. Gopalakrishna G S. Hydrothermal synthesis, structure and characterization of new .... Silver nanoparticles of variable morphology synthesized in aqueous foams as ... Thermal and structural properties of spray pyrolysed CdS thin film. 233.

  15. Resting electrical network activity in traps of the aquatic carnivorous plants of the genera Aldrovanda and Utricularia

    Czech Academy of Sciences Publication Activity Database

    Masi, E.; Ciszak, M.; Colzi, I.; Adamec, Lubomír; Mancuso, S.

    2016-01-01

    Roč. 6, e24989 (2016), s. 1-11 ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : electrophysiology * multielectrode array * aquatic carnivorous plants Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016

  16. UJI TOKSISITAS DAN PERUBAHAN STRUKTUR MIKROANATOMI INSANG IKAN NILA LARASATI (Oreochromis nilloticus YANG DIPAPAR TIMBAL ASETAT

    Directory of Open Access Journals (Sweden)

    FAM Mulyani

    2014-11-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui Nilai LC50-96 jam pada uji toksisitas ikan Nila Larasati yang dipapar timbal; mengetahui perubahan struktur  mikroanatomi dan mengetahui pada konsentrasi berapa timbal menyebabkan perubahan struktur mikroanatomi insang. Sampel uji toksisitas sebanyak 120 ekor untuk mengetahui tingkat  kematian ikan hingga 50% dalam 96 jam, dan uji perlakuan sebanyak 80 ekor dengan konsentrasi 0 ppm; 259,51 ppm; 291,94 ppm; dan 324,38 ppm. Pada akhir minggu ke empat diambil sampel insang dan dilakukan analisis gambaran struktur mikroanatomi insang secara diskriptif. Hasil analisis menunjukkan kerusakan edema 0%-25%, fusi lamela antara 1%-75%, hiperplasia 0%-50%, epithelial lifting 0%-50%, dan nekrosis 0%-50%. Dari hasil penelitian dapat disimpulkan bahwa nilai  LC50-96 jam pada uji toksisitas ikan Nila Larasati sebesar 324,38 ppm dan mulai terjadi perubahan struktur mikroanatomi insang pada konsentrasi 259,51 ppm. The objective of thje study was to determine the value of LC50-96 hours in a toxicity test of Nila Larasati fish exposed to lead acetate; to determine the changes in the microanatomy structure and to determine the concentration of lead acetate which causes microanatomy structure changes in the gills of Nila Larasati fish. The samples were 120 fish to find out the 50% fish mortality within 96 hours, and 80 fish in treatment test with the lead acetate concentrations of 0 ppm; 259.51 ppm; 291.94 ppm; and 324.38 ppm. At the end of the 4th week of the research, the gill samples were taken and the analysis of the microanatomy structure was carried out descriptively. The result of the analysis showed that there were 0%-25% edema, 1%-75% lamella fusion, 0%-50% hyperplasia, 0%-50% epithelial lifting and 0%-50% necrosis. It was concluded that the value of LC50-96 hours in Nila Larasati fish toxicity test was 324.38 ppm; and microanatomy changes started to occur in the lead acetate concentration of 259.51 ppm. 

  17. Satellite gravity gradient grids for geophysics

    Czech Academy of Sciences Publication Activity Database

    Bouman, J.; Ebbing, J.; Fuchs, M.; Sebera, Josef; Lieb, V.; Szwillus, W.; Haagmans, R.; Novák, P.

    2016-01-01

    Roč. 6, February (2016), 21050/1-21050/11 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : atlantic region * GOCE * model Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2016

  18. Asymmetric Preorganization of Inverted Pair Residues in the Sodium-Calcium Exchanger

    Czech Academy of Sciences Publication Activity Database

    Giladi, M.; Almagor, L.; Van Dijk, L.; Hiller, R.; Man, Petr; Forest, E.; Khananshvili, D.

    2016-01-01

    Roč. 6, FEB15 (2016), s. 20753 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : MASS-SPECTROMETRY * STRUCTURAL BASIS * NA+/CA2+ EXCHANGER Subject RIV: CE - Biochemistry Impact factor: 4.259, year: 2016

  19. Deciphering the relationship among phosphate dynamics, electron-dense body and lipid accumulation in the green alga Parachlorella kessleri

    Czech Academy of Sciences Publication Activity Database

    Ota, S.; Yoshihara, M.; Yamazaki, T.; Takeshita, T.; Hirata, A.; Konomi, M.; Oshima, K.; Hattori, M.; Bišová, Kateřina; Zachleder, Vilém; Kawano, S.

    2016-01-01

    Roč. 6, MAY 16 (2016), s. 25731 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : electron-dense body * lipid accumulation * Parachlorella kessleri Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  20. Herbivory in the soft coral Sinularia flexibilis (Alcyoniidae)

    Czech Academy of Sciences Publication Activity Database

    Piccinetti, C.C.; Ricci, R.; Pennesi, C.; Radaelli, G.; Totti, C.; Norici, A.; Giordano, Mario; Olivotto, I.

    2016-01-01

    Roč. 6, MAR 8 (2016), s. 22679 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : DIATOM THALASSIOSIRA-PSEUDONANA * STYLOPHORA-PISTILLATA * SCLERACTINIAN CORALS Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  1. Lidová hudba a zvukový záznam

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    2006-01-01

    Roč. 93, č. 3 (2006), s. 259-267 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : folk music * sound recording * phonograph * technology * media Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Intercalation of tartrazine into ZnAl and MgAl layered double hydroxides

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Zima, Vítězslav; Svoboda, Jan

    2005-01-01

    Roč. 70, č. 2 (2005), s. 259-267 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40500505 Keywords : intercalation * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.949, year: 2005

  3. Discovery of 6-Diazo-5-oxo-L-norleucine (DON) Prodrugs with Enhanced CSF Delivery in Monkeys: A Potential Treatment for Glioblastoma

    Czech Academy of Sciences Publication Activity Database

    Rais, R.; Jančařík, Andrej; Tenora, Lukáš; Nedelcovych, M.; Alt, J.; Englert, J.; Rojas, C.; Le, A.; Elgogary, A.; Tan, J.; Monincová, Lenka; Pate, K.; Adams, R.; Ferraris, D.; Powell, J.; Majer, Pavel; Slusher, B. S.

    2016-01-01

    Roč. 59, č. 18 (2016), s. 8621-8633 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : phase I * glutamine metabolism * adjuvant temozolomide Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016

  4. Effects of elevated CO2 and ozone on phenolic glycosides of trembling aspen

    Science.gov (United States)

    James K. Nitao; Muraleedharan G. Nair; William J. Mattson; Daniel A. Herms; Bruce A. Birr; Mark D. Coleman; Terry M. Trier; J. G. Isebrands

    1996-01-01

    We tested the effects of elevated CO2 and ozone on concentrations of the phenolic glycosides salicortin and tremulacin in immature and mature foliage of the trembling aspen (Populus tremuloides) clones 216, 259, and 271.

  5. Discovery of Orally Available Prodrugs of the Glutamate Carboxypeptidase II (GCPII) Inhibitor 2-Phosphonomethylpentanedioic Acid (2-PMPA)

    Czech Academy of Sciences Publication Activity Database

    Majer, Pavel; Jančařík, Andrej; Krečmerová, Marcela; Tichý, Tomáš; Tenora, Lukáš; Wozniak, K.; Wu, Y.; Pommier, E.; Ferraris, D.; Rais, R.; Slusher, B. S.

    2016-01-01

    Roč. 59, č. 6 (2016), s. 2810-2819 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : glutamate carboxypeptidase II * glutamate * 2-PMPA * prodrug Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016

  6. Effect of Machine Geometry on Higher Harmonics Content in Air-Gap Magnetic Field of Synchronous Reluctance Machine

    Czech Academy of Sciences Publication Activity Database

    Schreier, Luděk; Chomát, Miroslav; Doležel, Ivo

    2001-01-01

    Roč. 176, č. 1500 (2001), s. 259-266 ISSN 0072-4688 R&D Projects: GA ČR GA102/01/0181 Keywords : synchronous reluctance machine * torque pulsation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  7. Cerium oxide for the destruction of chemical warfare agents: A comparison of synthetic routes

    Czech Academy of Sciences Publication Activity Database

    Janos, P.; Henych, Jiří; Pelant, O.; Pilařová, V.; Vrtoch, L.; Kormunda, M.; Mazanec, K.; Štengl, Václav

    2016-01-01

    Roč. 304, MAR (2016), s. 259-268 ISSN 0304-3894 Institutional support: RVO:61388980 Keywords : Cerium oxide * Chemical warfare agents * Organophosphate compounds * Decontamination Subject RIV: CA - Inorganic Chemistry Impact factor: 6.065, year: 2016

  8. Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes

    Czech Academy of Sciences Publication Activity Database

    Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 259-271 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  9. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  10. Elementõ polititsheskoi mifologii Tjuttsheva (kommentari k state 1844 g.) / Aleksandr Ospovat

    Index Scriptorium Estoniae

    Ospovat, Aleksandr

    1999-01-01

    Bibl. lk. 259-263. Kokkuvõte inglise k. lk. 321. Kiri ajalehe "Allgemeine Zeitung" (Augsburg) toimetajale Gustav Kolbile (1844, prantsuse k.). Artikli venek. versioon (pealk. "Venemaa ja Saksamaa") publitseeriti ajakirjas Russki arhiv (1873, nr. 10)

  11. Temperature-Dependent Kinetics of Grape Seed Phenolic Compounds Extraction: Experiment and Model

    Czech Academy of Sciences Publication Activity Database

    Bucic´-Kojic´, A.; Sovová, Helena; Planinic´, M.; Tomas, S.

    2013-01-01

    Roč. 136, 3-4 (2013), s. 1136-1140 ISSN 0308-8146 Institutional support: RVO:67985858 Keywords : kinetics modelling * temperature * grape seed Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.259, year: 2013

  12. Enabling Teachers to Develop Pedagogically Sound and Technically Executable Learning Designs

    NARCIS (Netherlands)

    Miao, Yongwu; Van der Klink, Marcel; Boon, Jo; Sloep, Peter; Koper, Rob

    2008-01-01

    Miao, Y., Van der Klink, M., Boon, J., Sloep, P. B., & Koper, R. (2009). Enabling Teachers to Develop Pedagogically Sound and Technically Executable Learning Designs [Special issue: Learning Design]. Distance Education, 30(2), 259-276.

  13. Historic and ancient tsunamis uncovered on the Jalisco-Colima Pacific coast, the Mexican subduction zone

    Czech Academy of Sciences Publication Activity Database

    Ramírez-Herrera, M.-T.; Bógalo, M.-F.; Černý, Jan; Goguitchaichvili, A.; Corona, N.; Machain, M. L.; Edwards, A. C.; Sosa, S.

    2016-01-01

    Roč. 259, April 15 (2016), s. 90-104 ISSN 0169-555X Institutional support: RVO:67985831 Keywords : Earthquake * magnetic properties * Mexican subduction * tsunami deposit Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.958, year: 2016

  14. College Drinking

    Science.gov (United States)

    ... range of counseling options and policies related to sales and access. Yet, while school officials should be ... 18–24: changes from 1998 to 2001. Annual Review of Public Health 26: 259–279, 2005. PMID: ...

  15. Impact of ICTs on Local Democracy : Transparency and Citizen ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Impact of ICTs on Local Democracy : Transparency and Citizen Participation in the ... is characterized by great socioeconomic diversity and strong social networks ... of the population has access to computers, 25.9% of which use the Internet.

  16. Potent Antidiuretic Agonists, Deamino-Vasopressin and Desmopressin, and Their Inverso Analogs: NMR Structure and Interactions With Micellar and Liposomic Models of Cell Membrane

    Czech Academy of Sciences Publication Activity Database

    Lubecka, E. A.; Sikorska, E.; Sobolewski, D.; Prahl, A.; Slaninová, Jiřina; Ciarkowski, J.

    2016-01-01

    Roč. 106, č. 3 (2016), s. 245-259 ISSN 0006-3525 Institutional support: RVO:61388963 Keywords : desmopressin * deamino-vasopressin * anionic-zwitterionic micelles * liposomes * inverso analogs Subject RIV: CE - Biochemistry Impact factor: 1.908, year: 2016

  17. Tetra(3,4-pyrido)porphyrazines Caught in the Cationic Cage: Toward Nanomolar Active Photosensitizers

    Czech Academy of Sciences Publication Activity Database

    Macháček, M.; Demuth, J.; Čermák, P.; Vavrečková, M.; Hrubá, L.; Jedličková, A.; Kubát, Pavel; Šimůnek, T.; Nováková, V.; Zimčík, P.

    2016-01-01

    Roč. 59, č. 20 (2016), s. 9443-9456 ISSN 0022-2623 Institutional support: RVO:61388955 Keywords : TARGETED PHOTODYNAMIC THERAPY * SINGLET OXYGEN * PHOTOPHYSICAL PROPERTIES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.259, year: 2016

  18. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Rota.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 16-17 September 2003 (JD 259-260) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Rota Island in...

  19. Testosterone Test

    Science.gov (United States)

    ... Testing Triglycerides Troponin Tryptase Tumor Markers Uric Acid Urinalysis Urine Albumin and Albumin/Creatinine Ratio Urine Culture ... 2010) 2536–259. Centers for Disease Control Hormone Standardization website(HoST). Available online at http://www.cdc. ...

  20. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    RESEARCH ARTICLE Volume 96 Issue 2 June 2017 pp 251-259 ... is a chronic immuno-inflammatory disease characterized by inflammatory mediators and ... no notable differences between the multiple comparisons of rs28362491– rs696 ...

  1. Philipp Weselsky - profesor chemie vídeňské techniky z Českomoravské vysočiny

    Czech Academy of Sciences Publication Activity Database

    Jindra, Jiří

    2010-01-01

    Roč. 43, č. 4 (2010), s. 255-259 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Vienna Technical university 1854-1884 * tuition of analytical chemistry * Philipp Weselsky Subject RIV: AB - History

  2. beta-1,2,3-Triazolyl-Nucleosides as Nicotinamide Riboside Mimics

    Czech Academy of Sciences Publication Activity Database

    Amigues, E.J.; Armstrong, E.; Dvořáková, Marcela; Migaud, M.E.; Huang, M.

    2009-01-01

    Roč. 28, č. 3 (2009), s. 238-259 ISSN 1525-7770 Institutional research plan: CEZ:AV0Z50380511 Keywords : Nucleoside * nucleotide * sirtuin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.768, year: 2009

  3. matthew 28:19

    African Journals Online (AJOL)

    2010-03-05

    –93; Viljoen 2007:259). Scholars have noticed the co-existence of universalism and particularism (Guthrie 1990:29–30). Readers too would have been prepared regarding this matter (Hubbard 1974:86). For example, we may ...

  4. Tributyltin-resistant Methanothermobacter thermautotrophicus mutant with mutational substitutions in the A.sub.1./sub.A.sub.0./sub.-ATP synthase operon

    Czech Academy of Sciences Publication Activity Database

    Nováková, Z.; Bobálová, Janette; Vidová, M.; Hapala, I.; Šmigáň, P.

    2009-01-01

    Roč. 298, č. 2 (2009), s. 255-259 ISSN 0378-1097 Institutional research plan: CEZ:AV0Z40310501 Keywords : methanoarchaea * bioenergetics * tributyltin resistance Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.199, year: 2009

  5. Progress and prospects in rat genetics: a community view

    Czech Academy of Sciences Publication Activity Database

    Aitman, T. J.; Critser, J.K.; Cuppen, E.; Dominiczak, A.; Fernandez-Suarez, X.M.; Flint, J.; Gauguier, D.; Geurts, A.M.; Gould, M.; Harris, P.C.; Holmdahl, R.; Hubner, N.; Izsvák, Z.; Jacob, H. J.; Kuramoto, T.; Kwitek, A.E.; Marrone, A.; Mashimo, T.; Moreno, C.; Mullins, J.; Mullins, L.; Olsson, T.; Pravenec, Michal; Riley, L.; Saar, K.; Serikawa, T.; Shull, J.D.; Szpirer, C.; Twigger, S.N.; Voigt, B.; Worley, K.

    2008-01-01

    Roč. 40, č. 5 (2008), s. 516-522 ISSN 1061-4036 Institutional research plan: CEZ:AV0Z50110509 Keywords : white paper * rat * genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008

  6. AUTHOR INDEX

    Indian Academy of Sciences (India)

    symmetric po- tentials. 323. Arpornthip Tanwa. Conduction bands in classical periodic potentials. 259. Asfaw A see Chaudhary A K. 731. Aslan Ö see Özdemir Z Guven. 755. Asnani Himanshu. Effective mass theory of a two-dimen-.

  7. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  8. A combined approach of DNA probe and RFLP for family and species identification of larval stages of commercially important aquatic species: A study on the surfclam Spisula solidissima

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.

    fragment length polymorphism (RFLP) analysis. An oilgonucleotide sequence designed from the 18S ribosomal RNA gene (nucleotide position 259-276) provided a sensitive probe for the Family Mactridae, to which S. solidissima belongs. DNA of unknown larvae...

  9. Seismic communication in demon African mole rat Tachyoryctes daemon from Tanzania

    Czech Academy of Sciences Publication Activity Database

    Hrouzková, E.; Dvořáková, V.; Jedlička, Petr; Šumbera, R.

    2013-01-01

    Roč. 31, č. 3 (2013), s. 255-259 ISSN 0289-0771 Institutional support: RVO:67985530 Keywords : seismic communication * substrate-borne vibration * subterranean mammal Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.790, year: 2013

  10. Design of glycopeptides used to investigate class II MHC binding and T-cell responses associated with autoimmune arthritis.

    Directory of Open Access Journals (Sweden)

    Ida E Andersson

    Full Text Available The glycopeptide fragment CII259-273 from type II collagen (CII binds to the murine A(q and human DR4 class II Major Histocompatibility Complex (MHC II proteins, which are associated with development of murine collagen-induced arthritis (CIA and rheumatoid arthritis (RA, respectively. It has been shown that CII259-273 can be used in therapeutic vaccination of CIA. This glycopeptide also elicits responses from T-cells obtained from RA patients, which indicates that it has an important role in RA as well. We now present a methodology for studies of (glycopeptide-receptor interactions based on a combination of structure-based virtual screening, ligand-based statistical molecular design and biological evaluations. This methodology included the design of a CII259-273 glycopeptide library in which two anchor positions crucial for binding in pockets of A(q and DR4 were varied. Synthesis and biological evaluation of the designed glycopeptides provided novel structure-activity relationship (SAR understanding of binding to A(q and DR4. Glycopeptides that retained high affinities for these MHC II proteins and induced strong responses in panels of T-cell hybridomas were also identified. An analysis of all the responses revealed groups of glycopeptides with different response patterns that are of high interest for vaccination studies in CIA. Moreover, the SAR understanding obtained in this study provides a platform for the design of second-generation glycopeptides with tuned MHC affinities and T-cell responses.

  11. Susceptibility of Some Bacterial Contaminants Recovered from ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research February 2014; 13 (2): 255-259. ISSN: 1596-5996 (print); .... buffer pH 7. ... of each container are also given in Table 1. .... This investigation was performed to find out .... Microbiological quality of.

  12. Coupling of seasonal variations in the zooplankton community within the limnetic and littoral zones of a shallow pond

    Czech Academy of Sciences Publication Activity Database

    Šorf, M.; Devetter, Miloslav

    2011-01-01

    Roč. 47, č. 3 (2011), s. 259-268 ISSN 0003-4088 Institutional research plan: CEZ:AV0Z60660521 Keywords : limnetic zone * littoral zone * seasonal succession Subject RIV: EH - Ecology, Behaviour Impact factor: 0.930, year: 2011

  13. Drug Metabolism

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 3. Drug Metabolism: A Fascinating Link Between Chemistry and Biology. Nikhil Taxak Prasad V Bharatam. General Article Volume 19 Issue 3 March 2014 pp 259-282 ...

  14. Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva

    Czech Academy of Sciences Publication Activity Database

    Psota, V.; Čmelík, Richard; Sachambula, L.

    2011-01-01

    Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation

  15. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  16. Socio-Cultural Dimensions and Attitude of Women and Community ...

    African Journals Online (AJOL)

    Toshiba

    freedom = 6, P < 0.01 and Contingency coefficient (C) of 0.259. Vol. ..... For the sake of marital harmony in the contemporary time when .... mental view or disposition. Attitudes are .... Integrating the Prevention and Management of the Health.

  17. Qualitative study on maternal referrals in rural Tanzania: Decision ...

    African Journals Online (AJOL)

    Administrator

    discussions (FGDs) with health workers and community members, stratified by age and ..... health facilities and not listening carefully ..... Projects. Int J Gynaecol Obstet. 1997(59). S259-S265. 22. Campbell O, Koblinsky M, Taylor P. Off to.

  18. Empirical evidence for large X-effects in animals with undifferentiated sex chromosomes

    Czech Academy of Sciences Publication Activity Database

    Dufresnes, C.; Majtyka, T.; Baird, Stuart J. E.; Gerchen, J. F.; Borzée, A.; Savary, R.; Ogielska, M.; Perrin, N.; Stöck, M.

    2016-01-01

    Roč. 6, č. 21029 (2016), s. 21029 ISSN 2045-2322 Institutional support: RVO:68081766 Keywords : controlled study * genetic marker * hybrid zone * Hyla * introgression * sex chromosome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  19. Dicty_cDB: Contig-U13120-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Chromocleista malachitea isolate C... 311 2e-83 FJ358413_1( FJ358413 |pid:none) Leucothecium emdeni...pid:none) Gymnoascus reesii isolate CBS 259.... 312 1e-83 FJ358409_1( FJ358409 |p

  20. Calciopetersite from Domašov nad Bystřicí, Northen Moravia (Czech Republic), a new mineral species of the mixite group

    Czech Academy of Sciences Publication Activity Database

    Sejkora, J.; Novotný, P.; Novák, M.; Šrein, Vladimír; Berlepsch, P.

    2005-01-01

    Roč. 43, č. 4 (2005), 1393-1400 ISSN 0008-4476 Institutional research plan: CEZ:AV0Z30460519 Keywords : calciopetersite * new mineral species * X-ray poder diffraction Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.259, year: 2005

  1. Tallink võttis kompromissi vastu, ametiühing mitte / Helga Koger

    Index Scriptorium Estoniae

    Koger, Helga, 1945-

    2008-01-01

    Tallink võttis vastu riikliku lepitaja kompromissettepaneku ja on valmis tõstma Eesti lipu all sõitvate laevade töötajate eelmises palgaleppes fikseeritud palka järgmisel kolmel aastal vastavalt 25,9 ja 6 protsendi võrra

  2. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  3. Influence of seeing effects on cloud model inversions

    Czech Academy of Sciences Publication Activity Database

    Tziotziou, K.; Heinzel, Petr; Tsiropoula, G.

    2007-01-01

    Roč. 472, č. 1 (2007), s. 287-292 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : cloud model * inversions * seeing effects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  4. Maximum effort in the minimum-effort game

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Normann, H.-T.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  5. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  6. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  7. Eestlased riisusid Balti fotovõistlusel koore

    Index Scriptorium Estoniae

    2011-01-01

    Eesti, Läti ja Leedu fotovõistlusest, kus valiti Baltikumi parimad loodusfotod ja maaelu kajastavad fotod. Osales 259 fotograafi. Parim loodusfoto oli Kaido Haageni "Kus sa oled, mu sõber" ning parim foto maaelu kategoorias Arne Aderi "Jõuluks koju"

  8. 50 CFR 259.30 - Application for Interim Capital Construction Fund Agreement (“Interim CCF Agreement”).

    Science.gov (United States)

    2010-10-01

    ... of the applicant's actual intentions. Vague or contingent objectives will not be acceptable. (b...-carrying capacity, age, length, type of fishing gear, number of passengers carried or in the case of...) General characteristics (i.e., net tonnage, fish-carrying capacity, age, length, type of fishing gear...

  9. SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID

    International Nuclear Information System (INIS)

    Annamalai, Gopiraj; Watanabe, Yoichi

    2016-01-01

    Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm 2 – 25×25 cm 2 at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship

  10. SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID

    Energy Technology Data Exchange (ETDEWEB)

    Annamalai, Gopiraj [Government Arignar Anna Memorial Cancer Hospital & Research Institute, Kanchipuram, TAMILNADU (India); Watanabe, Yoichi [University of Minnesota, Minneapolis, MN (United States)

    2016-06-15

    Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm{sup 2} – 25×25 cm{sup 2} at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship.

