WorldWideScience

Sample records for mendelevium 258

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  3. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  4. 40 CFR 258.75 - Discounting.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Discounting. 258.75 Section 258.75... SOLID WASTE LANDFILLS Financial Assurance Criteria § 258.75 Discounting. The Director of an approved State may allow discounting of closure cost estimates in § 258.71(a), post-closure cost estimates in...

  5. 40 CFR 258.40 - Design criteria.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Design criteria. 258.40 Section 258.40... SOLID WASTE LANDFILLS Design Criteria § 258.40 Design criteria. (a) New MSWLF units and lateral... State or as specified in § 258.40(e) for unapproved States. The design must ensure that the...

  6. 47 CFR 73.258 - Indicating instruments.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Indicating instruments. 73.258 Section 73.258... Broadcast Stations § 73.258 Indicating instruments. (a) Each FM broadcast station shall be equipped with indicating instruments which conform with the specifications described in § 73.1215 for determining power by...

  7. 40 CFR 258.10 - Airport safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Airport safety. 258.10 Section 258.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Location Restrictions § 258.10 Airport safety. (a) Owners or operators of new...

  8. 20 CFR 632.258 - Allowable activities.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Allowable activities. 632.258 Section 632.258... EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.258 Allowable activities. Allowable activities are those listed in § 632.78-80 except that community service employment is not...

  9. 7 CFR 868.258 - Moisture.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Moisture. 868.258 Section 868.258 Agriculture... Governing Application of Standards § 868.258 Moisture. Water content in brown rice for processing as... purpose of this paragraph, “approved device” shall include the Motomco Moisture Meter and any other...

  10. 40 CFR 258.24 - Air criteria.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Air criteria. 258.24 Section 258.24 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Operating Criteria § 258.24 Air criteria. (a) Owners or operators of all MSWLFs must ensure that the units not violate any...

  11. 40 CFR 258.12 - Wetlands.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Wetlands. 258.12 Section 258.12... SOLID WASTE LANDFILLS Location Restrictions § 258.12 Wetlands. (a) New MSWLF units and lateral expansions shall not be located in wetlands, unless the owner or operator can make the following...

  12. 46 CFR 107.258 - Crane certification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Crane certification. 107.258 Section 107.258 Shipping... CERTIFICATION Inspection and Certification § 107.258 Crane certification. (a) The Coast Guard may accept current certificates issued by approved organizations as evidence of condition and suitability of cranes. The following...

  13. 40 CFR 258.13 - Fault areas.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Fault areas. 258.13 Section 258.13... SOLID WASTE LANDFILLS Location Restrictions § 258.13 Fault areas. (a) New MSWLF units and lateral expansions shall not be located within 200 feet (60 meters) of a fault that has had displacement in Holocene...

  14. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  15. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  16. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  17. 33 CFR 117.258 - Apalachicola River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apalachicola River. 117.258... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.258 Apalachicola River. The draw of the CSX Railroad bridge, mile 105.9, at River Junction shall open on signal Monday through Friday from 8 a...

  18. 40 CFR 258.74 - Allowable mechanisms.

    Science.gov (United States)

    2010-07-01

    ... institution, the owner or operator must obtain alternate financial assurance. (4) The owner or operator may... certified public accountant (or appropriate State agency) auditing its financial statement as required under... MUNICIPAL SOLID WASTE LANDFILLS Financial Assurance Criteria § 258.74 Allowable mechanisms. The mechanisms...

  19. 6 CFR 25.8 - Government contractor Defense.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Government contractor Defense. 25.8 Section 25.8...-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.8 Government contractor Defense. (a) Criteria for... applicability of the government contractor defense. In determining whether to issue such Certification, the...

  20. 40 CFR 258.41 - Project XL Bioreactor Landfill Projects.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Project XL Bioreactor Landfill Projects. 258.41 Section 258.41 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Design Criteria § 258.41 Project XL Bioreactor...

  1. Reference: 258 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available e also involved in a wide array of physiological and metabolic functions unique t...idopsis PEX12 gene is required for peroxisome biogenesis and is essential for development. 1 231-9 16113209 2005 Sep Plant physio... et al. 2005 Sep. Plant Physiol. 139(1):231-9. Peroxisomes perform diverse and vital functions in eukaryotes... 258 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16113209i Fan Jilian

  2. 40 CFR 258.22 - Disease vector control.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Disease vector control. 258.22 Section... MUNICIPAL SOLID WASTE LANDFILLS Operating Criteria § 258.22 Disease vector control. (a) Owners or operators of all MSWLF units must prevent or control on-site populations of disease vectors using techniques...

  3. 40 CFR 258.14 - Seismic impact zones.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Seismic impact zones. 258.14 Section... MUNICIPAL SOLID WASTE LANDFILLS Location Restrictions § 258.14 Seismic impact zones. (a) New MSWLF units and lateral expansions shall not be located in seismic impact zones, unless the owner or operator demonstrates...

  4. 40 CFR 258.27 - Surface water requirements.

    Science.gov (United States)

    2010-07-01

    ... FOR MUNICIPAL SOLID WASTE LANDFILLS Operating Criteria § 258.27 Surface water requirements. MSWLF... the discharge of a nonpoint source of pollution to waters of the United States, including wetlands...

  5. 40 CFR 258.55 - Assessment monitoring program.

    Science.gov (United States)

    2010-07-01

    ... migration and sample this well in accordance with § 258.55(d)(2); (iii) Must notify all persons who own the... variation in ground-water quality. A report documenting this demonstration must be certified by a qualified...

  6. 40 CFR 258.1 - Purpose, scope, and applicability.

    Science.gov (United States)

    2010-07-01

    ... solid waste management planning under RCRA. (h) Municipal solid waste landfill units failing to satisfy... CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS General § 258.1 Purpose, scope, and applicability. (a) The... Recovery Act (RCRA or the Act), as amended, for all municipal solid waste landfill (MSWLF) units and under...

  7. 40 CFR 258.73 - Financial assurance for corrective action.

    Science.gov (United States)

    2010-07-01

    ... required under § 258.58 of this part. The corrective action cost estimate must account for the total costs... or operator must increase the corrective action cost estimate and the amount of financial assurance... of the corrective action cost estimate and the amount of financial assurance provided under paragraph...

  8. 8 CFR 258.3 - Action upon arrival.

    Science.gov (United States)

    2010-01-01

    ..., docks, or real estate; possible environmental contamination; or possible injury or death to a person, a... OF LONGSHORE WORK BY ALIEN CREWMEN § 258.3 Action upon arrival. (a) The master or agent of the vessel... so. (b) If nonimmigrant crewmen will perform longshore work, the master or agent of the vessel shall...

  9. 40 CFR 258.3 - Consideration of other Federal laws.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Consideration of other Federal laws... CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS General § 258.3 Consideration of other Federal laws. The owner... rules, laws, regulations, or other requirements. ...

  10. 7 CFR 1944.258 - Professional assessment committee.

    Science.gov (United States)

    2010-01-01

    ...) Determine if non-elderly disabled individuals qualify under the definition of person with disabilities under... 1944.258 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE... this section, shall recommend services appropriate to the functional abilities and needs of each...

  11. 40 CFR 180.258 - Ametryn; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Ametryn; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.258 Ametryn; tolerances for residues. (a) General. Tolerances are established for residues of the desiccant...

  12. 40 CFR 258.16 - Closure of existing municipal solid waste landfill units.

    Science.gov (United States)

    2010-07-01

    ... waste landfill units. 258.16 Section 258.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Location Restrictions § 258.16 Closure of existing municipal solid waste landfill units. (a) Existing MSWLF units that cannot make the...

  13. Microscopic description of 258Fm fission dynamic with pairing

    Directory of Open Access Journals (Sweden)

    Scamps Guillaume

    2016-01-01

    Full Text Available Fission dynamic remains a challenge for nuclear microscopic theories. In order to understand the dynamic of the last stage of the fission process, the time-dependent Hartree-Fock approach with BCS pairing is applied to the describe the fission of the 258Fm. A good agreement is found for the one-body observables: the total kinetic energy and the average mass asymmetry. The non-physical dependence of two-body observables with the initial shape is discussed.

  14. Phase I trial of dovitinib (TKI258) in recurrent glioblastoma.

    Science.gov (United States)

    Schäfer, Niklas; Gielen, Gerrit H; Kebir, Sied; Wieland, Anja; Till, Andreas; Mack, Frederic; Schaub, Christina; Tzaridis, Theophilos; Reinartz, Roman; Niessen, Michael; Fimmers, Rolf; Simon, Matthias; Coch, Christoph; Fuhrmann, Christine; Herrlinger, Ulrich; Scheffler, Björn; Glas, Martin

    2016-07-01

    Dovitinib (TKI258) is an oral multi-tyrosine kinase inhibitor of FGFR, VEGFR, PDGFR β, and c-Kit. Since dovitinib is able to cross the blood-brain barrier and targets brain tumor-relevant pathways, we conducted a phase I trial to demonstrate its safety in recurrent glioblastoma (GBM). Patients with first or second GBM recurrence started treatment with the maximal tolerated dose (MTD) previously established in systemic cancer patients (500 mg/d, 5 days on/2 days off). A modified 3 + 3 design in three cohorts (500, 400, 300 mg) was used. Twelve patients were enrolled. Seventy-two adverse events (AEs) occurred and 16.7 % of AEs were classified as ≥CTC grade 3 toxicity, mainly including hepatotoxicity and hematotoxicity. Only one out of six patients of the 300-mg cohort showed grade 3 toxicity. The PFS-6 rate was 16.7 %, and it was not associated with detection of the FGFR-TACC gene fusion in the tumor. Dovitinib is safe in patients with recurrent GBM and showed efficacy in only some patients unselected for target expression. The recommended phase II dose of 300 mg would be substantially lower than the recently established MTD in systemic cancer patients. Further personalized trials are recommended.

  15. Yeast Interacting Proteins Database: YNL258C, YKR022C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YNL258C DSL1 Peripheral membrane protein required for Golgi-to-ER retrograde traffi...equired for Golgi-to-ER retrograde traffic; component of the ER target site that interacts with coatomer, th...it ORF YNL258C Bait gene name DSL1 Bait description Peripheral membrane protein r

  16. The arterial switch operation: 25-year experience with 258 patients.

    Science.gov (United States)

    Rudra, Harish S; Mavroudis, Constantine; Backer, Carl L; Kaushal, Sunjay; Russell, Hyde; Stewart, Robert D; Webb, Catherine; Sullivan, Christine

    2011-11-01

    At our institution, the arterial switch operation for transposition of the great arteries has transitioned from the Gore-Tex patch (W.L. Gore & Associates, Flagstaff, AZ) for pulmonary artery reconstruction to redundant pantaloon pericardial patch (RPPP). The (U-shaped) coronary artery button was used for coronary reimplantation. This study investigates overall mortality and factors for neopulmonary artery, neoaortic, and coronary artery surgical reintervention. We performed a retrospective chart review of all patients who underwent arterial switch between 1983 and 2007. Our surgical database, operative reports, and cardiology clinic charts were reviewed. Time to event was plotted as Kaplan-Meier curves. Predictors of time-to-event were examined using Cox proportional hazard modeling. A total of 258 patients underwent arterial switch during the study. Mortality declined from 15% (era I: 1983 to 1990) to 11% (era II: 1991 to 1998) to 7% (era III: 1999 to 2007). Era III had a significantly later time to death compared with era I (hazard ratio [HR] 0.62, p = 0.04). The RPPP had a lower neopulmonary artery reintervention rate compared with Gore-Tex; 9 of 225 (4%) versus 3 of 21 (14%), p = 0.008. Complex anatomy increased risk for neopulmonary reintervention (HR 3.3, p = 0.03). Surgical reintervention rate for coronary arteries was 2%. Complex coronary anatomy (HR 17.9, p = 0.01) predicted coronary reintervention. Predictors of neoaortic reintervention were prior pulmonary artery band (HR 4.3, p = 0.03), complex anatomy (HR 3.5, p = 0.01), and coronary artery anatomy (HR 3.5, p = 0.04). Arterial switch operation mortality has decreased. Conversion to RPPP reduced neopulmonary artery reintervention. The (U-shaped) coronary artery button technique is associated with low coronary reintervention rates. Complex coronary anatomy increases coronary and aortic reintervention. Prior pulmonary artery banding and complex anatomy increase aortic reintervention. Copyright © 2011

  17. Ancestral role of Pax2/5/8 in molluscan brain and multimodal sensory system development.

    Science.gov (United States)

    Wollesen, Tim; Rodríguez Monje, Sonia Victoria; Todt, Christiane; Degnan, Bernard M; Wanninger, Andreas

    2015-10-28

    Mollusks represent the largest lophotrochozoan phylum and exhibit highly diverse body plans. Previous studies have demonstrated that transcription factors such as Pax genes play important roles during their development. Accordingly, in ecdysozoan and vertebrate model organisms, orthologs of Pax2/5/8 are among others involved in the formation of the midbrain/hindbrain boundary, the auditory/geosensory organ systems, and the excretory system. Pax2/5/8 expression was investigated by in situ hybridization during the development of representatives of the two major molluscan subclades, Aculifera and Conchifera. Compared to the investigated polyplacophoran and bivalve species that lack larval statocysts as geosensory organs and elaborate central nervous systems (CNS), cephalopods possess highly centralized brains and statocysts. Pax2/5/8 is expressed in regions where sensory cells develop subsequently during ontogenesis. Expression domains include esthetes and the ampullary system in polyplacophorans as well as the eyes of cephalopods. No Pax2/5/8 expression was observed in the less centralized CNS of bivalve, polyplacophoran, and gastropod embryos, thus arguing for a loss of Pax2/5/8 involvement in CNS development in these lineages. In contrast, Pax2/5/8 is expressed among others in brain lobes along the trajectory of the esophagus that divides the cephalopod brain. Our results, along with those on Otx- and Hox-gene expression, demonstrate that the cephalopod condition is similar to that in mouse and fruit fly, with Otx being expressed in the anterior-most brain region (except for the vertical lobe) and a Pax2/5/8 expression domain separating the Otx-domain from a Hox-gene expressing posterior brain region. Thus, Pax2/5/8 appears to have been recruited independently into regionalization of non-homologous complex brains of organisms as different as squid, fruit fly, and mouse. In addition, Pax2/5/8 is expressed in multimodal sensory systems in mollusks such as the

  18. 37 CFR 258.3 - Royalty fee for secondary transmission of analog signals of broadcast stations by satellite...

    Science.gov (United States)

    2010-07-01

    ... transmission of analog signals of broadcast stations by satellite carriers. 258.3 Section 258.3 Patents... AND PROCEDURES ADJUSTMENT OF ROYALTY FEE FOR SECONDARY TRANSMISSIONS BY SATELLITE CARRIERS § 258.3 Royalty fee for secondary transmission of analog signals of broadcast stations by satellite carriers. (a...

  19. 37 CFR 258.4 - Royalty fee for secondary transmission of digital signals of broadcast stations by satellite...

    Science.gov (United States)

    2010-07-01

    ... transmission of digital signals of broadcast stations by satellite carriers. 258.4 Section 258.4 Patents... AND PROCEDURES ADJUSTMENT OF ROYALTY FEE FOR SECONDARY TRANSMISSIONS BY SATELLITE CARRIERS § 258.4 Royalty fee for secondary transmission of digital signals of broadcast stations by satellite carriers. (a...

  20. Yeast Interacting Proteins Database: YNL258C, YGL145W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YNL258C DSL1 Peripheral membrane protein required for Golgi-to-ER retrograde traffi...t description Peripheral membrane protein required for Golgi-to-ER retrograde traffic; component of the ER t

  1. Antibody-Mediated Killing of Carbapenem-Resistant ST258Klebsiella pneumoniaeby Human Neutrophils.

    Science.gov (United States)

    Kobayashi, Scott D; Porter, Adeline R; Freedman, Brett; Pandey, Ruchi; Chen, Liang; Kreiswirth, Barry N; DeLeo, Frank R

    2018-03-13

    Carbapenem-resistant Klebsiella pneumoniae is a problem worldwide. A carbapenem-resistant K. pneumoniae lineage classified as multilocus sequence type 258 (ST258) is prominent in the health care setting in many regions of the world, including the United States. ST258 strains can be resistant to virtually all clinically useful antibiotics; treatment of infections caused by these organisms is difficult, and mortality is high. As a step toward promoting development of new therapeutics for ST258 infections, we tested the ability of rabbit antibodies specific for ST258 capsule polysaccharide to enhance human serum bactericidal activity and promote phagocytosis and killing of these bacteria by human neutrophils. We first demonstrated that an isogenic wzy deletion strain is significantly more susceptible to killing by human heparinized blood, serum, and neutrophils than a wild-type ST258 strain. Consistent with the importance of capsule as an immune evasion molecule, rabbit immune serum and purified IgG specific for ST258 capsule polysaccharide type 2 (CPS2) enhanced killing by human blood and serum in vitro Moreover, antibodies specific for CPS2 promoted phagocytosis and killing of ST258 by human neutrophils. Collectively, our findings suggest that ST258 CPS2 is a viable target for immunoprophylactics and/or therapeutics. IMPORTANCE Infections caused by carbapenem-resistant K. pneumoniae are difficult to treat, and mortality is high. New prophylactic approaches and/or therapeutic measures are needed to prevent or treat infections caused by these multidrug-resistant bacteria. A strain of carbapenem-resistant K. pneumoniae , classified by multilocus sequence typing as ST258, is present in many regions of the world and is the most prominent carbapenem-resistant K. pneumoniae lineage in the United States. Here we show that rabbit antibodies specific for capsule polysaccharide of ST258 significantly enhance human serum bactericidal activity and promote phagocytosis and

  2. Genomic Analysis of the Emergence and Rapid Global Dissemination of the Clonal Group 258 Klebsiella pneumoniae Pandemic.

    Directory of Open Access Journals (Sweden)

    Jolene R Bowers

    Full Text Available Multidrug-resistant Klebsiella pneumoniae producing the KPC carbapenemase have rapidly spread throughout the world, causing severe healthcare-associated infections with limited antimicrobial treatment options. Dissemination of KPC-producing K. pneumoniae is largely attributed to expansion of a single dominant strain, ST258. In this study, we explore phylogenetic relationships and evolution within ST258 and its clonal group, CG258, using whole genome sequence analysis of 167 isolates from 20 countries collected over 17 years. Our results show a common ST258 ancestor emerged from its diverse parental clonal group around 1995 and likely acquired blaKPC prior to dissemination. Over the past two decades, ST258 has remained highly clonal despite diversity in accessory elements and divergence in the capsule polysaccharide synthesis locus. Apart from the large recombination event that gave rise to ST258, few mutations set it apart from its clonal group. However, one mutation occurs in a global transcription regulator. Characterization of outer membrane protein sequences revealed a profile in ST258 that includes a truncated OmpK35 and modified OmpK37. Our work illuminates potential genomic contributors to the pathogenic success of ST258, helps us better understand the global dissemination of this strain, and identifies genetic markers unique to ST258.

  3. Genomic Analysis of the Emergence and Rapid Global Dissemination of the Clonal Group 258 Klebsiella pneumoniae Pandemic.

    Science.gov (United States)

    Bowers, Jolene R; Kitchel, Brandon; Driebe, Elizabeth M; MacCannell, Duncan R; Roe, Chandler; Lemmer, Darrin; de Man, Tom; Rasheed, J Kamile; Engelthaler, David M; Keim, Paul; Limbago, Brandi M

    2015-01-01

    Multidrug-resistant Klebsiella pneumoniae producing the KPC carbapenemase have rapidly spread throughout the world, causing severe healthcare-associated infections with limited antimicrobial treatment options. Dissemination of KPC-producing K. pneumoniae is largely attributed to expansion of a single dominant strain, ST258. In this study, we explore phylogenetic relationships and evolution within ST258 and its clonal group, CG258, using whole genome sequence analysis of 167 isolates from 20 countries collected over 17 years. Our results show a common ST258 ancestor emerged from its diverse parental clonal group around 1995 and likely acquired blaKPC prior to dissemination. Over the past two decades, ST258 has remained highly clonal despite diversity in accessory elements and divergence in the capsule polysaccharide synthesis locus. Apart from the large recombination event that gave rise to ST258, few mutations set it apart from its clonal group. However, one mutation occurs in a global transcription regulator. Characterization of outer membrane protein sequences revealed a profile in ST258 that includes a truncated OmpK35 and modified OmpK37. Our work illuminates potential genomic contributors to the pathogenic success of ST258, helps us better understand the global dissemination of this strain, and identifies genetic markers unique to ST258.