  11. liver cirrhosis from autoimmune hepatitis in a nigerian woman

    African Journals Online (AJOL)

    Autoimmune hepatitis (AIH) is a rare cause of chronic liver disease (CLD). It presents with ... chronic viral hepatitis and alcoholic liver disease, making it difficult to diagnose in .... effects.2,5,9 We opted for the Budesonide/AZA therapy because ...

  12. Central Gi(2) proteins, sympathetic nervous system and blood pressure regulation

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef

    2016-01-01

    Roč. 216, č. 3 (2016), s. 258-259 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : inhibitory G proteins * sympathetic nervous system * central blood pressure control Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.867, year: 2016

  13. 02 Barnard WEB 02.pmd

    African Journals Online (AJOL)

    Owner

    and consensual sex is shown to be problematic in the relationship between David ... Sheila Jeffreys (Prostitution 259) does not use the word rape, but calls ... The canzone or ballad “La donna è mobile” is from Verdi's opera Rigoletto and can.

  14. New taxa and new records of oribatid mites of the family Galumnidae (Acari: Oribatida) from Ecuador

    Czech Academy of Sciences Publication Activity Database

    Ermilov, S.G.; Starý, Josef; Sandmann, D.; Marian, F.; Maraun, M.

    2013-01-01

    Roč. 3700, č. 2 (2013), s. 259-270 ISSN 1175-5326 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : Oribatida * Galumnidae * new species * Ecuador Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  15. ETHNOBOTANICAL STUDIES OF WEST AFRICAN OKRA ...

    African Journals Online (AJOL)

    Administrator

    18-87 years old. Of this number, 259 (48%) ... Traditional uses of the crop include food (100%) and non- ... inter-relationship studies between people and plants in the ..... of economic plants sold in the market of Benin City (Edo State). Nigeria.

  16. New mixed ligand complexes of ruthenium(II) that incorporate a ...

    Indian Academy of Sciences (India)

    Unknown

    infrared, UV-Vis, steady-state emission and 1H NMR spectroscopic methods. Results ... Deionised, triply distilled water was used for preparing various buffers. .... 259 nm in CH3CN containing a drop of HCl (acid was added to ensure complete.

  17. Effect of enzyme/substrate ratio on the antioxidant properties of ...

    African Journals Online (AJOL)

    Dr (Mrs) O.Fasasi

    2012-06-21

    Jun 21, 2012 ... Department of Food Science and Technology, P. M. B. 704, Federal University of Technology, ... of East Africa and it is cultivated for both its seeds and ..... inhibit lipid oxidation in cooked pork patties, Meat Sci., 64: 259-263.

  18. Halogen Bonding in Nucleic Acid Complexes

    Czech Academy of Sciences Publication Activity Database

    Kolář, Michal H.; Tabarrini, O.

    2017-01-01

    Roč. 60, č. 21 (2017), s. 8681-8690 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : aldose reductase inhibition * minor groove binders * medicinal chemistry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.259, year: 2016

  19. Human-Centered Technology for Maintainability: Workshop Proceedings

    Science.gov (United States)

    1991-06-01

    INT E RNAL) POPLITEAL STATION-ANKLE JOINT-- -* A (LOCATOR) AFTANKLE .... -. REANKLE ANKLE JOINT HT., STANDING---... - , FOREFOOT AFTFOOT...to strike down missile containers in the weapons elevator nwd stack them within the confines of the magazine. 259 Mechanized support equipment models

  20. Evolutionary plasticity of restorer-of-fertility-like proteins in rice

    Czech Academy of Sciences Publication Activity Database

    Melonek, J.; Stone, James D.; Small, I.

    2016-01-01

    Roč. 6, Oct 24 (2016), s. 1-12, č. článku 35152. ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : cytoplasmic male-sterility * genome-wide analysis * PPR protein Subject RIV: EF - Botanics Impact factor: 4.259, year: 2016

  1. Letopis na cestě ke kronice. Počátky beletrizace analistického textu

    Czech Academy of Sciences Publication Activity Database

    Černá, Alena M.

    2012-01-01

    Roč. 4, č. 2 (2012), s. 259-270 ISSN 1804-0977 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : Old Bohemian Annals * Old Czech * historical stylistics Subject RIV: AI - Linguistics

  2. Barrier crossing in small avian migrants: individual tracking reveals prolonged nocturnal flights into the day as a common migratory strategy

    Czech Academy of Sciences Publication Activity Database

    Adamík, P.; Emmenegger, T.; Briedis, M.; Gustafsson, L.; Henshaw, I.; Krist, M.; Laaksonen, T.; Liechti, F.; Procházka, Petr; Salewski, V.; Hahn, S.

    2016-01-01

    Roč. 6, č. 21560 (2016), s. 21560 ISSN 2045-2322 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : Animal behaviour * Animal migration Subject RIV: EG - Zoology Impact factor: 4.259, year: 2016

  3. Probiotic activities of Rhizobium laguerreae on growth and quality of spinach

    Czech Academy of Sciences Publication Activity Database

    Jimenez-Gomez, A.; Flores-Felix, J.D.; García-Fraile, Paula; Mateos, P.F.; Menéndez, E.; Velazquez, E.; Rivas, R.

    2018-01-01

    Roč. 8, JAN 10 (2018), č. článku 295. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : ZEA-MAYS L. * PROMOTING RHIZOBACTERIA * MEDITERRANEAN DIET Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  4. Nitrate reducing activity pervades surface waters during upwelling.

    Digital Repository Service at National Institute of Oceanography (India)

    Fernandes, S.O.; Halarnekar, R.; Malik, A.; Vijayan, V.; Varik, S.; RituKumari; Jineesh V.K.; Gauns, M.U.; Nair, S.; LokaBharathi, P.A.

    .A., Roson, G., Perez, F.F., Figueiras, F.G., Pazos, Y., 1996. Nitrogen cycling in an estuarine upwelling system, the Ria de Arousa (NW Spain). Short-time-scale patterns of hydrodynamic and biogeochemical circulation. Mar. Ecol. Prog. Ser. 135, 259...

  5. 78 FR 31599 - Notice of Quarterly Report (January 2013-March 31, 2013)

    Science.gov (United States)

    2013-05-24

    ... and secondary pipelines (kilometers). Restructure and rehabilitate tertiary pipelines (kilometers...,259 Increase the $30,030,971 Screening for adoption of hypertension behaviors that (percent). reduce... implementation. Secondary National Roads $214,493,000 Reduce $27,440,528 Kilometers of road Development Project...

  6. Cyclin a down - regulation in TGFb1 - arrested follicular lymphoma cells

    Czech Academy of Sciences Publication Activity Database

    Djaborkhel, Rashed; Tvrdík, Daniel; Eckschlager, T.; Raška, Ivan; Müller, Julius

    2000-01-01

    Roč. 261, - (2000), s. 250-259 ISSN 0014-4827 R&D Projects: GA ČR GA304/00/1481 Institutional research plan: CEZ:AV0Z5039906 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.860, year: 2000

  7. Entanglement and nonclassicality in four-mode Gaussian states generated via parametric down-conversion and frequency up-conversion

    Czech Academy of Sciences Publication Activity Database

    Arkhipov, Ie.I.; Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.

    2016-01-01

    Roč. 6, Sep (2016), 1-12, č. článku 33802. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : four-mode Gaussian states * parametric down-conversion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  8. The Execution of the Miners of Kutná Hora at Poděbrady and in Křivoklát in 1496. On the Veneration of the Miners of Poděbrady in the Sixteenth Century

    Czech Academy of Sciences Publication Activity Database

    Šárovcová, Martina

    Suppl., č. 2 (2015), s. 259-278 ISSN 0015-1831 Institutional support: RVO:68378033 Keywords : music manuscripts * Utraquism * Bohemian Reformation * illuminated fragments * Jan Hus * Fabián Puléř * early modern illuminated manuscripts Subject RIV: AL - Art, Architecture, Cultural Heritage

  9. UV irradiation-induced methionine oxidation in human skin keratins: Mass spectrometry-based non-invasive proteomic analysis.

    Science.gov (United States)

    Lee, Seon Hwa; Matsushima, Keita; Miyamoto, Kohei; Oe, Tomoyuki

    2016-02-05

    Ultraviolet (UV) radiation is the major environmental factor that causes oxidative skin damage. Keratins are the main constituents of human skin and have been identified as oxidative target proteins. We have recently developed a mass spectrometry (MS)-based non-invasive proteomic methodology to screen oxidative modifications in human skin keratins. Using this methodology, UV effects on methionine (Met) oxidation in human skin keratins were investigated. The initial screening revealed that Met(259), Met(262), and Met(296) in K1 keratin were the most susceptible oxidation sites upon UVA (or UVB) irradiation of human tape-stripped skin. Subsequent liquid chromatography/electrospray ionization-MS and tandem MS analyses confirmed amino acid sequences and oxidation sites of tryptic peptides D(290)VDGAYMTK(298) (P1) and N(258)MQDMVEDYR(267) (P2). The relative oxidation levels of P1 and P2 increased in a time-dependent manner upon UVA irradiation. Butylated hydroxytoluene was the most effective antioxidant for artifactual oxidation of Met residues. The relative oxidation levels of P1 and P2 after UVA irradiation for 48 h corresponded to treatment with 100mM hydrogen peroxide for 15 min. In addition, Met(259) was oxidized by only UVA irradiation. The Met sites identified in conjunction with the current proteomic methodology can be used to evaluate skin damage under various conditions of oxidative stress. We demonstrated that the relative Met oxidation levels in keratins directly reflected UV-induced damages to human tape-stripped skin. Human skin proteins isolated by tape stripping were analyzed by MS-based non-invasive proteomic methodology. Met(259), Met(262), and Met(296) in K1 keratin were the most susceptible oxidation sites upon UV irradiation. Met(259) was oxidized by only UVA irradiation. Quantitative LC/ESI-SRM/MS analyses confirmed a time-dependent increase in the relative oxidation of target peptides (P1 and P2) containing these Met residues, upon UVA irradiation

  10. Better theory-of-mind skills in children hearing voices mitigate the risk of secondary delusion formation

    NARCIS (Netherlands)

    Bartels-Velthuis, A. A.; Blijd-Hoogewys, E. M. A.; van Os, J.

    Objective: To examine the social cognitive vulnerabilities mediating delusion formation in children presenting with hallucinatory experiences. Method: A sample of 259 12- and 13-year-old children, from a baseline case-control sample of children with and without auditory hallucinations (AH), were

  11. Escitalopram in the Treatment of Adolescent Depression: A Randomized Placebo-Controlled Multisite Trial

    Science.gov (United States)

    Emslie, Graham J.; Ventura, Daniel; Korotzer, Andrew; Tourkodimitris, Stavros

    2009-01-01

    A randomized, double-blind, placebo-controlled trial that involves 312 male and female patients aged 12-17 reveal the effectiveness of escitalopram in the treatment of depressed adolescents. Eighty-three percent of the participants or 259 participants completed the 8 weeks therapy period.

  12. Spindle Cell Metaplastic Breast Cancer: Case Report

    Directory of Open Access Journals (Sweden)

    Dursun Ozgur Karakas

    2013-08-01

    Conclusion: Spindle cell metaplastic breast cancer must be considered in differential diagnosis of breast cancers, and preoperative immunohistochemical examination, including cytokeratin and vimentin, must be added to pathological examination in intervening cases. [Arch Clin Exp Surg 2013; 2(4.000: 259-262

  13. Dynamics of the biotopes at the edge of a medieval town: pollen analysis of Vltava river sediments in Prague, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kozáková, Radka; Pokorný, Petr

    2007-01-01

    Roč. 79, - (2007), s. 259-281 ISSN 0032-7786 R&D Projects: GA AV ČR(CZ) IAAX00020701 Institutional research plan: CEZ:AV0Z80020508 Keywords : pollen analysis Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.064, year: 2007

  14. Gardening in the zone of death: an experimental assessment of the absolute elevation limit of vascular plants

    Czech Academy of Sciences Publication Activity Database

    Dvorský, Miroslav; Chlumská, Zuzana; Altman, Jan; Čapková, K.; Řeháková, Klára; Macek, Martin; Kopecký, Martin; Liancourt, Pierre; Doležal, Jiří

    2016-01-01

    Roč. 6, č. 24440 (2016), s. 1-10 ISSN 2045-2322 R&D Projects: GA ČR GA13-13368S Institutional support: RVO:67985939 Keywords : Tibetan Plateau * warming * elevational limit Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  15. Experimental study and thermodynamic modelling of the B-Fe-Mn ternary system

    Czech Academy of Sciences Publication Activity Database

    Repovský, P.; Homolová, V.; Čiripová, L.; Kroupa, Aleš; Zemanová, Adéla

    2016-01-01

    Roč. 55, DEC (2016), s. 252-259 ISSN 0364-5916 R&D Projects: GA ČR GA14-15576S Institutional support: RVO:68081723 Keywords : thermodynamic modelling * phase diagram * borides Subject RIV: BJ - Thermodynamic s Impact factor: 1.600, year: 2016

  16. Pillai, Prof. Valliyil Narayanan Rajasekharan

    Indian Academy of Sciences (India)

    Date of birth: 20 October 1949. Specialization: Bio-organic Chemistry, Synthetic Organic Chemistry & Macromolecular Science Address: Harishree, S-31, Medical College Road, Gandhinagar P.O., Kottayam 686 008, Kerala Contact: Residence: (0481) 259 7885. Mobile: 99958 24472. Email: rajasekharpillai@gmail.com, ...

  17. Structural changes in alginate-based microspheres exposed to in vivo environment as revealed by confocal Raman microscopy

    Czech Academy of Sciences Publication Activity Database

    Kroneková, Z.; Pelach, M.; Mazancová, P.; Uhelská, L.; Treľová, D.; Rázga, F.; Némethová, V.; Szalai, S.; Chorvát, D.; McGarrigle, J. J.; Omami, M.; Isa, D.; Ghani, S.; Majková, E.; Oberholzer, J.; Raus, Vladimír; Šiffalovič, P.; Lacík, I.

    2018-01-01

    Roč. 8, 26 January (2018), s. 1-12, č. článku 1637. ISSN 2045-2322 Institutional support: RVO:61389013 Keywords : confocal Raman microscopy * alginate * microcapsule Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016

  18. RGD delivery of truncated coagulase to tumor vasculature affords local thrombotic activity to induce infarction of tumors in mice

    Czech Academy of Sciences Publication Activity Database

    Jahanban-Esfahlan, R.; Seidi, K.; Monhemi, H.; Adli, A.D.F.; Minofar, Babak; Zare, P.; Farajzadeh, D.; Farajnia, S.; Behzadi, R.; Abbasi, M.M.; Zarghami, N.; Javaheri, T.

    2017-01-01

    Roč. 7, AUG 15 (2017), s. 1-14, č. článku 8126. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : TISSUE-FACTOR * FACTOR-VIIA * STAPHYLOCOAGULASE Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  19. Photoacoustic Sounds from Meteors

    Czech Academy of Sciences Publication Activity Database

    Spalding, R.; Tencer, J.; Sweatt, W.; Conley, B.; Hogan, R.; Boslough, M.B.; Gonzales, G.; Spurný, Pavel

    2017-01-01

    Roč. 7, February (2017), 41251/1-41251/6 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : photoacoustic coupling * experimental results * numerical models Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.259, year: 2016

  20. Success factors in new ventures : A meta-analysis

    NARCIS (Netherlands)

    Song, Michael; Podoynitsyna, Ksenia; van der Bijl, H.M.; Halman, Johannes I.M.

    2008-01-01

    Technology entrepreneurship is key to economic development. New technology ventures (NTVs) can have positive effects on employment and could rejuvenate industries with disruptive technologies. However, NTVs have a limited survival rate. In our most recent empirical study of 11,259 NTVs established

  1. Success factors in new ventures : a meta-analysis

    NARCIS (Netherlands)

    Song, Michael; Podoynitsyna, K.S.; Bij, van der J.D.; Halman, J.I.M.

    2008-01-01

    Technology entrepreneurship is key to economic development. New technology ventures (NTVs) can have positive effects on employment and could rejuvenate industries with disruptive technologies. However, NTVs have a limited survival rate. In our most recent empirical study of 11,259 NTVs established

  2. How do lay people assess the quality of physicians' communicative responses to patients' emotional cues and concerns? An international multicentre study based on videotaped medical consultations.

    NARCIS (Netherlands)

    Mazzi, M.A.; Bensing, J.; Rimondini, M.; Fletcher, I.; Vliet, L. van; Zimmermann, C.; Deveugele, M.

    2013-01-01

    Objective: To establish which kind of physician communicative responses to patient cues and concerns are appreciated by lay people. Methods: A balanced sample (259 people) was recruited in public places to participate in a full day observation of four videotaped standardized medical consultations.

  3. A Gateway((R)) -compatible bacterial adenylate cyclase-based two-hybrid system

    Czech Academy of Sciences Publication Activity Database

    Ouellette, S. P.; Gauliard, E.; Antošová, Zuzana; Ladant, D.

    2014-01-01

    Roč. 6, č. 3 (2014), s. 259-267 ISSN 1758-2229 Institutional support: RVO:67985823 Keywords : bacterial two-hybrid system * protein–protein interactions * cell division * Gateway((R))(GW) cloning system Subject RIV: EE - Microbiology, Virology Impact factor: 3.293, year: 2014

  4. In-situ prepared polyaniline-silver composites: single- and two-step strategies

    Czech Academy of Sciences Publication Activity Database

    Bober, Patrycja; Stejskal, Jaroslav; Trchová, Miroslava; Prokeš, J.

    2014-01-01

    Roč. 122, 10 March (2014), s. 259-266 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : composites * conducting polymer * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.504, year: 2014

  5. Intergenerational Solidarity and Support Between Adult Siblings

    NARCIS (Netherlands)

    Voorpostel, Marieke; Blieszner, Rosemary

    2008-01-01

    Using a Dutch national sample containing 1,259 triads (two siblings, one parent), we examined whether practical support and emotional support between siblings are enhanced by intergenerational solidarity and how this differs for brothers and sisters. Sibling support was affected by sibling dyad

  6. Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results From An O3-Gradient and a Face Experiment

    Science.gov (United States)

    D.F. Karnosky; B. Mankovska; K. Percy; R.E. Dickson; G.K. Podila; J. Sober; A. Noormets; G. Hendrey; Mark D. Coleman; M. Kubiske; K.S. Pregitzer; J.G. Isebrands

    1999-01-01

    Abstract. Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[(O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3...

  7. Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti

    Czech Academy of Sciences Publication Activity Database

    Ďurďovič, Martin

    2014-01-01

    Roč. 36, č. 3 (2014), s. 259-281 ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281

  8. African Zoology - Vol 24, No 4 (1989)

    African Journals Online (AJOL)

    Fine structure of endogenous stages of Eimeria turcicus developing in gall bladder epithelium of the gecko Hemidactylus turcicus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I Paperna, J.H. Landsberg, 251-259 ...

  9. EJOTMAS 23

    African Journals Online (AJOL)

    AUNTY TEE

    people as well as other peoples in Nigeria and the world over. These cultural ... This very popular global story connects us, the Benin people, to other parts of ..... for Local History, Cultural Heritage and Folk Studies, 6 (2), 259-. 279. Omoera ...

  10. Mathematical description of the nonlinear chemical reactions with ...

    Indian Academy of Sciences (India)

    more complex and different. In this paper, we ... for complex oscillations with an autocatalytic stage in .... A) with sodium hydroxide (used as a reagent X). 0. 10. 20. 30 ... Time [a.u.] ..... Decroly O and Goldbeter A 1984 Physics Letters 105A. 259.

  11. Early diagnosis and treatment of unilateral or asymmetrical hearing loss in childhood: 2017 CODEPEH recommendations

    Directory of Open Access Journals (Sweden)

    Faustino Núñez Batalla

    2018-06-01

    Full Text Available Núñez, F. et al. (2018: “Diagnóstico y tratamiento precoz de la hipoacusia unilateral o asimétrica en la infancia: recomendaciones CODEPEH 2017”. Revista Española de Discapacidad, 6 (I: 259-280.

  12. Iron(II) supramolecular helicates interfere with the HIV-1 Tat-TAR RNA interaction critical for viral replication

    Czech Academy of Sciences Publication Activity Database

    Malina, Jaroslav; Hannon, Michael J.; Brabec, Viktor

    2016-01-01

    Roč. 6, JUL2016 (2016) ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA16-03517S Institutional support: RVO:68081707 Keywords : DINUCLEAR RUTHENIUM(II) COMPLEX * METALLOSUPRAMOLECULAR CYLINDERS * BIOLOGICAL EVALUATION Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  13. Review of James L. Baughman, Jennifer Ratner-Rosenhagen, and James P. Danky, eds, Protest on the Page: Essays on Print and the Culture of Dissent since 1865 (2015

    Directory of Open Access Journals (Sweden)

    Maria Zirra

    2017-12-01

    Full Text Available James L. Baughman, Jennifer Ratner-Rosenhagen, and James P. Danky, eds, Protest on the Page: Essays on Print and the Culture of Dissent since 1865 (Madison: University of Wisconsin Press, 2015. xv + 259 pp. ISBN 978-0-299-30284-9.

  14. Use of indigenous knowledge in the management of field and ...

    African Journals Online (AJOL)

    EJIRO

    African Journal of Environmental Science and Technology Vol. 3 (9), pp. 251-259 .... that an acre can to produce between 3 and 72 bags ..... Leaves of Eucalyptus are taken, air dried and grinded, and the resulting powder is mixed with the ...

  15. Hypersaline sapropels act as hotspots for microbial dark matter

    Czech Academy of Sciences Publication Activity Database

    Andrei, Adrian-Stefan; Baricz, A.; Robeson, M. S.; Pauşan, M. R.; Tamaş, T.; Chiriac, C.; Szekeres, E.; Barbu-Tudoran, L.; Levei, E. A.; Coman, C.; Podar, M.; Banciu, H.L.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 6150. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : 16S RIBOSOMAL-RNA * HALOPHILIC ARCHAEA * lake-sediments Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  16. Additional observations on Philometra spp. (Nematoda: Philometridae) in marine fishes off Iraq, with the description of two new species

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2014-01-01

    Roč. 87, č. 3 (2014), s. 259-271 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : systematic status * India * Philometridae Subject RIV: EA - Cell Biology Impact factor: 1.336, year: 2014

  17. Studies on improved Agrobacterium-mediated transformation in two ...

    African Journals Online (AJOL)

    Administrator

    168-169. Saharan V,Yadav RC,Yadav NR, Chapagain BP (2004). High frequency plant regeneration from desiccated calli of indica rice. (Oryza sativa L.). Afr. J. Biotechnol. 3:256-259. Sivamani E, Huet H, Shen P, Ong C, Kochko A, Beachy RN ...

  18. Keywords

    African Journals Online (AJOL)

    Femi

    Only about half of surveyed men were found to use ... Influencing men's attitude towards the uptake of ... survey of 259 men aged 15-65 years with at least one child less than 3 years of age was conducted ... been fully explored in Nigeria.

  19. Salvage radiation therapy following radical prostatectomy. A national Danish study

    DEFF Research Database (Denmark)

    Ervandian, Maria; Høyer, Morten; Petersen, Stine Elleberg

    2015-01-01

    BACKGROUND: The purpose of this observational cohort study was to evaluate the outcome and prognostic factors following salvage radiotherapy (SRT) in a consecutive national cohort. MATERIAL AND METHODS: Between 2006 and 2010, 259 patients received SRT in Denmark. Patient- and cancer-related chara...

  20. Coding accuracy on the psychophysical scale

    Czech Academy of Sciences Publication Activity Database

    Košťál, Lubomír; Lánský, Petr

    2016-01-01

    Roč. 6, Mar 29 (2016), s. 23810 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-08066S Institutional support: RVO:67985823 Keywords : cortex * neural decoding * senzory processing Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016

  1. Electrochemical and Quantum Chemical Study of Reactivity of Orthophthalaldehyde with Aliphatic Primary Amines

    Czech Academy of Sciences Publication Activity Database

    Donkeng Dazie, Joel; Liška, Alan; Ludvík, Jiří

    2016-01-01

    Roč. 163, č. 9 (2016), G127-G132 ISSN 0013-4651 R&D Projects: GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : electrochemistry * quantum chemical study * amines Subject RIV: CG - Electrochemistry Impact factor: 3.259, year: 2016

  2. N-(Pivaloyloxy)alkoxy-carbonyl Prodrugs of the Glutamine Antagonist 6-Diazo-5-oxo-L-norleucine (DON) as a Potential Treatment for HIV Associated Neurocognitive Disorders

    Czech Academy of Sciences Publication Activity Database

    Nedelcovych, M. T.; Tenora, Lukáš; Kim, B. H.; Kelschenbach, J.; Chao, W.; Hadas, E.; Jančařík, Andrej; Prchalová, Eva; Zimmermann, S. C.; Dash, R. P.; Gadiano, A. J.; Garrett, C.; Furtmüller, G.; Oh, B.; Brandacher, G.; Alt, J.; Majer, Pavel; Volsky, D.J.; Rais, R.; Slusher, B. S.

    2017-01-01

    Roč. 60, č. 16 (2017), s. 7186-7198 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : long-term potentiation * magnetic resonance spectroscopy * virus type 1 encephalitis Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  3. Can deep seated gravitational slope deformations be activated by regional tectonic strain: First insights from displacement measurements in caves from the Eastern Alps

    Czech Academy of Sciences Publication Activity Database

    Baron, I.; Plan, L.; Grasemann, B.; Mitrovic, I.; Lenhardt, W.; Hausmann, H.; Stemberk, Josef

    2016-01-01

    Roč. 259, APR 15 (2016), 81-89 ISSN 0169-555X Grant - others:Austrian Science Fund(AT) P25884-N29 Institutional support: RVO:67985891 Keywords : tectonic strain * slope failure * earthquake Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.958, year: 2016

  4. Estructura y funcionamiento de un servicio de cirugía mayor ambulatoria y de corta hospitalización

    Directory of Open Access Journals (Sweden)

    Juan Carlos Domínguez Lanuza

    1999-04-01

    Full Text Available Se realizó estudio de la estructura y funcionamiento del Servicio de Cirugía Ambulatoria y de Corta Hospitalización del Hospital Clinicoquirúrgico Docente "Miguel Enríquez", desde su creación en abril de 1989 hasta diciembre de 1995, donde se analizaron el total de intervenciones mayores (12 259 por las diferentes especialidades quirúrgicas, así como el organigrama de trabajo, y se constató un bajo índice de complicaciones (4,7 %A study of the structure and functioning of the Service of Ambulatory Surgery and of Short Hospitalization of the "Miguel Enríquez" Clinical and Surgical Teaching Hospital since its creation in April, 1989, to December, 1995, was conducted. The total amount of major procedures (12 259 by different surgical specialities and the working flowchart were analyzed. A low index of complications (4.7 % was obtained

  5. Is sarcopenia a useful predictor of outcome in patients after emergency laparotomy? A study using the NELA database.

    Science.gov (United States)

    Trotter, John; Johnston, Judith; Ng, Alvin; Gatt, Marcel; MacFie, John; McNaught, Clare

    2018-05-01

    Introduction Studies have reported on the use of frailty as a prognostic indicator in patients undergoing elective surgery. Similar data do not exist for patients undergoing emergency surgery. The aim of this study was to evaluate the effect of preoperative sarcopenia measured by computed tomography (CT) on outcome following emergency laparotomy. Materials and methods Data from the National Emergency Laparotomy Audit database were retrieved for patients who had undergone an emergency laparotomy over 12 months at York NHS Foundation Trust. Sarcopenia was assessed by psoas density and area on preoperative CT. Mortality rates at 30 days and 1 year were recorded. Secondary outcomes included discharge rates to non-independent living. Results A total of 259 patients were included. Overall cohort 30-day and 1-year mortality was 13.9% (36/259) and 28.2% (73/259), respectively. Sarcopenia measured by psoas density was associated with increased mortality compared with patients who did not develop sarcopenia at 30 days (29.7%, 19/64, vs. 8.7%, 17/195; P sarcopenia measured by psoas area at 30 days (21.3%, 13/61, vs. 9.1%, 17/187; OR 2.71; 95%CI 1.23-5.96, P = 0.013) and at 1 year (42.6%, 26/61, vs. 20.9%, 39/187; OR 2.82; 95% CI 1.52-5.23, P Sarcopenia assessed by measurement of psoas density and area on CT is associated with increased mortality following emergency laparotomy. The use of sarcopenia as a predictive tool merits further attention and may be useful in patients undergoing emergency surgery.

  6. The application of surgical procedure manager (SPM): first experience with FESS.

    Science.gov (United States)

    Feige, Katharina; Gollnick, Iris; Schmitz, Pia; Strauss, Gero

    2017-09-01

    In our hypothesis, the newly developed program SPM (surgical procedure manager) will ensure successful standardization and efficiency of the FESS (functional endoscopic sinus surgery) and therefore make a decisive contribution in terms of economization and improvement of intraoperative quality. Between 27th March 2015 and 8th October 2015, data from 259 FESS procedures were collected using the SPM. The study took place at the surgical desk, an operating room in the ACQUA clinic in Leipzig, Germany. 233 FESS (90%) of the total FESS (n = 259, 100%) were conducted entirely with SPM. 26 SPM terminations (10%) of 259 FESS remain, which are classified as actual SPM terminations-when the surgeon intentionally stops the SPM. The maximum time slot decreased clearly from 1 h 39 min (period A) to 1 h 10 min (period B). A time reduction can also be seen with the minimum duration of 13.5 min compared to 11 min. The variability of the time slot also decreases since the standard deviation is reduced by 4.5 min. On the basis of available recordings it can be postulated that the application of SPM is suitable for standardization for FESS. Standardization by means of SPM and minimal development can be recognized over a period of time. The SPM makes it possible to transfer the general advantages of mechanization on a concrete FESS and do not influence the medical processes nor even restrict the medical freedom. The users are still entirely free in the implementation of the respective procedure.

  7. Vegetable and animal products as determinants of colon cancer risk in Dutch men and women

    NARCIS (Netherlands)

    Kampman, E.; Verhoeven, D.; Sloots, L.; Veer, P. van 't

    1995-01-01

    To examine the relationship between colon cancer and food groups from vegetable or animal sources and their possible interactions with gender, we analyzed data from a Dutch case-control study. Dietary patterns were assessed for 232 colon cancer cases and 259 population controls. In multivariate

  8. Operational test report for 2706-T complex liquid transfer system

    International Nuclear Information System (INIS)

    BENZEL, H.R.

    1999-01-01

    This document is the Operational Test Report (OTR). It enters the Record Copy of the W-259 Operational Test Procedure (HNF-3610) into the document retrieval system. Additionally, the OTR summarizes significant issues associated with testing the 2706-T waste liquid transfer and storage system

  9. 78 FR 25939 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-05-03

    ...) is predominate, or designate land on which HEL is predominated to be set aside, diverted, devoted to... erosion. Description of Respondents: Individuals or households; Business or other for-profit; Not-for-profit institutions; Federal Government; State, Local or Tribal Government. Number of Respondents: 259...

  10. A new formulation of Bacillus thuringiensis: UV protection and sustained release mosquito larvae studies

    Czech Academy of Sciences Publication Activity Database

    Zhang, L.; Zhang, X.; Zhang, Y.; Wu, S.; Gelbič, Ivan; Xu, L.; Guan, X.

    2016-01-01

    Roč. 6, DEC 22 (2016), č. článku 39425. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * pest control * UV protection Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep39425

  11. Determination of dissociation constants of cytokinins by capillary zone electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Barták, P.; Bednář, P.; Stránský, Z.; Boček, Petr; Vespalec, Radim

    2000-01-01

    Roč. 878, č. 2 (2000), s. 249-259 ISSN 0021-9673 R&D Projects: GA MŠk VS96021; GA AV ČR IAA4031703; GA ČR GA203/99/0044 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.551, year: 2000

  12. Chemical degradation of trimethyl phosphate as surrogate for organo-phosporus pesticides on nanostructured metal oxides

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Henych, Jiří; Matys Grygar, Tomáš; Pérez, Raul

    2015-01-01

    Roč. 61, JAN (2015), s. 259-269 ISSN 0025-5408 R&D Projects: GA ČR(CZ) GAP106/12/1116 Institutional support: RVO:61388980 Keywords : Nanostructured oxides * Stoichiometric degradation * Trimethyl phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015

  13. Genetic Variation in the Leptin Receptor Gene, Leptin, and Weight Gain in Young Dutch Adults

    NARCIS (Netherlands)

    Rossum, van C.T.M.; Hoebee, B.; Baak, van M.A.; Mars, M.; Saris, W.H.M.; Seidell, J.C.

    2003-01-01

    Objective: To investigate the association between leptin levels, polymorphisms in the leptin receptor (LEPR) gene, and weight gain. Research Methods and Procedures: From two large prospective cohorts in The Netherlands (n = 17, 500), we compared the baseline leptin of 259 subjects who had gained an

  14. Photosystem II electron transport rates and oxygen production in natural waterblooms of freshwater cyanobacteria during a diel cycle

    Czech Academy of Sciences Publication Activity Database

    Masojídek, Jiří; Grobbelaar, J. U.; Pechar, Libor; Koblížek, Michal

    2001-01-01

    Roč. 23, č. 1 (2001), s. 57-66 ISSN 0142-7873 R&D Projects: GA ČR GA206/96/1222 Institutional research plan: CEZ:AV0Z5020903 Keywords : electron transport * evolution Subject RIV: CE - Biochemistry Impact factor: 1.259, year: 2001

  15. Simultaneous effect of organic modifier and physicochemical parameters of barbiturates on their retention on a narrow-bore PGC column

    Czech Academy of Sciences Publication Activity Database

    Forgács, E.; Cserháti, T.; Mikšík, Ivan; Eckhardt, Adam; Deyl, Zdeněk

    2004-01-01

    Roč. 800, č. 1-2 (2004), s. 259-262 ISSN 1570-0232 Grant - others:CZ - HU(CZ) Cooperation programme Institutional research plan: CEZ:AV0Z5011922 Keywords : barbiturates * porous graphitized carbon Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.176, year: 2004

  16. A comprehensive study of soft magnetic materials based on FeSi spheres and polymeric resin modified by silica nanorods

    Czech Academy of Sciences Publication Activity Database

    Strečková, M.; Füzer, J.; Kobera, Libor; Brus, Jiří; Fáberová, M.; Bureš, R.; Kollár, P.; Lauda, M.; Medvecký, L.; Girman, V.; Hadraba, Hynek; Baťková, M.; Baťko, I.

    2014-01-01

    Roč. 147, č. 3 (2014), s. 649-660 ISSN 0254-0584 Institutional support: RVO:61389013 ; RVO:68081723 Keywords : composite materials * magnetic materials * chemical synthesis Subject RIV: CD - Macromolecular Chemistry; JH - Ceramics, Fire-Resistant Materials and Glass (UFM-A) Impact factor: 2.259, year: 2014

  17. Genomic study of the Ket: a Paleo-Eskimo-related ethnic group with significant ancient North Eurasian ancestry

    Czech Academy of Sciences Publication Activity Database

    Flegontov, P.; Changmai, P.; Zidkova, A.; Logacheva, M.D.; Altınışık, N. E.; Flegontova, Olga; Gelfand, M. S.; Gerasimov, E. S.; Khrameeva, E. E.; Konovalova, O. P.; Neretina, T.; Nikolsky, Y. V.; Starostin, G.; Stepanova, V. V.; Travinsky, I. V.; Tříska, M.; Tříska, P.; Tatarinova, T. V.

    2016-01-01

    Roč. 6, FEB 11 (2016), č. článku 20768. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : human populations * genetic variation * wide patterns * sequence * association * europeans * admixture * history * origin * tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  18. Collins and Sivers asymmetries in muonproduction of pions and kaons off transversely polarised protons

    Czech Academy of Sciences Publication Activity Database

    Adolph, C.; Akhunzyanov, R.; Alexeev, M.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlák, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O.; Donskov, S. V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, E.; Hinterberger, F.; Höppner, Ch.; Horikawa, N.; d´Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jarý, V.; Jasinski, P.; Jörg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu. A.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Krämer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pesaro, G.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlüter, T.; Schmidt, K.; Schmieden, H.; Schönning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Steiger, L.; Stolarski, M.; Šulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Roč. 744, MAY 11 (2015), s. 250-259 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : single spin asymmetries * scattering * distributions * ratio Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.787, year: 2015

  19. Increased core body temperature in astronauts during long-duration space missions

    Czech Academy of Sciences Publication Activity Database

    Stahn, A. C.; Werner, A.; Opatz, O.; Maggioni, M. A.; Steinach, M.; von Ahlefeld, V. W.; Moore, A.; Crucian, B. E.; Smith, S. M.; Zwart, S. R.; Schlabs, T.; Mendt, S.; Trippel, T.; Koralewski, E.; Koch, J.; Chouker, A.; Reitz, Guenther; Shang, P.; Rocker, L.; Kirsch, K. A.; Gunga, H-C.

    2017-01-01

    Roč. 7, č. 11 (2017), č. článku 16180. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : core body temperature * astonauts' CBT * spaceflights Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering Impact factor: 4.259, year: 2016

  20. A solution of David Galeďs lion and man problem

    Czech Academy of Sciences Publication Activity Database

    Sgall, Jiří

    2001-01-01

    Roč. 259, 1-2 (2001), s. 663-670 ISSN 0304-3975 R&D Projects: GA AV ČR IAA1019901; GA ČR GA201/97/P038 Keywords : combinatorial game theory Subject RIV: BA - General Mathematics Impact factor: 0.468, year: 2001

  1. Rural Principal Leadership Skill Proficiency and Student Achievement

    Science.gov (United States)

    Winn, Pam; Erwin, Sue; Gentry, Jim; Cauble, Mary

    2009-01-01

    Because of the importance of developing highly skilled rural school leaders, statewide assessments of 259 rural Texas public school administrators were analyzed to determine principal confidence levels in leadership skill domains identified by the National Policy Board of Educational Administration (NPBEA). Important findings indicate differences…

  2. Characterization and crystal structure of a 17-membered macrocyclic Schiff base compound MeO-sal-pn-bn

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Ghoran, S.H.; Rohlíček, Jan; Dušek, Michal

    2015-01-01

    Roč. 56, č. 2 (2015), s. 259-265 ISSN 0022-4766 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : macrocyclic * Schiff base * spectroscopy * powder diffraction * orthorhombic Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.536, year: 2015

  3. Comparative assessment of fungal augmentation treatments of a fine-textured and historically oil-contaminated soil

    Czech Academy of Sciences Publication Activity Database

    Covino, Stefano; Stella, Tatiana; D'Annibale, A.; Lladó, Salvador; Baldrian, Petr; Čvančarová, Monika; Cajthaml, Tomáš; Petruccioli, M.

    2016-01-01

    Roč. 566, OCT1 (2016), s. 250-259 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GA15-02328S Institutional support: RVO:61388971 Keywords : Oil-contaminated soil * Bioremediation * Contaminant bioavailability Subject RIV: EE - Microbiology, Virology Impact factor: 4.900, year: 2016

  4. Three-dimensional 10-ring zeolites: The activities in toluene alkylation and disproportionation

    Czech Academy of Sciences Publication Activity Database

    Kubů, Martin; Žilková, Naděžda; Zones, S. I.; Chen, C.-Y.; Al-Khattaf, S.; Čejka, Jiří

    2016-01-01

    Roč. 259, JAN 2016 (2016), s. 97-106 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : 10-ring zeolites * TUN * IMF Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.636, year: 2016

  5. An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials

    Czech Academy of Sciences Publication Activity Database

    Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.

    2017-01-01

    Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016

  6. Modus operandi onderzoek naar door informatie en communicatie technologie (ICT) gefaciliteerde criminaliteit

    NARCIS (Netherlands)

    Junger, Marianne; Montoya, L.; Hartel, Pieter H.; Karemaker, M.

    Dit onderzoek beschrijft de invloed van ICT op de 'traditionele' misdrijven door te onderzoeken hoe delicten als inbraak, overvallen en fraude doordrongen zijn van ICT. In totaal zijn 136 woninginbraken, 140 commerciële inbraken, 259 bedreigingen en 274 fraudeza-ken onderzocht. Uit de resultaten

  7. Arginine side chain interactions and the role of arginine as a gating charge carrier in voltage sensitive ion channels

    Czech Academy of Sciences Publication Activity Database

    Armstrong, C. T.; Mason, Philip E.; Anderson, J. L. R.; Dempsey, Ch. E.

    2016-01-01

    Roč. 6, Feb 22 (2016), č. článku 21759. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : K+ channel * potassium channels * sensing domain Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep21759

  8. Characterization of natural leaf senescence in tobacco (Nicotiana tabacum) plants grown in vitro

    Czech Academy of Sciences Publication Activity Database

    Uzelac, B.; Janošević, D.; Simonović, A.; Motyka, Václav; Dobrev, Petre; Budimir, S.

    2016-01-01

    Roč. 253, č. 2 (2016), s. 259-275 ISSN 0033-183X R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Leaf senescence * Mesophyll ultrastructure * Phytohormones Subject RIV: EF - Botanics Impact factor: 2.870, year: 2016

  9. 2015-2016 Travel and Hospitality Expense Reports for Joanne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Destination(s):. Delhi (India). Airfare: $11,659.58. Other. Transportation: $106.70. Accommodation: $2,913.67. Meals and. Incidentals: $847.77. Other: $259.25. Total: $15,786.97. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.

  10. Inhibition of nuclear factor kappaB proteins-platinated DNA interactions correlates with cytotoxic effectiveness of the platinum complexes

    Czech Academy of Sciences Publication Activity Database

    Brabec, Viktor; Kašpárková, Jana; Kostrhunová, Hana; Farrell, N.P.

    2016-01-01

    Roč. 6, AUG2016 (2016), č. článku 28474. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LH13096 Institutional support: RVO:68081707 Keywords : interstrand cross-links * group domain proteins Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  11. 78 FR 38304 - Applications for New Awards; Native Hawaiian Career and Technical Education Program (NHCTEP...

    Science.gov (United States)

    2013-06-26

    ... DEPARTMENT OF EDUCATION Applications for New Awards; Native Hawaiian Career and Technical Education Program (NHCTEP); Correction Catalog of Federal Domestic Assistance (CFDA), Number: 84.259A... Register and the Code of Federal Regulations is available via the Federal Digital System at: www.gpo.gov...

  12. SALO, a novel classical pathway complement inhibitor from saliva of the sand fly Lutzomyia longipalpis

    Czech Academy of Sciences Publication Activity Database

    Ferreira, V.P.; Vale, V.F.; Pangburn, M.K.; Abdeladhim, M.; Mendes-Sousa, A.F.; Coutinho-Abreu, I.V.; Rasouli, M.; Brandt, E.A.; Meneses, C.; Lima, K.F.; Araújo, R.N.; Pereira, M.H.; Kotsyfakis, Michalis; Oliveira, F.; Kamhawi, S.; Ribeiro, J.M.C.; Gontijo, N.F.; Collin, N.; Valenzuela, J. G.

    2016-01-01

    Roč. 6, JAN 13 (2016), č. článku 19300. ISSN 2045-2322 R&D Projects: GA ČR GAP502/12/2409 Institutional support: RVO:60077344 Keywords : leishmania * immunity * glands Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  13. PTPRD (protein tyrosine phosphatase receptor type delta) is associated with restless legs syndrome

    Czech Academy of Sciences Publication Activity Database

    Schormair, B.; Kemlink, D.; Roeske, D.; Eckstein, G.; Xiong, L.; Lichtner, P.; Ripke, S.; Trenkwalder, C.; Zimprich, A.; Stiasny-Kolster, K.; Oertel, W.; Bachmann, C. G.; Paulus, W.; Högl, B.; Frauscher, B.; Gschliesser, V.; Poewe, W.; Peglau, I.; Vodička, Pavel; Vávrová, J.; Šonka, K.; Nevšímalová, S.; Montplaisir, J.; Turecki, G.; Rouleau, G.; Gieger, Ch.; Illig, T.; Wichmann, H.E.; Holsboer, F.; Müller-Myhsok, B.; Meitinger, T.; Winkelmann, J.

    2008-01-01

    Roč. 40, č. 8 (2008), s. 946-948 ISSN 1061-4036 R&D Projects: GA MZd NR8563 Institutional research plan: CEZ:AV0Z50390703 Keywords : PTPRD * syndrom restless legs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008

  14. Enhanced functional and structural domain assignments using

    Indian Academy of Sciences (India)

    Unknown

    using remote similarity detection procedures for proteins encoded in the genome of Mycobacterium tuberculosis H37Rv” (J. Biosci. 29 (3) 245–. 259, 2004) by Seema Namboori, Natasha Mhatre, Sentivel Sujatha,. Narayanaswamy Srinivasan and Shashi Bhushan Pandit. The three-dimensional structure and subcellular ...

  15. Prevalence of intestinal parasites among school children in a rural ...

    African Journals Online (AJOL)

    Prevalence of intestinal parasites among school children in a rural area close to the southeast of Lake Langano, Ethiopia. ... Ethiopian Journal of Health Development ... Methods: In April 2003, fresh stool samples were collected from 259 students enrolled in two primary schools located in southeast of Lake Langano.

  16. Production of human papillomavirus type16 E7 oncoprotein fused with ß-glucuronidase in transgenic tomato and potato

    Czech Academy of Sciences Publication Activity Database

    Bříza, Jindřich; Pavingerová, Daniela; Vlasák, Josef; Ludvíková, V.; Niedermeierová, Hana

    2007-01-01

    Roč. 51, č. 2 (2007), s. 268-276 ISSN 0006-3134 R&D Projects: GA ČR GA521/05/2092 Institutional research plan: CEZ:AV0Z50510513 Keywords : transgenic plants * human papillomavirus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.259, year: 2007

  17. The Hardy inequality with boundary or intermediate conditions

    Czech Academy of Sciences Publication Activity Database

    Kufner, Alois

    2017-01-01

    Roč. 8, č. 2 (2017), s. 105-109 ISSN 2077-9879 Institutional support: RVO:67985840 Keywords : Hardy's inequality * boundary conditions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics http://www.mathnet.ru/ php /archive.phtml?wshow=paper&jrnid=emj&paperid=259&option_lang=eng

  18. Book Review Ngozi Ezenwa-Ohaeto* http://dx.doi.org/10.4314/og ...

    African Journals Online (AJOL)

    Dean SPGS NAU

    When Dr. Paul Ifeanyi called me on phone, informing me about this book and requesting that ... indiscipline, brazen embezzlement of public funds by people in authority ... money laundering” (Ifeanyi, 259). OJY just .... devastating effects of societal lawlessness, of insecurity, of materialism ... accountable investment. It makes ...

  19. Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..

    Czech Academy of Sciences Publication Activity Database

    Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.

    259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999

  20. Parenting and Family Stress as Mediators of the Long-Term Effects of Child Abuse.

    Science.gov (United States)

    Wind, Tiffany Weissmann; Silvern, Louise

    1994-01-01

    Data on child physical/sexual abuse, family stress histories, perceived parental warmth, and current psychological functioning were gathered from 259 working women. Multiple regression analyses showed that parental warmth strongly influenced or mediated the relationship of intrafamilial child abuse to depression and self-esteem levels. However,…

  1. T Plant secondary containment and leak detection upgrades

    International Nuclear Information System (INIS)

    Carlson, T.A.

    1995-01-01

    The W-259 project will provide upgrades to the 2706-T/TA Facility to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. The project provides decontamination activities supporting the environmental restoration mission and waste management operations on the Hanford Site

  2. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  3. The molecular structure effects in hydrogenation of cycloalkylsubstituted alkynes and alkenes on platinum and palladium catalysts

    Czech Academy of Sciences Publication Activity Database

    Kačer, P.; Kuzma, Marek; Červený, L.

    2004-01-01

    Roč. 259, - (2004), s. 179-183 ISSN 0926-860X R&D Projects: GA ČR GA104/00/1009 Institutional research plan: CEZ:AV0Z5020903 Keywords : adsorptivity * competitive hydrogenation * substituent effects Subject RIV: EE - Microbiology, Virology Impact factor: 2.378, year: 2004

  4. Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?

    Czech Academy of Sciences Publication Activity Database

    Linek, Lukáš; Pecháček, Š.

    2007-01-01

    Roč. 23, č. 2 (2007), s. 259-275 ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences

  5. Myogenic nature of insect heartbeat and intestinal peristalsis, revealed by neuromuscular paralysis caused by the sting of a braconid wasp

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel; Lukáš, J.