  4. 40 CFR Appendix II to Part 258 - List of Hazardous Inorganic and Organic Constituents

    Science.gov (United States)

    2010-07-01

    ...-Dibromo-3-chloropropane; DBCP 96-12-8 Propane, 1,2-dibromo-3-chloro- 1,2-Dibromoethane; Ethylene dibromide... 258—List of Hazardous Inorganic and Organic Constituents Common name 1 CAS RN 2 Chemical abstracts service index name 3 Acenaphthene 83-32-9 Acenaphthylene, 1,2-dihydro- Acenaphthylene 208-96-8...

  5. MgrB variants in colistin-susceptible and colistin-resistant Klebsiella pneumoniae ST258

    OpenAIRE

    Béla Kocsis; Béla Kádár

    2017-01-01

    Resistance determinants of a colistin susceptible and five colistin resistant Klebsiella pneumoniae ST258 from a Hungarian outbreak were investigated. A novel MgrB variant in colistin susceptible strain was found. Elevated phoP and arn gene expressions and wild-type PmrB in all colistin resistant K. pneumoniae were detected. All strains lacked mcr-1.

  6. RCRA SUBTITLE D (258): SEISMIC DESIGN GUIDANCE FOR MUNICIPAL SOLID WASTE LANDFILL FACILITIES

    Science.gov (United States)

    On October 9, 1993, the new RCRA Subtitle D regulations (40 CFR Part 258) went into effect. These regulations are applicable to landfills receiving municipal solid waste (MSW) and establish minimum Federal criteria for the siting, design, operation, and closure of MSW landfills....

  7. Single-Chain Antibody Fragment VEGF Inhibitor RTH258 for Neovascular Age-Related Macular Degeneration

    DEFF Research Database (Denmark)

    Holz, Frank G; Dugel, Pravin U.; Weissgerber, Georges

    2016-01-01

    Purpose To assess the safety and efficacy of different doses of RTH258 applied as single intravitreal administration compared with ranibizumab 0.5 mg in patients with neovascular age-related macular degeneration (AMD). Design Six-month, phase 1/2, prospective, multicenter, double-masked, randomized...

  8. Reading Ruth 4 and Leviticus 25:8–55 in the light of the landless ...

    African Journals Online (AJOL)

    2016-06-24

    Jun 24, 2016 ... continuity with feminism as the liberation of women is advocated in our contextual reading of the. Hebrew Bible. To this ... order to articulate the social location from which Ruth 4 and Leviticus 25:8–55 will be read. Landless and poor ..... early Hellenisfic periods: Social memory and imaginafion, pp. 306–310 ...

  9. MgrB variants in colistin-susceptible and colistin-resistant Klebsiella pneumoniae ST258

    Directory of Open Access Journals (Sweden)

    Béla Kocsis

    2017-10-01

    Full Text Available Resistance determinants of a colistin susceptible and five colistin resistant Klebsiella pneumoniae ST258 from a Hungarian outbreak were investigated. A novel MgrB variant in colistin susceptible strain was found. Elevated phoP and arn gene expressions and wild-type PmrB in all colistin resistant K. pneumoniae were detected. All strains lacked mcr-1.

  10. GRS 1758–258: RXTE Monitoring of a Rare Persistent Hard State Black Hole

    Directory of Open Access Journals (Sweden)

    M. Obst

    2011-01-01

    Full Text Available GRS 1758–258 is the least studied of the three persistent black hole X-ray binaries in our Galaxy. It is also one of only two known black hole candidates, including all black hole transients, which shows a decrease of its 3-10 keV flux when entering the thermally dominated soft state, rather than an increase.We present the spectral evolution of GRS 1758–258 from RXTE-PCA observations spanning a time of about 11 years from 1996 to 2007. During this time, seven dim soft states are detected. We also consider INTEGRAL monitoring observations of the source and compare the long-term behavior to that of the bright persistent black hole X-ray binary Cygnus X-1. We discuss the observed state transitions in the light of physical scenarios for black hole transitions.

  11. MgrB variants in colistin-susceptible and colistin-resistant Klebsiella pneumoniae ST258.

    Science.gov (United States)

    Kocsis, Béla; Kádár, Béla; Tóth, Ákos; Fullár, Alexandra; Szabó, Dóra

    2017-10-01

    Resistance determinants of a colistin susceptible and five colistin resistant Klebsiella pneumoniae ST258 from a Hungarian outbreak were investigated. A novel MgrB variant in colistin susceptible strain was found. Elevated phoP and arn gene expressions and wild-type PmrB in all colistin resistant K. pneumoniae were detected. All strains lacked mcr-1. Copyright © 2016. Published by Elsevier B.V.

  12. Evolution and dissemination of the Klebsiella pneumoniae clonal group 258 throughout Israeli post-acute care hospitals, 2008-13.

    Science.gov (United States)

    Adler, Amos; Lifshitz, Ziv; Gordon, Michal; Ben-David, Debbie; Khabra, Efrat; Masarwa, Samira; Zion, Orit; Schwaber, Mitchell J; Carmeli, Yehuda

    2017-08-01

    The KPC-producing Klebsiella pneumoniae (KPC-KP) clonal group (CG) 258 has disseminated throughout Israeli post-acute care hospitals (PACHs). The objectives of the study were (i) to describe the evolution and (ii) to understand the dissemination modes of CG 258 in the PACH system in Israel. KPC-KP surveillance cultures isolates were collected in Israeli PACHs in three national point-prevalence surveys: 2008, 2011 and 2013. CG 258 was identified by pilv-l PCR. WGS was performed for CG 258 isolates from 9 of 14 PACHs and data extracted for core-genome MLST (cgMLST) and for capsule polysaccharide gene cluster analysis. The proportional representation of CG 258 among the KPC-KP isolates increased from 72 of 104 isolates (69.2%) in 2008 to 113 of 133 isolates (85%) in 2011 ( P  =   0.004 for 2008 versus 2011) and remained high in 2013 [56 of 67 isolates (83.6%)]. All isolates were related to CG 258 clade 2. cgMLST phylogenetic analysis showed relative convergence in the 2008 survey, with increasing diversification in the subsequent surveys. A predominantly institutional dissemination pattern was observed only in centre F from southern Israel. A predominantly regional dissemination pattern was observed in the two PACHs in Jerusalem. The other PACHs were characterized by a combined institutional and generalized pattern, with the majority of isolates clustering within the same PACH and survey. CG 258 clade 2 has retained its predominance despite increased diversification. Although interchanging of CG 258 strains occurred between most PACHs, local spread is the leading cause of its dissemination. © The Author 2017. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Safety of betaine as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2017-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on betaine as a novel food (NF) pursuant to Regulation (EC) No 258/97. The information provided on the composition, the specifications, the batch......-to-batch variability, stability and production process of the NF is sufficient and does not raise concerns about the safety of the NF. The NF is proposed to be used in foods intended to meet additional requirements for intense muscular effort with a maximum intake of 2.5 g/day of betaine for sports people above 10...

  14. Safety of hydroxytyrosol as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2017-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on hydroxytyrosol, which is chemically synthesised, as a novel food (NF) pursuant to Regulation (EC) No 258/97. The information provided on the comp......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on hydroxytyrosol, which is chemically synthesised, as a novel food (NF) pursuant to Regulation (EC) No 258/97. The information provided...... is the general population which excludes children under 36 months of age, pregnant women and breastfeeding women. Considering the no observed adverse effect level (NOAEL) of 50 mg/kg body weight per day from a subchronic oral toxicity study with the NF and the maximum anticipated daily intake for the NF......, the margin of exposure (MoE) would result in 100 for children (3–9 years of age) and at least 200 for adolescents, adults (excluding pregnant and breastfeeding women) and elderly. Taking into account that the anticipated daily intake of the NF would be in the range of or even less than the exposure...

  15. THE VARIABLE NEAR-INFRARED COUNTERPART OF THE MICROQUASAR GRS 1758–258

    Energy Technology Data Exchange (ETDEWEB)

    Luque-Escamilla, Pedro L. [Departamento de Ingeniería Mecánica y Minera, EPSJ, Universidad de Jaén, Campus Las Lagunillas s/n, A3-008, 23071 Jaén (Spain); Martí, Josep [Departamento de Física, EPSJ, Universidad de Jaén, Campus Las Lagunillas s/n, A3-420, 23071 Jaén (Spain); Muñoz-Arjonilla, Álvaro J., E-mail: peter@ujaen.es, E-mail: jmarti@ujaen.es, E-mail: ajmunoz@ujaen.es [Grupo de Investigación FQM-322, Universidad de Jaén, Campus Las Lagunillas s/n, A3-065, 23071 Jaén (Spain)

    2014-12-10

    We present a new study of the microquasar system GRS 1758–258 in the near-infrared domain based on archival observations with the Hubble Space Telescope and the NICMOS camera. In addition to confirming the near-infrared counterpart pointed out by Muñoz-Arjonilla et al., we show that this object displays significant photometric variability. From its average magnitudes, we also find that GRS 1758–258 fits well within the correlation between the optical/near-infrared and X-ray luminosity known to exist for low-mass, black-hole candidate X-ray binaries in a hard state. Moreover, the spectral energy distribution built using all radio, near-infrared, and X-ray data available closest in time to the NICMOS observations can be reasonably interpreted in terms of a self-absorbed radio jet and an irradiated accretion disk model around a stellar-mass black hole. All these facts match the expected behavior of a compact binary system and strengthen our confidence in the counterpart identification.

  16. Epidemic potential of Escherichia coli ST131 and Klebsiella pneumoniae ST258: a systematic review and meta-analysis

    Science.gov (United States)

    Dautzenberg, M J D; Haverkate, M R; Bonten, M J M; Bootsma, M C J

    2016-01-01

    Objectives Observational studies have suggested that Escherichia coli sequence type (ST) 131 and Klebsiella pneumoniae ST258 have hyperendemic properties. This would be obvious from continuously high incidence and/or prevalence of carriage or infection with these bacteria in specific patient populations. Hyperendemicity could result from increased transmissibility, longer duration of infectiousness, and/or higher pathogenic potential as compared with other lineages of the same species. The aim of our research is to quantitatively estimate these critical parameters for E. coli ST131 and K. pneumoniae ST258, in order to investigate whether E. coli ST131 and K. pneumoniae ST258 are truly hyperendemic clones. Primary outcome measures A systematic literature search was performed to assess the evidence of transmissibility, duration of infectiousness, and pathogenicity for E. coli ST131 and K. pneumoniae ST258. Meta-regression was performed to quantify these characteristics. Results The systematic literature search yielded 639 articles, of which 19 data sources provided information on transmissibility (E. coli ST131 n=9; K. pneumoniae ST258 n=10)), 2 on duration of infectiousness (E. coli ST131 n=2), and 324 on pathogenicity (E. coli ST131 n=285; K. pneumoniae ST258 n=39). Available data on duration of carriage and on transmissibility were insufficient for quantitative assessment. In multivariable meta-regression E. coli isolates causing infection were associated with ST131, compared to isolates only causing colonisation, suggesting that E. coli ST131 can be considered more pathogenic than non-ST131 isolates. Date of isolation, location and resistance mechanism also influenced the prevalence of ST131. E. coli ST131 was 3.2 (95% CI 2.0 to 5.0) times more pathogenic than non-ST131. For K. pneumoniae ST258 there were not enough data for meta-regression assessing the influence of colonisation versus infection on ST258 prevalence. Conclusions With the currently available data

  17. Microscopic Phase-Space Exploration Modeling of ^{258}Fm Spontaneous Fission.

    Science.gov (United States)

    Tanimura, Yusuke; Lacroix, Denis; Ayik, Sakir

    2017-04-14

    We show that the total kinetic energy (TKE) of nuclei after the spontaneous fission of ^{258}Fm can be well reproduced using simple assumptions on the quantum collective phase space explored by the nucleus after passing the fission barrier. Assuming energy conservation and phase-space exploration according to the stochastic mean-field approach, a set of initial densities is generated. Each density is then evolved in time using the nuclear time-dependent density-functional theory with pairing. This approach goes beyond the mean-field theory by allowing spontaneous symmetry breaking as well as a wider dynamical phase-space exploration leading to larger fluctuations in collective space. The total kinetic energy and mass distributions are calculated. New information on the fission process: fluctuations in scission time, strong correlation between TKE and collective deformation, as well as prescission particle emission, are obtained. We conclude that fluctuations of the TKE and mass are triggered by quantum fluctuations.

  18. Induction of Neuroendocrine Differentiation in Prostate Cancer Cells by Dovitinib (TKI-258 and its Therapeutic Implications

    Directory of Open Access Journals (Sweden)

    Shalini S. Yadav

    2017-06-01

    Full Text Available Prostate cancer (PCa remains the second-leading cause of cancer-related deaths in American men with an estimated mortality of more than 26,000 in 2016 alone. Aggressive and metastatic tumors are treated with androgen deprivation therapies (ADT; however, the tumors acquire resistance and develop into lethal castration resistant prostate cancer (CRPC. With the advent of better therapeutics, the incidences of a more aggressive neuroendocrine prostate cancer (NEPC variant continue to emerge. Although de novo occurrences of NEPC are rare, more than 25% of the therapy-resistant patients on highly potent new-generation anti-androgen therapies end up with NEPC. This, along with previous observations of an increase in the number of such NE cells in aggressive tumors, has been suggested as a mechanism of resistance development during prostate cancer progression. Dovitinib (TKI-258/CHIR-258 is a pan receptor tyrosine kinase (RTK inhibitor that targets VEGFR, FGFR, PDGFR, and KIT. It has shown efficacy in mouse-model of PCa bone metastasis, and is presently in clinical trials for several cancers. We observed that both androgen receptor (AR positive and AR-negative PCa cells differentiate into a NE phenotype upon treatment with Dovitinib. The NE differentiation was also observed when mice harboring PC3-xenografted tumors were systemically treated with Dovitinib. The mechanistic underpinnings of this differentiation are unclear, but seem to be supported through MAPK-, PI3K-, and Wnt-signaling pathways. Further elucidation of the differentiation process will enable the identification of alternative salvage or combination therapies to overcome the potential resistance development.

  19. The Subject of the Crime Provided by Article 258.1 of the Criminal Code of the Russian Federation

    Directory of Open Access Journals (Sweden)

    Natalia I. Kuznetsova

    2016-06-01

    Full Text Available The article reveals the content of the subject of the crime provided by article 258.1 of the Russian Criminal code. Attention is drawn to the need to clarify the criteria for the selection of wildlife for the list of particularly valuable wild animals and aquatic biological resources belonging to the species included in the Red List of Threatened Species of the Russian Federation and (or protected by international treaties of the Russian Federation. The article contains recommendation for supplementing the list of especially valuable wild animals and aquatic biological resources protected by norms of Article 258.1 of the Russian Criminal code.

  20. Epidemic potential of Escherichia coli ST131 and Klebsiella pneumoniae ST258 : a systematic review and meta-analysis

    NARCIS (Netherlands)

    Dautzenberg, M J D; Haverkate, M R; Bonten, M J M; Bootsma, M C J

    2016-01-01

    OBJECTIVES: Observational studies have suggested that Escherichia coli sequence type (ST) 131 and Klebsiella pneumoniae ST258 have hyperendemic properties. This would be obvious from continuously high incidence and/or prevalence of carriage or infection with these bacteria in specific patient

  1. Pax258 and Pax6 alternative splicing events in basal chordates and vertebrates: a focus on paired box domain

    Directory of Open Access Journals (Sweden)

    Peter eFabian

    2015-07-01

    Full Text Available Paired box transcription factors play important role in development and tissue morphogenesis. The number of Pax homologs varies among species studied so far, due to genome and gene duplications that have affected PAX family to a great extent. Based on sequence similarity and functional domains, four Pax classes have been identified in chordates, namely Pax1/9, Pax2/5/8, Pax3/7 and Pax4/6. Numerous splicing events have been reported mainly for Pax2/5/8 and Pax6 genes. Of significant interest are those events that lead to Pax proteins with presumed novel properties, such as altered DNA-binding or transcriptional activity. In the current study, a thorough analysis of Pax2/5/8 splicing events from cephalochordate and vertebrates was performed. We focused more on Pax2/5/8 and Pax6 splicing events in which the paired domain is involved. Three new splicing events were identified in Oryzias latipes, one of which seems to be conserved in Acanthomorphata. Using representatives from deuterostome and protostome phyla, a comparative analysis of the Pax6 exon-intron structure of the paired domain was performed, during an attempt to estimate the time of appearance of the Pax6(5a mRNA isoform. As shown in our analysis, this splicing event is absent in basal chordates and is characteristic of Gnathostomata. Moreover, expression pattern of alternative spliced variants was compared between basal chordates and fish species. In summary, our data indicate expansion of alternative mRNA variants in paired box region of Pax2/5/8 and Pax6 genes during the course of vertebrate evolution.

  2. 77 FR 6782 - In the Matter of: Kok Tong Lim, a/k/a Thomas Lim Blk 258A Compassvale Road #07-551 Singapore...

    Science.gov (United States)

    2012-02-09

    ... Thomas Lim Blk 258A Compassvale Road 07-551 Singapore 541258; Order Denying Export Privileges On October 9, 2009, in the U.S. District Court, District of Minnesota, Kok Tong Lim, a/k/a Thomas Lim, (``Lim..., a/k/a Thomas Lim, with the last known address at: Blk 258A,Compassvale Road 07-551, Singapore 541258...

  3. Two cases of monomicrobial intraabdominal abscesses due to KPC - 3 Klebsiella pneumoniae ST258 clone

    Directory of Open Access Journals (Sweden)

    Madonia Simona

    2011-09-01

    Full Text Available Abstract Background Knowledge of the etiology of pyogenic liver and pancreatic abscesses is an important factor in determining the success of combined surgical and antibiotic treatment. Literature shows geographical variations in the prevalence and distribution of causative organisms, and the spread of Klebsiella pneumoniae carbapenemase-producing bacteria is an emerging cause of abdominal infections. Case presentation We herein describe two cases of intra-abdominal abscesses due to monomicrobial infection by Klebsiella pneumoniae Sequence Type 258 producing K. pneumoniae carbapenemase 3 (KPC-Kp. In case 1, a 50-year-old HIV-negative Italian woman with chronic pancreatitis showed infection of a pancreatic pseudocystic lesion caused by KPC-Kp. In case 2, a 64-year-old HIV- negative Italian woman with pancreatic neoplasm and liver metastases developed a liver abscess due to KPC after surgery. Both women were admitted to our hospital but to different surgical units. The clonal relationship between the two isolates was investigated by pulsed-field gel electrophoresis (PFGE. In case 2, the patient was already colonized at admission and inter-hospital transmission of the pathogen was presumed. A long-term combination regimen of colistin with tigecycline and percutaneous drainage resulted in full recovery and clearance of the multidrug-resistant (MDR pathogen. Conclusions Timely microbiological diagnosis, the combined use of new and old antibiotics and radiological intervention appeared to be valuable in managing these serious conditions. The emergence and dissemination of MDR organisms is posing an increasing challenge for physicians to develop new therapeutic strategies and control and prevention frameworks.

  4. Safety of UV-treated milk as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2016-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on UV-treated milk as a novel food submitted pursuant to Regulation (EC) No 258/97, taking into account the comments and objections of a scientific...... nature raised by Member States. The novel food is cow’s milk (whole, semi-skimmed or skimmed) to which a treatment with ultraviolet (UV) radiation is applied after pasteurisation in order to extend the shelf life of the milk. This treatment results in an increase in the vitamin D3 concentrations....... The Panel considers that the provided compositional data, the specifications and the data from batch testing do not give rise to safety concerns. The data provided on the production process are sufficient and do not give rise to safety concerns. The target group is the general population with the exclusion...

  5. Volcanic Spreading and Regional Extension on Venus: Evidence from the Study of Ne Ngam Mons (43ºS/258ºE)

    Science.gov (United States)

    López, I.; Lillo, J.; Hansen, V. L.

    2002-03-01

    A detailed study of Ne Ngam Mons (43ºS/258ºE) has been carried out. We argue that the features present in the volcano and the changes in the regional fracture system are due to volcano spreading and its interplay with the regional stress field.

  6. Induction and detection of bystander effects after combined treatment of cells with 5-bromo-2 '-deoxyurine, Hoechst 33 258 and ultraviolet A light

    NARCIS (Netherlands)

    Xiao, Y.; de Feyter, E.; van Oven, C. H.; Stap, J.; Hoebe, R.; Havenith, S.; van Noorden, C. J. F.; Aten, J. A.