    2011-01-01

    Roč. 57, č. 2 (2011), s. 251-259 ISSN 0022-1910 Grant - others:MZe ČR(CZ) 002 700 604 Institutional research plan: CEZ:AV0Z50070508 Keywords : autonomic heartbeat * myogenic heartbeat * anterograde heartbeat Subject RIV: ED - Physiology Impact factor: 2.236, year: 2011

  6. 77 FR 30514 - Native Hawaiian Career and Technical Education Program; Final Waiver and Extension of Project Period

    Science.gov (United States)

    2012-05-23

    ... DEPARTMENT OF EDUCATION Native Hawaiian Career and Technical Education Program; Final Waiver and... Career and Technical Education Program Catalog of Federal Domestic Assistance (CFDA) Number: 84.259A... Technical Education Program (NHCTEP), the Secretary hereby waives 34 CFR 75.261(c)(2) in order to extend the...

  7. Productivity convergence across industries and countries : The importance of theory-based measurement

    NARCIS (Netherlands)

    Inklaar, R.; Timmer, M.P.

    Cross-country studies of economic growth have been hampered by the scarcity of reliable data on productivity at the industry level; see Bernard and Jones [American Economic Review, 91 (4) (2001) 1168-1169] and Rogerson [Journal of Political Economy, 116 (2) (2008), 235-259]. We bring together

  8. Blood lactate levels as a biomarker for angling-induced stress in ...

    African Journals Online (AJOL)

    These data suggest that longer angling time significantly increases physiological stress, which may have an impact on breading success and mortality in tigerfish. Keywords: catch-and-release angling; fish; physiology; recreational fisheries management; stress. African Journal of Aquatic Science 2009, 34(3): 255–259 ...

  9. Skill/Knowledge Commonalities in Selected Electronics Specialties.

    Science.gov (United States)

    1986-10-01

    Maintenance Specialist 241 19 30750 Telecomunications Systems Control Specialist 498 35 30950A Missile Det and Warning Radar Specialistc 18 30 309506... Telecomunications Systems Control Specialist 59 ( 5) 125 (10) 259 (21) :. aNumbers in parenthesis are percentage of total possible (1,257). bBased on principles

  10. Regional coherency of boreal forest growth defines Arctic driftwood provenancing

    Czech Academy of Sciences Publication Activity Database

    Hellmann, L.; Agafonov, L.; Churakova (Sidorova), O.; Düthorn, E.; Eggertsson, O.; Esper, J.; Kirdyanov, A. V.; Knorre, A. A.; Moiseev, P.; Myglan, V. S.; Nikolaev, A. N.; Reinig, F.; Schweingruber, F.; Solomina, O.; Tegel, W.; Büntgen, Ulf

    2016-01-01

    Roč. 39, sep (2016), s. 3-9 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : mackenzie river driftwood * tree-ring data * central siberia * origin * archipelago * holocene * ocean * sea * ice * circulation * Driftwood * Arctic * Dendro-provenancing * Boreal Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016

  11. Millennial cycles of mean sea level excited by earth´s orbital variations

    Czech Academy of Sciences Publication Activity Database

    Chapanov, Y.; Ron, Cyril; Vondrák, Jan

    2015-01-01

    Roč. 12, č. 3 (2015), s. 259-266 ISSN 1214-9705 R&D Projects: GA ČR GA13-15943S Institutional support: RVO:67985815 Keywords : millenial cycles * mean sea level * Earth's insolation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.561, year: 2015

  12. Outcomes of repeated exposure of the carp (Cyprinus carpio L.) to cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Krejčí, R.; Štěrba, F.; Tichý, F.; Kubala, Lukáš; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, č. 2 (2004), s. 259-265 ISSN 0001-7213 R&D Projects: GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z5004920 Keywords : erythrocytes * leukocytes * plasma enzymes Subject RIV: BO - Biophysics Impact factor: 0.449, year: 2004

  13. Differential effects of v-Jun and c-Jun proteins on v-myb-transformed monoblasts

    Czech Academy of Sciences Publication Activity Database

    Ševčíková, S.; Souček, Karel; Kubala, Lukáš; Bryja, Vítězslav; Šmarda, J.

    2002-01-01

    Roč. 59, č. 10 (2002), s. 1690-1705 ISSN 1420-682X R&D Projects: GA ČR GA301/01/0040 Institutional research plan: CEZ:AV0Z5004920 Keywords : v-myb * Jun * differentiation Subject RIV: BO - Biophysics Impact factor: 5.259, year: 2002

  14. Glacial refugia and the prediction of future habitat coverage of the South American lichen species Ochrolechia austroamericana

    Czech Academy of Sciences Publication Activity Database

    Kukwa, M.; Kolanowska, Marta

    2016-01-01

    Roč. 6, dec (2016), č. článku 38779. ISSN 2045-2322 R&D Projects: GA ČR GB14-36098G Institutional support: RVO:67179843 Keywords : glacial refugia * prediction of future * Ochrolechia austroamericana Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  15. The lateral distance between a proton pump and ATP synthase determines the ATP-synthesis rate

    Czech Academy of Sciences Publication Activity Database

    Sjöholm, C.; Bergstrand, J.; Nilsson, T.; Šachl, Radek; von Ballmoos, Ch.; Widengren, J.; Brzezinski, P.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 2926. ISSN 2045-2322 Institutional support: RVO:61388955 Keywords : biological energy -conversion * cytochrome-c-oxidase * membrane-surface * rhodobacter-sphaeroides Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  16. Aromatic and proteomic analyses corroborate the distinction between Mediterranean landraces and modern varieties of durum wheat

    Czech Academy of Sciences Publication Activity Database

    Federico, V.; Pompeiano, Antonio; Gu, Z.; Lo Presti, E.; Whitney, L.; Monti, M.; Di Miceli, G.; Giambalvo, D.; Ruisi, P.; Guglielminetti, L.; Mancuso, S.

    2016-01-01

    Roč. 6, oct (2016), č. článku 34619. ISSN 2045-2322 Institutional support: RVO:67179843 Keywords : PTR-TOF-MS * volatile compounds * gluten strength * rapid characterization * protein-composition * extrusion-cooking * quality * cultivars * flour * subunits Subject RIV: GC - Agronomy Impact factor: 4.259, year: 2016

  17. Buckling of plate strip subjected to localized corrosion a stochastic model

    Czech Academy of Sciences Publication Activity Database

    Sadovský, Z.; Drdácký, Miloš

    2001-01-01

    Roč. 39, č. 3 (2001), s. 247-259 ISSN 0263-8231 R&D Projects: GA ČR GA103/97/S051 Grant - others:GA SR(SK) GA2/5102/20 Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.429, year: 2001

  18. FMNH2-dependent monooxygenases initiate catabolism of sulfonamides in Microbacterium sp strain BR1 subsisting on sulfonamide antibiotics

    Czech Academy of Sciences Publication Activity Database

    Ricken, B.; Kolvenbach, B.A.; Bergesch, C.; Benndorf, D.; Kroll, K.; Strnad, Hynek; Vlček, Čestmír; Adaixo, R.; Hammes, F.; Shahgaldian, P.; Schaeffer, A.; Kohler, H.P.E.; Corvini, P.F.X.

    2017-01-01

    Roč. 7, podzim (2017), č. článku 15783. ISSN 2045-2322 Institutional support: RVO:68378050 Keywords : resistance mechanism * clinical specimens * sulfamethoxazole * bacteria * degradation * benzylpenicillin * biodegradation * genes * sulfadiazine * arthrobacter Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  19. How a high-gradient magnetic field could affect cell life

    Czech Academy of Sciences Publication Activity Database

    Zablotskyy, Vitaliy A.; Polyakova, Tetyana; Lunov, Oleg; Dejneka, Alexandr

    2016-01-01

    Roč. 6, Nov (2016), 1-12, č. článku 37407. ISSN 2045-2322 Grant - others:AV ČR(CZ) Fellowship J. E. Purkyně Institutional support: RVO:68378271 Keywords : high-gradient magnetic field * cell Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  20. New methodology for a person identification system

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 31; Issue 3. New methodology for a person identification system. R Bremananth A Chitra. Volume 31 Issue 3 June 2006 pp 259-276 ... Experimental results illustrate that the proposed method has been easily espoused in elections, bank transactions and other security applications.

  1. Untitled

    African Journals Online (AJOL)

    presence of NaOEt led to d-diketones (1) in good yields compared to the ... (8) which further undergoes a Michael addition with a second molecule of acetophenone. .... 27. 12. - 1691, 1679. 其过. | ca81. | 259. 174L 165. | le,. NO.,. NO. 35. - f . F.

  2. Cystathionine .gamma.-lyase: Clinical, metabolic, genetic, and structural studies

    Czech Academy of Sciences Publication Activity Database

    Kraus, J. P.; Hašek, Jindřich; Kožich, V.; Collard, R.; Venezia, S.; Janošíková, B.; Wang, J.; Stabler, S. P.; Allen, R. H.; Jakobs, C.; Finn, C. T.; Chien, Y. H.; Hwu, W. L.; Hegele, R. A.; Mudd, S. H.

    2009-01-01

    Roč. 97, č. 4 (2009), s. 250-259 ISSN 1096-7192 R&D Projects: GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : cystathionine gamma-lyase * cystathioninuria * hypercystathioninemia Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.897, year: 2009

  3. Recent advances in the diagnosis of Cushing’s syndrome in dogs

    NARCIS (Netherlands)

    Kooistra, H.S.; Galac, S.

    2010-01-01

    Vet Clin North Am Small Anim Pract. 2010 Mar;40(2):259-67. Recent advances in the diagnosis of Cushing's syndrome in dogs. Kooistra HS, Galac S. Department of Clinical Sciences of Companion Animals, Faculty of Veterinary Medicine, Utrecht University, Yalelaan 108, 3584 CM Utrecht, The Netherlands.

  4. On the linear problem arising from motion of a fluid around a moving rigid body

    Czech Academy of Sciences Publication Activity Database

    Nečasová, Šárka; Wolf, J.

    2015-01-01

    Roč. 140, č. 2 (2015), s. 241-259 ISSN 0862-7959 R&D Projects: GA ČR(CZ) GAP201/11/1304 Institutional support: RVO:67985840 Keywords : incompressible fluid * rotating rigid body * strong solution Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144329

  5. The N-terminal domain plays a crucial role in the structure of a full-length human mitochondrial Lon protease

    Czech Academy of Sciences Publication Activity Database

    Kereiche, S.; Kováčik, L.; Bednár, J.; Pevala, V.; Kunová, N.; Ondrovičová, G.; Bauer, J.; Ambro, L.; Bellová, J.; Kutejová, Eva; Raška, I.

    2016-01-01

    Roč. 6, SEP 16 (2016), s. 33631 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : ESCHERICHIA-COLI LON * SUBSTRATE TRANSLOCATION * PROTEOLYTIC MACHINE Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  6. Synthesis of the silky sifaka's distribution (Propithecus candidus )

    African Journals Online (AJOL)

    SR) in 2015 are also extremely low at 1.9 individuals. (indiv.)/km² (north-east near Ambodisatrana) and 0.29 indiv./km². (central-east near Camp Indri), though higher in the western ex- tension at 2.59 indiv./km² (south-west near Ampoanaomby).

  7. Silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine - characterization of this primary explosive

    Czech Academy of Sciences Publication Activity Database

    Musil, T.; Matyáš, R.; Vala, R.; Růžička, A.; Vlček, Milan

    2014-01-01

    Roč. 39, č. 2 (2014), s. 251-259 ISSN 0721-3115 Institutional support: RVO:61389013 Keywords : primary explosive * AgDANT * silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine Subject RIV: CC - Organic Chemistry Impact factor: 1.604, year: 2014

  8. Pseudotrichonympha leei, Pseudotrichonympha lifesoni, and Pseudotrichonympha pearti, new species of parabasalian flagellates and the description of a rotating subcellular structure

    Czech Academy of Sciences Publication Activity Database

    del Campo, J.; James, E. R.; Hirakawa, Y.; Fiorito, R.; Kolísko, Martin; Irwin, N. A.T.; Mathur, V.; Boscaro, V.; Hehenberger, E.; Karnkowska, A.; Scheffrahn, R. H.; Keeling, P. J.

    2017-01-01

    Roč. 7, NOV 27 (2017), č. článku 16349. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : lower termites * phylogeny * symbiosis * protozoa * primers * tool Subject RIV: EB - Gene tics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  9. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Anurag Kumar Mishra. Articles written in Journal of Biosciences. Volume 27 Issue 3 June 2002 pp 251-259 Articles. Cloning and sequencing of complete -crystallin cDNA from embryonic lens of Crocodylus palustris · Raman Agrawal Reena Chandrashekhar Anurag Kumar Mishra ...

  10. On the hydrogen neutral outflowing disks of B[e] supergiants

    Czech Academy of Sciences Publication Activity Database

    Kraus, Michaela; Borges Fernandes, M.; de Araújo, F. X.

    2007-01-01

    Roč. 463, č. 2 (2007), s. 627-634 ISSN 0004-6361 R&D Projects: GA ČR GA205/04/1267 Institutional research plan: CEZ:AV0Z10030501 Keywords : supergiants * winds * outflows Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  11. Combined astrometric catalogue EOC-3 An improved reference frame for long-term Earth rotation studies

    Czech Academy of Sciences Publication Activity Database

    Vondrák, Jan; Štefka, Vojtěch

    2007-01-01

    Roč. 463, č. 2 (2007), s. 783-788 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC506 Institutional research plan: CEZ:AV0Z10030501 Keywords : reference systems * astrometry * catalogs Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  12. Forensic Index and Substance Abuse among Psychiatric Patients ...

    African Journals Online (AJOL)

    Although forensic index and substance use are crucial issues in clinical work among mentally ill patients, studies emanating from psychiatric facilities in nonwestern cultures have been relatively scarce. This paper examines this issue in a tertiary health institution. Participants were 259 mentally ill patients (124 inpatients ...

  13. The co-evolutionary relationship between bitterling fishes and freshwater mussels: insights from interspecific comparisons

    Czech Academy of Sciences Publication Activity Database

    Reichard, Martin; Liu, H.; Smith, C.

    2007-01-01

    Roč. 9, č. 2 (2007), s. 239-259 ISSN 1522-0613 Grant - others:NSFC(CN) 30470237 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * co-evolution * egg ejection * host-parasite relationship * mutualism * oviposition Subject RIV: EG - Zoology Impact factor: 1.409, year: 2007

  14. Circulating nucleic acids as a new diagnostic tool

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Markéta; Plzák, J.; Strnad, Hynek; Betka, J.

    2010-01-01

    Roč. 15, č. 2 (2010), s. 242-259 ISSN 1425-8153 R&D Projects: GA MŠk 2B06106 Institutional research plan: CEZ:AV0Z50520514 Keywords : circulating nucleic acids * diagnostics * cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.455, year: 2010

  15. Priority choice experimental two-qubit tomography: measuring one by one all elements of density matrices

    Czech Academy of Sciences Publication Activity Database

    Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.

    2016-01-01

    Roč. 6, Jan (2016), 1-7, č. článku 19610. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : entangled photons * state tomography Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  16. The relationship between generic and diabetes specific psychological factors and glycaemic control in adults with type 1 diabetes

    DEFF Research Database (Denmark)

    Shaban, C.; Fosbury, J. A.; Cavan, D. A.

    2009-01-01

    259 adults with type 1 diabetes completed measure of anxiety, depression and diabetes specific distress, HbA1c from medical records. Anxiety not depression predicted HbA1c, this association was mediated by illness specific cognitions. Targeting illness specific cognitions may be more productive...

  17. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2Department of Health Management and Economics, School of Public Health, Tehran University of Medical Sciences, ... Algeria, Brazil, Colombia, Iran, and Syria. (5). ..... Statistics Center of Iran. 2013: 259- 60. [Persian]. 24. Reithinger R. Leishmaniases' burden of disease: ways forward for getting from speculation to reality.

  18. Genome-wide association analysis of symbiotic nitrogen fixation in common bean

    Science.gov (United States)

    A genome-wide association study (GWAS) was conducted to explore the genetic basis of variation for symbiotic nitrogen fixation (SNF) and related traits in the Andean diversity panel (ADP) comprised of 259 common bean (Phaseolus vulgaris) genotypes. The ADP was evaluated for SNF and related traits in...

  19. Phase morphology of PP/COC blends

    Czech Academy of Sciences Publication Activity Database

    Šlouf, Miroslav; Kolařík, Jan; Fambri, L.

    2003-01-01

    Roč. 91, č. 1 (2003), s. 253-259 ISSN 0021-8995 R&D Projects: GA ČR GP106/02/P029 Institutional research plan: CEZ:AV0Z4050913 Keywords : polypropylene * norbornene * polyolefin Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.017, year: 2003

  20. Genotype dependent callus induction and shoot regeneration in ...

    African Journals Online (AJOL)

    This study aims to observe the effect of genotype, hormone and culture conditions on sunflower (Helianthus annuus L.) callus induction and indirect plant regeneration. Calli were obtained from hypocotyl and cotyledon explants of five different sunflower genotypes; Trakya 80, Trakya 129, Trakya 259, Trakya 2098 and ...

  1. Functional groups of fossil marattialeans: chemotaxonomic implications for Pennsylvanian tree ferns and pteridophylls

    Czech Academy of Sciences Publication Activity Database

    Pšenička, J.; Zodrow, E. L.; Mastalerz, M.; Bek, Jiří

    2005-01-01

    Roč. 61, 3-4 (2005), s. 259-280 ISSN 0166-5162 R&D Projects: GA AV ČR(CZ) IAA3013902 Institutional research plan: CEZ:AV0Z30130516 Keywords : interdisciplinary approach * functional groups * FTIR Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.397, year: 2005

  2. Impact of Executive Function Deficits and Attention-Deficit/Hyperactivity Disorder (ADHD) on Academic Outcomes in Children

    Science.gov (United States)

    Biederman, Joseph; Monuteaux, Michael C.; Doyle, Alysa E.; Seidman, Larry J.; Wilens, Timothy E.; Ferrero, Frances; Morgan, Christie L.; Faraone, Stephen V.

    2004-01-01

    The association between executive function deficits (EFDs) and functional outcomes were examined among children and adolescents with attention-deficit/hyperactivity disorder (ADHD). Participants were children and adolescents with (n = 259) and without (n = 222) ADHD, as ascertained from pediatric and psychiatric clinics. The authors defined EFD as…

  3. The Hardy inequality with boundary or intermediate conditions

    Czech Academy of Sciences Publication Activity Database

    Kufner, Alois

    2017-01-01

    Roč. 8, č. 2 (2017), s. 105-109 ISSN 2077-9879 Institutional support: RVO:67985840 Keywords : Hardy's inequality * boundary conditions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics http://www.mathnet.ru/php/archive.phtml?wshow=paper&jrnid=emj&paperid=259&option_lang=eng

  4. Climatic and environmental aspects of the Mongol withdrawal from Hungary in 1242 CE

    Czech Academy of Sciences Publication Activity Database

    Büntgen, Ulf; Di Cosmo, N.

    2016-01-01

    Roč. 6, MAY (2016), č. článku 25606. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : Central Europe * ice age * variability * Carpathians * plain Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  5. Prostaglandin E2 EP2 and EP4 receptor activation mediates cAMP-dependent hyperpolarization and exocytosis of renin in juxtaglomerular cells

    DEFF Research Database (Denmark)

    Friis, Ulla Glenert; Stubbe, Jane; Uhrenholt, Torben Rene

    2005-01-01

    /l), AE1-259-01 (1 nmol/l), EP4-selective agonist AE1-329 (1 nmol/l), and IP agonist iloprost (1 micromol/l) significantly increased C(m) mediated by PKA. The EP4 antagonist AE3-208 (10 nmol/l) blocked the effect of EP4 agonist but did not alter the response to PGE(2). Application of both EP4 antagonist....... The membrane potential hyperpolarized significantly after PGE(2), butaprost, AE1-329 and AE1-259 and outward current was augmented in a PKA-dependent fashion. PGE(2)-stimulated outward current, but not C(m) change, was abolished by the BK(Ca) channel inhibitor iberiotoxin (300 nmol/l). EP2 and EP4 m......RNA was detected in sampled JG cells, and the preglomerular and glomerular vasculature was immunopositive for EP4. Thus IP, EP2, and EP4 receptors are associated with JG cells, and their activation leads to rapid PKA-mediated exocytotic fusion and release of renin granules....

  6. Estimating the number of unvaccinated Chinese workers against yellow fever in Angola.

    Science.gov (United States)

    Wilder-Smith, A; Massad, E

    2018-04-17

    A yellow fever epidemic occurred in Angola in 2016 with 884 laboratory confirmed cases and 373 deaths. Eleven unvaccinated Chinese nationals working in Angola were also infected and imported the disease to China, thereby presenting the first importation of yellow fever into Asia. In Angola, there are about 259,000 Chinese foreign workers. The fact that 11 unvaccinated Chinese workers acquired yellow fever suggests that many more Chinese workers in Angola were not vaccinated. We applied a previously developed model to back-calculate the number of unvaccinated Chinese workers in Angola in order to determine the extent of lack of vaccine coverage. Our models suggest that none of the 259,000 Chinese had been vaccinated, although yellow fever vaccination is mandated by the International Health Regulations. Governments around the world including China need to ensure that their citizens obtain YF vaccination when traveling to countries where such vaccines are required in order to prevent the international spread of yellow fever.

  7. Variants of glycoside hydrolases

    Science.gov (United States)

    Teter, Sarah [Davis, CA; Ward, Connie [Hamilton, MT; Cherry, Joel [Davis, CA; Jones, Aubrey [Davis, CA; Harris, Paul [Carnation, WA; Yi, Jung [Sacramento, CA

    2011-04-26

    The present invention relates to variants of a parent glycoside hydrolase, comprising a substitution at one or more positions corresponding to positions 21, 94, 157, 205, 206, 247, 337, 350, 373, 383, 438, 455, 467, and 486 of amino acids 1 to 513 of SEQ ID NO: 2, and optionally further comprising a substitution at one or more positions corresponding to positions 8, 22, 41, 49, 57, 113, 193, 196, 226, 227, 246, 251, 255, 259, 301, 356, 371, 411, and 462 of amino acids 1 to 513 of SEQ ID NO: 2 a substitution at one or more positions corresponding to positions 8, 22, 41, 49, 57, 113, 193, 196, 226, 227, 246, 251, 255, 259, 301, 356, 371, 411, and 462 of amino acids 1 to 513 of SEQ ID NO: 2, wherein the variants have glycoside hydrolase activity. The present invention also relates to nucleotide sequences encoding the variant glycoside hydrolases and to nucleic acid constructs, vectors, and host cells comprising the nucleotide sequences.

  8. Steric Hindrance as a Basis for Structure-Based Design of Selective Inhibitors of Protein-Tyrosine Phosphatases

    DEFF Research Database (Denmark)

    Iversen, L. F.; Andersen, H. S.; Møller, K. B.

    2001-01-01

    Utilizing structure-based design, we have previously demonstrated that it is possible to obtain selective inhibitors of protein-tyrosine phosphatase 1B (PTP1B). A basic nitrogen was introduced into a general PTP inhibitor to form a salt bridge to Asp48 in PTP1B and simultaneously cause repulsion...... in PTPs containing an asparagine in the equivalent position [Iversen, L. F., et al. (2000) J. Biol. Chem. 275, 10300−10307]. Further, we have recently demonstrated that Gly259 in PTP1B forms the bottom of a gateway that allows easy access to the active site for a broad range of substrates, while bulky...... in accessibility to the active site among various PTPs. We show that a general, low-molecular weight PTP inhibitor can be developed into a highly selective inhibitor for PTP1B and TC-PTP by introducing a substituent, which is designed to address the region around residues 258 and 259. Detailed enzyme kinetic...

  9. Angel or Devil? Dentists and Dental Students Conceptions of Pediatric Dental Patients through Metaphor Analysis.

    Science.gov (United States)

    Buldur, B

    The aim of this qualitative study was to identify the conceptions of dentists and dental students (DSs) about pediatric dental patients (PDPs) using metaphor analysis. The study group (N = 259) consisted of dentists and DSs. Participants completed the sentence "A pediatric dental patient is like ... because …..." in order to reveal the metaphors they use about the concept of PDPs. The data were analyzed using the mixed-methods: qualitative (metaphor analysis) and quantitative (chi-square) data analysis techniques. The dentists and DSs produced 259 metaphors. These metaphors were gathered under six different conceptual categories that define a PDP as unpredictable, dangerous, uncontrollable, requiring care and sensitivity, valuable, and orientable. The most important factors leading to these conceptions were the uncooperativeness of some PDPs and the effectiveness of behavior management. The results of this study indicate that there was no significant difference among DSs, general dentists and specialist dentists with respect to six conceptual categories that identify the conceptions about PDPs.