    2004-01-01

    Purpose: A combined treatment of cells with 5-bromo-2'-deoxyurine (BrdU), Hoechst 33 258 and ultraviolet A (UVA) light was used to introduce chromosomal aberrations in cells for the study of bystander effects in non-labelled cells. Materials and methods: Mixtures of BrdU-labelled and non-labelled

  7. Safety of 1-methylnicotinamide chloride (1-MNA) as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2017-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on 1-methylnicotinamide chloride (1-MNA) as a novel food (NF) ingredient submitted pursuant to Regulation (EC) No 258/97 of the European Parliament...... and the batch-to-batch variability of the NF is sufficient. The applicant intends to use 1-MNA in food supplements and proposes a maximum intake of 58 mg/day. 1-MNA is not genotoxic. In a subchronic rat study, epithelium degeneration of the non-glandular stomach was observed at all dose levels with increasing...... frequency. The Panel notes that the human stomach does not have non-glandular epithelium and considers this finding is toxicologically not relevant for humans. At doses of 500 and 1,000 mg/kg body weight (bw), changes of the urine pH, that did not reverse in the recovery period, were reported. As adversity...

  8. Characterization of ST258 Colistin-Resistant, blaKPC-Producing Klebsiella pneumoniae in a Greek Hospital.

    Science.gov (United States)

    Mavroidi, Angeliki; Katsiari, Maria; Likousi, Sofia; Palla, Eleftheria; Roussou, Zoi; Nikolaou, Charikleia; Maguina, Asimina; Platsouka, Evangelia D

    2016-07-01

    The emergence of colistin resistance may further contribute to treatment failure of infection caused by multidrug-resistant (MDR) Klebsiella pneumoniae. The colistin resistance rates were determined and colistin-resistant carbapenemase-producing K. pneumoniae (COL-R CP-Kp) were characterized over an 18-month period in a Greek hospital. Out of 135 carbapenemase producers, 19 isolates (14%) were categorized as resistant to colistin. Phenotypic and molecular characterization of the COL-R CP-Kp isolates revealed that all were MDR blaKPC producers and, excluding one isolate of MLST ST383, belonged to the international clonal lineage ST258. Furthermore, PCR amplification and sequencing of the mgrB locus revealed nucleotide sequences of different sizes and insertions of IS1- and IS5-like mobile elements. The majority (63%) of the COL-R blaKPC producers was recovered from patients in the intensive care unit (ICU) and clinical data indicated that all patients should have acquired these isolates in the ICU. The findings of the present study underscore a concerning evolution of colistin resistance in a setting of high K. pneumoniae carbapenemase (KPC)-Kp endemicity, such as Greece. Thus, continuous surveillance, molecular characterization, prudent use of antibiotics, and implementation of infection control measures for K. pneumoniae are urgent.

  9. An Update of the Evolving Epidemic of blaKPC Carrying Klebsiella pneumoniae in Sicily, Italy, 2014: Emergence of Multiple Non-ST258 Clones.

    Directory of Open Access Journals (Sweden)

    Celestino Bonura

    Full Text Available In Italy, Klebsiella pneumoniae carbapenemase producing K. pneumoniae (KPC-Kp strains are highly endemic and KPC producing CC258 is reported as the widely predominating clone. In Palermo, Italy, previous reports have confirmed this pattern. However, recent preliminary findings suggest that an epidemiological change is likely ongoing towards a polyclonal KPC-Kp spread. Here we present the results of molecular typing of 94 carbapenem non susceptible K. pneumoniae isolates detected during 2014 in the three different hospitals in Palermo, Italy.Ninety-four consecutive, non replicate carbapenem non susceptible isolates were identified in the three largest acute general hospitals in Palermo, Italy, in the six-month period March-August 2014. They were characterized by PCR for β-lactam, aminoglycoside and plasmid mediated fluoroquinolone resistance genetic determinants. The mgrB gene of the colistin resistant isolates was amplified and sequenced. Clonality was assessed by pulsed field gel electrophoresis and multilocus sequence typing. Eight non-CC258 sequence types (STs were identified accounting for 60% of isolates. In particular, ST307 and ST273 accounted for 29% and 18% of isolates. CC258 isolates were more frequently susceptible to gentamicin and non-CC258 isolates to amikacin. Colistin non susceptibility was found in 42% of isolates. Modifications of mgrB were found in 32 isolates.Concurrent clonal expansion of some STs and lateral transmission of genetic resistance determinants are likely producing a thorough change of the KPC-Kp epidemiology in Palermo, Italy. In our setting mgrB inactivation proved to substantially contribute to colistin resistance. Our findings suggest the need to continuously monitor the KPC-Kp epidemiology and to assess by a nationwide survey the possible shifting towards a polyclonal epidemic.

  10. The function and developmental expression of alternatively spliced isoforms of amphioxus and Xenopus laevis Pax2/5/8 genes: revealing divergence at the invertebrate to vertebrate transition

    Czech Academy of Sciences Publication Activity Database

    Short, S.; Kozmik, Zbyněk; Holland, L. Z.

    2012-01-01

    Roč. 318, č. 7 (2012), s. 555-571 ISSN 1552-5007 R&D Projects: GA ČR GAP305/10/2141; GA MŠk LH12047 Grant - others:NSF(US) MCB 06-20019 Institutional research plan: CEZ:AV0Z50520514 Keywords : Pax2/5/8 * alternative splicing * eye development * amphioxus * Xenopus laevis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.123, year: 2012

  11. Report on a request for initial assessment for marketing of synthetic hydroxytyrosol under Regulation (EC) No 258 97 concerning novel foods and novel food ingredients

    OpenAIRE

    Spanish Agency for Consumer Affairs, Food Safety and Nutrition

    2015-01-01

    The company Seprox Biotech S.L. has applied for authorisation to market synthetic hydroxytyrosol in the European Union, for addition, as an ingredient, to oils, fats and fruit and vegetable juices. This ingredient has no history of use in the European Union prior to 1997 and therefore comes within the scope of Regulation (EC) No 258/97 concerning novel foods and novel food ingredients. The Scientific Committee of the Spanish Agency for Consumer Affairs, Food Safety and Nutriti...

  12. Persistence of Klebsiella pneumoniae ST258 as the predominant clone of carbapenemase-producing Enterobacteriaceae in post-acute-care hospitals in Israel, 2008-13.

    Science.gov (United States)

    Adler, Amos; Hussein, Omar; Ben-David, Debby; Masarwa, Samira; Navon-Venezia, Shiri; Schwaber, Mitchell J; Carmeli, Yehuda

    2015-01-01

    To study the molecular characteristics of carbapenemase-producing Enterobacteriaceae (CPE) in post-acute-care hospitals (PACHs) in Israel and to analyse the temporal changes between 2008 and 2013. CPE isolates were obtained during two cross-sectional, point prevalence national surveys of PACHs in Israel performed in 2008 and 2013. Surveillance cultures were collected by streaking rectal swabs onto selective media. Isolates were identified to species level and tested for blaKPC, blaNDM and blaOXA-48 by PCR and by the Carba NP test. Molecular typing was done by PCR for the pilv-l gene, designed for the ST258 KPC-producing Klebsiella pneumoniae (KPC-KP) clone, BOX-PCR and MLST. The prevalence of CPE carriage in the first survey was 184/1147 (16%); all of the isolates were KPC-KP. The prevalence of CPE carriage in the second survey was 127/1287 (9.9%); of these isolates, 113 (89%) were KPC-KP, 9 (7%) were other KPC-producing species and 5 (4%) were NDM- and OXA-48-producing CPE (n = 1 and 4, respectively). The proportion of the KPC-KP population represented by the ST258 clone increased from 120/184 (65%) in 2008 to 91/113 (80%) in 2013. In 58% (71/122) of the KPC-CPE carriers identified in the 2013 survey, the source of acquisition was determined to be the PACH itself. All four OXA-48 CPE were acquired either directly or indirectly from patients arriving from the Palestinian Authority or Syria. Despite the decreased prevalence of CPE in Israeli PACHs, and the emergence of new types of CPE, the KPC-KP ST258 clone remains the predominant clone represented. © The Author 2014. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  13. Safety of Ecklonia cava phlorotannins as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2017-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion on the safety of Ecklonia cava phlorotannins (marketed as SeaPolynolTM) as a novel food submitted pursuant to Regulation (EC) No 258....... The intention is to market the novel food as a food supplement for healthy individuals over the age of 12 years. A subchronic repeated dose oral toxicity study in rodents tested the novel food at daily doses of 0, 375, 750 and 1,500 mg/kg body weight (bw). The Panel considers the middose as the no...

  14. Role of routine imaging in detecting recurrent lymphoma; a review of 258 patients with relapsed aggressive non-Hodgkin and Hodgkin lymphoma

    DEFF Research Database (Denmark)

    El-Galaly, Tarec Christoffer; Mylam, Karen Juul; Bøgsted, Martin

    2014-01-01

    After first-line therapy, patients with Hodgkin and aggressive non-Hodgkin lymphomas are followed closely for early signs of relapse. The current follow-up practice with frequent use of surveillance imaging is highly controversial and warrants a critical evaluation. Therefore a retrospective...... multicenter study of relapsed Hodgkin and aggressive non-Hodgkin lymphomas (nodal T-cell and diffuse large B-cell lymphomas) was conducted. All included patients had been diagnosed during the period 2002-2011 and relapsed after achieving complete remission on first-line therapy. Characteristics and outcome...... of imaging-detected relapses were compared to other relapses. A total of 258 patients with recurrent lymphoma were included in the study. Relapse investigations were initiated outside preplanned visits in 52% of the patients. Relapse detection could be attributed to patient-reported symptoms alone...

  15. Scientific Opinion on the safety of alginate-konjac-xanthan polysaccharide complex (PGX) as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2017-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion on alginate-konjac-xanthan polysaccharide complex (PGX) as a novel food (NF) submitted pursuant to Regulation (EC) No 258/97. The NF...... is an off-white granular powder composed of three non-starch polysaccharides: konjac glucomannan, xanthan gum and sodium alginate. The information provided on the composition, the specifications, the batch-to-batch variability and the stability of the NF is sufficient and does not raise safety concerns....... The production process is sufficiently described and does not raise concerns about the safety of the NF. The applicant intends to add the NF to a variety of foods as well as to market the NF in capsules. The recommended maximum daily intake of the NF from fortified foods and food supplements is 15 g. The target...

  16. Comparison of reactions for the production of 258,257Db: 208Pb(51V,xn) and 209Bi(50Ti,xn)

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M.; Nelson, Sarah L.; Gregorich, Kenneth E.; Dragojevic, Irena; Dullmann, Christoph E.; Ellison, Paul A.; Folden III, Charles M.; Garcia, Mitch A.; Stavsetra, Liv; Sudowe, Ralf; Hoffman, Darleane C.; Nitsche, Heino

    2008-09-29

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070+1100/-760 pb was measured at an excitation energy of 16.0 +- 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660+450/-370 pb was measured at 22.0 +- 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480+1750/-1370 pb at an excitation energy of 16.0 +- 1.6 MeV, in agreement with previous values [F. P. Hebberger, et al., Eur. Phys. J. A 12, 57 (2001)]. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier.

  17. (Vapor + liquid) phase equilibrium measurements for {trifluoroiodomethane (R13I1) + propane (R290)} from T = (258.150 to 283.150) K

    International Nuclear Information System (INIS)

    Gong, Maoqiong; Guo, Hao; Dong, Xueqiang; Li, Huiya; Wu, Jianfeng

    2014-01-01

    Highlights: • VLE data for (R13I1 + R290) system were measured at four temperatures. • Experiments were based on the vapor-recirculation method. • VLE data were correlated using PR–vdW and PR–HV–NRTL models. • Zeotropic behavior can be found. - Abstract: In this paper, the (vapor + liquid) equilibrium data for (R13I1 + R290) were measured by a vapor-recirculation apparatus at temperatures from (258.150 to 283.150) K. The VLE data were correlated by the Peng–Robinson equation of state with two different models, the van der Waals mixing rule, and the Huron–Vidal mixing rule involving the NRTL activity coefficient model. Good agreements were found between the calculated data and the experimental data. The maximum average absolute relative deviation of pressure (AARD p) was 0.48%, while the maximum average absolute deviation of composition (AAD y) was 0.0040. Meanwhile, zeotropic behavior can be found for the measured system in this study. The total combined standard uncertainties for temperature, pressure and composition measurements were ±5 mK, ±0.0005 MPa and ±0.005, respectively

  18. Association of Clinical Benign Prostate Hyperplasia with Prostate Cancer Incidence and Mortality Revisited: A Nationwide Cohort Study of 3 009 258 Men

    DEFF Research Database (Denmark)

    Ørsted, David Dynnes; Bojesen, Stig E; Nielsen, Sune F

    2011-01-01

    with an increased risk of PCa incidence and mortality. DESIGN, SETTING, AND PARTICIPANTS: Using designs with individual participant data from five national registries, we studied the entire Danish male population from 1980 through 2006, a total of 3 009 258 Danish men. We collected PCa diagnoses (n=53 315......-adjusted HRs for PCa incidence were 2.22 (95% confidence interval, 2.13-2.31) in men hospitalized and 3.26 (3.03-3.50) in men operated on for clinical BPH versus general population controls. Corresponding HRs for PCa mortality were 2.00 (1.91-2.08) for hospitalization and 7.85 (7.40-8.32) for surgery. For age......-matched cohort studies, corresponding HRs for PCa incidence were 3.04 (2.96-3.13) for hospitalization, 2.60 (2.47-2.73) for surgery, 4.49 (4.33-4.65) for a-adrenergic receptor antagonist use, and 2.54 (2.40-2.68) for 5-ARI use. Each category of clinical BPH has limitations, but limitations differ between...

  19. Role of routine imaging in detecting recurrent lymphoma: A review of 258 patients with relapsed aggressive non-Hodgkin and Hodgkin lymphoma.

    Science.gov (United States)

    El-Galaly, T C; Mylam, Karen Juul; Bøgsted, Martin; Brown, Peter; Rossing, Maria; Gang, Anne Ortved; Haglund, Anne; Arboe, Bente; Clausen, Michael Roost; Jensen, Paw; Pedersen, Michael; Bukh, Anne; Jensen, Bo Amdi; Poulsen, Christian Bjørn; d'Amore, Francesco; Hutchings, Martin

    2014-06-01

    After first-line therapy, patients with Hodgkin lymphoma (HL) and aggressive non-HL are followed up closely for early signs of relapse. The current follow-up practice with frequent use of surveillance imaging is highly controversial and warrants a critical evaluation. Therefore, a retrospective multicenter study of relapsed HL and aggressive non-HL (nodal T-cell and diffuse large B-cell lymphomas) was conducted. All included patients had been diagnosed during the period 2002-2011 and relapsed after achieving complete remission on first-line therapy. Characteristics and outcome of imaging-detected relapses were compared with other relapses. A total of 258 patients with recurrent lymphoma were included in the study. Relapse investigations were initiated outside preplanned visits in 52% of the patients. Relapse detection could be attributed to patient-reported symptoms alone or in combination with abnormal blood tests or physical examination in 64% of the patients. Routine imaging prompted relapse investigations in 27% of the patients. The estimated number of routine scans per relapse was 91-255 depending on the lymphoma subtype. Patients with imaging-detected relapse had lower disease burden (P = 0.045) and reduced risk of death following relapse (hazard ratio = 0.62, P = 0.02 in multivariate analysis). Patient-reported symptoms are still the most common factor for detecting lymphoma relapse and the high number of scans per relapse calls for improved criteria for use of surveillance imaging. However, imaging-detected relapse was associated with lower disease burden and a possible survival advantage. The future role of routine surveillance imaging should be defined in a randomized trial. © 2014 Wiley Periodicals, Inc.

  20. Non–SCF-type F-box protein Roy1/Ymr258c interacts with a Rab5-like GTPase Ypt52 and inhibits Ypt52 function

    Science.gov (United States)

    Liu, Yuan; Nakatsukasa, Kunio; Kotera, Michiko; Kanada, Akira; Nishimura, Takashi; Kishi, Tsutomu; Mimura, Satoru; Kamura, Takumi

    2011-01-01

    Skp1/Cul1/F-box (SCF)–type F-box proteins are a component of the Cullin-RING SCF ubiquitin E3 ligase, which is involved in numerous cellular processes. However, the function of non–SCF-type F-box proteins remains largely unknown. The Rab5-like small guanosine 5′-triphosphatase Vps21/Ypt51 is a key regulator of intracellular transportation; however, deletion of its isoforms, Ypt52 and Ypt53, results in only a modest inhibition of intracellular trafficking. The function of these proteins therefore remains largely elusive. Here we analyze the role of a previously uncharacterized non–SCF-type F-box protein, Roy1/Ymr258c, in cell growth and intracellular transport in Saccharomyces cerevisiae. Roy1 binds to Ypt52 under physiological conditions, and Skp1 is indispensable for the association of Roy1 with Ypt52. The vps21Δ yeast cells exhibit severe deficiencies in cell growth and intracellular trafficking, whereas simultaneous deletion of roy1 alleviates the defects caused by deletion of vps21. However, additional disruption of ypt52 in roy1Δvps21Δ cells largely suppresses the cell growth and trafficking observed in roy1Δvps21Δ cells. We demonstrate that Roy1 interacts with guanosine 5′-diphosphate–bound and nucleotide-free Ypt52 and thereby inhibits the formation of guanosine 5′-triphosphate–bound, active Ypt52. These results thus indicate that Roy1 negatively modulates cell viability and intracellular transport by suppressing Ypt52. PMID:21389113

  1. Non-SCF-type F-box protein Roy1/Ymr258c interacts with a Rab5-like GTPase Ypt52 and inhibits Ypt52 function.

    Science.gov (United States)

    Liu, Yuan; Nakatsukasa, Kunio; Kotera, Michiko; Kanada, Akira; Nishimura, Takashi; Kishi, Tsutomu; Mimura, Satoru; Kamura, Takumi

    2011-05-01

    Skp1/Cul1/F-box (SCF)-type F-box proteins are a component of the Cullin-RING SCF ubiquitin E3 ligase, which is involved in numerous cellular processes. However, the function of non-SCF-type F-box proteins remains largely unknown. The Rab5-like small guanosine 5'-triphosphatase Vps21/Ypt51 is a key regulator of intracellular transportation; however, deletion of its isoforms, Ypt52 and Ypt53, results in only a modest inhibition of intracellular trafficking. The function of these proteins therefore remains largely elusive. Here we analyze the role of a previously uncharacterized non-SCF-type F-box protein, Roy1/Ymr258c, in cell growth and intracellular transport in Saccharomyces cerevisiae. Roy1 binds to Ypt52 under physiological conditions, and Skp1 is indispensable for the association of Roy1 with Ypt52. The vps21Δ yeast cells exhibit severe deficiencies in cell growth and intracellular trafficking, whereas simultaneous deletion of roy1 alleviates the defects caused by deletion of vps21. However, additional disruption of ypt52 in roy1Δvps21Δ cells largely suppresses the cell growth and trafficking observed in roy1Δvps21Δ cells. We demonstrate that Roy1 interacts with guanosine 5'-diphosphate-bound and nucleotide-free Ypt52 and thereby inhibits the formation of guanosine 5'-triphosphate-bound, active Ypt52. These results thus indicate that Roy1 negatively modulates cell viability and intracellular transport by suppressing Ypt52.

  2. EFSA NDA Panel (EFSA Panel on Dietetic Products, Nutrition and Allergies), 2016. Scientific opinion on the safety of fermented soybean extract NSK-SD® as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2016-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on the fermented soybean extract NSK-SD® as a novel food (NF) submitted pursuant to Regulation (EC) No 258/97 of the European Parliament and of the ......Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on the fermented soybean extract NSK-SD® as a novel food (NF) submitted pursuant to Regulation (EC) No 258/97 of the European Parliament...... and of the Council, taking into account the comments and objections of a scientific nature raised by Member States. The NF is the fermented soybean extract NSK-SD®, which is standardised to a nattokinase enzyme activity of 20,000–28,000 fibrin degradation units/g. The information provided on the composition...... of the NF, the specifications, batch-to-batch variability and the stability is sufficient and does not raise safety concerns. The proposed maximum intake is 100 mg NSK-SD®/day as a food supplement. The target population proposed by the applicant is healthy men and women over the age of 35 years, excluding...

  3. (Vapour + liquid) equilibrium data for the azeotropic {1,1-difluoroethane (R152a) + 1,1,2,2-Tetrafluoroethane (R134)} system at various temperatures from (258.150 to 288.150) K

    International Nuclear Information System (INIS)

    Guo, Hao; Gong, Maoqiong; Dong, Xueqiang; Wu, Jianfeng

    2012-01-01

    Highlights: ► VLE data for the {R152a + R134} system were measured. ► The experiment is based on the static–analytic method. ► The VLE data were correlated using the PR–HV–NRTL model. ► A negative azeotropic behaviour was found. - Abstract: (Vapour + liquid) equilibrium (VLE) data for the {1,1-difluoroethane (R152a) + 1,1,2,2-Tetrafluoroethane (R134)} system were measured at T = (258.150 to 288.150) K. The experiment is based on a static–analytic method. Experimental data were correlated with the Peng–Robinson equation of state (PR EoS) and the Huron–Vidal (HV) mixing rule involving the NRTL activity coefficient model. The results show good agreement with experimental results for the binary system at each temperature. It was found that the system has a negative azeotropic behaviour within the temperature range measured here.

  4. EFSA NDA Panel (EFSA Panel on Dietetic Products, Nutrition and Allergies), 2015. Scientific opinion on the safety of 2'-O-fucosyllactose as a novel food ingredient pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Tetens, Inge; Poulsen, Morten

    2015-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on 2'-O-fucosyllactose as a novel food ingredient (NFI) submitted pursuant to Regulation (EC) No 258/97 of the European Parliament and of the Council...... for infants and young children, as well as in foods or food supplements for adults. The information provided on the potential mutagenicity of 2'-FL does not raise safety concerns as regards the genotoxicity of this NFI. Based on the observations from a sub-chronic 90-day toxicity study in rats, the Panel......, taking into account the comments and objections of a scientific nature raised by Member States. 2'-O-fucosyllactose (2'-FL) is a synthetic trisaccharide, which is intended to be used in infant and follow-on formulae, foods for special medical purposes for infants and young children, and other foods...

  5. EFSA NDA Panel (EFSA Panel on Dietetic Products, Nutrition and Allergies), 2015. Scientific opinion on the Safety of lacto-N-neotetraose as a novel food ingredient pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Tetens, Inge; Poulsen, Morten

    2015-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on lacto-N-neotetraose as a novel food ingredient (NFI) submitted pursuant to Regulation (EC) No 258/97 of the European Parliament and of the Council...... for infants and young children, as well as in foods or food supplements for adults. The information provided on the potential mutagenicity of LNnT does not raise safety concerns as regards the genotoxicity of this NFI. Based on the observations from a sub-chronic 90-day toxicity study in rats, the Panel......, taking into account the comments and objections of a scientific nature raised by Member States. Lacto-N-neotetraose (LNnT) is a synthetic tetrasaccharide, which is intended to be used in infant and follow-on formulae, foods for special medical purposes for infants and young children and other foods...

  6. Multiplex PCR for the detection of BCL-1/IGH and BCL-2/IGH gene rearrangements--clinical validation in a prospective study of blood and bone marrow in 258 patients with or suspected of non-Hodgkin's lymphoma

    DEFF Research Database (Denmark)

    Nyvold, Charlotte G; Bendix, Knud; Brandsborg, Margrethe

    2007-01-01

    prospectively been evaluated. Eleven patients (4%) were found t(11;14)+ and 37 patients (14%) t(14;18)+. Comparing these results to standard diagnostic methods of PB and/or BM identified PCR+ samples that were normal by morphology (BCL-1/IGH: 1/11; BCL-2/IGH: 17/37). Equally important, patients who were......We have designed a multiplex PCR, which allows for fast and high throughput demonstration of the BCL-1/IGH and BCL-2/IGH fusion DNA observed primarily in mantle cell- and follicular non-Hodgkin's lymphoma (NHL). Blood (PB) and/or bone marrow (BM) from 258 patients suspected of NHL have...... not clonal in PB and/or BM by flow cytometry were identified as PCR+ (BCL-1/IGH: 3/11; BCL-2/IGH: 23/37). We conclude that this multiplex approach allows for easy and sensitive molecular determination of molecular lesions in NHL, which have diagnostic and prognostic importance. Udgivelsesdato: 2007-null...

  7. (Vapour + liquid) equilibrium data for the binary system of {trifluoroiodomethane (R13I1) + trans-1, 3, 3, 3-tetrafluoropropene (R1234ze (E))} at various temperatures from (258.150 to 298.150) K

    International Nuclear Information System (INIS)

    Guo Hao; Gong Maoqiong; Dong Xueqiang; Wu Jianfeng

    2012-01-01

    Highlights: ► VLE data for {R13I1 + R1234ze (E)} systems were measured. ► This work was based on the static-analytic method. ► The VLE data were correlated using the PR-HV-NRTL model. ► Obviously azeotropic behavior can be found. - Abstract: (Vapour + liquid) equilibrium (VLE) data for the binary system of {trifluoroiodomethane (R13I1) + trans-1, 3, 3, 3-tetrafluoropropene (R1234ze (E))} were measured by a static-analytic method within the temperature range of (258.150 to 298.150) K. The experimental data were correlated using the Peng–Robinson equation of state (PR EoS) with the Huron–Vidal (HV) mixing rule involving the NRTL activity coefficient model. The results show good agreement with experimental values for the binary system at each temperature point. The maximum average absolute relative deviation of pressure is 0.28%, while the maximum average absolute deviation of vapour phase mole fraction is 0.0025. Obviously azeotropic behaviour can be found for the measured temperature range here.

  8. Measurements of isothermal (vapor + liquid) phase equilibrium for {trifluoroiodomethane (R13I1) + 1,1-difluoroethane (R152a)} from T = (258.150 to 283.150) K

    International Nuclear Information System (INIS)

    Gong, Maoqiong; Cheng, Kuiwei; Dong, Xueqiang; Guo, Hao; Zhao, Yanxing; Wu, Jianfeng

    2015-01-01

    Highlights: • VLE data for (R13I1 + R152a) system were measured at four temperatures. • Experiments were based on the vapor-recirculation method. • VLE data were correlated using PR−VdWs and PR−HV−NRTL models. • Azeotropic behavior can be found. - Abstract: In this paper, isothermal (vapor + liquid) equilibrium (VLE) values for {trifluoroiodomethane (R13I1) + 1,1-difluoroethane (R152a)} at T = (258.150 to 283.150) K are presented. The experimental apparatus was based on a vapor-recirculation method. The VLE measurements were regressed by the Peng–Robinson equation of state with two models, the Van der Waals mixing rules and the Huron–Vidal mixing rules using the NRTL activity coefficient model. The newly measured VLE values satisfied the thermodynamic consistency test. The results have led to that the two models selected are both suitable for the description of the binary system. Azeotropic behavior can be found for the system measured

  9. Klebsiella pneumoniae resistant to third-generation cephalosporins in five African and two Vietnamese major towns: multiclonal population structure with two major international clonal groups, CG15 and CG258.

    Science.gov (United States)

    Breurec, S; Guessennd, N; Timinouni, M; Le, T A H; Cao, V; Ngandjio, A; Randrianirina, F; Thiberge, J M; Kinana, A; Dufougeray, A; Perrier-Gros-Claude, J D; Boisier, P; Garin, B; Brisse, S

    2013-04-01

    The molecular epidemiology of third-generation cephalosporin-resistant (3GC-R) Klebsiella pneumoniae in developing countries is poorly documented. From February 2007 to March 2008, we collected 135 3GC-R K. pneumoniae isolates from seven major towns in Maghreb (Morocco), West Africa (Senegal, Côte d'Ivoire), Central Africa (Cameroon), East Africa (Madagascar) and Southeast Asia (Vietnam). Their genetic diversity, assessed by multilocus sequence typing, was high (60 sequence types), reflecting multiclonality. However, two major clonal groups, CG15 (n = 23, 17% of isolates) and CG258 (n = 18, 13%), were detected in almost all participating centres. The two major clonal groups have previously been described in other parts of the world, indicating their global spread. The high diversity of enterobacterial repetitive intergenic consensus sequence-PCR banding patterns at the local level indicates that most isolates were epidemiologically unrelated. The isolates were characterized by the presence of multiple resistance determinants, most notably the concomitant presence of the aac(6')-Ib-cr, qnr and blaCTX-M-15 genes in 61 isolates (45%) belonging to 31 sequence types. These isolates were detected across a large geographical area including Cameroon (n = 1), Vietnam (n = 4), Madagascar (n = 10), Côte d'Ivoire (n = 12), Morocco (n = 13) and Senegal (n = 21). These results have major implications for patient management and highlight a potential reservoir for resistance determinants. © 2012 The Authors. Clinical Microbiology and Infection © 2012 European Society of Clinical Microbiology and Infectious Diseases.

  10. A drug-drug interaction study to assess the effect of the CYP1A2 inhibitor fluvoxamine on the pharmacokinetics of dovitinib (TKI258) in patients with advanced solid tumors

    DEFF Research Database (Denmark)

    de Weger, Vincent A; Goel, Sanjay; von Moos, Roger

    2018-01-01

    PURPOSE: Dovitinib is an orally available multi tyrosine kinase inhibitor which inhibits VEGFR 1-3, FGFR 1-3, and PDGFR. This study was performed to investigate the potential drug-drug interaction of dovitinib with the CYP1A2 inhibitor fluvoxamine in patients with advanced solid tumors. METHODS......-five patients were enrolled; 24 were evaluable for drug-drug interaction assessment. Median age was 60 years (range 30-85). At steady state the geometric mean for dovitinib (coefficient of variation%) of the area under the plasma concentration-time curve (AUC0-72h) and maximum concentration (C max) were 2880 ng...... (dovitinib + fluvoxamine vs. dovitinib alone) were 2.88 [90% confidence interval (CI) 2.58, 3.20] and 1.80 (90% CI 1.66, 1.95). This effect is considered a moderate drug-drug interaction. CONCLUSIONS: Fluvoxamine co-administration resulted in a 80% increase in C max and a 188% increase in AUC0-72h...

  11. 28 CFR 25.8 - System safeguards.

    Science.gov (United States)

    2010-07-01

    ... justice agency computer site must have adequate physical security to protect against any unauthorized... from terminal devices must be afforded appropriate security to prevent any unauthorized access or use... Index is stored electronically for use in an FBI computer environment. The NICS central computer will...

  12. 40 CFR 258.28 - Liquids restrictions.

    Science.gov (United States)

    2010-07-01

    ... waste may not be placed in a MSWLF unit unless: (1) The container is a small container similar in size... other than storage; or (3) The waste is household waste. (c) For purposes of this section: (1) Liquid..., [email protected]; or at the National Archives and Records Administration (NARA). For information on the...

  13. 8 CFR 258.2 - Exceptions.

    Science.gov (United States)

    2010-01-01

    ... of automated self-unloading conveyor belt or vacuum-actuated system on a vessel. An automated self-unloading conveyor belt or a vacuum-actuated system may be operated by a nonimmigrant crewman under the... self-unloading conveyor belt or a vacuum-actuated system on the vessel under the prevailing practice...

  14. Publications | Page 258 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, ... social and cultural relations. These in turn impact gendered divisions of work and control over income and assets. This gender review.

  15. Publications | Page 258 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    restricted access). This report contains the findings of research into the case of the gold mining industry in Ghana. By 2009, Ghana was the second-ranked African producer after South Africa, and had become the world''s ninth largest producer of ...

  16. 40 CFR 258.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... any rainwater, leachate, or other liquid that drains over land from any part of a facility. Run-on means any rainwater, leachate, or other liquid that drains over land onto any part of a facility... within the facility's property boundary. Waste management unit boundary means a vertical surface located...

  17. 40 CFR 258.50 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... potential for migration of hazardous constituents from that MSWLF unit to the uppermost aquifer (as defined... must be certified by a qualified ground-water scientist and approved by the Director of an approved... fate and transport predictions that maximize contaminant migration and consider impacts on human health...

  18. 21 CFR 558.258 - Fenbendazole.

    Science.gov (United States)

    2010-04-01

    ...)(2)(i) of this section; for reduction in the severity of swine mycoplasmal pneumonia caused by... bighorn sheep (Ovis c. canadensis) 10 mg/kg/day for 3 days. For the removal and control of Protostrongylus...

  19. 251 - 258_Hajara_Mobile exhaust

    African Journals Online (AJOL)

    pc

    may exert control over their gas exchange rate varying stomata ... This relationship is inv meaning that as C02 increases, the numbe stomata decreases and vice versa. This oc because as C02 concentration in the air surroun the leaf .... Table 2: Mean stomata measurement on abaxial (lower) surface of plant leaves studied.

  20. 14 CFR 258.5 - Notice requirement.

    Science.gov (United States)

    2010-01-01

    ... carrier or ticket agent doing business in the United States shall tell the consumer before booking... change of aircraft en route. (c) Written notice. At the time of sale in the United States of transportation that includes a change-of-gauge service to, from, or within the United States, or, if no ticket is...

  1. 37 CFR 258.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... establishment used for commercial purposes, such as bars, restaurants, private offices, fitness clubs, oil rigs... multi-unit permanent or temporary dwelling where private home viewing occurs, such as hotels, dormitories, hospitals, apartments, condominiums and prisons, all of which shall be subject to the rates...

  2. A drug-drug interaction study to assess the effect of the CYP1A2 inhibitor fluvoxamine on the pharmacokinetics of dovitinib (TKI258) in patients with advanced solid tumors.

    Science.gov (United States)

    de Weger, Vincent A; Goel, Sanjay; von Moos, Roger; Schellens, Jan H M; Mach, Nicholas; Tan, Eugene; Anand, Suraj; Scott, Jeffrey W; Lassen, Ulrik

    2018-01-01

    Dovitinib is an orally available multi tyrosine kinase inhibitor which inhibits VEGFR 1-3, FGFR 1-3, and PDGFR. This study was performed to investigate the potential drug-drug interaction of dovitinib with the CYP1A2 inhibitor fluvoxamine in patients with advanced solid tumors. Non-smoking patients of ≥ 18 years with advanced solid tumors, excluding breast cancer, were included. Patients were treated with a dose of 300 mg in 5 days on/2 days off schedule. Steady-state pharmacokinetic assessments of dovitinib were performed with or without fluvoxamine. Forty-five patients were enrolled; 24 were evaluable for drug-drug interaction assessment. Median age was 60 years (range 30-85). At steady state the geometric mean for dovitinib (coefficient of variation%) of the area under the plasma concentration-time curve (AUC 0-72h ) and maximum concentration (C max ) were 2880 ng/mL h (47%) and 144 ng/mL (41%), respectively. Following administration of dovitinib in combination with fluvoxamine the geometric mean of dovitinib AUC 0-72h and C max were 8290 ng/mL h (60%) and 259 ng/mL (45%), respectively. The estimated geometric mean ratios for dovitinib AUC 0-72h and C max (dovitinib + fluvoxamine vs. dovitinib alone) were 2.88 [90% confidence interval (CI) 2.58, 3.20] and 1.80 (90% CI 1.66, 1.95). This effect is considered a moderate drug-drug interaction. Fluvoxamine co-administration resulted in a 80% increase in C max and a 188% increase in AUC 0-72h of dovitinib. Given the increase in exposure to dovitinib observed, patients are at risk of dovitinib related toxicity. Dovitinib should, therefore, not be co-administered with moderate and strong CYP1A2 inhibitors, without dose reduction.

  3. Anterior cervical discectomy with fusion in patients with cervical disc degeneration: a prospective outcome study of 258 patients (181 fused with autologous bone graft and 77 fused with a PEEK cage

    Directory of Open Access Journals (Sweden)

    Roenning Paal

    2010-03-01

    Full Text Available Abstract Background Anterior cervical discectomy with fusion (ACDF is challenging with respect to both patient selection and choice of surgical procedure. The aim of this study was to evaluate the clinical outcome of ACDF, with respect to both patient selection and choice of surgical procedure: fusion with an autologous iliac crest graft (AICG versus fusion with an artificial cage made of polyetheretherketone (PEEK. Methods This was a non-randomized prospective single-center outcome study of 258 patients who underwent ACDF for cervical disc degeneration (CDD. Fusion was attained with either tricortical AICG or PEEK cages without additional anterior plating, with treatment selected at surgeon's discretion. Radicular pain, neck-pain, headache and patient satisfaction with the treatment were scored using the visual analogue scale (VAS. Results The median age was 47.5 (28.3-82.8 years, and 44% of patients were female. 59% had single-level ACDF, 40% had two level ACDF and 1% had three-level ACDF. Of the patients, 181 were fused with AICG and 77 with a PEEK-cage. After surgery, the patients showed a significant reduction in radicular pain (ΔVAS = 3.05, neck pain (ΔVAS = 2.30 and headache (ΔVAS = 0.55. Six months after surgery, 48% of patients had returned to work: however 24% were still receiving workers' compensation. Using univariate and multivariate analyses we found that high preoperative pain intensity was significantly associated with a decrease in pain intensity after surgery, for all three pain categories. There were no significant correlations between pain relief and the following patient characteristics: fusion method (AICG or PEEK-cage, sex, age, number of levels fused, disc level fused, previous neck surgery (except for neck pain, previous neck trauma, or preoperative symptom duration. Two hundred out of the 256 (78% patients evaluated the surgical result as successful. Only 27/256 (11% classified the surgical result as a failure

  4. Anterior cervical discectomy with fusion in patients with cervical disc degeneration: a prospective outcome study of 258 patients (181 fused with autologous bone graft and 77 fused with a PEEK cage)

    Science.gov (United States)

    2010-01-01

    Background Anterior cervical discectomy with fusion (ACDF) is challenging with respect to both patient selection and choice of surgical procedure. The aim of this study was to evaluate the clinical outcome of ACDF, with respect to both patient selection and choice of surgical procedure: fusion with an autologous iliac crest graft (AICG) versus fusion with an artificial cage made of polyetheretherketone (PEEK). Methods This was a non-randomized prospective single-center outcome study of 258 patients who underwent ACDF for cervical disc degeneration (CDD). Fusion was attained with either tricortical AICG or PEEK cages without additional anterior plating, with treatment selected at surgeon's discretion. Radicular pain, neck-pain, headache and patient satisfaction with the treatment were scored using the visual analogue scale (VAS). Results The median age was 47.5 (28.3-82.8) years, and 44% of patients were female. 59% had single-level ACDF, 40% had two level ACDF and 1% had three-level ACDF. Of the patients, 181 were fused with AICG and 77 with a PEEK-cage. After surgery, the patients showed a significant reduction in radicular pain (ΔVAS = 3.05), neck pain (ΔVAS = 2.30) and headache (ΔVAS = 0.55). Six months after surgery, 48% of patients had returned to work: however 24% were still receiving workers' compensation. Using univariate and multivariate analyses we found that high preoperative pain intensity was significantly associated with a decrease in pain intensity after surgery, for all three pain categories. There were no significant correlations between pain relief and the following patient characteristics: fusion method (AICG or PEEK-cage), sex, age, number of levels fused, disc level fused, previous neck surgery (except for neck pain), previous neck trauma, or preoperative symptom duration. Two hundred out of the 256 (78%) patients evaluated the surgical result as successful. Only 27/256 (11%) classified the surgical result as a failure. Patient satisfaction

  5. 40 CFR 258.4 - Research, development, and demonstration permits.

    Science.gov (United States)

    2010-07-01

    ...), (a)(2) and (b)(1), provided the MSWLF unit owner/operator demonstrates that the infiltration of liquid through the alternative cover system will not cause contamination of groundwater or surface water... monitoring and testing results, as well as any other operating information specified by the State Director in...

  6. Dicty_cDB: CHN258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TCACACCAACGCCAACCTCTTCAGCTGAAGAACCAGCTGCTGGTGGCGAA sequence update 2002. 9.10 Translated Amino Acid sequence ---cnwsqivgxatx...rtscwwr Frame B: ---cnwsqivgxatxsqivalasgsk*WVLQXGANSGNNAAVTGAANGNNGAAAGANSGA ATAANSGAATAANSGAATAANRGNNAAATG

  7. All projects related to | Page 258 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This project aims to help West African nations develop policies based on a better understanding of why youth leave rural areas, and what economic activities ... Research into changes to China's minimum wage policies will evaluate their impact and provide guidelines for regulatory bodies at municipal and provincial levels.

  8. 40 CFR 60.258 - Reporting and recordkeeping.

    Science.gov (United States)

    2010-07-01

    ... measurements of the reagent injection flow rate, as applicable. (b) For the purpose of reports required under... the measurements of the reagent injection flow rate, as applicable, vary by more than 10 percent from...; Energy Strategies Group; 109 TW Alexander DR; mail code: D243-01; RTP, NC 27711. ...

  9. Dicty_cDB: AFH258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6. 2 Translated Amino Acid sequence gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilk...vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilkscllvf ywvplmhl*fgkvqerpq*fvdslkihfgvnkiisssirhqaqvmnisplsil*nlvipm vqyws...*nkkkl* Frame B: gllxskinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkilmilkq* hhh*SQNPLVAVLVKINHHHHHHVVVVVIK

  10. Dicty_cDB: SHJ258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 02.10.25 Translated Amino Acid sequence vkccstinptfmink*KRREKKMNVKEMDFNDLSNKSNQIINRISSFSSPIGLSSFNIER NLQEIGD...LEEILG QKHIKVLPSV--- Translated Amino Acid sequence (All Frames) Frame A: vkccstinptfm

  11. 40 CFR 258.57 - Selection of remedy.