  10. Ft. Lewis/Gray, Washington. Revised Uniform Summary of Surface Weather Observations. Parts A-F.

    Science.gov (United States)

    1987-07-27

    75.9 75.9 76.1 76.2 GE 30001 5.3 66.8 70.6 73.0 75.6 7.7 76.4 76.9 77.0 78.0 78.0 78.0 78.4 78.4 7R.7 78.8 IE 27001 5.3 69.3 73.1 75.7 78.2 78.3 79.1...25.1 25.2 25.2 25.6 25.6 25.7 26.0 26.0 26.0 26.0 26.0 2b.2 6.E ISO DO 16.8 25.9 26.S 26.9 27.0 27.2 27.3 27.7 27.7 27.9 26.1 28.1 28.1 28.1 ip.1 28.1...3.259 3.596 5.103 6.164 8.878 9.563 T.O7 ITO! 0BSf 309 282 310 299 310 300 310 310 300 309 300 298 3632 22 ISO 1 9.724 9.333 8.111 6.610 5.262 9.228

  11. Formative Assessment and Elementary School Student Academic Achievement: A Review of the Evidence. REL 2017-259

    Science.gov (United States)

    Klute, Mary; Apthorp, Helen; Harlacher, Jason; Reale, Marianne

    2017-01-01

    Formative assessment is a process that engages teachers and students in gathering, interpreting, and using evidence about what and how students are learning in order to facilitate further student learning during a short period of time. The process offers the potential to guide educator decisions about midstream adjustments to instruction that…

  12. The Effect of Participation in Professional Development on Perceived Change in Teaching Practice by Minnesota K-12 Physical Education Teachers

    Science.gov (United States)

    Sertich, Sally Krause

    2013-01-01

    This study used a conceptual framework of professional development theory to identify characteristics of effective learning activities specific to 259 Minnesota K-12 public school physical education and developmental adapted physical education (PE/DAPE) teachers during 2012-2013. Study results confirmed that as PE/DAPE teacher participation in…

  13. Reproductive and hormonal factors in male and female colon cancer

    NARCIS (Netherlands)

    Kampman, E.; Bijl, A.J.; Kok, C.; Veer, P. van 't

    1994-01-01

    We analysed data from a case-control study in the Netherlands in order to investigate whether reproductive events and hormonal factors are similarly related to colon cancer risk in men and women after adjustment for dietary factors. In total, 232 colon cancer cases (102 women, 130 men) and 259

  14. Journal for Language Teaching - Vol 36, No 3-4 (2002)

    African Journals Online (AJOL)

    Shortcomings of the written survey questionnaire for discovering language learner perceptions: reflections of a researcher · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gary P. Barkhuizen, 259-272. http://dx.doi.org/10.4314/jlt.v36i3-4.5991 ...

  15. The effect of the position of oxygen group to the aromatic ring to emission performance in a heavy-duty diesel engine

    NARCIS (Netherlands)

    Zhou, L.; Boot, M.D.; Goey, de L.P.H.

    2012-01-01

    In this paper the soot-NOx trade-off and fuel efficiency of various aromatic oxygenates is investigated in a modern DAF heavy-duty diesel engine. All oxygenates were blended to diesel fuel such that the blend oxygen concentration was 2.59 wt.-%. The oxygenates in question, anisole, benzyl alcohol

  16. Kalivodův zápas o marxismus bez pověr a iluzí

    Czech Academy of Sciences Publication Activity Database

    Zumr, Josef

    2012-01-01

    Roč. 60, mimořádné číslo 2 (2012), s. 259-267 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Robert Kalivoda * Marx ism * Hussite movement * Karl Marx * Sigmund Freud Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  17. G-Quadruplex Identification in the Genome of Protozoan Parasites Points to Naphthalene Diimide Ligands as New Antiparasitic Agents

    Czech Academy of Sciences Publication Activity Database

    Belmonte-Reche, E.; Martínez-García, M.; Guédin, A.; Zuffo, M.; Arevalo-Ruiz, M.; Doria, F.; Campos-Salinas, J.; Maynadier, M.; Lopez-Rubio, J.J.; Freccero, M.; Mergny, Jean-Louis; Maria Perez-Victoria, J.; Carlos Morales, J.

    2018-01-01

    Roč. 61, č. 3 (2018), s. 1231-1240 ISSN 0022-2623 R&D Projects: GA MŠk EF15_003/0000477 Institutional support: RVO:68081707 Keywords : terminal repeat promoter * plasmodium-falciparum Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016

  18. Chemically different non-thermal plasmas target distinct cell death pathways

    Czech Academy of Sciences Publication Activity Database

    Lunov, O.; Zablotskyy, V.; Chrupina, O.; Lunova, M.; Jirsa, M.; Dejneka, A.; Kubinová, Šárka

    2017-01-01

    Roč. 7, apr (2017), s. 600 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : chemically different * non-thermal plasmas * target distinct cell death pathways Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  19. Impaired binding of 14-3-3 to C-RAF in noonan syndrome suggests new approaches in diseases with increased ras signaling

    NARCIS (Netherlands)

    Molzan, M.; Schumacher, B.; Ottmann, C.; Baljuls, A.; Polzien, L.; Weyand, M.; Thiel, P.; Rose, R.; Rose, M.; Kuhenne, P.; Kaiser, M.; Rapp, U.R.; Kuhlmann, J.; Ottmann, C.

    2010-01-01

    The Ras-RAF-mitogen-activated protein kinase (Ras-RAF-MAPK) pathway is overactive in many cancers and in some developmental disorders. In one of those disorders, namely, Noonan syndrome, nine activating C-RAF mutations cluster around Ser(259), a regulatory site for inhibition by 14-3-3 proteins. We

  20. Novel electrochemical route to cleaner fuel dimethyl ether

    Czech Academy of Sciences Publication Activity Database

    Cassone, Giuseppe; Pietrucci, F.; Saija, F.; Guyot, Y.; Šponer, Jiří; Šponer, Judit E.; Saitta, A. M.

    2017-01-01

    Roč. 7, JUL2017 (2017), č. článku 6901. ISSN 2045-2322 Institutional support: RVO:68081707 Keywords : initio molecular-dynamics * solid-acid catalysts * electric-fields Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.259, year: 2016

  1. Ježekite, Na.sub.8./sub.[(UO.sub.2./sub.)(CO.sub.3./sub.).sub.3./sub.](SO.sub.4./sub.).sub.2./sub..3H.sub.2./sub.O, a new uranyl mineral from Jáchymov, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Belakovskiy, D. I.; Čejka, J.; Chernyshov, D.

    2015-01-01

    Roč. 60, č. 4 (2015), 259-267 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : ježekite * new mineral * uranyl carbonate-sulfate * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

  2. Investigation of the clinical features and therapeutic methods for the ...

    African Journals Online (AJOL)

    Purpose: To establish if there are different classes of inflammatory lacrimal punctum diseases (ILPDs) and to examine the various strategies by which they can be managed therapeutically. Methods: Two hundred and fifty nine (259) patients with inflammatory punctum lacrimal disease were identified and used as subjects for ...

  3. 77 FR 13141 - Notice of Intent To Prepare a Master Leasing Plan, Amendments to the Resource Management Plans...

    Science.gov (United States)

    2012-03-05

    ... Northrup, Project Manager, BLM Moab Field Office, 82 East Dogwood, Moab, UT 84532, telephone (435) 259-2151... Instruction Memorandum No. 2010-117. The MLP process will provide additional planning and analysis for areas... with varying mitigation levels for leasing. The planning area covers about 783,000 acres in east...

  4. Determination of iodine in Asian diets by epithermal and radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Iyengar, GV.; Řanda, Zdeněk; Parr, RM.

    2004-01-01

    Roč. 259, č. 3 (2004), s. 505-509 ISSN 0236-5731 R&D Projects: GA AV ČR IAA4048301 Institutional research plan: CEZ:AV0Z1048901 Keywords : iodine * Asian diets Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.457, year: 2004

  5. An Evaluation of Two Different Methods of Assessing Independent Investigations in an Operational Pre-University Level Examination in Biology in England.

    Science.gov (United States)

    Brown, Chris

    1998-01-01

    Explored aspects of assessment of extended investigation ("project") practiced in the operational examinations of The University of Cambridge Local Examinations Syndicate (UCLES) for the perspective of construct validity. Samples of the 1993 (n=333) and 1996 (n=259) biology test results reveal two methods of assessing the project. (MAK)

  6. Effect of inhibition of biosynthesis of phenylpropanoids on sessile oak somatic embryogenesis

    Czech Academy of Sciences Publication Activity Database

    Cvikrová, Milena; Malá, J.; Hrubcová, Marie; Eder, Josef; Zoń, J.; Macháčková, Ivana

    2003-01-01

    Roč. 41, č. 3 (2003), s. 251-259 ISSN 0981-9428 R&D Projects: GA MŠk LN00A081 Institutional research plan: CEZ:AV0Z5038910 Keywords : Inhibition of phenylpropanoid biosynthesis * Somatic embryogenesis * Oak Subject RIV: CE - Biochemistry Impact factor: 1.729, year: 2003

  7. Direct fabrication of 3D graphene on nanoporous anodic alumina by plasma-enhanced chemical vapor deposition

    Czech Academy of Sciences Publication Activity Database

    Zhan, H.; Garrett, D.J.; Apollo, N.V.; Ganesan, K.; Lau, D.; Prawer, S.; Červenka, Jiří

    2016-01-01

    Roč. 6, Jan (2016), 1-8, č. článku 19822. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : double-layer capacitors * carbon nanotube arrays * amorphous-carbon * supercapacitor applications * Raman-spectroscopy * energy -storage Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  8. 75 FR 64781 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2010-10-20

    ... framework for the President to impose sanctions against significant foreign narcotics traffickers and their...., Martin L. Guzman 259-3, Colonia Villa de Cortes, Delegacion Benito Juarez, Mexico City, Mexico; Folio Mercantil No. 325909 (Mexico); (ENTITY) [BPI-SDNTK] 2. TATES DESARROLLO, S.A. DE C.V., Mexico City, Mexico...

  9. [Combined physiotherapy of chronic infectious prostatitis].

    Science.gov (United States)

    Churakov, A A; Popkov, V M; Zemskov, S P; Glybochko, P V; Bliumberg, B I

    2007-01-01

    Our experience with therapy of 259 outpatients with chronic infectious prostatitis (CIP) aged 16-55 years has demonstrated that combined treatment of CIP with rectal digital massage of the prostate, electrophoresis of chimotripsin solution with dimexide and local magnetotherapy (Intramag unit) significantly raises treatment efficacy, shortens treatment, prevents complications.

  10. Electron microscopy and molecular characterization of phytoplasmas associated with strawflower yellows in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Fránová, Jana; Přibylová, Jaroslava; Šimková, Marie; Navrátil, M.; Válová, P.

    2003-01-01

    Roč. 109, - (2003), s. 883-887 ISSN 0929-1873 R&D Projects: GA ČR GA522/98/0792; GA AV ČR IBS5051014 Institutional research plan: CEZ:AV0Z5051902 Keywords : Helichrysum bracteatum Subject RIV: EE - Microbiology, Virology Impact factor: 1.259, year: 2003

  11. A Static Model of Abiotic Predictors and Forest Ecosystem Receptor Designed Using Dimensionality Reduction and Regression Analysis

    Czech Academy of Sciences Publication Activity Database

    Samec, P.; Rychtecká, P.; Tuček, P.; Bojko, J.; Zapletal, Miloš; Cudlín, Pavel

    2016-01-01

    Roč. 22, č. 2 (2016), s. 259-274 ISSN 1392-1355 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : forest state monitoring * EMEP-LRTAP * floodplain * mountain forests * canonical correlation analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.635, year: 2016

  12. Malakostratigrafie holocenního pěnovce na Babině u Hradiště pod Vrátnom (jihozápadní Slovensko)

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2013-01-01

    Roč. 2012, Prosinec (2013), s. 259-262 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : SW Slovakia * Holocene * tufa * buried soils * molluscan succession Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-52.pdf

  13. Příběh války. Vědecko-pedagogická konference v Poslanecké sněmovně Parlamentu ČR

    Czech Academy of Sciences Publication Activity Database

    Beranská, Veronika

    2017-01-01

    Roč. 104, č. 2 (2017), s. 259-261 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : World War II * Association of the Czechs from Volynia and their friends * Volynia Czechs * Chamber of deputies Parliament of the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  14. Binary asteroid population. 1. Angular momentum content

    Czech Academy of Sciences Publication Activity Database

    Pravec, Petr; Harris, A. W.

    2007-01-01

    Roč. 190, č. 1 (2007), s. 250-259 ISSN 0019-1035 R&D Projects: GA ČR(CZ) GA205/05/0604 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.869, year: 2007

  15. Novel structural aspect of the diatom thylakoid membrane: lateral segregation of photosystem I under red-enhanced illumination

    Czech Academy of Sciences Publication Activity Database

    Bína, David; Herbstová, Miroslava; Gardian, Zdenko; Vácha, František; Litvín, Radek

    2016-01-01

    Roč. 6, MAY 2016 (2016), č. článku 25583. ISSN 2045-2322 R&D Projects: GA ČR GBP501/12/G055 Institutional support: RVO:60077344 Keywords : Light-harvesting complexes * Supramolecular organization * Protein complexes Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  16. Nonlinear magnetoelectric effect in paraelectric state of Co4Nb2O9 single crystal

    Czech Academy of Sciences Publication Activity Database

    Cao, Ym.; Deng, Gc.; Beran, Přemysl; Feng, Zj.; Kang, Bj.; Zhang, Jc.; Guiblin, N.; Dkhil, B.; Ren, W.; Cao, Sx.

    2017-01-01

    Roč. 7, č. 10 (2017), č. článku 14079. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : magnetoelectric * single crystal * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  17. Secreted Isoform of Human Lynx1 (SLURP-2): Spatial Structure and Pharmacology of Interactions with Different Types of Acetylcholine Receptors

    Czech Academy of Sciences Publication Activity Database

    Lyukmanova, E. N.; Shulepko, M. A.; Shenkarev, Z. O.; Bychkov, M. L.; Paramonov, A. S.; Chugunov, A. O.; Kulbatskii, D. S.; Arvaniti, M.; Dolejší, Eva; Schaer, T.; Arseniev, A. S.; Efremov, R. G.; Thomsen, M. S.; Doležal, Vladimír; Bertrand, D.; Dolgikh, D. A.; Kirpichnikov, M. P.

    2016-01-01

    Roč. 6, Aug 3 (2016), s. 30698 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA14-05696S Institutional support: RVO:67985823 Keywords : ion channel * signalling * molecular modelling * protein–protein interaction networks * solution-state NMR Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016

  18. Gas stripping in galaxy clusters: a new SPH simulation approach

    Czech Academy of Sciences Publication Activity Database

    Jáchym, Pavel; Palouš, Jan; Köppen, J.; Combes, F.

    2007-01-01

    Roč. 472, č. 1 (2007), s. 5-20 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : galaxie s * interactions * intergalactic medium Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  19. Voltammetric and X-ray diffraction analysis of the early stages of the thermal crystallization of mixed Cu,Mn oxides

    Czech Academy of Sciences Publication Activity Database

    Grygar, Tomáš; Rojka, T.; Bezdička, Petr; Večerníková, Eva; Kovanda, F.

    2004-01-01

    Roč. 8, č. 4 (2004), s. 252-259 ISSN 1432-8488 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : amorphous phases * Cu,Mn oxides * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.984, year: 2004

  20. FEM simulation of a sono-reactor accounting for vibrations of the boundaries

    Czech Academy of Sciences Publication Activity Database

    Louisnard, O.; González-Garcia, J.; Tudela, I.; Klíma, Jiří; Sáez, V.; Vargas-Hernandez, Y.

    2009-01-01

    Roč. 16, č. 2 (2009), s. 250-259 ISSN 1350-4177 R&D Projects: GA MŠk 1P05OC074 Institutional research plan: CEZ:AV0Z40400503 Keywords : finite elements * ultrasound * standing waves Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.993, year: 2009

  1. ISSN 1727-3781

    African Journals Online (AJOL)

    HP4510s

    place the question is addressed how a monist or dualist approach regarding the ... humanitarian law, customary international law, and the law and practice of States. ... Law 171 et seq; Boothby 2006 Intervention 244-259; Cohn 1991 IJRL 100-111; ...... as victims because of their emotional, mental and intellectual immaturity.

  2. TropJrnal Vol 29 No 1 for PDF

    African Journals Online (AJOL)

    Mr Olusoji

    (25.9%), Husband's opposition (24.2%), desire for more children (17.2%), Religious prohibition (13.8%), lack of ... Strategies to improving access and utilization to family planning methods should therefore include; the .... marketing of the condom in response to the HIV ... personnel towards building their capacity in offering.

  3. Experimental temporal quantum steering

    Czech Academy of Sciences Publication Activity Database

    Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.; Nori, F.

    2016-01-01

    Roč. 6, Nov (2016), 1-8, č. článku 38076. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : temporal quantum steering * EPR steering Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  4. 76 FR 4250 - Operating Certain Railroad Tank Cars in Excess of 263,000 Pounds Gross Rail Load; Approval

    Science.gov (United States)

    2011-01-25

    ..., thicknesses, materials of construction, and working pressures were as follows: Working Tank car specification..., wheels, draft systems, springs and trucks. S-259, however, does not allow for the free interchange among...-jacketed tank cars constructed with ASTM 516-70 steel and having only the minimum plate thickness required...

  5. Using Application-Domain Knowledge in the Runtime Support of Multi-Experiment Computational Studies

    Science.gov (United States)

    2009-01-01

    259, 1993. [20] Carlos A Coello, David A Van Veldhuizen , and Gary B Lamont. Evolu- tionary Algorithms for Solving Multi-Objective Problems. Kluwer...Applications, 20(2):255–285, 2006. [56] Robert Van Liere, Jurriaan D. Mulder, and Jarke J. van Wijk. Compu- tational steering. Future Generation Computer

  6. Nonpyrogenic Molecular Adjuvants Based on norAbu-Muramyldipeptide and norAbu-Glucosaminyl Muramyldipeptide: Synthesis, Molecular Mechanisms of Action, and Biological Activities in Vitro and in Vivo

    Czech Academy of Sciences Publication Activity Database

    Effenberg, R.; Turánek Knötigová, P.; Zyka, D.; Čelechovská, H.; Mašek, J.; Bartheldyová, E.; Hubatka, F.; Koudelka, Š.; Lukáč, R.; Kovalová, Anna; Šaman, David; Křupka, M.; Barkocziova, L.; Kosztyu, P.; Šebela, M.; Drož, L.; Hučko, M.; Kanásová, M.; Miller, A.D.; Raška, M.; Ledvina, M.; Turánek, J.

    2017-01-01

    Roč. 60, č. 18 (2017), s. 7745-7763 ISSN 0022-2623 R&D Projects: GA MŠk(CZ) LO1304 Institutional support: RVO:61388963 Keywords : N-acetylmuramyl peptides * muramyl dipeptide * adamantylamide dipeptide Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  7. Volume 11 No. 1 February 2011 4538 UTILIZATION OF STOVER ...

    African Journals Online (AJOL)

    user

    2011-02-01

    Feb 1, 2011 ... balance (3.0±0.98 g/d) was similar (P > 0.05) among cultivars, whereas available protein ranged (P ... solar radiation, and 25.9°C. (range: 22.6°C ..... Van Soest PJ Nutritional ecology of the ruminant, O & B Books, Inc. Oregon,.

  8. Molecular MR imaging of fibrosis in a mouse model of pancreatic cancer

    Czech Academy of Sciences Publication Activity Database

    Polášek, Miloslav; Yang, Y.; Schühle, D. T.; Yaseen, M. A.; Kim, Y. R.; Sung, Y. S.; Guimaraes, A. R.; Caravan, P.

    2017-01-01

    Roč. 7, Aug 14 (2017), č. článku 8114. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : fibrosis * molecular imaging * pancreatic cancer Subject RIV: FD - Oncology ; Hematology OBOR OECD: Oncology Impact factor: 4.259, year: 2016 https://www.nature.com/ articles /s41598-017-08838-6

  9. Efecto del encalado en la respuesta vegetal y fijación simbiótica del nitrógeno en frijol común

    Directory of Open Access Journals (Sweden)

    Aurelio Garc\\u00EDa

    2003-01-01

    Full Text Available En casa de cristales se evaluó mediante el método de valor A, utilizando el isótopo estable 15N, el efecto del encalado de un suelo Rhodic ferralsol sobre la fijación simbiótica de nitrógeno (FSN de los genotipos de frijol común (Phaseolus vulgaris L. BAT 58, BAT 477, DOR 364, CC 25-9 (N. La isolínea NN 125, genotipo de frijol no nodulante, fue utilizado como cultivo de referencia. El efecto del encalado incrementó la fracción de nitrógeno en planta derivado del aire, principalmente en CC 25-9 (N que posee muy poca capacidad de fijación de N atmosf érico cuando no se encala el suelo. Además, se encontró un efecto beneficioso del encalado sobre las reservas de N del suelo, visto que los incrementos de las extracciones totales de N por las plantas provienen del N del aire, e incluso, la cantidad de N en planta derivado del suelo disminuyó para todos los genotipos, principalmente en DOR 364 y CC 25-9(N. Por otra parte, la relación %Nddf/%Ndds, por ciento de N en planta derivado del fertilizante y por ciento de N en planta derivado del suelo respectivamente, varió debido a la aplicación de cal. Por consiguiente, es necesario utilizar dos tratamientos con el cultivo de referencia para evaluar acertadamente la FSN: cultivo de referencia con y sin suelo encalado. Se discute la interpretación del parámetro Eficiencia de Uso del N.

  10. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  11. p53 Over-expression and p53 mutations in colon carcinomas: Relation to dietary risk factors

    NARCIS (Netherlands)

    Voskuil, D.W.; Kampman, E.; Kraats, A.A. van; Balder, H.F.; Muijen, G.N.P. van; Goldbohm, R.A.; Veer, P. van 't

    1999-01-01

    Epidemiological studies have suggested that dietary factors may differently affect p53-dependent and p53-independent pathways to colon cancer. Results of such studies may depend on the method used to assess p53 status. This case-control study of 185 colon-cancer cases and 259 controls examines this

  12. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  13. Discovery of the first dual inhibitor of the 5-lipoxygenase-activating protein and soluble epoxide hydrolase using pharmacophore-based virtual screening

    Czech Academy of Sciences Publication Activity Database

    Temml, V.; Garscha, U.; Romp, E.; Schubert, G.; Gerstmeier, J.; Kutil, Zsófia; Matuszczak, B.; Waltenberger, B.; Stuppner, H.; Werz, O.; Schuster, D.

    2017-01-01

    Roč. 7, FEB 20 (2017), č. článku 42751. ISSN 2045-2322 Institutional support: RVO:61389030 Keywords : activating protein * drug discovery * leukotriene biosynthesis * inflammatory diseases * conformer generation * arachidonic-acid * flap * challenges * asthma * risk Subject RIV: CE - Biochemistry OBOR OECD: Physiology (including cytology) Impact factor: 4.259, year: 2016

  14. Status Of Strategic Management Practices Of Secondary School ...

    African Journals Online (AJOL)

    The purpose of the study was to determine the extent to which principals practice strategic management skills in students' administration in secondary schools in Anambra State. All the two hundred and fifty-nine (259) secondary school principals of the six education zones of Anambra State were used for the study.

  15. New sections in Taraxacum

    Czech Academy of Sciences Publication Activity Database

    Kirschner, Jan; Štěpánek, Jan

    2004-01-01

    Roč. 39, č. 3 (2004), s. 259-274 ISSN 0015-5551 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/02/0346 Institutional research plan: CEZ:AV0Z6005908 Keywords : Asteraceae * Compositae * Lactuceae Subject RIV: EF - Botanics Impact factor: 0.968, year: 2004

  16. Changes in white blood cells in sheep blood during selenium supplementation

    Czech Academy of Sciences Publication Activity Database

    Písek, L.; Trávníček, J.; Salát, Jiří; Kroupová, V.; Soch, M.

    2008-01-01

    Roč. 53, č. 5 (2008), s. 255-259 ISSN 0375-8427 R&D Projects: GA ČR GD523/03/H076 Institutional research plan: CEZ:AV0Z60220518 Keywords : ewes * immunity * T lymphocytes * CD4(+) * CD8(+) Subject RIV: GG - Livestock Rearing Impact factor: 0.659, year: 2008

  17. Selenium protects the immature rat heart against ischemia/reperfusion injury

    Czech Academy of Sciences Publication Activity Database

    Ošťádalová, Ivana; Vobecký, Miloslav; Chvojková, Zuzana; Miková, D.; Hampl, V.; Wilhelm, J.; Ošťádal, Bohuslav

    2007-01-01

    Roč. 300, 1-2 (2007), s. 259-267 ISSN 0300-8177 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : selenium * immature heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.707, year: 2007

  18. A rare-earth free magnesium alloy with improved intrinsic ductility

    Czech Academy of Sciences Publication Activity Database

    Sandlöbes, S.; Friák, Martin; Korte-Ketzel, S.; Pei, Z.; Neugebauer, J.; Raabe, D.

    2017-01-01

    Roč. 7, SEP (2017), č. článku 10458. ISSN 2045-2322 Institutional support: RVO:68081723 Keywords : MECHANICAL-PROPERTIES * MG-ZN * PRISMATIC-SLIP * DEFORMATION-BEHAVIOR Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  19. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  20. Deformation pattern in vibrating microtubule: Structural mechanics study based on an atomistic approach

    Czech Academy of Sciences Publication Activity Database

    Havelka, Daniel; Deriu, M.A.; Cifra, Michal; Kučera, Ondřej

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 4227. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-17102S Institutional support: RVO:67985882 Keywords : Continuum model * Protein microtubules * Molecular-dymamics Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  1. Biomonitoring of occupational exposure: Neutron activation determination of selected metals in the body tissues and fluids of workers manufacturing stainless steel vessels

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Bencko, V.; Tejral, J.; Borská, L.; Soukal, L.; Řanda, Zdeněk

    2004-01-01

    Roč. 259, č. 1 (2004), s. 7-11 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Institutional research plan: CEZ:AV0Z1048901 Keywords : occupational exposure * biomonitoring * neutron activation analysis Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.457, year: 2004

  2. 4-Bromoselenoanisole

    DEFF Research Database (Denmark)

    Sørensen, Henning Osholm; Stuhr-Hansen, Nicolai

    2009-01-01

    The title compound, 1-bromo-4-methylselenobenzene, C7H7BrSe, was prepared by methylation of 4-bromoselenophenolate with methyl iodide, and crystals suitable for structure determination were obtained by sublimation. The molecule is essentially planar; the Se-Me bond is rotated by only 2.59 (19)° out...

  3. affect rice in integrated rice-fish culture in Lake Victoria Basin, Kenya?

    African Journals Online (AJOL)

    AGHOGHO A

    Rice field ecology and fish culture - an overview. Hydrobiologia 259:91-113. Fernando CH, Halwart M (2000). Fish farming in irrigation systems. Fisheries Management and Ecol. 7:45-54. Frei M, Razzak MA, Hossain MM, Ochme M, Dewan S, Becker K. (2007). Performance of common carp, Cyprinus carpio L. and Nile.

  4. Cold tolerance is unaffected by oxygen availability despite changes in anaerobic metabolism

    Czech Academy of Sciences Publication Activity Database

    Boardman, L.; Sorensen, J. G.; Košťál, Vladimír; Šimek, Petr; Terblanche, J. S.

    2016-01-01

    Roč. 6, SEPT 13 (2016), č. článku 32856. ISSN 2045-2322 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : hypoxia * cold * insect Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep32856

  5. Measles, Mumps, and Rubella - Vaccine Use and Strategies for Elimination of Measles, Rubella, and Congenital Rubella Syndrome and Control of Mumps: Recommendations of the Advisory Committee on Immunization Practices (ACIP). Vol. 47/No. RR-8.

    Science.gov (United States)

    1998-05-22

    onset an average of 16-18 days after exposure. Parotitis may be preceded by fever, headache, malaise, myalgia, and anorexia . Only 30%-40% of mumps...six- " teen -year follow-up in the Hawaiian Islands. JAMA 1988;259:3133-6 98 Hillary IB, Griffith AH. Persistence of antibody 10 years after

  6. Influence of Active Immunization Against Angiotensin AT1 or AT2 Receptor on Hypertension Development in Young and Adult SHR

    Czech Academy of Sciences Publication Activity Database

    Železná, Blanka; Veselský, Leopold; Velek, Jiří; Dobešová, Zdenka; Zicha, Josef; Kuneš, Jaroslav

    1999-01-01

    Roč. 48, č. 4 (1999), s. 259-265 ISSN 0862-8408 R&D Projects: GA MŠk OK 170; GA AV ČR IAA7011711; GA AV ČR IPP2020702 Grant - others:Coperincus(FR) CT94-0239 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.521, year: 1999

  7. Magnetically responsive yeast cells: methods of preparation and applications

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Maděrová, Zdeňka; Pospišková, K.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 227-237 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA MŠk(CZ) LD13021 Institutional support: RVO:67179843 Keywords : yeast cells * Saccharomyces * Kluyveromyces * Rhodotorula * Yarrowia * magnetic modification Subject RIV: CE - Biochemistry Impact factor: 2.259, year: 2015

  8. Heterodera schachtii Tyrosinase-like protein a novel nematode effector modulating plant hormone homeostasis

    Czech Academy of Sciences Publication Activity Database

    Habash, S.; Radakovic, Z.S.; Vaňková, Radomíra; Siddique, S.; Dobrev, Petre; Gleason, C.; Grundler, F.M.W.; Elashry, A.

    2017-01-01

    Roč. 7, JUL 31 (2017), č. článku 6874. ISSN 2045-2322 Institutional support: RVO:61389030 Keywords : arabidopsis-thaliana * cyst-nematode * parasitic nematode * transient expression * host plants * sequence * identification * infection * model * transformation Subject RIV: ED - Physiology OBOR OECD: Plant sciences, botany Impact factor: 4.259, year: 2016

  9. 78 FR 3911 - Big Stone National Wildlife Refuge, Big Stone and Lac Qui Parle Counties, MN; Final Comprehensive...

    Science.gov (United States)

    2013-01-17

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R3-R-2012-N259; FXRS1265030000-134-FF03R06000] Big Stone National Wildlife Refuge, Big Stone and Lac Qui Parle Counties, MN; Final Comprehensive... significant impact (FONSI) for the environmental assessment (EA) for Big Stone National Wildlife Refuge...

  10. AcEST: BP917978 [AcEST

    Lifescience Database Archive (English)

    Full Text Available IC6|VGLG_LNYV Glycoprotein G OS=Lettuce necrotic yellows v... 29 9.4 sp|A6VMF8|MEND_ACTSZ 2-succinyl-5-enolp...SPQKVVIENSWAFRNGINY 259 Query: 218 WKD 210 W D Sbjct: 260 WND 262 >sp|Q9DIC6|VGLG_LNYV Glycoprotein G OS=Lettuce

  11. Portfolio optimization with short-selling and spin-glass

    NARCIS (Netherlands)

    Schianchi, A.; Bongini, L.; Degli Esposti, M.; Giardinà, C.

    2002-01-01

    n this paper, we solve a general problem of optimizing a portfolio in a futures markets framework, extending the previous work of Galluccio et al. [Physica A 259, 449 (1998)]. We allow for long buying/short selling of a relatively large number of assets, assuming a fixed level of margin requirement.

  12. A highly diverse spectrum of naphthoquinone derivatives produced by the endophytic fungus Biatriospora sp CCF 4378

    Czech Academy of Sciences Publication Activity Database

    Stodůlková, Eva; Man, Petr; Kuzma, Marek; Černý, J.; Císařová, I.; Kubátová, A.; Chudíčková, Milada; Kolařík, Miroslav; Flieger, Miroslav

    2015-01-01

    Roč. 60, č. 3 (2015), s. 259-267 ISSN 0015-5632 R&D Projects: GA MŠk(CZ) LD13039; GA ČR GA13-16565S Institutional support: RVO:61388971 Keywords : NECTRIA-HAEMATOCOCCA * ASCOMYCETOUS FUNGUS * BIOLOGICAL-ACTIVITY Subject RIV: EE - Microbiology, Virology Impact factor: 1.335, year: 2015

  13. Bidirectional Influences between Maternal Parenting and Children's Peer Problems: A Longitudinal Monozygotic Twin Difference Study

    Science.gov (United States)

    Yamagata, Shinji; Takahashi, Yusuke; Ozaki, Koken; Fujisawa, Keiko K.; Nonaka, Koichi; Ando, Juko

    2013-01-01

    This twin study examined the bidirectional relationship between maternal parenting behaviors and children's peer problems that were not confounded by genetic and family environmental factors. Mothers of 259 monozygotic twin pairs reported parenting behaviors and peer problems when twins were 42 and 48 months. Path analyses on monozygotic twin…

  14. FERO (Finding Extreme Relativistic Objects): statistics of relativistic broad Fe Kalpha lines in AGN

    Czech Academy of Sciences Publication Activity Database

    Longinotti, A. L.; de La Calle, I.; Bianchi, S.; Guainazzi, M.; Dovčiak, Michal

    2008-01-01

    Roč. 79, č. 1 (2008), s. 259-261 ISSN 0037-8720. [ Simbol -X: The hard X-ray Universe in focus. Bologna, 14.05.2007-16.05.2007] Institutional research plan: CEZ:AV0Z10030501 Keywords : active galaxies * X-raylLines-iron Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  15. Vitamin B2 as a virulence factor in Pseudogymnoascus destructans skin infection

    Czech Academy of Sciences Publication Activity Database

    Flieger, Miroslav; Banďouchová, H.; Černý, J.; Chudíčková, Milada; Kolařík, Miroslav; Kováčová, V.; Martínková, Natália; Novák, Petr; Šebesta, O.; Stodůlková, Eva; Pikula, J.

    2016-01-01

    Roč. 6, č. 33200 (2016), s. 33200 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:61388971 ; RVO:68081766 Keywords : riboflavin * white-nose syndrome (WNS) * bats Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016

  16. Insulin-like Growth Factor 1 Analogs Clicked in the C Domain: Chemical Synthesis and Biological Activities

    Czech Academy of Sciences Publication Activity Database

    Macháčková, Kateřina; Collinsová, Michaela; Chrudinová, Martina; Selicharová, Irena; Pícha, Jan; Buděšínský, Miloš; Vaněk, Václav; Žáková, Lenka; Brzozowski, A. M.; Jiráček, Jiří

    2017-01-01

    Roč. 60, č. 24 (2017), s. 10105-10117 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : IGF-1 * receptor * synthesis * triazole Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016 http://pubs.acs.org/doi/full/10.1021/acs.jmedchem.7b01331

  17. Perceptions of physical activity, activity preferences and health ...

    African Journals Online (AJOL)

    "Weight loss," "health concerns" and "increased energy," were top motivators for PA. "Can't find the time," "work/family obligations," and "don't have a facility" were top barriers. Presence of hypertension, hypercholesterolemia and prior weight loss correlated with the slimming motivator (adjusted odds ratio 2.59, p=0.008; ...

  18. Is the dark matter halo of the Milky Way flattened?

    Czech Academy of Sciences Publication Activity Database

    Růžička, Adam; Palouš, Jan; Theis, Ch.

    2007-01-01

    Roč. 461, č. 1 (2007), s. 155-169 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : N-body simulations * galaxies * interactions * Magellanic clouds Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  19. Relationship between Tobacco Advertising and Youth Smoking: Assessing the Effectiveness of a School-Based Antismoking Intervention Program.

    Science.gov (United States)

    Beltramini, Richard F.; Bridge, Patrick D.

    2001-01-01

    The Hazards of Tobacco (C) program, which focuses on smoking prevention among youth, was completed by 259 suburban sixth graders (199 controls) and 166 urban fifth through seventh graders. Participation significantly changed understanding of the role of tobacco advertising and the intention to smoke in both samples. (Contains 49 references.) (SK)

  20. Science Credit for Agriculture: Perceived Support, Preferred Implementation Methods and Teacher Science Course Work.

    Science.gov (United States)

    Johnson, Donald M.

    1996-01-01

    Arkansas agriculture teachers (213 of 259 surveyed) expressed support for granting science credit for agriculture (88.8%); 65.6% supported science credit for a limited number of agriculture courses. Blanket endorsement for all certified agriculture teachers was favored by 71.5%; 56.6% preferred endorsement only for certified teachers completing an…

  1. Application of the information, motivation and behavioural skills ...

    African Journals Online (AJOL)

    This paper discusses the application of an information, motivation and behavioural skills (IMB) model in a school-based programme for the reduction of HIV risk behaviour among 259 Grade 11 learners in two high schools in Alexandra township, Johannesburg. School 1 was the Experimental group, while School 2 was the ...

  2. Leukotriene-mediated neuroinflammation, toxic brain damage, and neurodegeneration in acute methanol poisoning

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Kotíková, K.; Nurieva, O.; Hlušička, J.; Kačer, P.; Urban, P.; Vaněčková, M.; Seidl, Z.; Diblík, P.; Kuthan, P.; Navrátil, Tomáš; Pelclová, D.

    2017-01-01

    Roč. 55, č. 4 (2017), s. 249-259 ISSN 1556-3650 Institutional support: RVO:61388955 Keywords : brain damage * leukotrienes * methanol poisoning * Neuroinflammation * nontraumatic brain injury * sequelae of poisoning Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 3.677, year: 2016

  3. Non-uniform self-assembly: On the anisotropic architecture of alpha-synuclein supra-fibrillar aggregates

    Czech Academy of Sciences Publication Activity Database

    Semerdzhiev, S. A.; Shvadchak, Volodymyr V.; Subramaniam, V.; Claessens, M. M. A. E.

    2017-01-01

    Roč. 7, Aug 9 (2017), č. článku 7699. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : liquid crystal spherulites * Parkinson's disease * Alzheimer's disease Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-06532-1

  4. Prevalence of Demodex spp among alcohol-dependent patients

    Directory of Open Access Journals (Sweden)

    Mehmet Hanifi Kokacya

    2016-06-01

    Conclusion: Demodex spp. are more common in alcohol-dependent patients due conditions of reduced self-care and immunosuppression. Demodex parasites should be considered in alcohol-dependent patients with skin lesions, especially on the face, and should to be treated if needed. [Cukurova Med J 2016; 41(2.000: 259-263

  5. Transcobalamin 776C-->G polymorphism is associated with peripheral neuropathy in elderly with high folate intake

    Science.gov (United States)

    Background: The 776C-->G polymorphism of the vitamin B-12 transport protein transcobalamin gene (TCN2) (rs1801198; Pro259Arg) is associated with a lower holotranscobalamin concentration in plasma. This effect may reduce the availability of vitamin B-12 to tissues even when vitamin B-12 intake is ade...

  6. Nanoparticle core stability and surface functionalization drive the mTOR signaling pathway in hepatocellular cell lines.

    Czech Academy of Sciences Publication Activity Database

    Lunova, M.; Prokhorov, A.; Jirsa, M.; Hof, M.; Olžyńska, A.; Jurkiewicz, P.; Kubinová, Šárka; Lunov, O.; Dejneka, A.

    2017-01-01

    Roč. 7, č. 1 (2017), s. 16049 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : mesoporous silica nanoparticles * iron-oxide nanoparticles * double-stranded-rna * drug-delivery Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  7. Development of a human vasopressin V-1a-receptor antagonist from an evolutionary-related insect neuropeptide

    Czech Academy of Sciences Publication Activity Database

    Di Giglio, M. G.; Muttenthaler, M.; Harpsoe, K.; Liutkeviciute, Z.; Keov, P.; Eder, T.; Rattei, T.; Arrowsmith, S.; Wray, S.; Marek, Aleš; Elbert, Tomáš; Alewood, P. F.; Gloriam, D. E.; Gruber, C. W.

    2017-01-01

    Roč. 7, Feb 1 (2017), č. článku 41002. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : neuropeptide * inotocin * V1aR-antagonist Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep41002

  8. Field-induced exciton condensation in LaCoO.sub.3./sub.

    Czech Academy of Sciences Publication Activity Database

    Sotnikov, A.; Kuneš, Jan

    2016-01-01

    Roč. 6, Jul (2016), 1-6, č. článku 30510. ISSN 2045-2322 EU Projects: European Commission(XE) 646807 - EXMAG Institutional support: RVO:68378271 Keywords : exciton condensation * LaCoO 3 * dynamical mean-field theory Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  9. Role of guard rings in improving the performance of silicon detectors

    Indian Academy of Sciences (India)

    number of free charge carriers thus produced is proportional to the energy deposited. 259 .... grounding the innermost guard ring of a strip detector of geometry 60 × 60 mm2. ... The guard ring was kept floating with no electrical connection .... ment of maintaining high-quality semiconductor properties during high temperature.

  10. A Survey of Exemplar Teachers' Perceptions, Use, and Access of Computer-Based Games and Technology for Classroom Instruction

    Science.gov (United States)

    Proctor, Michael D.; Marks, Yaela

    2013-01-01

    This research reports and analyzes for archival purposes surveyed perceptions, use, and access by 259 United States based exemplar Primary and Secondary educators of computer-based games and technology for classroom instruction. Participating respondents were considered exemplary as they each won the Milken Educator Award during the 1996-2009…

  11. The enigma of the lower gut-associated lymphoid tissue (GALT)

    Czech Academy of Sciences Publication Activity Database

    Butler, J. E.; Šinkora, Marek

    2013-01-01

    Roč. 94, č. 2 (2013), s. 259-270 ISSN 0741-5400 R&D Projects: GA ČR GAP502/10/0038; GA ČR GAP502/12/0110 Institutional support: RVO:61388971 Keywords : B lymphocytes * lymphogenesis * B cell development Subject RIV: EC - Immunology Impact factor: 4.304, year: 2013

  12. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  13. Assessment of the nutritional quality of smoked catfish ( Clarias ...

    African Journals Online (AJOL)

    This study examined the nutritional quality of smoked Catfish Clarias gariepinus obtained in three different markets in Lapai, Niger State, Nigeria for a period of three months. Proximate compositions of smoked Clarias gariepinus were determined. The highest protein content (49.27 ± 2.59) was recorded in smoked fish ...

  14. Prevalence and severity of malnutrition in pre-school children in a rural area of western Kenya

    NARCIS (Netherlands)

    Kwena, Arthur M.; Terlouw, Dianne J.; de Vlas, Sake J.; Phillips-Howard, Penelope A.; Hawley, William A.; Friedman, Jennifer F.; Vulule, John M.; Nahlen, Bernard L.; Sauerwein, Robert W.; ter Kuile, Feiko O.

    2003-01-01

    We determined the nutritional status of children less than five years of age in an area in rural western Kenya with intense malaria transmission, a high prevalence of severe anemia and human immunodeficiency virus, and high infant and under-five mortality (176/1,000 and 259/1,000). No information is

  15. Variation in annual pollen accumulation rates of Fagus along a N-S transect in Europe based on pollen traps

    Czech Academy of Sciences Publication Activity Database

    Pidek, I. A.; Svitavská-Svobodová, Helena; van der Knaap, W. O.; Noryskiewicz, A. M.; Filbrandt-Czaja, A.; Noryskiewicz, B.; Latalova, M.; Zimny, M.; Swieta-Musznicka, J.; Bozilova, E.; Tonkov, S.; Filipova-Marinova, M.; Poska, A.; Giesecke, T.; Gikov, A.

    2010-01-01

    Roč. 19, č. 4 (2010), s. 259-270 ISSN 0939-6314 R&D Projects: GA AV ČR IAAX00130801; GA AV ČR IAAX00050801 Institutional research plan: CEZ:AV0Z60050516 Keywords : Fagus * Europe * pollen monitoring Subject RIV: EF - Botanics Impact factor: 1.656, year: 2010

  16. Proceedings of the International Conference on Cyclic Nucleotides, Calcium and Protein Phosphorylation (6th) Held in Bethesda, Maryland on September 2-7, 1986. Advances in Second Messenger and Phosphorprotein Research. Volume 21A. Abstracts Volume

    Science.gov (United States)

    1988-11-16

    on an operational classification (Robinson- Steiner , A.M., Beebe, S.J., Rannels, S.R., and Corbin, J.D. (1984) J. Biol. Chem. 259, 10595). RIIA forms... Rudolf -Bucheim-Institut flir Phariakologie, D-6300 Giessen, F.R.G. Botulimnm C2 tocin (BtcxC2), which causes hypotnic effects, increase in vascular

  17. Pattern of gastrointestinal opportunistic infections among HIV ...

    African Journals Online (AJOL)

    Twenty-two per cent (22%) of these had mixed parasitosis of cryptosporidium and hookworm. There was no significant association of CD4 cells count with intestinal parasitosis. x2 = 5.286 and p=0.259. However marital status was significantly associated with gastrointestinal opportunistic parasitosis with x2 of 12.693, ...

  18. N-terminal tetrapeptide T/SPLH motifs contribute to multimodal activation of human TRPA1 channel

    Czech Academy of Sciences Publication Activity Database

    Hynková, Anna; Maršáková, Lenka; Vašková, Jana; Vlachová, Viktorie

    2016-01-01

    Roč. 6, Jun 27 (2016), s. 28700 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-15839S Institutional support: RVO:67985823 Keywords : ankyrin receptor subtype 1 * transient receptor potential * gating * ankyrin repeat * whole-cell electrophysiology * N-terminus * mutagenesis Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016

  19. Sourcing in Professional Education: Do Text Factors Make Any Difference?

    Science.gov (United States)

    Bråten, Ivar; Strømsø, Helge I.; Andreassen, Rune

    2016-01-01

    The present study investigated the extent to which the text factors of source salience and emphasis on risk might influence readers' attention to and use of source information when reading single documents to make behavioral decisions on controversial health-related issues. Participants (n = 259), who were attending different bachelor-level…

  20. Back-transformation of treatment differences - an approximate method

    DEFF Research Database (Denmark)

    Laursen, Rikke Pilmann; Dalskov, Stine-Mathilde; Damsgaard, Camilla Trab

    2014-01-01

    Background/Objectives:Transformation of outcomes is frequently used in the analysis of studies in clinical nutrition. However, back-transformation of estimated treatment means and differences is complicated by the nonlinear nature of the transformations. It is not straightforward to obtain an est...... publication, 11 December 2013; doi:10.1038/ejcn.2013.259....

  1. Influence of doxorubicin on model cell membrane properties: insights from in vitro and in silico studies

    Czech Academy of Sciences Publication Activity Database

    Alves, A. C.; Magarkar, Aniket; Horta, M.; Lima, J. L. F. C.; Bunker, A.; Nunes, C.; Reis, S.

    2017-01-01

    Roč. 7, Jul 24 (2017), č. článku 6343. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : P-glycoprotein * molecular dynamics * multidrug resistance Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-06445-z

  2. Mitochondrial biogenesis in brown adipose tissue is associated with differential expression of transcription regulatory factors

    Czech Academy of Sciences Publication Activity Database

    Villena, J. A.; Carmona, M. C.; Rodriguez de la Concepción, M.; Rossmeisl, Martin; Vinas, O.; Mampel, T.; Iglesias, R.; Giralt, M.; Villarroya, F.

    2002-01-01

    Roč. 59, č. 11 (2002), s. 1934-1944 ISSN 1420-682X Grant - others:Ministerio de Ciencia y Tecnología (ES) PM98.0188 Institutional research plan: CEZ:AV0Z5011922 Keywords : brown adipose tissue * mitochondria * transcription factors Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.259, year: 2002

  3. Myocardial scintigraphy. Clinical use and consequence in a non-invasive cardiological department

    DEFF Research Database (Denmark)

    Dümcke, Christine Elisabeth; Graff, J; Rasmussen, SPL

    2006-01-01

    to analyse the clinical use of MPI in a university hospital without invasive cardiological laboratory. MATERIAL AND METHODS: In the period 01.01.2002 to 31.12.2003, 259 patients (141 women, 118 men) were referred to MPI from our department of cardiology. RESULTS: Normal MPI was seen in 111 patients (43...

  4. The correlation theory of the chemical bond

    Czech Academy of Sciences Publication Activity Database

    Szalay, S.; Barcza, G.; Szilvási, T.; Veis, Libor; Legeza, Ö.

    2017-01-01

    Roč. 7, MAY 2017 (2017), č. článku 2237. ISSN 2045-2322 R&D Projects: GA ČR GA16-12052S Institutional support: RVO:61388955 Keywords : density matrix * quantum chemistry * theoretical model Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  5. Vavraia culicis (Weiser, 1947) Weiser, 1977 revisited: cytological characterisation of a Vavraia culicis-like microsporidium isolated from mosquitoes in Florida and the establishment of Vavraia culicis floridensis subsp. n

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Becnel, J. J.