    Science.gov (United States)

    2010-07-01

    ... which may offer significant advantages over already available technologies in terms of effectiveness... environment from exposure to contamination prior to completion of the remedy; (6) Resource value of the... substances that have originated from a source other than a MSWLF unit and those substances are present in...

  12. Dicty_cDB: VHK258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence ---xlhqlmvxq*plkslepxhln*LXPWIXHXKQXVNYXWMMVNXFKXMXXIXXXSSNS MXXPXP...A: ---xvtpvdgixmttkisrtxpfelixaxdxsxqaxgqlxxddgesiqtyxdxkxxfiqf dxvssxxficiqitinxsq*ql*wyrxfnhxxypnxrxaxssxs...qc*vvaqsihlmlfxx qls Frame B: ---xlhqlmvxq*plkslepxhln*LXPWIXHXKQXVNYXWMMVNXFKXMXXIXXXSSNS MXXPXPXSFAYKLQSTX

  13. 29 CFR 779.258 - Sales made or business done.

    Science.gov (United States)

    2010-07-01

    ... with more clarity the economic test of business size expressed in the prior Act in terms of “annual gross volume of sales” and conforms the language of the Act with the Congressional view expressed in the... first expressed in the Senate Report on the 1961 amendment (S. Rept. No. 145, 87th Congress, first...

  14. 14 CFR 258.4 - Unfair and deceptive practice.

    Science.gov (United States)

    2010-01-01

    ... meaning of 49 U.S.C. 41712 unless, in conjunction with such holding out or sale, carriers and ticket.... The holding out or sale of scheduled passenger air transportation that involves change-of-gauge...

  15. 24 CFR 92.258 - Elder cottage housing opportunity (ECHO) units.

    Science.gov (United States)

    2010-04-01

    ... designed to be installed adjacent to existing single-family dwellings. (b) Eligible owners. The owner of a HOME-assisted ECHO unit may be: (1) The owner-occupant of the single-family host property on which the... elderly or disabled family as defined in 24 CFR 5.403 and must also be a low-income family. (d) Applicable...

  16. S. Aft. J. Anim. Sci., 4, 247-258 (1974) INTENSIFICATION

    African Journals Online (AJOL)

    optimal age for replacement is influenced more by declining productivity after 9 years of age than by existing cattle prices or interest rates. This study suggests that although many variables must be considered, the retention of cows beyond 10 years of age is likely to result in reduced long- term productivity and profits in most ...

  17. 40 CFR Appendix I to Part 258 - Constituents for Detection Monitoring

    Science.gov (United States)

    2010-07-01

    ...; DBCP 96-12-8 (29) 1,2-Dibromoethane; Ethylene dibromide; EDB 106-93-4 (30) o-Dichlorobenzene; 1,2... for Detection Monitoring Common name 1 CAS RN 2 Inorganic Constituents: (1) Antimony (Total) (2... 67-64-1 (17) Acrylonitrile 107-13-1 (18) Benzene 71-43-2 (19) Bromochloromethane 74-97-5 (20...

  18. 40 CFR 258.53 - Ground-water sampling and analysis requirements.

    Science.gov (United States)

    2010-07-01

    ... management area must be measured within a period of time short enough to avoid temporal variations in ground... operator to be inappropriate for a normal theory test, then the data should be transformed or a distribution-free theory test should be used. If the distributions for the constituents differ, more than one...

  19. 40 CFR 258.72 - Financial assurance for post-closure care.

    Science.gov (United States)

    2010-07-01

    ... to demonstrate financial assurance in paragraph (b) of this section must account for the total costs... increase the post-closure care cost estimate and the amount of financial assurance provided under paragraph... amount of financial assurance provided under paragraph (b) of this section if the cost estimate exceeds...

  20. Yeast Interacting Proteins Database: YFR015C, YLR258W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available yeast homolog; expression induced by glucose limitation, nitrogen starvation, environmental stress, and entr...; expression induced by glucose limitation, nitrogen starvation, environmental stress, and entry into statio

  1. : tous les projets | Page 258 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutien à l'initiative À la recherche du prochain Einstein. Projet. Près d'un million d'étudiants reçoivent chaque année un diplôme d'une université africaine. Sujet: SCIENCE. Région: South of Sahara, Ethiopia, Ghana, Nigeria, Senegal, Canada, South Africa. Programme: Foundations for Innovation. Financement total : CA$ ...

  2. Zhang et al., Afr J Tradit Complement Altern Med. (2013) 10(2):258 ...

    African Journals Online (AJOL)

    AJTCAM

    Figure 2: Anti-proliferative activity of the JMM6 detected by MTT assay after 24, 48 and 72h of treatment on BEL-7402 (A) and chang liver (B) cell. Cytotoxicity of the positive .... in the induced apoptosis of cancer cells: First once mitochondrial membrane permeabilization (MMP) occurs and the △Ψm decrease, cells die either ...

  3. the trend of ionospheric total electron content near the equator 258

    African Journals Online (AJOL)

    userpc

    interconnected part of physical system, and plays a significant role in long distance radio communications in HF band (Dabas et al., 2006,. Matsushita and Wallace, 1967). The ionosphere is affected by solar activity, sun-earth relative position and interaction among the ionosphere, magnetosphere plus thermosphere etc.

  4. Yeast Interacting Proteins Database: YGL145W, YNL258C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ripheral membrane protein required for Golgi-to-ER retrograde traffic; component ... membrane protein required for Golgi-to-ER retrograde traffic; component of the ER target site that interact

  5. Novel C3V-symmetric tripodal scaffold, triethyl cis,cis,cis-2,5,8- tribenzyltrindane-2,5,8-tricarboxylate, for the construction of artificial receptors.

    Science.gov (United States)

    Choi, Heung-Jin; Park, Yeon Sil; Yun, Seok Hun; Kim, Hong-Seok; Cho, Chan Sik; Ko, Kwangnak; Ahn, Kyo Han

    2002-03-07

    [reaction: see text] A novel C3V-symmetric scaffold, trindane 7, has been efficiently synthesized from 1,3,5-tris(bromomethyl)-2,4,6-tris(chloromethyl)benzene (1) in six steps with 47% overall yield. The control of all-syn stereochemistry in the tribenzylation step has been achieved by blocking one side of the trindane ring as metal carbonyl complexes. The potential utility of trindane 7 as a receptor skeleton has been examined with a urea derivative 12 toward several anionic guests.

  6. Safety of pyrroloquinoline quinone disodium salt as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2017-01-01

    intends to market PQQ for use in food supplements for healthy adults, except pregnant and lactating women, at a maximum proposed level of consumption of 20 mg/day (corresponding to 0.29 mg/kg bw per day for a 70-kg person). The proposed level of consumption is at least 250 times higher than the estimated...

  7. Safety of synthetic trans-resveratrol as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2016-01-01

    and specifications of the novel food is sufficient. The applicant intends to market the novel food as a food supplement in capsule or tablet form at daily doses up to 150 mg/day. The Panel considers that resveratrol does not have a nutritionally relevant role in the human diet and that the consumption of the novel...

  8. 258 Typologie des granitoïdes de la région de Tiassalé (Sud de la ...

    African Journals Online (AJOL)

    Afrique Sciences

    L'étude petro-structurale a permis de caractériser, en partie, les différents faciès des granitoïdes de la région de Tiassalé (Sud de la Côte d'Ivoire). Les treize (13) faciès granitiques inventoriés sont les suivants :1) granodiorite, 2) granite à feldspaths alcalins, 3) granite alcalin à deux micas, 4) granite à biotite,.

  9. Morbidity in 258 bipolar outpatients followed for 1 year with daily prospective ratings on the NIMH Life Chart Method

    NARCIS (Netherlands)

    Post, RM; Denicoff, KD; Leverich, GS; Altshuler, LL; Frye, MA; Suppes, TM; Rush, AJ; Keck, PE; McElroy, SL; Luckenbaugh, DA; Pollio, C; Kupka, R; Nolen, WA

    Background. A number of recent longitudinal outcome studies have found substantial long-term morbidity in patients with bipolar disorder. The detailed course and pattern of illness emerging despite comprehensive treatment with mood stabilizers and adjunctive agents have previously not been well

  10. SU-F-T-258: Efficacy of Exit Fluence-Based Dose Calculation for Prostate Radiation Therapy

    International Nuclear Information System (INIS)

    Siebers, J; Gardner, J; Neal, B

    2016-01-01

    Purpose: To investigate the efficacy of exit-fluence-based dose computation for prostate radiotherapy by determining if it estimates true dose more accurately than the original planning dose. Methods: Virtual exit-fluencebased dose computation was performed for 19 patients, each with 9–12 repeat CT images. For each patient, a 78 Gy treatment plan was created utilizing 5 mm CTV-to-PTV and OAR-to-PRV margins. A Monte Carlo framework was used to compute dose and exit-fluence images for the planning image and for each repeat CT image based on boney-anatomyaligned and prostate-centroid-aligned CTs. Identical source particles were used for the MC dose-computations on the planning and repeat CTs to maximize correlation. The exit-fluence-based dose and image were computed by multiplying source particle weights by FC(x,y)=FP(x,y)/FT(x,y), where (x,y) are the source particle coordinates projected to the exit-fluence plane and we denote the dose/fluence from the plan by (DP,FP), from the repeat-CT as (DT,FT), and the exit-fluence computation by (DFC,FFC). DFC mimics exit-fluence backprojection through the planning image as FT=FFC. Dose estimates were intercompared to judge the efficacy of exit-fluence-based dose computation. Results: Boney- and prostate-centroid aligned results are combined as there is no statistical difference between them, yielding 420 dose comparisons per dose-volume metric. DFC is more accurate than DP for 46%, 33%, and 44% of cases in estimating CTV D98, D50, and D2 respectively. DFC improved rectum D50 and D2 estimates 54% and 49% respectively and bladder D50 and D2 47 and 49% respectively. While averaged over all patients and images DFC and DP were within 3.1% of DT, they differed from DT by as much as 22% for GTV D98, 71% for the Bladder D50, 17% for Bladder D2, 19% for Rectum D2. Conclusion: Exit-fluence based dose computations infrequently improve CTV or OAR dose estimates and should be used with caution. Research supported in part by Varian Medical Systems.

  11. Alison Kafer, Feminist Queer Crip (Indiana: Indiana University Press, 2013, pp. 258, ISBN: 9780253009340, £16.99, paperback.

    Directory of Open Access Journals (Sweden)

    Eve Lacey

    2014-01-01

    Full Text Available In Feminist Queer Crip, Alison Kafer endeavours to re-politicise disability and its relations to gender and sexuality. This entails a thorough examination of the ways in which time can be or become 'crip' – a critical term for 'imagining bodies and desires otherwise' – with a focus on those bodies that won't grow, age, labour or reproduce according to normal standards of growth and productivity. Kafer also examines bodies that are visually reproduced, or omitted, to facilitate the production of a political agenda, and how the continual reproduction of the able-bodied norm may be challenged or undone. She writes with an acute awareness of intersectionality and her understanding of reproductive politics repeatedly challenges ableist notions of care, future, and productivity. She first identifies problems with the medical model of disability, which constructs a timeline that can only lead to cure or failure, and with the social model, which risks ignoring the lived realities of pain until 'cure becomes the future no self-respecting disability activist or scholar wants' (p. 7. Kafer then arrives at a political and relational stance, one which prioritises coalition over diagnosis and which recognises that disability 'does not occur in isolation' (p. 8. Her relational model takes into account partnerships with carers and attendants and assisting animals, and a focus on political allegiance allows room for Robert McRuer's theory of a 'non-disabled claim to crip': an expansive identity politics which extends beyond diagnostics and towards the deconstructive principle that everyone is, has or will be disabled, and so has a stake in dismantling the ablebodied ideal. The bounds of these relations move from the social to the temporal – Feminist Queer Crip suggests that disability occurs in time, or out of it, and is often marked by a rupture in the rhythm of ableist lifetimes.

  12. Genome sequence of Corynebacterium pseudotuberculosis biovar equi strain 258 and prediction of antigenic targets to improve biotechnological vaccine production

    DEFF Research Database (Denmark)

    Soares, Siomar C; Trost, Eva; Ramos, Rommel T J

    2013-01-01

    Corynebacterium pseudotuberculosis is the causative agent of several veterinary diseases in a broad range of economically important hosts, which can vary from caseous lymphadenitis in sheep and goats (biovar ovis) to ulcerative lymphangitis in cattle and horses (biovar equi). Existing vaccines ag...

  13. Status of Radiotherapy around the World: Australia, New Zealand and Papua New Guinea. Chapter 25.8

    International Nuclear Information System (INIS)

    Koh, Eng-Siew; Hanna, T.P.; Barton, M.B.

    2017-01-01

    Australia has a population of over 22 million and New Zealand 4 million people. Both are classified as high income countries. In 2007, there were over 100 000 new cases of cancer diagnosed in Australia (excluding basal and squamous cell carcinoma of the skin), with the most commonly diagnosed cancers being prostate, bowel, breast, melanoma of the skin and lung cancer. The incidence profiles are similar in New Zealand. In both countries, lung cancer accounted for the most cancer deaths in 2008 (19%), followed by colorectal, prostate and breast cancers. In Australia, the age standardized death rate per 100 000 population due to cancer is 140.8 for men and 92.9 for women. The relative survival rate for cancer patients in Australia is among the best in an international comparison of six developed nations. Radiotherapy services across Australia and New Zealand are predominantly outpatient based and provided in public sector specialist cancer care facilities. According to the IAEA’s DIRAC database, there are currently 69 radiotherapy centres in Australia and eight in New Zealand. Megavoltage linacs for standard 3-D external beam radiotherapy, brachytherapy, as well as stereotactic radiotherapy for both cranial and extracranial applications are available in selected large metropolitan based centres. Across Australia and New Zealand, a wide range of current imaging technologies, including CT, magnetic resonance imaging (MRI), and positron emission tomography, are available for incorporation into radiation treatment planning. IMRT was first introduced around 2001 for head and neck cancers and is now available in most radiotherapy centres for selected tumour sites and clinical indications. Papua New Guinea, classified in the low and middle income group, has a current population of over 6.8 million people dispersed over 600 islands. Registrations at the National Cancer Registry do not document the true burden of cancer in Papua New Guinea. It is estimated that there are over 16 000 new cancer cases annually, and conservatively at least 12 750 deaths per year due to cancer, giving Papua New Guinea one of the world’s highest per capita cancer rates. Cancers account for about 8% of all deaths. The age standardized death rate per 100 000 due to cancer is 151.8 for men and 106.9 for women. The four cancers with the highest incidence are oral cavity, cervix, liver and breast, the burden of which disproportionately affects women. However, three of these cancers are potentially preventable. Relevant prevention strategies include tobacco and betel nut control, hepatitis B virus vaccination and HPV vaccination, together with cervical cancer screening.

  14. PHYS: Division of Physical Chemistry 258 - Properties and Origins of Cometary and Asteroidal Organic Matter Delivered to the Early Earth

    Science.gov (United States)

    Messenger, Scott; Nguyen, Ann

    2017-01-01

    Comets and asteroids may have contributed much of the Earth's water and organic matter. The Earth accretes approximately 4x10(exp 7) Kg of dust and meteorites from these sources every year. The least altered meteorites contain complex assemblages of organic compounds and abundant hydrated minerals. These carbonaceous chondrite meteorites probably derive from asteroids that underwent hydrothermal processing within the first few million years after their accretion. Meteorite organics show isotopic and chemical signatures of low-T ion-molecule and grain-surface chemistry and photolysis of icy grains that occurred in cold molecular clouds and the outer protoplanetary disk. These signatures have been overprinted by aqueously mediated chemistry in asteroid parent bodies, forming amino acids and other prebiotic molecules. Comets are much richer in organic matter but it is less well characterized. Comet dust collected in the stratosphere shows larger H and N isotopic anomalies than most meteorites, suggesting better preservation of primordial organics. Rosetta studies of comet 67P coma dust find complex organic matter that may be related to the macromolecular material that dominates the organic inventory of primitive meteorites. The exogenous organic material accreting on Earth throughout its history is made up of thousands of molecular species formed in diverse processes ranging from circumstellar outflows to chemistry at near absolute zero in dark cloud cores and the formative environment within minor planets. NASA and JAXA are currently flying sample return missions to primitive, potentially organic-rich asteroids. The OSIRIS-REx and Hayabusa2 missions will map their target asteroids, Bennu and Ryugu, in detail and return regolith samples to Earth. Laboratory analyses of these pristine asteroid samples will provide unprecedented views of asteroidal organic matter relatively free of terrestrial contamination within well determined geological context. Studies of extraterrestrial materials and returned samples are essential to understand the origins of Solar System organic material and the roles of comets and asteroids to providing the starting materials for the emergence of life.

  15. Scientific opinion on the safety of synthetic L-ergothioneine (Ergoneine®) as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2016-01-01

    mg/day for children. The target population is children above 3 years of age and the general adult population, except pregnant and breastfeeding women. Considering the NOAEL of 800 mg/kg bw per day, which was based on two subchronic toxicity studies in rats, and the maximum estimated intake levels...

  16. Phosphorylation of the norepinephrine transporter at threonine 258 and serine 259 is linked to protein kinase C-mediated transporter internalization

    DEFF Research Database (Denmark)

    Jayanthi, Lankupalle D; Annamalai, Balasubramaniam; Samuvel, Devadoss J

    2006-01-01

    ester (beta-PMA)-induced phosphorylation of NET occurs on serine and threonine residues. Beta-PMA treatment inhibited NE transport, reduced plasma membrane hNET levels, and stimulated hNET phosphorylation in human placental trophoblast cells expressing the WT-hNET. Substance P-mediated activation......Recently, we have demonstrated the phosphorylation- and lipid raft-mediated internalization of the native norepinephrine transporter (NET) following protein kinase C (PKC) activation (Jayanthi, L. D., Samuvel, D. J., and Ramamoorthy, S. (2004) J. Biol. Chem. 279, 19315-19326). Here we tested...

  17. Correction: Correction to 'Clinical Policy: Procedural Sedation and Analgesia in the Emergency Department' [Annals of Emergency Medicine 63 (2014) 247-258.e18].

    Science.gov (United States)

    Godwin, Steven A; Burton, John H; Gerardo, Charles J; Hatten, Benjamin W; Mace, Sharon E; Silvers, Scott M; Fesmire, Francis M

    2017-11-01

    Due to a miscommunication during the process of transferring this manuscript from our editorial team to Production, the Members of the American College of Emergency Physicians Clinical Policies Committee (Oversight Committee) were not properly indexed in PubMed. This has now been corrected online. This has now been corrected online. The publisher would like to apologize for any inconvenience caused. Copyright © 2017 American College of Emergency Physicians. Published by Elsevier Inc. All rights reserved.

  18. Scientific Opinion on the safety of synthetic N-acetyl-D-neuraminic acid as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2017-01-01

    daily intake of the NF, was considered to be sufficient for fortified foods for the general population and for food supplements for individuals above 10 years of age, as the anticipated daily intake was in the range of the exposure to free NANA from the consumption of early human milk, which...... in a variety of foods and in food supplements for the general population. NANA is naturally present in human milk, in a bound and free form. The Margin of Exposure, which was based on the no-observed-adverse effect level (NOAEL) of 493 mg/kg body weight (bw) per day from a subchronic study and the anticipated...... is considered to be safe. The Panel concludes that the NF is safe when added to foods other than food supplements at the proposed uses and use levels for the general population; is safe in food supplements alone at the proposed uses and use levels for individuals above 10 years of age; is safe at the combined...