    2007-01-01

    Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquito es * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

  6. Synthesis and Evaluation of Asymmetric Acyclic Nucleoside Bisphosphonates as Inhibitors of Plasmodium falciparum and Human Hypoxanthine-Guanine-(Xanthine) Phosphoribosyltransferase

    Czech Academy of Sciences Publication Activity Database

    Špaček, Petr; Keough, D. T.; Chavchich, M.; Dračínský, Martin; Janeba, Zlatko; Naesens, L.; Edstein, M. D.; Guddat, L. W.; Hocková, Dana

    2017-01-01

    Roč. 60, č. 17 (2017), s. 7539-7554 ISSN 0022-2623 R&D Projects: GA ČR(CZ) GA16-06049S Institutional support: RVO:61388963 Keywords : hypoxanthine-guanine phosphoribosyltransferase * 2nd phosphonate group * 6-oxopurine phosphoribosyltransferases Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  7. Physiological and genomic insights into the lifestyle of arsenite-oxidizing Herminiimonas arsenitoxidans

    Czech Academy of Sciences Publication Activity Database

    Koh, H.W.; Hur, M.; Kang, M.S.; Ku, Y.B.; Ghai, Rohit; Park, S.J.

    2017-01-01

    Roč. 7, Nov (2017), č. článku 15007. ISSN 2045-2322 R&D Projects: GA ČR GA17-04828S Institutional support: RVO:60077344 Keywords : sp-nov. * escherichia-coli * oxidative stress * molecular characterization * drinking-water Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  8. Transcobalamin C776G genotype modifies the association between vitamin B12 and homocysteine in older hispanics

    Science.gov (United States)

    Background: A common polymorphism, C776G, in the plasma B12 transport protein transcobalamin (TC), encodes for either proline or arginine at codon 259. This polymorphism may affect the affinity of TC for B12 and subsequent delivery of B12 to tissues. Methods: TC genotype and its associations with i...

  9. Intentions to Participate in Counselling among Front-Line, At-Risk Irish Government Employees: An Application of the Theory of Planned Behaviour

    Science.gov (United States)

    Hyland, Philip E.; McLaughlin, Christopher G.; Boduszek, Daniel; Prentice, Garry R.

    2012-01-01

    The study set out to examine intentions to engage in counselling among at-risk Irish government employees and the differential utility of two alternative theory of planned behaviour (TPB) models of behaviour to explain intentions to participate in counselling. Individuals (N = 259) employed in a front-line, at-risk occupation for the Irish…

  10. Ultra-low gossypol cottonseed: gene-silencing opens up a vast, but underutilized protein resource for human nutrition

    Science.gov (United States)

    Cotton, grown mainly for its fiber, is a major crop in several developing and developed countries across the globe. In 2012, 48.8 million metric tons (MMT) of cottonseed was produced worldwide as a by-product of the 25.9 MMT of cotton lint production (FAO Production Statistics). This amount of cot...

  11. Numerical modelling of the reinforcing effect of geosynthetic material used in a ballasted railway tracks

    Czech Academy of Sciences Publication Activity Database

    Jiroušek, Ondřej; Jíra, J.; Hrdlička, Ondřej; Kunecký, Jiří; Kytýř, Daniel; Vyčichl, J.; Doktor, Tomáš

    2010-01-01

    Roč. 224, č. 4 (2010), s. 259-267 ISSN 0954-4097 Institutional research plan: CEZ:AV0Z20710524 Keywords : railway track bed * reinforcing geogrid * finite-element modelling * settlement reduction * contact analysis * ballast material Subject RIV: JN - Civil Engineering Impact factor: 0.389, year: 2010 http://journals.pepublishing.com/content/k561040632411117/

  12. Citizen science shows systematic changes in the temperature difference between air and inland waters with global warming

    Czech Academy of Sciences Publication Activity Database

    Weyhenmeyer, G. A.; Mackay, M.; Stockwell, J. D.; Thiery, W.; Grossart, H. P.; Augusto-Silva, P. B.; Baulch, H. M.; de Eyto, E.; Hejzlar, Josef; Kangur, K.; Kirillin, G.; Pierson, D. C.; Rusak, J. A.; Sadro, S.; Woolway, R. I.

    2017-01-01

    Roč. 7, March (2017), č. článku 43890. ISSN 2045-2322 R&D Projects: GA ČR GA15-13750S Institutional support: RVO:60077344 Keywords : dissolved organic-carbon * transfer velocity * energy fluxes * lake * evaporation Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 4.259, year: 2016

  13. Proton irradiation: a key to the challenge of N-glycosidic bond formation in a prebiotic context

    Czech Academy of Sciences Publication Activity Database

    Saladino, R.; Bizzarri, B.M.; Botta, L.; Šponer, Jiří; Šponer, Judit E.; Georgelin, T.; Jaber, M.; Rigaud, B.; Kapralov, M.; Timoshenko, G. N.; Rozanov, A.; Krasavin, E.; Timperio, A.M.; Di Mauro, E.

    2017-01-01

    Roč. 7, NOV2017 (2017), č. článku 14709. ISSN 2045-2322 R&D Projects: GA ČR GA17-05076S Institutional support: RVO:68081707 Keywords : aqueous-solution * nucleic-acids * formamide * radicals Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  14. 76 FR 62165 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List Texas...

    Science.gov (United States)

    2011-10-06

    ... shell). They may also feed on organic particles in sediment using the large, muscular foot (an organ... detritus (Yeager et al. 1994, pp. 253-259). Mussels tend to grow relatively rapidly for the first few years.... Juvenile freshwater mussels burrow into interstitial substrates and grow to a larger size that is less...

  15. Neutron diffraction study of Lu.sub.2./sub.Fe.sub.17./sub. under pressure

    Czech Academy of Sciences Publication Activity Database

    Prokhnenko, Olexandr; Ritter, C.; Medvedeva, I.; Arnold, Zdeněk; Kamarád, Jiří; Kuchin, A.

    258-259, - (2003), s. 564-566 ISSN 0304-8853 R&D Projects: GA ČR GA202/02/0739; GA AV ČR IAA1010018 Institutional research plan: CEZ:AV0Z1010914 Keywords : intermetallic compounds * neutron scattering * magnetic structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003

  16. Spatiotemporal variability of stone pine (Pinus pinea L.) growth response to climate across the Iberian Peninsula

    Czech Academy of Sciences Publication Activity Database

    Natalini, F.; Alejano, R.; Vazquez-Pique, J.; Pardos, M.; Calama, R.; Büntgen, Ulf

    2016-01-01

    Roč. 40, dec (2016), s. 72-84 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-rings * genetically depauperate * mediterranean climate * phenotypic plasticity * cambial activity * fagus-sylvatica * spain * drought * widespread * halepensis * Climate change * Dendroecology * Growth plasticity * Mediterranean * Tree rings * Drought Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2016

  17. Click chemistry-based tracking reveals putative cell wall-located auxin binding sites in expanding cells

    Czech Academy of Sciences Publication Activity Database

    Mravec, J.; Kračun, S. K.; Zemlyanskaya, E.; Rydahl, M. G.; Guo, X.; Pičmanová, M.; Sørensen, K.; Růžička, Kamil; Willats, W.G.T.

    2017-01-01

    Roč. 7, NOV 22 (2017), č. článku 15988. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:61389030 Keywords : MEMBRANE H+-ATPASE * BIOLOGICAL-ACTIVITY * AZIDO AUXINS Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 4.259, year: 2016

  18. Differential distribution of Y-chromosome haplotypes in Swiss and Southern European goat breeds

    Czech Academy of Sciences Publication Activity Database

    Vidal, O.; Drögemüller, C.; Obexer-Ruff, G.; Reber, I.; Jordana, J.; Martínez, A.; Bâlteanu, V. A.; Delgado, J. V.; Eghbalsaied, S.; Landi, V.; Goyache, F.; Traore, A.; Pazzola, M.; Vacca, G.M.; Badaoui, B.; Pilla, F.; D'Andrea, M.; Álvarez, I.; Capote, J.; Sharaf, Abdoallah; Pons, A.; Amills, M.

    2017-01-01

    Roč. 7, NOV 23 (2017), č. článku 16161. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : mitochondrial-dna * nucleotide diversity * genetic diversity * domestication * origins * phylogenies * east Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 4.259, year: 2016

  19. Demand and Supply of Teachers to Secondary Schools in Anambra ...

    African Journals Online (AJOL)

    This study investigated the demand and supply of teachers to secondary schools in Anambra State of Nigeria due to school type. The survey design approach was adopted for this study. The population of the study comprised of all the secondary school principals, numbering 259 in the six education zones of Anambra State.

  20. Elicitation threshold of cobalt chloride

    DEFF Research Database (Denmark)

    Fischer, Louise A; Johansen, Jeanne D; Voelund, Aage

    2016-01-01

    : On the basis of five included studies, the ED10 values of aqueous cobalt chloride ranged between 0.0663 and 1.95 µg cobalt/cm(2), corresponding to 30.8-259 ppm. CONCLUSIONS: Our analysis provides an overview of the doses of cobalt that are required to elicit allergic cobalt contactdermatitis in sensitized...

  1. Regional Fears of Western Primacy and the Future of U.S. Middle Eastern Basing Policy

    Science.gov (United States)

    2006-12-01

    8, 2006, internet. 166. “ Green Energy Gambit,” The Pearl (Magazine of the State of Qatar), March 2005, p. 4. 167. Michael R. Gordon and Lieutenant...The Middle East, October 2005, pp. 16-17. 259. Hamad Bin Isa al Khalifa, First Light: Modern Bahrain and Its Heritage, London and New York: Kegan

  2. Social Adjustment of College Freshmen: The Importance of Gender and Living Environment

    Science.gov (United States)

    Enochs, Wendy K.; Roland, Catherine B.

    2006-01-01

    The relationship between living environment, gender and both overall adjustment to college and social adjustment in freshmen students was examined in this study. The College Adjustment Scales were administered to 511 freshmen students living in on-campus housing. There were 259 students living in Freshmen Year Experience (FYE) Halls verses 252…

  3. Critical Climate: Relations among Sexual Harassment, Climate, and Outcomes for High School Girls and Boys

    Science.gov (United States)

    Ormerod, Alayne J.; Collinsworth, Linda L.; Perry, Leigh Ann

    2008-01-01

    This study examined the relationships among peer-to-peer sexual harassment, school climate, adult-to-student harassment, and outcomes (psychological and physical well-being; school withdrawal and safety) for high school girls (n = 310) and boys (n = 259) recruited from seven public high schools in a Midwestern state. More frequent, severe peer…

  4. Atmospheric deceleration and light curves of Draconid meteors and implications for the structure of cometary dust

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jiří; Spurný, Pavel; Koten, Pavel

    2007-01-01

    Roč. 473, č. 2 (2007), s. 661-672 ISSN 0004-6361 R&D Projects: GA ČR GA205/05/0543; GA AV ČR KJB300030502 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor * meteoroid * comet Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  5. Sickness absence and return to work rates in women with breast cancer

    NARCIS (Netherlands)

    Roelen, Corne A. M.; Koopmans, Petra C.; de Graaf, Jan H.; Balak, Fulya; Groothoff, Johan W.

    Most women are diagnosed with breast cancer when they are of working age. How long are breast cancer patients absent? How many of them return to work? ArboNed Occupational Health Services documents sickness absence data of 1 million workers of whom 40% were women. Between 2001 and 2005, 2,259 women

  6. Influence of non-thermal plasma on structural and electrical properties of globular and nanostructured conductive polymer polypyrrole in water suspension

    Czech Academy of Sciences Publication Activity Database

    Galář, P.; Khun, J.; Kopecký, D.; Scholtz, V.; Trchová, Miroslava; Fučíková, A.; Jirešová, J.; Fišer, L.

    2017-01-01

    Roč. 7, 08 November (2017), s. 1-10, č. článku 15068. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA17-04109S Institutional support: RVO:61389013 Keywords : conductive polymer * polypyrrole * plasma Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016

  7. Polyaniline cryogels: Biocompatibility of novel conducting macroporous material

    Czech Academy of Sciences Publication Activity Database

    Humpolíček, P.; Radaszkiewicz, K. A.; Capáková, Z.; Pacherník, J.; Bober, Patrycja; Kašpárková, V.; Rejmontová, P.; Lehocký, M.; Ponížil, P.; Stejskal, Jaroslav

    2018-01-01

    Roč. 8, 09 January (2018), s. 1-12, č. článku 135. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA17-05095S Institutional support: RVO:61389013 Keywords : polyaniline * cryogel * biocompatibility Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016

  8. Diurnal and seasonal fluctuations in wood ant (.i.Formica polyctena./i.) nest temperature in two geographically distant populations along a south-north gradient

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Finer, L.

    2007-01-01

    Roč. 54, - (2007), s. 251-259 ISSN 0020-1812 Grant - others:Academy of Finland(FI) 200870 Institutional research plan: CEZ:AV0Z60660521 Source of funding: V - iné verejné zdroje Keywords : ant nests * thermoregulation * Formica rufa group Subject RIV: EH - Ecology, Behaviour Impact factor: 1.391, year: 2007

  9. Two New Faces of Amifostine: Protector from DNA Damage in Normal Cells and Inhibitor of DNA Repair in Cancer Cells

    Czech Academy of Sciences Publication Activity Database

    Hofer, Michal; Falk, Martin; Komůrková, Denisa; Falková, Iva; Bačíková, Alena; Klejdus, B.; Pagáčová, Eva; Štefančíková, Lenka; Weiterová, Lenka; Angelis, Karel; Kozubek, Stanislav; Dušek, L.; Galbavy, S.

    2016-01-01

    Roč. 59, č. 7 (2016), s. 3003-3017 ISSN 0022-2623 R&D Projects: GA ČR GBP302/12/G157; GA ČR(CZ) GA16-12454S Institutional support: RVO:68081707 Keywords : alternative splicing variant * order chromatin -structure Subject RIV: BO - Biophysics Impact factor: 6.259, year: 2016

  10. Intricate disorder in defect fluorite/pyrochlore: a concord of chemistry and crystallography

    Czech Academy of Sciences Publication Activity Database

    Simeone, D.; Thorogood, G.J.; Huo, D.; Luneville, L.; Baldinozzi, G.; Petříček, Václav; Porcher, F.; Ribis, J.; Mazerolles, L.; Largeau, L.; Berar, J.F.; Surble, S.

    2017-01-01

    Roč. 7, Jun (2017), 1-7, č. článku 3727. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : disorder * atomic scale * metallic allys * oxides * fluorite/pyrochlore Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  11. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Sangappa. Articles written in Journal of Biosciences. Volume 30 Issue 2 March 2005 pp 259-268 Articles. Crystal structure of raw pure Mysore silk fibre based on (Ala-Gly)2-Ser-Gly peptide sequence using Linked-Atom-Least-Squares method · Sangappa S S Mahesh R Somashekar.

  12. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. R Bremananth. Articles written in Sadhana. Volume 31 Issue 3 June 2006 pp 259-276. New methodology for a person identification system · R Bremananth A Chitra · More Details Abstract Fulltext PDF. Reliable person identification is a key factor for any safety measure. Unlike other biometrics ...

  13. Male knowledge of danger signs of obstetric complications in an ...

    African Journals Online (AJOL)

    cannot be overlooked in this regard. The aim of this study was to determine men's knowledge of danger signs in pregnancy and their role in pregnancy related decision making. Methods: A cross sectional survey was conducted among 259 men aged 15-65 years in selected communities in Ibadan, Oyo State by multistage

  14. HANSENULA WICKERHAMII SP. N., A NEW YEAST FROM FINNISH SOIL

    Science.gov (United States)

    Capriotti, Augusto

    1961-01-01

    Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638

  15. Prevalence of Hemolivia mauritanica (Apicomplexa: Adeleina: Haemogregarinidae) in natural populations of tortoises of the genus Testudo in the east Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Široký, P.; Kamler, M.; Modrý, David

    2005-01-01

    Roč. 52, č. 4 (2005), s. 259-361 ISSN 0015-5683 R&D Projects: GA ČR GP524/03/D104 Grant - others:IGA VFU(CZ) 2/2004/FVHE Institutional research plan: CEZ:AV0Z60220518 Keywords : Apicomplexa * Hemolivia mauritanica Subject RIV: EG - Zoology Impact factor: 1.138, year: 2005

  16. Determination of radon concentration in spring gases with a portable semiconductor detector

    International Nuclear Information System (INIS)

    Endo, K.; Yanaga, M.; Yoshikawa, H.; Horiuchi, K.; Nakahara, H.; Murakami, Y.

    1985-01-01

    A portable integrating radon meter, alpha METER-400, was tested. The instrument detects α-rays of energy greater than 2.59 MeV. With this detector, the concentration of 222 Rn in spring gases at volcanic regions was determined. The results were compared with those observed by the liquid scintillation counting method. (author)

  17. Ticks infected via co-feeding transmission can transmit Lyme borreliosis to vertebrate hosts

    Czech Academy of Sciences Publication Activity Database

    Belli, A.; Sarr, A.; Rais, O.; Rego, Ryan O. M.; Voordouw, M.J.

    2017-01-01

    Roč. 7, JUL 10 (2017), č. článku 5006. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Ixodes ricinus ticks * disease spirochete * borne pathogens * r-0 model * vector * mice * immunity * persistence Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 4.259, year: 2016

  18. SLC22A3 polymorphisms do not modify pancreatic cancer risk, but may influence overall patient survival

    Czech Academy of Sciences Publication Activity Database

    Mohelníková-Duchoňová, B.; Strouhal, O.; Hughes, D. J.; Holcatová, I.; Oliverius, M.; Kala, Z.; Campa, D.; Rizzato, C.; Canzian, F.; Pezzilli, R.; Talar-Wojnarowska, R.; Malecka-Panas, E.; Sperti, C.; Federico Zambon, C.; Pedrazzoli, S.; Fogar, P.; Milanetto, A.C.; Capurso, G.; Fave, G.D.; Valente, R.; Gazouli, M.; Malleo, G.; Lawlor, R.T.; Strobel, O.; Hackert, T.; Giese, N.; Vodička, Pavel; Vodičková, Ludmila; Landi, S.; Tavano, F.; Gioffreda, D.; Piepoli, A.; Pazienza, V.; Mambrini, A.; Pedata, M.; Cantore, M.; Bambi, F.; Ermini, S.; Funel, N.; Lemstrová, R.; Souček, P.

    2017-01-01

    Roč. 7, MAR 2017 (2017), s. 43812 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP301/12/1734 Institutional support: RVO:68378041 Keywords : genome-wide association * genetic susceptibility * loci * transporters Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  19. Secondary School Administration in Anambra State Today ...

    African Journals Online (AJOL)

    The study, a descriptive survey research design was used to identify the challenges that impede secondary school administration today in Anambra State. The population of the study was all the 259 public secondary school principals in the state. Two research questions and two null hypotheses guided the study. A 20-item ...

  20. Administrative environmental proceedings in the electromagnetic pollution field; Procedure autorizzatorie nel settore dell'inquinamento da campi elettromagnetici

    Energy Technology Data Exchange (ETDEWEB)

    Fracchia, Fabrizio [Bocconi Univ., Milano (Italy). IDC Istituto di diritto comparato

    2005-05-15

    The aim of the research at issue is to understand the general aspects of administrative environmental proceedings in the electromagnetic pollution field, as they are regulated in Italy both by the Law of February 22, 2001, No. 36 and by the art. 87 of the Legislative Decree of August 1, 2003, No. 259 (by means of this decree, Italy implemented a package of EU Directives -2002/19/EC, 2002/20/EC, 2002/21/EC and 2002/22/EC - in the TLC sector; entered into force on September 16, 2003, it introduced the so-called Unique Code on Electronic Communications) [Italian] Il lavoro ha ad oggetto l'analisi delle procedure autorizzatorie nel settore dell'inquinamento da campi elettromagnetici disciplinate dalla legge 22 febbraio 2001, n. 36 e dall'art. 87, d.lgs. 1 agosto 2003, n. 259 (codice delle comunicazioni elettroniche). Dopo aver registrato la presenza, all'interno di siffatti procedimenti, delle tradizionali funzioni assegnate al procedimento amministrativo, l'indagine individua nel dettaglio i principi stabiliti dalla normativa e i caratteri dell'autorizzazione, indugiando in particolare sul profilo del margine di discrezionalita sussistente in capo all'amministrazione. L'angustia di questo spazio di discrezionalita viene tra l'altro collegato alla rilevanza che, nel settore in esame, risulta avere il principio di precauzione. Specifica attenzione e dedicata al procedimento delineato dall'art. 87, d.lgs. 259/2003, cit.: vengono analizzati i titoli di legittimazione ivi disciplinati, i rapporti con l'istituto della valutazione di impatto ambientale, le fasi procedimentali, la conferenza di servizi e i limiti di applicabilita del meccanismo del silenzio assenso, il tutto avendo come riferimento essenziale il tema della precauzione, il principio di doverosita e la loro valenza normativa.

  1. Interaction between O-GlcNAc modification and tyrosine phosphorylation of prohibitin: implication for a novel binary switch.

    Directory of Open Access Journals (Sweden)

    Sudharsana R Ande

    Full Text Available Prohibitin (PHB or PHB1 is an evolutionarily conserved, multifunctional protein which is present in various cellular compartments including the plasma membrane. However, mechanisms involved in various functions of PHB are not fully explored yet. Here we report for the first time that PHB interacts with O-linked beta-N-acetylglucosamine transferase (O-GlcNAc transferase, OGT and is O-GlcNAc modified; and also undergoes tyrosine phosphorylation in response to insulin. Tyrosine 114 (Tyr114 and tyrosine 259 (Tyr259 in PHB are in the close proximity of potential O-GlcNAc sites serine 121 (Ser121 and threonine 258 (Thr258 respectively. Substitution of Tyr114 and Tyr259 residues in PHB with phenylalanine by site-directed mutagenesis results in reduced tyrosine phosphorylation as well as reduced O-GlcNAc modification of PHB. Surprisingly, this also resulted in enhanced tyrosine phosphorylation and activity of OGT. This is attributed to the presence of similar tyrosine motifs in PHB and OGT. Substitution of Ser121 and Thr258 with alanine and isoleucine respectively resulted in attenuation of O-GlcNAc modification and increased tyrosine phosphorylation of PHB suggesting an association between these two dynamic modifications. Sequence analysis of O-GlcNAc modified proteins having known O-GlcNAc modification site(s or known tyrosine phosphorylation site(s revealed a strong potential association between these two posttranslational modifications in various proteins. We speculate that O-GlcNAc modification and tyrosine phosphorylation of PHB play an important role in tyrosine kinase signaling pathways including insulin, growth factors and immune receptors signaling. In addition, we propose that O-GlcNAc modification and tyrosine phosphorylation is a novel previously unidentified binary switch which may provide new mechanistic insights into cell signaling pathways and is open for direct experimental examination.

  2. Two flagellar BAR domain proteins in Trypanosoma brucei with stage-specific regulation

    Czech Academy of Sciences Publication Activity Database

    Číčová, Z.; Dejung, M.; Skalický, Tomáš; Eisenhuth, N.; Hanselmann, S.; Morriswood, B.; Figueiredo, L.M.; Butter, F.; Janzen, C. J.

    2016-01-01

    Roč. 6, 25 October (2016), č. článku 35826. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : variant surface glycoprotein * attachment zone filament * blood stream forms * life cycle stages * paraflagellar rod * stable transformation * cell morphogenesis * ortholog groups * psi blast * membrane Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  3. Network Inference and Maximum Entropy Estimation on Information Diagrams

    Czech Academy of Sciences Publication Activity Database

    Martin, E.A.; Hlinka, J.; Meinke, A.; Děchtěrenko, Filip; Tintěra, J.; Oliver, I.; Davidsen, J.