  19. SU-E-T-258: Development of a New Patient Set-Up Monitoring System Using Force Sensing Resistor (FSR) Sensor for the Radiation Therapy

    International Nuclear Information System (INIS)

    Cho, M; Kim, T; Kang, S; Kim, D; Kim, K; Shin, D; Suh, T

    2015-01-01

    Purpose: The purpose of this work is to develop a new patient set-up monitoring system using force sensing resistor (FSR) sensors that can confirm pressure of contact surface and evaluate its feasibility. Methods: In this study, we focused on develop the patient set-up monitoring system to compensate for the limitation of existing optical based monitoring system, so the developed system can inform motion in the radiation therapy. The set-up monitoring system was designed consisting of sensor units (FSR sensor), signal conditioning devices (USB cable/interface electronics), a control PC, and a developed analysis software. The sensor unit was made by attaching FSR sensor and dispersing pressure sponge to prevent error which is caused by concentrating specific point. Measured signal from the FSR sensor was sampled to arduino mega 2560 microcontroller, transferred to control PC by using serial communication. The measured data went through normalization process. The normalized data was displayed through the developed graphic user interface (GUI) software. The software was designed to display a single sensor unit intensity (maximum 16 sensors) and display 2D pressure distribution (using 16 sensors) according to the purpose. Results: Changes of pressure value according to motion was confirmed by the developed set-up monitoring system. Very small movement such as little physical change in appearance can be confirmed using a single unit and using 2D pressure distribution. Also, the set-up monitoring system can observe in real time. Conclusion: In this study, we developed the new set-up monitoring system using FSR sensor. Especially, we expect that the new set-up monitoring system is suitable for motion monitoring of blind area that is hard to confirm existing optical system and compensate existing optical based monitoring system. As a further study, an integrated system will be constructed through correlation of existing optical monitoring system. This work was supported by the Industrial R&D program of MOTIE/KEIT. [10048997, Development of the core technology for integrated therapy devices based on real-time MRI guided tumor tracking] and the Mid-career Researcher Program (2014R1A2A1A10050270) through the National Research Foundation of Korea funded by the Ministry of Science, ICT&Future Planning

  20. SU-E-T-258: Development of a New Patient Set-Up Monitoring System Using Force Sensing Resistor (FSR) Sensor for the Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Cho, M; Kim, T; Kang, S; Kim, D; Kim, K; Shin, D; Suh, T [The Catholic University of Korea College of Medicine, Seoul (Korea, Republic of)

    2015-06-15

    Purpose: The purpose of this work is to develop a new patient set-up monitoring system using force sensing resistor (FSR) sensors that can confirm pressure of contact surface and evaluate its feasibility. Methods: In this study, we focused on develop the patient set-up monitoring system to compensate for the limitation of existing optical based monitoring system, so the developed system can inform motion in the radiation therapy. The set-up monitoring system was designed consisting of sensor units (FSR sensor), signal conditioning devices (USB cable/interface electronics), a control PC, and a developed analysis software. The sensor unit was made by attaching FSR sensor and dispersing pressure sponge to prevent error which is caused by concentrating specific point. Measured signal from the FSR sensor was sampled to arduino mega 2560 microcontroller, transferred to control PC by using serial communication. The measured data went through normalization process. The normalized data was displayed through the developed graphic user interface (GUI) software. The software was designed to display a single sensor unit intensity (maximum 16 sensors) and display 2D pressure distribution (using 16 sensors) according to the purpose. Results: Changes of pressure value according to motion was confirmed by the developed set-up monitoring system. Very small movement such as little physical change in appearance can be confirmed using a single unit and using 2D pressure distribution. Also, the set-up monitoring system can observe in real time. Conclusion: In this study, we developed the new set-up monitoring system using FSR sensor. Especially, we expect that the new set-up monitoring system is suitable for motion monitoring of blind area that is hard to confirm existing optical system and compensate existing optical based monitoring system. As a further study, an integrated system will be constructed through correlation of existing optical monitoring system. This work was supported by the Industrial R&D program of MOTIE/KEIT. [10048997, Development of the core technology for integrated therapy devices based on real-time MRI guided tumor tracking] and the Mid-career Researcher Program (2014R1A2A1A10050270) through the National Research Foundation of Korea funded by the Ministry of Science, ICT&Future Planning.

  1. Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1, 1995--December 31, 1995. Volume 42, Pages 1-258

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    This is the 42nd volume of issuances of the U.S. Nuclear Regulatory Commission (NRC) and its Atomic Safety and Licensing Boards, Administrative Law Judges, and Office Directors. This book is a reprinting, containing corrections of numerous printing errors in a previously distributed book. It covers the period from July 1, 1995 to December 31, 1995. Atomic Safety and Licensing Boards conduct adjudicatory hearings on applications to construct and operate nuclear power plants and related facilities, and issue initial decisions which, subject to internal review and appellate procedures, become the final Commission action with respect to those applications. The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a 6-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly editions and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition.

  2. SU-E-J-258: Inter- and Intra-Fraction Setup Stability and Couch Change Tolerance for Image Guided Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Teboh, Forbang R; Agee, M; Rowe, L; Creasy, T; Schultz, J; Bell, R; Wong, J; Armour, E [Johns Hopkins University, Baltimore, MD (United States)

    2014-06-01

    Purpose: Immobilization devices combine rigid patient fixation as well as comfort and play a key role providing the stability required for accurate radiation delivery. In the setup step, couch re-positioning needed to align the patient is derived via registration of acquired versus reference image. For subsequent fractions, replicating the initial setup should yield identical alignment errors when compared to the reference. This is not always the case and further couch re-positioning can be needed. An important quality assurance measure is to set couch tolerances beyond which additional investigations are needed. The purpose of this work was to study the inter-fraction couch changes needed to re-align the patient and the intra-fraction stability of the alignment as a guide to establish the couch tolerances. Methods: Data from twelve patients treated on the Accuray CyberKnife (CK) system for fractionated intracranial radiotherapy and immobilized with Aquaplast RT, U-frame, F-Head-Support (Qfix, PA, USA) was used. Each fraction involved image acquisitions and registration with the reference to re-align the patient. The absolute couch position corresponding to the approved setup alignment was recorded per fraction. Intra-fraction set-up corrections were recorded throughout the treatment. Results: The average approved setup alignment was 0.03±0.28mm, 0.15±0.22mm, 0.06±0.31mm in the L/R, A/P, S/I directions respectively and 0.00±0.35degrees, 0.03±0.32degrees, 0.08±0.45degrees for roll, pitch and yaw respectively. The inter-fraction reproducibility of the couch position was 6.65mm, 10.55mm, and 4.77mm in the L/R, A/P and S/I directions respectively and 0.82degrees, 0.71degrees for roll and pitch respectively. Intra-fraction monitoring showed small average errors of 0.21±0.21mm, 0.00±0.08mm, 0.23±0.22mm in the L/R, A/P, S/I directions respectively and 0.03±0.12degrees, 0.04±0.25degrees, and 0.13±0.15degrees in the roll, pitch and yaw respectively. Conclusion: The inter-fraction reproducibility should serve as a guide to couch tolerances, specific to a site and immobilization. More patients need to be included to make general conclusions.

  3. Scientific Opinion on the safety of cranberry extract powder as a novel food ingredient pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2017-01-01

    concentrate through an ethanolic extraction using an adsorptive resin column to retain the phenolic components. The Panel considers that the production process is sufficiently described and does not raise concerns about the safety of the novel food. The NF is intended to be added to beverages and yogurts...

  4. Non–SCF-type F-box protein Roy1/Ymr258c interacts with a Rab5-like GTPase Ypt52 and inhibits Ypt52 function

    OpenAIRE

    Liu, Yuan; Nakatsukasa, Kunio; Kotera, Michiko; Kanada, Akira; Nishimura, Takashi; Kishi, Tsutomu; Mimura, Satoru; Kamura, Takumi

    2011-01-01

    Skp1/Cul1/F-box (SCF)–type F-box proteins are a component of the Cullin-RING SCF ubiquitin E3 ligase, which is involved in numerous cellular processes. However, the function of non–SCF-type F-box proteins remains largely unknown. The Rab5-like small guanosine 5′-triphosphatase Vps21/Ypt51 is a key regulator of intracellular transportation; however, deletion of its isoforms, Ypt52 and Ypt53, results in only a modest inhibition of intracellular trafficking. The function of these proteins theref...

  5. Safety of dried aerial parts of Hoodia parviflora as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2017-01-01

    provided on the composition, the specifications, the production process, the batch-to-batch variability and the stability of the NF is sufficient and does not raise safety concerns. The applicant intends to use the NF in a number of energy-reduced/sugar-free/no-added-sugar foods in quantities of up to 15...

  6. Corrigendum to "A Morse-Smale index theorem for indefinite elliptic systems and bifurcation" [J. Differential Equations 258 (5) (2015) 1715-1748

    Science.gov (United States)

    Portaluri, Alessandro; Waterstraat, Nils

    2018-02-01

    We discussed in a previous paper elliptic systems of partial differential equations on star-shaped domains and introduced the notions of conjugate radius and bifurcation radius. We proved that every bifurcation radius is a conjugate radius, and believed to have shown by an example that on the other hand not every conjugate radius is a bifurcation radius. This note reveals that our previous example was wrong, but it also introduces an improved example that shows the assertion that we claimed before.

  7. SU-E-J-258: Inter- and Intra-Fraction Setup Stability and Couch Change Tolerance for Image Guided Radiation Therapy

    International Nuclear Information System (INIS)

    Teboh, Forbang R; Agee, M; Rowe, L; Creasy, T; Schultz, J; Bell, R; Wong, J; Armour, E

    2014-01-01

    Purpose: Immobilization devices combine rigid patient fixation as well as comfort and play a key role providing the stability required for accurate radiation delivery. In the setup step, couch re-positioning needed to align the patient is derived via registration of acquired versus reference image. For subsequent fractions, replicating the initial setup should yield identical alignment errors when compared to the reference. This is not always the case and further couch re-positioning can be needed. An important quality assurance measure is to set couch tolerances beyond which additional investigations are needed. The purpose of this work was to study the inter-fraction couch changes needed to re-align the patient and the intra-fraction stability of the alignment as a guide to establish the couch tolerances. Methods: Data from twelve patients treated on the Accuray CyberKnife (CK) system for fractionated intracranial radiotherapy and immobilized with Aquaplast RT, U-frame, F-Head-Support (Qfix, PA, USA) was used. Each fraction involved image acquisitions and registration with the reference to re-align the patient. The absolute couch position corresponding to the approved setup alignment was recorded per fraction. Intra-fraction set-up corrections were recorded throughout the treatment. Results: The average approved setup alignment was 0.03±0.28mm, 0.15±0.22mm, 0.06±0.31mm in the L/R, A/P, S/I directions respectively and 0.00±0.35degrees, 0.03±0.32degrees, 0.08±0.45degrees for roll, pitch and yaw respectively. The inter-fraction reproducibility of the couch position was 6.65mm, 10.55mm, and 4.77mm in the L/R, A/P and S/I directions respectively and 0.82degrees, 0.71degrees for roll and pitch respectively. Intra-fraction monitoring showed small average errors of 0.21±0.21mm, 0.00±0.08mm, 0.23±0.22mm in the L/R, A/P, S/I directions respectively and 0.03±0.12degrees, 0.04±0.25degrees, and 0.13±0.15degrees in the roll, pitch and yaw respectively. Conclusion: The inter-fraction reproducibility should serve as a guide to couch tolerances, specific to a site and immobilization. More patients need to be included to make general conclusions

  8. SU-E-J-258: Prediction of Cervical Cancer Treatment Response Using Radiomics Features Based On F18-FDG Uptake in PET Images

    Energy Technology Data Exchange (ETDEWEB)

    Altazi, B; Fernandez, D; Zhang, G; Biagioli, M; Moros, E; Moffitt, H. Lee [Cancer Center, Tampa, FL, University of South Florida, Tampa, FL (United States)

    2015-06-15

    Purpose: Radiomics have shown potential for predicting treatment outcomes in several body sites. This study investigated the correlation between PET Radiomics features and treatment response of cervical cancer outcomes. Methods: our dataset consisted of a cohort of 79 patients diagnosed with cervical cancer, FIGO stage IB-IVA, age range 25–86 years, (median age at diagnosis: 50 years) all treated between: 2009–14 with external beam radiation therapy to a dose range between: 45–50.4 Gy (median= 45 Gy), concurrent cisplatin chemotherapy and MRI-based brachytherapy to a dose of 20–30 Gy (median= 28 Gy). Metabolic Tumor Volume (MTV) in patient’s primary site was delineated on pretreatment PET/CT by two board certified Radiation Oncologists. The features extracted from each patient’s volume were: 26 Co-occurrence matrix (COM) Feature, 11 Run-Length Matrix (RLM), 11 Gray Level Size Zone Matrix (GLSZM) and 33 Intensity-based features (IBF). The treatment outcome was divided based on the last follow up status into three classes: No Evidence of Disease (NED), Alive with Disease (AWD) and Dead of Disease (DOD). The ability for the radiomics features to differentiate between the 3 treatments outcome categories were assessed by One-Way ANOVA test with p-value < 0.05 was to be statistically significant. The results from the analysis were compared with the ones obtained previously for standard Uptake Value (SUV). Results: Based on patients last clinical follow-up; 52 showed NED, 17 AWD and 10 DOD. Radiomics Features were able to classify the patients based on their treatment response. A parallel analysis was done for SUV measurements for comparison. Conclusion: Radiomics features were able to differentiate between the three different classes of treatment outcomes. However, most of the features were only able to differentiate between NED and DOD class. Also, The ability or radiomics features to differentiate types of response were more significant than SUV.

  9. Genome-wide meta-analysis of 241,258 adults accounting for smoking behaviour identifies novel loci for obesity traits.

    Science.gov (United States)

    Justice, Anne E; Winkler, Thomas W; Feitosa, Mary F; Graff, Misa; Fisher, Virginia A; Young, Kristin; Barata, Llilda; Deng, Xuan; Czajkowski, Jacek; Hadley, David; Ngwa, Julius S; Ahluwalia, Tarunveer S; Chu, Audrey Y; Heard-Costa, Nancy L; Lim, Elise; Perez, Jeremiah; Eicher, John D; Kutalik, Zoltán; Xue, Luting; Mahajan, Anubha; Renström, Frida; Wu, Joseph; Qi, Qibin; Ahmad, Shafqat; Alfred, Tamuno; Amin, Najaf; Bielak, Lawrence F; Bonnefond, Amelie; Bragg, Jennifer; Cadby, Gemma; Chittani, Martina; Coggeshall, Scott; Corre, Tanguy; Direk, Nese; Eriksson, Joel; Fischer, Krista; Gorski, Mathias; Neergaard Harder, Marie; Horikoshi, Momoko; Huang, Tao; Huffman, Jennifer E; Jackson, Anne U; Justesen, Johanne Marie; Kanoni, Stavroula; Kinnunen, Leena; Kleber, Marcus E; Komulainen, Pirjo; Kumari, Meena; Lim, Unhee; Luan, Jian'an; Lyytikäinen, Leo-Pekka; Mangino, Massimo; Manichaikul, Ani; Marten, Jonathan; Middelberg, Rita P S; Müller-Nurasyid, Martina; Navarro, Pau; Pérusse, Louis; Pervjakova, Natalia; Sarti, Cinzia; Smith, Albert Vernon; Smith, Jennifer A; Stančáková, Alena; Strawbridge, Rona J; Stringham, Heather M; Sung, Yun Ju; Tanaka, Toshiko; Teumer, Alexander; Trompet, Stella; van der Laan, Sander W; van der Most, Peter J; Van Vliet-Ostaptchouk, Jana V; Vedantam, Sailaja L; Verweij, Niek; Vink, Jacqueline M; Vitart, Veronique; Wu, Ying; Yengo, Loic; Zhang, Weihua; Hua Zhao, Jing; Zimmermann, Martina E; Zubair, Niha; Abecasis, Gonçalo R; Adair, Linda S; Afaq, Saima; Afzal, Uzma; Bakker, Stephan J L; Bartz, Traci M; Beilby, John; Bergman, Richard N; Bergmann, Sven; Biffar, Reiner; Blangero, John; Boerwinkle, Eric; Bonnycastle, Lori L; Bottinger, Erwin; Braga, Daniele; Buckley, Brendan M; Buyske, Steve; Campbell, Harry; Chambers, John C; Collins, Francis S; Curran, Joanne E; de Borst, Gert J; de Craen, Anton J M; de Geus, Eco J C; Dedoussis, George; Delgado, Graciela E; den Ruijter, Hester M; Eiriksdottir, Gudny; Eriksson, Anna L; Esko, Tõnu; Faul, Jessica D; Ford, Ian; Forrester, Terrence; Gertow, Karl; Gigante, Bruna; Glorioso, Nicola; Gong, Jian; Grallert, Harald; Grammer, Tanja B; Grarup, Niels; Haitjema, Saskia; Hallmans, Göran; Hamsten, Anders; Hansen, Torben; Harris, Tamara B; Hartman, Catharina A; Hassinen, Maija; Hastie, Nicholas D; Heath, Andrew C; Hernandez, Dena; Hindorff, Lucia; Hocking, Lynne J; Hollensted, Mette; Holmen, Oddgeir L; Homuth, Georg; Jan Hottenga, Jouke; Huang, Jie; Hung, Joseph; Hutri-Kähönen, Nina; Ingelsson, Erik; James, Alan L; Jansson, John-Olov; Jarvelin, Marjo-Riitta; Jhun, Min A; Jørgensen, Marit E; Juonala, Markus; Kähönen, Mika; Karlsson, Magnus; Koistinen, Heikki A; Kolcic, Ivana; Kolovou, Genovefa; Kooperberg, Charles; Krämer, Bernhard K; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A; Langenberg, Claudia; Launer, Lenore J; Leander, Karin; Lee, Nanette R; Lind, Lars; Lindgren, Cecilia M; Linneberg, Allan; Lobbens, Stephane; Loh, Marie; Lorentzon, Mattias; Luben, Robert; Lubke, Gitta; Ludolph-Donislawski, Anja; Lupoli, Sara; Madden, Pamela A F; Männikkö, Reija; Marques-Vidal, Pedro; Martin, Nicholas G; McKenzie, Colin A; McKnight, Barbara; Mellström, Dan; Menni, Cristina; Montgomery, Grant W; Musk, Aw Bill; Narisu, Narisu; Nauck, Matthias; Nolte, Ilja M; Oldehinkel, Albertine J; Olden, Matthias; Ong, Ken K; Padmanabhan, Sandosh; Peyser, Patricia A; Pisinger, Charlotta; Porteous, David J; Raitakari, Olli T; Rankinen, Tuomo; Rao, D C; Rasmussen-Torvik, Laura J; Rawal, Rajesh; Rice, Treva; Ridker, Paul M; Rose, Lynda M; Bien, Stephanie A; Rudan, Igor; Sanna, Serena; Sarzynski, Mark A; Sattar, Naveed; Savonen, Kai; Schlessinger, David; Scholtens, Salome; Schurmann, Claudia; Scott, Robert A; Sennblad, Bengt; Siemelink, Marten A; Silbernagel, Günther; Slagboom, P Eline; Snieder, Harold; Staessen, Jan A; Stott, David J; Swertz, Morris A; Swift, Amy J; Taylor, Kent D; Tayo, Bamidele O; Thorand, Barbara; Thuillier, Dorothee; Tuomilehto, Jaakko; Uitterlinden, Andre G; Vandenput, Liesbeth; Vohl, Marie-Claude; Völzke, Henry; Vonk, Judith M; Waeber, Gérard; Waldenberger, Melanie; Westendorp, R G J; Wild, Sarah; Willemsen, Gonneke; Wolffenbuttel, Bruce H R; Wong, Andrew; Wright, Alan F; Zhao, Wei; Zillikens, M Carola; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Böger, Carsten A; Boomsma, Dorret I; Bouchard, Claude; Bruinenberg, Marcel; Chasman, Daniel I; Chen, Yii-DerIda; Chines, Peter S; Cooper, Richard S; Cucca, Francesco; Cusi, Daniele; Faire, Ulf de; Ferrucci, Luigi; Franks, Paul W; Froguel, Philippe; Gordon-Larsen, Penny; Grabe, Hans-Jörgen; Gudnason, Vilmundur; Haiman, Christopher A; Hayward, Caroline; Hveem, Kristian; Johnson, Andrew D; Wouter Jukema, J; Kardia, Sharon L R; Kivimaki, Mika; Kooner, Jaspal S; Kuh, Diana; Laakso, Markku; Lehtimäki, Terho; Marchand, Loic Le; März, Winfried; McCarthy, Mark I; Metspalu, Andres; Morris, Andrew P; Ohlsson, Claes; Palmer, Lyle J; Pasterkamp, Gerard; Pedersen, Oluf; Peters, Annette; Peters, Ulrike; Polasek, Ozren; Psaty, Bruce M; Qi, Lu; Rauramaa, Rainer; Smith, Blair H; Sørensen, Thorkild I A; Strauch, Konstantin; Tiemeier, Henning; Tremoli, Elena; van der Harst, Pim; Vestergaard, Henrik; Vollenweider, Peter; Wareham, Nicholas J; Weir, David R; Whitfield, John B; Wilson, James F; Tyrrell, Jessica; Frayling, Timothy M; Barroso, Inês; Boehnke, Michael; Deloukas, Panagiotis; Fox, Caroline S; Hirschhorn, Joel N; Hunter, David J; Spector, Tim D; Strachan, David P; van Duijn, Cornelia M; Heid, Iris M; Mohlke, Karen L; Marchini, Jonathan; Loos, Ruth J F; Kilpeläinen, Tuomas O; Liu, Ching-Ti; Borecki, Ingrid B; North, Kari E; Cupples, L Adrienne

    2017-04-26

    Few genome-wide association studies (GWAS) account for environmental exposures, like smoking, potentially impacting the overall trait variance when investigating the genetic contribution to obesity-related traits. Here, we use GWAS data from 51,080 current smokers and 190,178 nonsmokers (87% European descent) to identify loci influencing BMI and central adiposity, measured as waist circumference and waist-to-hip ratio both adjusted for BMI. We identify 23 novel genetic loci, and 9 loci with convincing evidence of gene-smoking interaction (GxSMK) on obesity-related traits. We show consistent direction of effect for all identified loci and significance for 18 novel and for 5 interaction loci in an independent study sample. These loci highlight novel biological functions, including response to oxidative stress, addictive behaviour, and regulatory functions emphasizing the importance of accounting for environment in genetic analyses. Our results suggest that tobacco smoking may alter the genetic susceptibility to overall adiposity and body fat distribution.

  10. Pax2/5/8 and Pax6 alternative splicing events in basal chordates and vertebrates: a focus on paired box domain

    Czech Academy of Sciences Publication Activity Database

    Fabian, Peter; Kozmiková, Iryna; Kozmik, Zbyněk; Pantzartzi, Chrysoula

    2015-01-01

    Roč. 6, Jul 2 (2015) ISSN 1664-8021 R&D Projects: GA MŠk LH12047; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:68378050 Keywords : Pax homologs * splicing * vertebrate evolution Subject RIV: EB - Genetics ; Molecular Biology

  11. Genome-wide meta-analysis of 241,258 adults accounting for smoking behaviour identifies novel loci for obesity traits

    NARCIS (Netherlands)

    Justice, A.E.; Winkler, T.W.; Feitosa, M.F.; Graff, M.; Fisher, V.A.; Young, K.; Vink, J.M.; North, K.E.; Cupples, L.A.

    2017-01-01

    Few genome-wide association studies (GWAS) account for environmental exposures, like smoking, potentially impacting the overall trait variance when investigating the genetic contribution to obesity-related traits. Here, we use GWAS data from 51,080 current smokers and 190,178 nonsmokers (87%

  12. Opinions and decisions of the Nuclear Regulatory Commission with selected orders, July 1, 1995--December 31, 1995. Volume 42, Pages 1-258

    International Nuclear Information System (INIS)

    1996-01-01

    This is the 42nd volume of issuances of the U.S. Nuclear Regulatory Commission (NRC) and its Atomic Safety and Licensing Boards, Administrative Law Judges, and Office Directors. This book is a reprinting, containing corrections of numerous printing errors in a previously distributed book. It covers the period from July 1, 1995 to December 31, 1995. Atomic Safety and Licensing Boards conduct adjudicatory hearings on applications to construct and operate nuclear power plants and related facilities, and issue initial decisions which, subject to internal review and appellate procedures, become the final Commission action with respect to those applications. The hardbound edition of the Nuclear Regulatory Commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a 6-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly editions and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition

  13. Scientific opinion on the safety of proline-specific oligopeptidase as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2017-01-01

    . The results from a bacterial reverse mutation test and of an in vitro chromosome aberration test did not indicate genotoxicity. The Panel considers that the reported effects observed in a 90-day rat study are treatment-related effects and can be attributed to the higher energy consumption by these animals....... Taking into account the intended maximum use level for Tolerase® G, its daily consumption would correspond to 2,746 mg TOS/person or to 39.2 mg TOS/kg body weight (bw) per day, when considering a default body weight of 70 kg for an adult person. The margin between this value and the dose in the rats...

  14. The Nordic Housing Enabler: Inter-rater reliability in cross-Nordic occupational therapy practice. Previously published in Scandinavian Journal of Occupational Therapy 2010; 17: 258-266.

    Science.gov (United States)

    Helle, Tina; Nygren, Carita; Slaug, Björn; Brandt, Aase; Pikkarainen, Aila; Hansen, Anne-Grethe; Pétursdórttir, Emma; Iwarsson, Susanne

    2014-01-01

    This study addresses development of a content-valid cross-Nordic version of the Housing Enabler and investigation of its inter-rater reliability when used in occupational therapy rating situations, involving occupational therapists, clients, and their home environments. The instrument was translated from the original Swedish version of the Housing Enabler, and adapted according to accessibility norms and guidelines for housing design in Sweden, Denmark, Finland, and Iceland. This iterative process involved occupational therapists, architects, building engineers, and professional translators, resulting in the Nordic Housing Enabler. For reliability testing, the sampling strategy and data collection procedures used were the same in all countries. Twenty voluntary occupational therapists, pair-wise but independently of each other, collected data from 106 cases by means of the Nordic Housing Enabler. Inter-rater reliability was calculated by means of percentage agreement and kappa statistics. Overall good percentage agreement for the personal and environmental components of the instrument was shown, indicating that the instrument was sufficiently reliable for application in practice and research in the Nordic context. The varying kappa results highlight the need for further study in order to understand the influence of prevalence more profoundly, which should be kept in mind when interpreting the results.

  15. Statement on the safety of EstroG-100TM as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2017-01-01

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to update its scientific opinion on the safety of EstroG-100™ as a novel food (NF) in the light of additional information submitted by the applicant. In its previous...... scientific opinion of 2016, the Panel concluded that EstroG-100™, which is a hot-water extract of a mixture of three herbal roots, is safe for the use in food supplements at the maximum intake level of 175 mg/day in post-menopausal women, which is lower than the maximum intake level proposed by the applicant...... (514 mg/day). The Panel reached its conclusions based on the effects of EstroG-100™ on liver and haematology as observed in several oral toxicity studies, the lack of information on liver and haematological parameters in human studies and the absence of chronic toxicity data. In view of the Panel...

  16. Genome-wide meta-analysis of 241,258 adults accounting for smoking behaviour identifies novel loci for obesity traits

    Science.gov (United States)

    Justice, Anne E.; Winkler, Thomas W.; Feitosa, Mary F.; Graff, Misa; Fisher, Virginia A.; Young, Kristin; Barata, Llilda; Deng, Xuan; Czajkowski, Jacek; Hadley, David; Ngwa, Julius S.; Ahluwalia, Tarunveer S.; Chu, Audrey Y.; Heard-Costa, Nancy L.; Lim, Elise; Perez, Jeremiah; Eicher, John D.; Kutalik, Zoltán; Xue, Luting; Mahajan, Anubha; Renström, Frida; Wu, Joseph; Qi, Qibin; Ahmad, Shafqat; Alfred, Tamuno; Amin, Najaf; Bielak, Lawrence F.; Bonnefond, Amelie; Bragg, Jennifer; Cadby, Gemma; Chittani, Martina; Coggeshall, Scott; Corre, Tanguy; Direk, Nese; Eriksson, Joel; Fischer, Krista; Gorski, Mathias; Neergaard Harder, Marie; Horikoshi, Momoko; Huang, Tao; Huffman, Jennifer E.; Jackson, Anne U.; Justesen, Johanne Marie; Kanoni, Stavroula; Kinnunen, Leena; Kleber, Marcus E.; Komulainen, Pirjo; Kumari, Meena; Lim, Unhee; Luan, Jian'an; Lyytikäinen, Leo-Pekka; Mangino, Massimo; Manichaikul, Ani; Marten, Jonathan; Middelberg, Rita P. S.; Müller-Nurasyid, Martina; Navarro, Pau; Pérusse, Louis; Pervjakova, Natalia; Sarti, Cinzia; Smith, Albert Vernon; Smith, Jennifer A.; Stančáková, Alena; Strawbridge, Rona J.; Stringham, Heather M.; Sung, Yun Ju; Tanaka, Toshiko; Teumer, Alexander; Trompet, Stella; van der Laan, Sander W.; van der Most, Peter J.; Van Vliet-Ostaptchouk, Jana V.; Vedantam, Sailaja L.; Verweij, Niek; Vink, Jacqueline M.; Vitart, Veronique; Wu, Ying; Yengo, Loic; Zhang, Weihua; Hua Zhao, Jing; Zimmermann, Martina E.; Zubair, Niha; Abecasis, Gonçalo R.; Adair, Linda S.; Afaq, Saima; Afzal, Uzma; Bakker, Stephan J. L.; Bartz, Traci M.; Beilby, John; Bergman, Richard N.; Bergmann, Sven; Biffar, Reiner; Blangero, John; Boerwinkle, Eric; Bonnycastle, Lori L.; Bottinger, Erwin; Braga, Daniele; Buckley, Brendan M.; Buyske, Steve; Campbell, Harry; Chambers, John C.; Collins, Francis S.; Curran, Joanne E.; de Borst, Gert J.; de Craen, Anton J. M.; de Geus, Eco J. C.; Dedoussis, George; Delgado, Graciela E.; den Ruijter, Hester M.; Eiriksdottir, Gudny; Eriksson, Anna L.; Esko, Tõnu; Faul, Jessica D.; Ford, Ian; Forrester, Terrence; Gertow, Karl; Gigante, Bruna; Glorioso, Nicola; Gong, Jian; Grallert, Harald; Grammer, Tanja B.; Grarup, Niels; Haitjema, Saskia; Hallmans, Göran; Hamsten, Anders; Hansen, Torben; Harris, Tamara B.; Hartman, Catharina A.; Hassinen, Maija; Hastie, Nicholas D.; Heath, Andrew C.; Hernandez, Dena; Hindorff, Lucia; Hocking, Lynne J.; Hollensted, Mette; Holmen, Oddgeir L.; Homuth, Georg; Jan Hottenga, Jouke; Huang, Jie; Hung, Joseph; Hutri-Kähönen, Nina; Ingelsson, Erik; James, Alan L.; Jansson, John-Olov; Jarvelin, Marjo-Riitta; Jhun, Min A.; Jørgensen, Marit E.; Juonala, Markus; Kähönen, Mika; Karlsson, Magnus; Koistinen, Heikki A.; Kolcic, Ivana; Kolovou, Genovefa; Kooperberg, Charles; Krämer, Bernhard K.; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A.; Langenberg, Claudia; Launer, Lenore J.; Leander, Karin; Lee, Nanette R.; Lind, Lars; Lindgren, Cecilia M.; Linneberg, Allan; Lobbens, Stephane; Loh, Marie; Lorentzon, Mattias; Luben, Robert; Lubke, Gitta; Ludolph-Donislawski, Anja; Lupoli, Sara; Madden, Pamela A. F.; Männikkö, Reija; Marques-Vidal, Pedro; Martin, Nicholas G.; McKenzie, Colin A.; McKnight, Barbara; Mellström, Dan; Menni, Cristina; Montgomery, Grant W.; Musk, AW (Bill); Narisu, Narisu; Nauck, Matthias; Nolte, Ilja M.; Oldehinkel, Albertine J.; Olden, Matthias; Ong, Ken K.; Padmanabhan, Sandosh; Peyser, Patricia A.; Pisinger, Charlotta; Porteous, David J.; Raitakari, Olli T.; Rankinen, Tuomo; Rao, D. C.; Rasmussen-Torvik, Laura J.; Rawal, Rajesh; Rice, Treva; Ridker, Paul M.; Rose, Lynda M.; Bien, Stephanie A.; Rudan, Igor; Sanna, Serena; Sarzynski, Mark A.; Sattar, Naveed; Savonen, Kai; Schlessinger, David; Scholtens, Salome; Schurmann, Claudia; Scott, Robert A.; Sennblad, Bengt; Siemelink, Marten A.; Silbernagel, Günther; Slagboom, P Eline; Snieder, Harold; Staessen, Jan A.; Stott, David J.; Swertz, Morris A.; Swift, Amy J.; Taylor, Kent D.; Tayo, Bamidele O.; Thorand, Barbara; Thuillier, Dorothee; Tuomilehto, Jaakko; Uitterlinden, Andre G.; Vandenput, Liesbeth; Vohl, Marie-Claude; Völzke, Henry; Vonk, Judith M.; Waeber, Gérard; Waldenberger, Melanie; Westendorp, R. G. J.; Wild, Sarah; Willemsen, Gonneke; Wolffenbuttel, Bruce H. R.; Wong, Andrew; Wright, Alan F.; Zhao, Wei; Zillikens, M Carola; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Böger, Carsten A.; Boomsma, Dorret I.; Bouchard, Claude; Bruinenberg, Marcel; Chasman, Daniel I.; Chen, Yii-DerIda; Chines, Peter S.; Cooper, Richard S.; Cucca, Francesco; Cusi, Daniele; Faire, Ulf de; Ferrucci, Luigi; Franks, Paul W.; Froguel, Philippe; Gordon-Larsen, Penny; Grabe, Hans- Jörgen; Gudnason, Vilmundur; Haiman, Christopher A.; Hayward, Caroline; Hveem, Kristian; Johnson, Andrew D.; Wouter Jukema, J; Kardia, Sharon L. R.; Kivimaki, Mika; Kooner, Jaspal S.; Kuh, Diana; Laakso, Markku; Lehtimäki, Terho; Marchand, Loic Le; März, Winfried; McCarthy, Mark I.; Metspalu, Andres; Morris, Andrew P.; Ohlsson, Claes; Palmer, Lyle J.; Pasterkamp, Gerard; Pedersen, Oluf; Peters, Annette; Peters, Ulrike; Polasek, Ozren; Psaty, Bruce M.; Qi, Lu; Rauramaa, Rainer; Smith, Blair H.; Sørensen, Thorkild I. A.; Strauch, Konstantin; Tiemeier, Henning; Tremoli, Elena; van der Harst, Pim; Vestergaard, Henrik; Vollenweider, Peter; Wareham, Nicholas J.; Weir, David R.; Whitfield, John B.; Wilson, James F.; Tyrrell, Jessica; Frayling, Timothy M.; Barroso, Inês; Boehnke, Michael; Deloukas, Panagiotis; Fox, Caroline S.; Hirschhorn, Joel N.; Hunter, David J.; Spector, Tim D.; Strachan, David P.; van Duijn, Cornelia M.; Heid, Iris M.; Mohlke, Karen L.; Marchini, Jonathan; Loos, Ruth J. F.; Kilpeläinen, Tuomas O.; Liu, Ching-Ti; Borecki, Ingrid B.; North, Kari E.; Cupples, L Adrienne

    2017-01-01

    Few genome-wide association studies (GWAS) account for environmental exposures, like smoking, potentially impacting the overall trait variance when investigating the genetic contribution to obesity-related traits. Here, we use GWAS data from 51,080 current smokers and 190,178 nonsmokers (87% European descent) to identify loci influencing BMI and central adiposity, measured as waist circumference and waist-to-hip ratio both adjusted for BMI. We identify 23 novel genetic loci, and 9 loci with convincing evidence of gene-smoking interaction (GxSMK) on obesity-related traits. We show consistent direction of effect for all identified loci and significance for 18 novel and for 5 interaction loci in an independent study sample. These loci highlight novel biological functions, including response to oxidative stress, addictive behaviour, and regulatory functions emphasizing the importance of accounting for environment in genetic analyses. Our results suggest that tobacco smoking may alter the genetic susceptibility to overall adiposity and body fat distribution. PMID:28443625

  17. Genome-wide meta-analysis of 241,258 adults accounting for smoking behaviour identifies novel loci for obesity traits

    DEFF Research Database (Denmark)

    Justice, Anne E; Winkler, Thomas W; Feitosa, Mary F

    2017-01-01

    direction of effect for all identified loci and significance for 18 novel and for 5 interaction loci in an independent study sample. These loci highlight novel biological functions, including response to oxidative stress, addictive behaviour, and regulatory functions emphasizing the importance of accounting...

  18. Statement on the safety of EstroG-100TM as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Poulsen, Morten

    2017-01-01

    scientific opinion of 2016, the Panel concluded that EstroG-100™, which is a hot-water extract of a mixture of three herbal roots, is safe for the use in food supplements at the maximum intake level of 175 mg/day in post-menopausal women, which is lower than the maximum intake level proposed by the applicant...... the additional information provided by the applicant, the Panel considers that the conclusion of the scientific opinion on the safety of EstroG-100™ does not need to be revised, and thus, the Panel reconfirms that the NF is safe for the use in food supplements at the maximum intake level of 175 mg/day in post...

  19. Safety of EstroG-100TM as a novel food pursuant to Regulation (EC) No 258/97

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2016-01-01

    G-100TM, a hot-water extract of a mixture of three herbal roots (Cynanchum wilfordii Hemsley, Phlomis umbrosa Turcz. and Angelica gigas Nakai), which is concentrated and spray-dried. The information provided on the composition, specifications and stability of the NF is sufficient, and does not raise...... safety concerns. The applicant intends to use EstroG-100TM in food supplements, with a proposed maximum intake level of 514 mg/day. The target population is post-menopausal women. The Panel considers that the information provided does not raise safety concerns as regards the genotoxicity of the NF...... factor of 200 to derive the maximum safe intake level for the NF. Thus, the Panel concludes that the NF, EstroG-100TM, is safe for the use in food supplements at the maximum intake level of 175 mg/day for an adult of 70 kg bw....

  20. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  1. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125579)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  2. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125648)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  3. Gonzalo Portocarrero, Profetas del odio. Raíces culturales y líderes de Sendero Luminoso, Lima, Fondo Editorial de la Pontificia Universidad Católica del Perú, 2012, 258 p.

    OpenAIRE

    Iglesias, Daniel

    2012-01-01

    Los análisis del surgimiento y desarrollo de Sendero Luminoso (SL) han tenido siempre que afrontar duras críticas fuera del mundo académico peruano. Estas opiniones negativas son una de las tantas expresiones de las dificultades que existen en el Perú para reflexionar sobre los años de violencia y terrorismo que sacudieron este país entre 1980 y el año 2000. Las polémicas y escándalos desatados por la publicación del libro Profetas del odio. Raíces culturales y líderes de Sendero Luminoso del...

  4. Micro-fluidic (Lab-on the- Chip) PCR Array Cartridge for Biological Screening in a Hand Held Device: FInal Report for CRADA no 264. PNNL-T2-258-RU with CombiMatrix Corp

    Energy Technology Data Exchange (ETDEWEB)

    Rainina, Evguenia I.

    2010-10-31

    The worldwide emergence of both new and old diseases resulting from human expansion and also human and materials mobility has and will continue to place stress on both medical and clinical diagnostics. The classical approach to bioagents detection involves the use of differential metabolic assays to determine species type in the case of most bacteria, or the use of cell culture and electron microscopy to diagnose viruses and some bacteria that are intracellular parasites. The long-term goal in bioagent detection is to develop a hand-held instrument featuring disposable cartridges which contain all the necessary reagents, reaction chambers, waste chambers, and micro-fluidics to extract, concentrate, amplify, and analyze nucleic acids. This GIPP project began development of a sensory platform using nucleic-acid based probes. Although research was not completed, initial findings indicated that an advanced sensing device could theoretically be built on a DNA/RNA-based technology platform.

  5. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125647)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  6. Marine Protected Areas, Aquatic Preserves are state-owned sovereign submerged lands in areas which have exceptional biological, aesthetic, and scientific value, as described in Chapter 258.39, Florida Statutes, which have been set aside for the benefit of future generations. The, Published in 2011, 1:24000 (1in=2000ft) scale, Florida Department of Environmental Protection (FDEP).

    Data.gov (United States)

    NSGIC State | GIS Inventory — Marine Protected Areas dataset current as of 2011. Aquatic Preserves are state-owned sovereign submerged lands in areas which have exceptional biological, aesthetic,...

  7. CCDC 974613: Experimental Crystal Structure Determination : catena-[bis(mu-5,5',5''-(1,3,4,6,7,9,9b-heptaazaphenalene-2,5,8-triyltriimino)triisophthalato)-tris(dimethyl sulfoxide)-triaqua-hexa-copper dimethyl sulfoxide solvate hydrate

    KAUST Repository

    Luebke, Ryan

    2014-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  8. Validation of a Protocol to Compare the Effectiveness of Experimental Decontaminants with Component 2 of the M258A1 Kit or Fuller’s Earth Standard Decontaminants Against Percutaneous Application of Undiluted Vesicant Chemical Surety Materiel to the Laboratory Albino Rabbit

    Science.gov (United States)

    1987-07-24

    is individually packaged in aluminum foil to maintain activity of the ingredients and to prolong the storage life of the kit. Component I consists of...1.0 (w/w) mixture of Ketamine and Rompun (8.75 mg/kg and 5.0 mg/kg, respectively) by intramuscular injection. The unconscious animals were then...corresponding time interval for the standard decontamination system. The ease of estimation of lesion length was enhanced by the intramuscular injection of I ml

  9. The Launch of a Joint Library/Writing Centre Online Course on Academic Integrity. A Review of: Greer, K., Swanberg, S., Hristova, M., Switzer, A. T., Daniel, D., & Perdue, S. W. (2012. Beyond the web tutorial: Development and implementation of an online, self-directed academic integrity course at Oakland University. The Journal of Academic Librarianship, 38(5, 251-258.