    2017-01-01

    Roč. 7, č. 1 (2017), s. 1-15, č. článku 7062. ISSN 2045-2322 R&D Projects: GA ČR GA13-23940S Institutional support: RVO:68081740 Keywords : complex networks * mutual information * entropy maximization * fMRI Subject RIV: AN - Psychology OBOR OECD: Cognitive sciences Impact factor: 4.259, year: 2016

  4. High-yield fabrication and properties of 1.4 nm nanodiamonds with narrow size distribution

    Czech Academy of Sciences Publication Activity Database

    Stehlík, Štěpán; Varga, Marián; Ledinský, Martin; Miliaieva, Daria; Kozak, Halyna; Skakalova, V.; Mangler, C.; Pennycook, T. J.; Meyer, J.C.; Kromka, Alexander; Rezek, Bohuslav

    2016-01-01

    Roč. 6, Dec (2016), 1-8, č. článku 38419. ISSN 2045-2322 R&D Projects: GA ČR GA15-01809S Institutional support: RVO:68378271 Keywords : detonation nanodiamonds * Raman-spectroscopy * diamond nanoparticles * selective oxidation * ion-implantation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  5. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30120515; CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  6. effet de la macrofaune et des modes de gestion de la fertilité sur le ...

    African Journals Online (AJOL)

    crop in semi-arid West Africa. PhD Thesis. University and research centre, Wagenin- gen, The Netherland, 193 p. Ouédraogo E., Mando A., Brussaard L., 2004. Soil macrofaunal-mediated organic resource disappearance in semi-arid West Africa. Appl. Soil Ecol, 27 : 259 - 267. Ouédraogo E., Mando A., Stroosnijder L., 2006.

  7. Variability of space-use patterns in a free living eusocial rodent, Ansell’s mole-rat indicates age-based rather than caste polyethism

    Czech Academy of Sciences Publication Activity Database

    Šklíba, Jan; Lövy, M.; Burda, H.; Šumbera, R.

    2016-01-01

    Roč. 6, DEC 06 (2016), č. článku 37497. ISSN 2045-2322 EU Projects: European Commission(XE) 669609 - Diversity6continents Institutional support: RVO:60077344 Keywords : eusocial rodent * mole-rats * Fukomys anselli Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep37497

  8. The Contribution of Counseling Providers to the Success or Failure of Marriages

    Science.gov (United States)

    Ansah-Hughes, Winifred

    2015-01-01

    This study is an investigation into the contribution of counseling providers to the success or failure of marriages. The purposive and the simple random sampling methods were used to select eight churches and 259 respondents (married people) in the Techiman Municipality. The instrument used to collect data was a 26-item questionnaire including a…

  9. Spatial mapping of metals in tissue-sections using combination of mass-spectrometry and histology through image registration

    Czech Academy of Sciences Publication Activity Database

    Anýz, J.; Vysloužilová, L.; Vaculovič, T.; Tvrdoňová, M.; Kanický, V.; Haase, H.; Horák, Vratislav; Štěpánková, O.; Heger, Z.; Adam, V.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 40169. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1609 Institutional support: RVO:67985904 Keywords : melanoma patients * mixed effects models * bearing Libechov minipig Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemical research methods Impact factor: 4.259, year: 2016

  10. Optical observations of enhanced activity of the 2005 Draconid meteor shower

    Czech Academy of Sciences Publication Activity Database

    Koten, Pavel; Borovička, Jiří; Spurný, Pavel; Štork, Rostislav

    2007-01-01

    Roč. 466, č. 2 (2007), s. 729-735 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030502; GA ČR GA205/05/0543 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteors * meteor shower s * Draconids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  11. Internal dynamics of intense twin beams and their coherence

    Czech Academy of Sciences Publication Activity Database

    Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.

    2016-01-01

    Roč. 6, Feb (2016), 1-8, č. článku 22320. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : dynamics of intense * twin beams * pump-depleted parametric * down-conversion * coherence Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  12. Robustness of one-dimensional viscous fluid motion under multidimensional perturbations

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Sun, Y.

    2015-01-01

    Roč. 259, č. 12 (2015), s. 7529-7539 ISSN 0022-0396 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes equations * 1-D compressible fluid flow * relative energy Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022039615004325

  13. Universal growth modes of high-elevation conifers

    Czech Academy of Sciences Publication Activity Database

    Datsenko, N. M.; Sonechkin, D. M.; Büntgen, Ulf; Yang, B.

    2016-01-01

    Roč. 38, JUN (2016), s. 38-50 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-ring chronologies * summer temperature-variations * northeastern tibetan plateau * climate signal * fennoscandian summers * annual precipitation * density * variability * qinghai * Growth modes * Ring width and maximum latewood density * Eigenvector analysis Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016

  14. Structure-Activity Relationship of F-18-Labeled Phosphoramidate Peptidomimetic Prostate-Specific Membrane Antigen (PSMA)-Targeted Inhibitor Analogues for PET Imaging of Prostate Cancer

    Czech Academy of Sciences Publication Activity Database

    Dannoon, S.; Ganguly, T.; Cahaya, H.; Geruntho, J. J.; Galliher, M. S.; Beyer, S. K.; Choy, C.J.; Hopkins, M.R.; Regan, M.; Blecha, J.E.; Škultétyová, Ĺubica; Drake, Ch.R.; Jivan, S.; Bařinka, Cyril; Jones, E. F.; Berkman, C.E.; VanBrocklin, H.F.

    2016-01-01

    Roč. 59, č. 12 (2016), s. 5684-5694 ISSN 0022-2623 R&D Projects: GA ČR GAP301/12/1513; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : GLUTAMATE CARBOXYPEPTIDASE-II * REACTION-MECHANISM * FOLATE-HYDROLASE Subject RIV: FD - Oncology ; Hematology Impact factor: 6.259, year: 2016

  15. Spatial distribution of organic pollutants (PAHs and polar pesticides) in the floodplain of the Ohře (Eger) River, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Fikarová, J.; Kříženecká, S.; Elznicová, J.; Faměra, Martin; Lelková, T.; Matkovič, J.; Matys Grygar, Tomáš

    2018-01-01

    Roč. 18, č. 1 (2018), s. 259-275 ISSN 1439-0108 R&D Projects: GA ČR(CZ) GA15-00340S Institutional support: RVO:61388980 Keywords : Chemostratigraphy * Floodplain architecture * Organic pollutants * PAH * Pesticides Subject RIV: DD - Geochemistry OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 2.522, year: 2016

  16. White-nose syndrome without borders: Pseudogymnoascus destructans infection tolerated in Europe and Palearctic Asia but not in North America

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan; Banďouchová, H.; Brichta, J.; Cmoková, A.; Jaron, K. S.; Kolařík, Miroslav; Kováčová, V.; Kubátová, A.; Nováková, Alena; Orlov, O.; Pikula, J.; Presetnik, P.; Šuba, J.; Zahradníková Jr., A.; Martínková, Natália

    2016-01-01

    Roč. 6, č. 19829 (2016), č. článku 19829. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:68081766 ; RVO:61388971 Keywords : White-nose syndrome * zoonotic viruses * emerging disease Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016

  17. The perspectives for genetically modified cellulosic biofuels in the Central European conditions

    Czech Academy of Sciences Publication Activity Database

    Bláhová, P.; Janda, K.; Krištoufek, Ladislav

    2014-01-01

    Roč. 60, č. 6 (2014), s. 247-259 ISSN 0139-570X Grant - others:GA ČR(CZ) GAP402/11/0948 Program:GA Institutional support: RVO:67985556 Keywords : ellulosic biofuels * genetic modifications Subject RIV: AH - Economics Impact factor: 0.442, year: 2014 http://library.utia.cas.cz/separaty/2014/E/kristoufek-0433521.pdf

  18. Costly neighbours: Heterospecific competitive interactions increase metabolic rates in dominant species

    Czech Academy of Sciences Publication Activity Database

    Janča, M.; Gvoždík, Lumír

    2017-01-01

    Roč. 7, č. 5177 (2017), č. článku 5177. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-07140S Institutional support: RVO:68081766 Keywords : interference competition * intraspecific variation * terrestrial salamander * energy metabolism * natural selection * newts Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.259, year: 2016

  19. Curriculum Orientations of Pre-Service Teachers in Jordan: A Required Reform Initiative for Professional Development

    Science.gov (United States)

    Ashour, Rateb; Khasawneh, Samer; Abu-Alruz, Jamal; Alsharqawi, Subhi

    2012-01-01

    The primary purpose of this study was to determine the curriculum orientations of pre-service teachers at a university in Jordan. Rigorous translation procedures were utilized to validate an Arabic version of the Curriculum Orientation Inventory (COI) for use in Jordan. The validated COI was administered to a sample of 259 pre-service teachers who…

  20. Accessibility of women farmers to agricultural information in South ...

    African Journals Online (AJOL)

    Furthermore, the women farmers were accessible to technical information on improved seeds (x = 2.59), storage methods (x = 2.44), but poor access to operating farm machinery (x =0.49) and weather forecast (x =0.68). With regard to economic information they were accessible to market locations (x =2.40), but had low ...

  1. Experimental Study of the Effect of Si/Al Composition on the Aluminum Distribution in (Al)MCM-41

    Czech Academy of Sciences Publication Activity Database

    Dědeček, Jiří; Žilková, Naděžda; Čejka, Jiří

    44-45, 1/3 (2001), s. 259-266 ISSN 1387-1811 R&D Projects: GA AV ČR IAA4040001; GA AV ČR IBS4040017 Institutional research plan: CEZ:AV0Z4040901 Keywords : (Al)MCM-41 * Al distribution * VIS spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.497, year: 2001

  2. Pán a pán, který běží – vývoj kresby v mladším školním věku

    Czech Academy of Sciences Publication Activity Database

    Vágnerová, M.; Janošová, Pavlína

    2017-01-01

    Roč. 51, č. 4 (2017), s. 240-259 ISSN 0555-5574 Grant - others:AV ČR(CZ) StrategieAV21/14 Program:StrategieAV Institutional support: RVO:68081740 Keywords : development of drawing * early school age * running human figure drawing * diagnostic possibilitie of drawing Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations)

  3. Specific Inhibitors of HIV Capsid Assembly Binding to the C-Terminal Domain of the Capsid Protein: Evaluation of 2-Arylquinazolines as Potential Antiviral Compounds

    Czech Academy of Sciences Publication Activity Database

    Machara, A.; Lux, V.; Kožíšek, Milan; Grantz Šašková, Klára; Štěpánek, O.; Kotora, M.; Parkan, Kamil; Pávová, Marcela; Glass, B.; Sehr, P.; Lewis, J.; Müller, B.; Kräusslich, H. G.; Konvalinka, Jan

    2016-01-01

    Roč. 59, č. 2 (2016), s. 545-558 ISSN 0022-2623 R&D Projects: GA ČR GA13-19561S EU Projects: European Commission(XE) 201095 - HIV ACE Institutional support: RVO:61388963 Keywords : HIV -1 assembly * capsid * high-throughput screening * AlphaScreen assay Subject RIV: CE - Biochemistry Impact factor: 6.259, year: 2016

  4. Stress among Secondary School Teachers in Ebonyi State, Nigeria: Suggested Interventions in the Worksite Milieu

    Science.gov (United States)

    Nwimo, Ignatius O.; Onwunaka, Chinagorom

    2015-01-01

    The aim of the study was to determine the level of stress experienced by secondary school teachers in Ebonyi State. The dimensions of stress studied included physical stress, mental stress, emotional stress and social stress. The study adopted the cross-sectional survey design using a sample of 660 (male 259, female 401) teachers randomly drawn…

  5. 17 CFR 250.57 - Notices and reports to be filed under section 33.

    Science.gov (United States)

    2010-04-01

    ... section 33. (a) Notification of Status as Foreign Utility Company. Form U-57 (§ 259.207 of this chapter), notification of status as a foreign utility company, may be filed by, or on behalf of, an entity that seeks to... COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Regulation...

  6. Lipid Driven Nanodomains in Giant Lipid Vesicles are Fluid and Disordered

    Czech Academy of Sciences Publication Activity Database

    Koukalová, Alena; Amaro, Mariana; Aydogan, Gokcan; Gröbner, G.; Williamson, P. T. F.; Mikhalyov, I.; Hof, Martin; Šachl, Radek

    2017-01-01

    Roč. 7, JUL 2017 (2017), č. článku 5460. ISSN 2045-2322 R&D Projects: GA ČR GA17-03160S Institutional support: RVO:61388955 Keywords : FLUORESCENCE CORRELATION SPECTROSCOPY * PLASMA-MEMBRANE VESICLES * RESONANCE ENERGY-TRANSFER Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  7. Microwave Assisted Synthesis of Magnetically Responsive Composite Materials

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Pospišková, K.; Maděrová, Zdeňka; Baldíková, E.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 239-243 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA ČR(CZ) GAP503/11/2263 Institutional support: RVO:67179843 Keywords : saccharomyces cerevisiae * cells immobilization * chitosan * magnetite * microwave irradiation * yeast Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2015

  8. International Uranium Resources Evaluation Project (IUREP) national favourability studies: Niue

    International Nuclear Information System (INIS)

    1977-12-01

    Niue is described as a coral island containing 259 square kilometers, located between Tonga and the Southern Cook Islands in the Central Pacific. Geologically, little is known, or can be deduced from available information, therefore reported occurrences of uranium are the basis for a potential in category 1 (less than 1,000 tonnes U) . (author)

  9. Family Functioning Predictors of Self-Concept and Self-Esteem in Children at Risk for Learning Disabilities in Oman: Exclusion of Parent and Gender Contribution

    Science.gov (United States)

    Emam, Mahmoud Mohamed; Abu-Serei, Usama Saad

    2014-01-01

    The study investigated whether family functioning can predict the self-concept and self-esteem of normally achieving (NA) and at risk for learning disabilities (LD) students in Oman regardless of parent education level and gender status. A total of 259 elementary school students were selected from schools in the main districts of Muscat, the…

  10. The Burden of Pulmonary Hypertension in Patients with ...

    African Journals Online (AJOL)

    Results: A total of 1390 echocardiogram reports done at Conquest Medical Imaging, Enugu, from July 2009 to August 2013 were retrospectively reviewed. Degenerative mitral valve disease was noted in 18.7% of the patients, (259/1390) made up of 149 males and 110 females with a mean age of 68.3 (14.4) years.

  11. Bibliography of publications and manuscripts relating to the Bohemian/Bavarian Forest lakes

    Czech Academy of Sciences Publication Activity Database

    Vrba, Jaroslav (ed.)

    2000-01-01

    Roč. 4, č. 4 (2000), s. 259-278 ISSN 1211-7420. [Acidified Lakes in the Bohemian/Bavarian Forest - History, Present and Future. Č. Budějovice, 21.03.2000-23.03.2000] R&D Projects: GA ČR GA206/97/0072; GA ČR GA206/98/0727 Subject RIV: DA - Hydrology ; Limnology

  12. Erythropoietin and carbamylated erythropoietin promote histone deacetylase 5 phosphorylation and nuclear export in rat hippocampal neurons

    International Nuclear Information System (INIS)

    Jo, Hye-Ryeong; Kim, Yong-Seok; Son, Hyeon

    2016-01-01

    Erythropoietin (EPO) produces neurotrophic effects in animal model of neurodegeneration. However, clinical use of EPO is limited due to thrombotic risk. Carbamylated EPO (cEPO), devoid of thrombotic risk, has been proposed as a novel neuroprotective and neurotrophic agent although the molecular mechanisms of cEPO remain incomplete. Here, we show a previously unidentified role of histone deacetylase 5 (HDAC5) in the actions of EPO and cEPO. EPO and cEPO regulate the HDAC5 phosphorylation at two critical sites, Ser259 and Ser498 through a protein kinase D (PKD) dependent pathway. In addition, EPO and cEPO rapidly stimulates nuclear export of HDAC5 in rat hippocampal neurons which expressing HDAC5-GFP. Consequently, EPO and cEPO enhanced the myocyte enhancer factor-2 (MEF2) target gene expression. Taken together, our results reveal that EPO and cEPO mediate MEF2 target gene expression via the regulation of HDAC5 phosphorylation at Ser259/498, and suggest that HDAC5 could be a potential mechanism contributing to the therapeutic actions of EPO and cEPO.

  13. Removal of NO {sub x} by microwave reactor with ammonium bicarbonate and Ga-A zeolites at low temperature

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Z.S. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China)]. E-mail: weizaishan98@163.com; Du, Z.Y. [School of Light Industry and Chemical Engineering, Guangdong University of Technology, Guangzhou 510006 (China); Lin, Z.H. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China); He, H.M. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China); Qiu, R.L. [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China)

    2007-08-15

    Microwave reactor with the mixture of ammonium bicarbonate (NH{sub 4}HCO{sub 3}) and Ga-A zeolites was set up to study the removal of nitrogen oxides (NO {sub x} ) from waste gas with excess oxygen concentration (14-19%) at low temperature (80-120 deg. C). The results showed that the microwave reactor filled with NH{sub 4}HCO{sub 3} and Ga-A zeolites could reduce NO {sub x} to nitrogen with the best purifying efficiency of 95.45% and the best denitrification amount of 89.28 mg h{sup -1}. The optimal microwave power and residence time (RT) on denitrification was 259-280 W and 0.259 s, respectively. Microwave denitrification effect of the experiment using ammonium bicarbonate and Ga-A zeolites was much higher than that using ammonium bicarbonate or Ga-A zeolites only. The mechanism for microwave-induced NO {sub x} reduction can be explained as the microwave-induced catalytic reaction between NO {sub x} and ammonium bicarbonate with Ga-A zeolites being the catalyst and microwave absorbent.

  14. Ketamine produces antidepressant-like effects through phosphorylation-dependent nuclear export of histone deacetylase 5 (HDAC5) in rats

    Science.gov (United States)

    Choi, Miyeon; Lee, Seung Hoon; Wang, Sung Eun; Ko, Seung Yeon; Song, Mihee; Choi, June-Seek; Duman, Ronald S.; Son, Hyeon

    2015-01-01

    Ketamine produces rapid antidepressant-like effects in animal assays for depression, although the molecular mechanisms underlying these behavioral actions remain incomplete. Here, we demonstrate that ketamine rapidly stimulates histone deacetylase 5 (HDAC5) phosphorylation and nuclear export in rat hippocampal neurons through calcium/calmodulin kinase II- and protein kinase D-dependent pathways. Consequently, ketamine enhanced the transcriptional activity of myocyte enhancer factor 2 (MEF2), which leads to regulation of MEF2 target genes. Transfection of a HDAC5 phosphorylation-defective mutant (Ser259/Ser498 replaced by Ala259/Ala498, HDAC5-S/A), resulted in resistance to ketamine-induced nuclear export, suppression of ketamine-mediated MEF2 transcriptional activity, and decreased expression of MEF2 target genes. Behaviorally, viral-mediated hippocampal knockdown of HDAC5 blocked or occluded the antidepressant effects of ketamine both in unstressed and stressed animals. Taken together, our results reveal a novel role of HDAC5 in the actions of ketamine and suggest that HDAC5 could be a potential mechanism contributing to the therapeutic actions of ketamine. PMID:26647181

  15. Erythropoietin and carbamylated erythropoietin promote histone deacetylase 5 phosphorylation and nuclear export in rat hippocampal neurons

    Energy Technology Data Exchange (ETDEWEB)

    Jo, Hye-Ryeong [Department of Biomedical Sciences, Graduate School of Biomedical Science and Engineering (Korea, Republic of); Kim, Yong-Seok [Department of Biomedical Sciences, Graduate School of Biomedical Science and Engineering (Korea, Republic of); Department of Biochemistry and Molecular Biology, College of Medicine, Hanyang University, 17 Haengdang-dong, Sungdong-gu, Seoul 133-791 (Korea, Republic of); Son, Hyeon, E-mail: hyeonson@hanyang.ac.kr [Department of Biomedical Sciences, Graduate School of Biomedical Science and Engineering (Korea, Republic of); Department of Biochemistry and Molecular Biology, College of Medicine, Hanyang University, 17 Haengdang-dong, Sungdong-gu, Seoul 133-791 (Korea, Republic of)

    2016-01-29

    Erythropoietin (EPO) produces neurotrophic effects in animal model of neurodegeneration. However, clinical use of EPO is limited due to thrombotic risk. Carbamylated EPO (cEPO), devoid of thrombotic risk, has been proposed as a novel neuroprotective and neurotrophic agent although the molecular mechanisms of cEPO remain incomplete. Here, we show a previously unidentified role of histone deacetylase 5 (HDAC5) in the actions of EPO and cEPO. EPO and cEPO regulate the HDAC5 phosphorylation at two critical sites, Ser259 and Ser498 through a protein kinase D (PKD) dependent pathway. In addition, EPO and cEPO rapidly stimulates nuclear export of HDAC5 in rat hippocampal neurons which expressing HDAC5-GFP. Consequently, EPO and cEPO enhanced the myocyte enhancer factor-2 (MEF2) target gene expression. Taken together, our results reveal that EPO and cEPO mediate MEF2 target gene expression via the regulation of HDAC5 phosphorylation at Ser259/498, and suggest that HDAC5 could be a potential mechanism contributing to the therapeutic actions of EPO and cEPO.

  16. Prevalence of Toxoplasma gondii infection in feral cats in Seoul, Korea.

    Science.gov (United States)

    Lee, Sang-Eun; Kim, Neung-Hee; Chae, Hee-Sun; Cho, Shin-Hyeong; Nam, Ho-Woo; Lee, Won-Ja; Kim, Sun-Heung; Lee, Jung-Hark

    2011-02-01

    The present study assessed the prevalence of Toxoplasma gondii infection in feral cat populations in Seoul using enzyme-linked immunosorbent assay (ELISA) and nested polymerase chain reaction (PCR). A total of 456 feral cats from 17 wards in Seoul was surveyed. The overall prevalence of T. gondii infection was 15.8% (69/456) by ELISA and 17.5% (80/456) by PCR; by gender, 17% (44/259) by ELISA and 16.2% (42/259) by PCR in males and 14.3% (28/196) by ELISA and 19.4% (38/196) by PCR in females. On a baseline of the Han River, prevalence was 15.1% (29/192) by ELISA and 15.6% (30/192) by PCR in the upper region and 16.4% (43/264) by ELISA and 18.9% (50/264) by PCR in the lower area. This suggested that toxoplasmosis is widespread throughout Seoul's feral cat population and it is critical that the city institute policies for the control of the feral cat population to reduce the risk of toxoplasmosis transmission to animals, including humans.

  17. TiO2-catalyzed synthesis of sugars from formaldehyde in extraterrestrial impacts on the early Earth

    Czech Academy of Sciences Publication Activity Database

    Civiš, Svatopluk; Szabla, Rafal; Szyja, B. M.; Smykowsky, D.; Ivanek, Ondřej; Knížek, Antonín; Kubelík, Petr; Šponer, Jiří; Ferus, Martin; Šponer, Judit E.

    2016-01-01

    Roč. 6, MAR 2016 (2016), č. článku 23199. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LQ1601; GA MŠk LM2010014 Institutional support: RVO:61388955 ; RVO:68378271 ; RVO:68081707 Keywords : HIGH-ENERGY CHEMISTRY * CARBONACEOUS METEORITES * CHEMICAL-COMPOSITION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.259, year: 2016

  18. Review: Julie Coleman: A History of Cant and Slang Dictionaries ...

    African Journals Online (AJOL)

    Julie Coleman. A History of Cant and Slang Dictionaries. Volume I: 1567– 1784. 2004, xii + 259 pp. ISBN 0 19 925471 0 (Hb.). Oxford: Oxford University Press. Price: £115. Julie Coleman. A History of Cant and Slang Dictionaries. Volume II: 1785– 1858. 2004, xiv + 338 pp. ISBN 0 19 925470 2 (Hb.). Oxford: Oxford ...

  19. Physiological basis for low-temperature survival and storage of quiescent larvae of the fruit fly Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Košťál, Vladimír; Korbelová, Jaroslava; Štětina, Tomáš; Poupardin, Rodolphe; Colinet, H.; Zahradníčková, Helena; Opekarová, Iva; Moos, Martin; Šimek, Petr

    2016-01-01

    Roč. 6, 30 AUG (2016), č. článku 32346. ISSN 2045-2322 R&D Projects: GA ČR GA13-01057S EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : cold storage * thermal fluctuations * -omics Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep32346

  20. Classification of weed vegetation of arable land in the Czech Republic and Slovakia

    Czech Academy of Sciences Publication Activity Database

    Lososová, Z.; Chytrý, M.; Cimalová, Š.; Otýpková, Z.; Pyšek, Petr; Tichý, L.

    2006-01-01

    Roč. 41, - (2006), s. 259-273 ISSN 1211-9520 R&D Projects: GA ČR(CZ) GA526/00/1443; GA ČR(CZ) GA206/05/0020 Institutional research plan: CEZ:AV0Z60050516 Keywords : weed vegetation * phytosociological classification * Česko a Slovensko Subject RIV: EF - Botanics Impact factor: 1.196, year: 2006