    Directory of Open Access Journals (Sweden)

    Cari Merkley

    2013-06-01

    Full Text Available Objective – To outline the collaborative development of an online course addressing academic integrity by a university’s library system and writing centre.Design – Case study.Setting – A public research university in the Midwestern United States.Subjects – 1650 students who completed the online module.Methods – Oakland University (OU Libraries and the Writing Centre began to collaborate on the development of a new online course on academic integrity in 2011. It was felt that an existing online library tutorial on plagiarism no longer met the needs of students and faculty. The development of the course was informed by the Association of College and Research Libraries’ Information Literacy Competency Standards for Higher Education (2000 as well as a research study investigating students’ use of sources in their scholarly writing across several institutions. Moodle, the institution’s learning management system (LMS, was used to develop the learning object.Main Results – OU Libraries and the Writing Centre launched the six-part online course entitled “Using and Citing Sources” in January 2012. They developed modules around learning outcomes in five broad categories: defining academic integrity and plagiarism; the use of sources in academic writing; paraphrasing; quoting; and citation. The final module provided students with an opportunity to practise lessons learned in the first five modules. The use of the LMS to design and host the course limited the tutorial to registered students, but provided developers with access to additional course functionality without labour-intensive coding. It also allowed Writing Centre staff to access students’ performance data on the modules prior to their appointments. Improvements over the previous online tutorial included expanded content on academic ethics and referencing, more active learning elements, video content, and the opportunity for students to choose discipline-specific examples. In the first four months of its availability, 1650 students completed the course, with 3330 attempts overall.Conclusion – The diverse perspectives and expertise that individuals from OU Libraries and the Writing Center brought to their collaboration greatly informed the development of the course. The time and effort saved by using the university’s existing LMS to develop interactive content and the focus on providing students with opportunities for active learning within the course contributed to the project’s success.

  10. Biswas, Dr Gautam

    Indian Academy of Sciences (India)

    Specialization: Enhancement of Heat Transfer, Computational Fluid Dynamics, Bubble Growth in Film Boiling, Free Surface Flows, Turbulence& Turbomachinery Address: Director, Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 269 0401, (0361) 258 2005. Residence: (0361) 258 4001

  11. 40 CFR 52.1977 - Content of approved State submitted implementation plan.

    Science.gov (United States)

    2010-07-01

    ..., except (6)(c) (10/14/99) 252-0210Consequences of Control Strategy Implementation Plan Failures, except (1...-0170Oxygenated Gasoline Blending (10/14/99) 258-0180Registration (10/14/99) 258-0190CAR, Distributor and Retail Outlet Operating Permits (10/14/99) 258-0200Owners of Gasoline at Terminals, Distributors and Retail...

  12. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Date of birth: 6 January 1981. Specialization: RNA Biology, Structural & Computational Biology, Genome Engineering Address: Dept. of Biosciences & Bioengg., Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 258 2223. Residence: (0361) 258 4223, 98641 23088. Fax: (0361) 258 2249

  13. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Address: Dept. of Biosciences & Bioengg., Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 258 2223. Residence: (0361) 258 4223, 98641 23088. Fax: (0361) 258 2249. Email: banand@iitg.ernet.in, anandbasub@gmail.com. http://www.iitg.ernet.in/banand · YouTube · Twitter · Facebook ...

  14. AcEST: BP921473 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 58|B3R258_CUPTR Putative uncharacterized protein OS=Cupriavidus taiwanensis (stra... Putative uncharacterized protein OS=Asper... 33 9.3 >tr|B3R258|B3R258_CUPTR Putative uncharacterized protein OS=Cupriavidus taiwan

  15. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  16. Universal Documentation System

    Science.gov (United States)

    2012-07-01

    Secretariat Range Commanders Council Attn: STEWS -RCC White Sands Missile Range, New Mexico 88002-5110 Comm 575-678-1107 DSN 258-1107 E-mail...Range/ STEWS -NRO-BP White Sands Missile Range, NM 88002-5113 PHONE: DSN: 258-3812 COMMERCIAL: (575) 678-3812 FAX: DSN: 258-1904 COMMERCIAL: (575...wants a copy. Make additional entries as necessary to ensure distribution to the appropriate recipients . NUMBER OF COPIES: Enter the number of

  17. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available : 132 RFVEASIKVSDGDPALRPAIAEIVSSIKPTLGLFINEEVEGNPLATMICVQDNDLAGVIS 191 ... RFVEASIKVSDGDPALRPAIAEIVSSIKPTLGLFINEE...VEGNPLATMICVQDNDLAGVIS Sbjct: 1 ... RFVEASIKVSDGDPALRPAIAEIVSSIKPTLGLFINEEVEGNPLATMICVQDNDLAGVIS 60 ... Query: 252 WQKGTGE 258 ... WQKGTGE Sbjct: 121 WQKGTGE 127

  18. ORF Alignment: NC_003106 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LLLPWKSLLHDKIRDFAPPEKFSKV 60 ... Query: 122 FPSKKSNYIVKRVDWSSRILLWELLSKLNSIELIDARNREEYEGLTSAPPEHKCEQTQVS 181 ... ... ... FPSKKSNYIVKRVDWSSRILLWELLSKLNSIELIDARNREEYEGLTSAPPEHKCEQTQVS Sbjct: 121 ...FPSKKSNYIVKRVDWSSRILLWELLSKLNSIELIDARNREEYEGLTSAPPEHKCEQTQVS 180 ... Query: 242 LSYKNVRLYDGSWVEYGN 259 ... LSYKNVRLYDGSWVEYGN Sbjct: 241 LSYKNVRLYDGSWVEYGN 258

  19. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Pseudomonas syringae pv. tomato str. DC3000] ... Length = 161 ... Query: 199 DIRFALGESSLGSILVATSR...KGICAISLGDDPDALIQGFQDQFPNANLIGADAQFEALIA 258 ... DIRFALGESSLGSILVATSRKGICA...ISLGDDPDALIQGFQDQFPNANLIGADAQFEALIA Sbjct: 1 ... DIRFALGESSLGSILVATSRKGICAISLGDDPDALIQGFQDQFPNANLIGADAQFEALIA

  20. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  1. National Information Centre for Marine Sciences (NICMAS) - An excellent source of information for aquaculturists

    Digital Repository Service at National Institute of Oceanography (India)

    Tapaswi, M.P.

    stream_size 4 stream_content_type text/plain stream_name Proc_Natl_Workshop_Aquacult_WeeK_1998_258.pdf.txt stream_source_info Proc_Natl_Workshop_Aquacult_WeeK_1998_258.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  2. Jiří George Kukla a velká klimatologie globálních změn

    Czech Academy of Sciences Publication Activity Database

    Cílek, Václav

    2003-01-01

    Roč. 58, č. 9 (2003), s. 257-258 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : J. G. Kukla * climatology * ice age Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/ data /004/000514.pdf

  3. Sample geometry and the brittle-ductile behavior of edge cracks in 3D atomistic simulations by molecular dynamics

    Czech Academy of Sciences Publication Activity Database

    Pelikán, Vladimír; Hora, Petr; Machová, Anna; Kolman, Radek; Uhnáková, Alena

    2017-01-01

    Roč. 258 (2017), s. 45-48, č. článku 188189. ISSN 1662-9779 R&D Projects: GA ČR(CZ) GA15-20666S Institutional support: RVO:61388998 Keywords : BCC iron * crack growth * dislocation emission * twins Subject RIV: BM - Solid Matter Physics ; Magnetism https://www.scientific.net/SSP.258.45

  4. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    ... December 1923. Address: Department of Physics, Joseph Henry Laboratories, Princeton University, Jadwin Hall, Post Box 708, Princeton, NJ 08544-0708, U.S.A.. Contact: Office: (+1-609) 258 5850. Residence: (+1-609) 454 5075. Fax: (+1-609) 258 1006. Email: pwa@princeton.edu. YouTube · Twitter · Facebook · Blog ...

  5. 76 FR 270 - Alaska: Adequacy of Alaska Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2011-01-04

    ... AGENCY 40 CFR Parts 239 and 258 Alaska: Adequacy of Alaska Municipal Solid Waste Landfill Permit Program... modification to Alaska's approved Municipal Solid Waste Landfill (MSWLF) permit program. The approved... 40 CFR 258.4. III. Statutory and Executive Order Reviews This action approves State solid waste...

  6. Anderson, Prof. Philip Warren

    Indian Academy of Sciences (India)

    ... 13 December 1923. Address: Department of Physics, Joseph Henry Laboratories, Princeton University, Jadwin Hall, Post Box 708, Princeton, NJ 08544-0708, U.S.A.. Contact: Office: (+1-609) 258 5850. Residence: (+1-609) 454 5075. Fax: (+1-609) 258 1006. Email: pwa@princeton.edu. YouTube; Twitter; Facebook; Blog ...

  7. Polymorphisms in the pituitary growth hormone gene and its ...

    Indian Academy of Sciences (India)

    ... 258/A, Bommasandra Industrial Area, Bangalore 560 099, India; Tata Proteomics and Coagulation Unit, Thrombosis Research Institute India, 258/A, Bommasandra Industrial Area, Bangalore 560 099, India; Thrombosis Research Institute-London, Emmanuel Kaye Building, Manresa Road, Chelsea SW3 6LR, London, UK ...

  8. A common variant in chromosome 9p21 associated with coronary ...

    Indian Academy of Sciences (India)

    ... Bangalore 560 099, India; Tata Proteomics and Coagulation Unit, Narayana Hrudayalaya Hospital, 258/A Bommasandra Industrial Area, Anekal Taluk, Bangalore 560 099, India; Thrombosis Research Institute, Narayana Hrudayalaya Hospital, 258/A Bommasandra Industrial Area, Anekal Taluk, Bangalore 560 099, India ...

  9. Air sea interaction during summer monsoon period of 1979

    Digital Repository Service at National Institute of Oceanography (India)

    RameshKumar, M.R.

    stream_size 6 stream_content_type text/plain stream_name Satellite_Remote_Sensing_Ocean_Environ_1993_258.pdf.txt stream_source_info Satellite_Remote_Sensing_Ocean_Environ_1993_258.pdf.txt Content-Encoding ISO-8859-1 Content...

  10. Capabilities, Learning and the Nature of the Firm

    DEFF Research Database (Denmark)

    Knudsen, Thorbjørn; Hodgson, Geoffrey M.

    2007-01-01

      Knudsen, Thorbjørn (2007) with Geoffrey M. Hodgson, "Capabilities, Learning and the Nature of the Firm", Revue Economique, 2(58), pp. 331-350.......  Knudsen, Thorbjørn (2007) with Geoffrey M. Hodgson, "Capabilities, Learning and the Nature of the Firm", Revue Economique, 2(58), pp. 331-350....

  11. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  12. Description of the Puparium of Protocalliphora nourtevai (Insecta: Diptera: Calliphoridae)

    Czech Academy of Sciences Publication Activity Database

    Jamriška, J.; Modrý, David

    2013-01-01

    Roč. 99, č. 5 (2013), s. 896-898 ISSN 0022-3395 Institutional support: RVO:60077344 Keywords : breeding success * Avian blowflies * blood Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013

  13. Genetics Home Reference: episodic ataxia

    Science.gov (United States)

    ... 5 links) Consortium for Clinical Investigations of Neurological Channelopathies (CINCH) GeneReview: Episodic Ataxia Type 1 GeneReview: Episodic ... MG. Episodic ataxia type 1: a neuronal potassium channelopathy. Neurotherapeutics. 2007 Apr;4(2):258-66. Review. ...

  14. Young Children's Mathematics References during Free Play in Family Childcare Settings

    Science.gov (United States)

    Hendershot, Shawnee M.; Berghout Austin, Ann M.; Blevins-Knabe, Belinda; Ota, Carrie

    2016-01-01

    Very little is known about children's discussion of mathematics topics during unstructured play. Ginsburg, Lin, Ness, and Seo [2003. Young American and Chinese children's everyday mathematical activity. Mathematical Thinking and Learning, 5(4), 235-258. Retrieved from…

  15. Keramický depot mohylové kultury střední doby bronzové z Prahy 9 – Běchovic

    Czech Academy of Sciences Publication Activity Database

    Vencl, Slavomil; Zadák, J.

    2010-01-01

    Roč. 62, č. 2 (2010), s. 211-258 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Bohemia * Middle Bronze Age * pottery deposits * settlement structure Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. Spinal Injury: First Aid

    Science.gov (United States)

    ... EmergencyManual/WhatToDoInMedicalEmergency/Default.aspx?id=258&terms=spinal+injuries. Accessed Jan. 8, 2015. Marx JA, et al. Rosen's Emergency Medicine: Concepts and Clinical Practice. 8th ed. Philadelphia, Pa.: Mosby ...

  17. Light acclimation and pH perturbations affect photosynthetic performance in Chlorella mass culture

    Czech Academy of Sciences Publication Activity Database

    Ihnken, S.; Beardall, J.; Kromkamp, J.C.; Serrano, C.G.; Torres, M.A.; Masojídek, Jiří; Malapartida, I.; Abdala, R.; Jerez, C.G.; Malapascua, José R.F.; Navarro, E.; Rico, R.M.; Peralta, E.; Ferreira Ezequil, J.P.; Figueroa, F.L.

    2014-01-01

    Roč. 22, č. 2 (2014), s. 95-110 ISSN 1864-7790 Institutional support: RVO:61388971 Keywords : Chlorella * Mass culture * pH * Chlorophyll fluorescence Subject RIV: EE - Microbiology, Virology Impact factor: 1.258, year: 2014

  18. Cyanobacterial water-bloom of Limnoraphis robusta in the Lago Mayor of the Lake Titicaca. Can it develop?

    Czech Academy of Sciences Publication Activity Database

    Komárková, Jaroslava; Montoya, H.; Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 249-258 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * water bloom * Titicaca Lake Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  19. Cyanobacteria in ambient springs

    Czech Academy of Sciences Publication Activity Database

    Cantonati, M.; Komárek, Jiří; Montejano, G.

    2015-01-01

    Roč. 24, č. 4 (2015), s. 865-888 ISSN 0960-3115 Institutional support: RVO:67985939 Keywords : Springs * Cyanoprokaryotes * Radiation * Nitrogen Subject RIV: EF - Botanics Impact factor: 2.258, year: 2015

  20. Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Sarasota County

    Data.gov (United States)

    NSGIC Education | GIS Inventory — The RGB/CIR half-foot orthophotos to be mapped consists of 2,258 cells (approximately 2,025 square miles) flown with a Z/I Intergraph DMC airborne digital sensor....

  1. Fire in South African ecosystems: an annotated bibliography.

    CSIR Research Space (South Africa)

    Schrige, GU

    1978-10-01

    Full Text Available References to 258 publications are presented together with summaries, keyword listings and a keyword index. This bibliography forms part of the South African contribution to the SCOPE project "The ecological effects of fire", 1977-1980....

  2. 78 FR 79413 - Notice of Availability of Record of Decision for Hawaii-Southern California Training and Testing

    Science.gov (United States)

    2013-12-30

    ... includes the establishment of new range capabilities, as well as modifications of existing abilities.../EV21.CS, Attn: HSTT EIS/OEIS Project Manager, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI 96860...

  3. Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Manatee County

    Data.gov (United States)

    NSGIC Education | GIS Inventory — The RGB/CIR half-foot orthophotos to be mapped consists of 2,258 cells (approximately 2,025 square miles) flown with a Z/I Intergraph DMC airborne digital sensor....

  4. Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Pinellas County

    Data.gov (United States)

    NSGIC Education | GIS Inventory — The RGB/CIR half-foot orthophotos to be mapped consists of 2,258 cells (approximately 2,025 square miles) flown with a Z/I Intergraph DMC airborne digital sensor....

  5. ORF Alignment: NC_002971 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TIG_COXBU ... Trigger factor (TF) ... Length = 124 ... Query: 135 EITEEDLDKMLEALRKQYAEWKEMDRPAKAD...DRVIIDFEGTLDGKPFERGSAKDFQLELG 194 ... EITEEDLDKMLEALRKQYAEWKEMDRPAKADDRVII...DFEGTLDGKPFERGSAKDFQLELG Sbjct: 1 ... EITEEDLDKMLEALRKQYAEWKEMDRPAKADDRVIIDFEGTLDGKPFERGSAKDFQLELG 60 ... Query: 255 QFAE 258 ... QFAE Sbjct: 121 QFAE 124

  6. Toxicity of zinc oxide nanoparticles to the annelid Enchytraeus crypticus in agar-based exposure media

    Czech Academy of Sciences Publication Activity Database

    Hrdá, K.; Opršál, J.; Knotek, P.; Pouzar, M.; Vlček, Milan

    2016-01-01

    Roč. 70, č. 11 (2016), s. 1512-1520 ISSN 0366-6352 Institutional support: RVO:61389013 Keywords : terrestrial ecotocicity test * zinc ocide nanoparticles * potworm Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.258, year: 2016

  7. Nové poznatky a otázky nad hrádkem Rohy u Skřinářova, okr. Zďár n. S.

    Czech Academy of Sciences Publication Activity Database

    Unger, J.; Velek, J.; Kirchner, Karel; Zduba, J.

    2017-01-01

    Roč. 69, č. 3 (2017), s. 252-258 ISSN 0323-2581 Institutional support: RVO:68145535 Keywords : Moravia * middle ages * castle * colonization * mining Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  8. Telescience Data Collection Radar

    National Research Council Canada - National Science Library

    Beckner, Frederick

    2000-01-01

    Report developed under SBIR contract for topic AF99-258. The feasibility of developing a telescience data collection radar to reduce the cost of gathering aircraft signature data for noncooperative identification programs is investigated...

  9. Nápěvy písní k tanci "do kolečka"– textová výstavba a deklamace

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk

    2006-01-01

    Roč. 93, č. 3 (2006), s. 243-258 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : round and round * structural analysis * declamation Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Thermal Manifestations and Nanoindentation of Bone Cements for Orthopaedic Surgery

    Czech Academy of Sciences Publication Activity Database

    Hloch, Sergej; Monka, P.; Hvizdoš, P.; Jakubéczyová, D.; Kozak, D.; Čolič, K.; Kloc, J.; Magurová, D.

    2013-01-01

    Roč. 17, č. 1 (2013), s. 251-258 ISSN 0354-9836 Institutional support: RVO:68145535 Keywords : bone cement * exothermic behaviour * nanoindentation * porosity * osteonecrosis Subject RIV: FJ - Surgery incl. Transplants Impact factor: 0.962, year: 2013

  11. Sensitive voltammetric method for the fast analysis of the antioxidant pyrogallol using a boron-doped diamond electrode in biofuels

    Czech Academy of Sciences Publication Activity Database

    Chýlková, J.; Tomášková, M.; Janíková, L.; Šelešovská, R.; Navrátil, Tomáš; Chudobová, I.

    2017-01-01

    Roč. 71, č. 6 (2017), s. 1047-1054 ISSN 0366-6352 Institutional support: RVO:61388955 Keywords : antioxidant * voltammetry * pyrogallol Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.258, year: 2016

  12. Original Research

    African Journals Online (AJOL)

    home

    2014-12-21

    Samapundo et al., 2007; Amiri ... contamination of foods and feeds by mycotoxins should be minimized by designing a series of ..... Innovative Food Science and Emerging Technologies. 8: 253-258. Velluti, A., Marin, S., Gonzalez, ...

  13. Determining the quality of competences assessment programs: A self-evaluation procedure

    NARCIS (Netherlands)

    Baartman, Liesbeth; Prins, Frans; Kirschner, Paul A.; Van der Vleuten, Cees

    2009-01-01

    Baartman, L. K. J., Prins, F. J., Kirschner, P. A., & Van der Vleuten, C. P. M. (2007). Determining the quality of Competence Assessment Programs: A self-evaluation procedure. Studies in Educational Evaluation, 33, 258-281.

  14. Anvisning om Bygningsreglement 2015

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan de Place; Ginnerup, Søren; Stang, Birgitte Friis Dela

    Anvisningen forklarer og fortolker bestemmelserne i Bygningsreglement 2015 (BR15). SBi-anvisning 258 har samme kapitelstruktur som BR15, og anvisningsteksten ledsages af den fulde reglements- og vejledningstekst. Desuden henviser anvisningen til relevante standarder, andre anvisninger og andet...

  15. Wheat Induced Resistance to Powdery Mildew (Blumeria graminis f. sp. tritici) by Means of Biological Preparations

    Czech Academy of Sciences Publication Activity Database

    Věchet, L.; Vrchotová, Naděžda; Hanazalová, J.

    2012-01-01

    Roč. 15, SI (2012), s. 61-62 ISSN 1335-258X Institutional support: RVO:67179843 Keywords : wheat * powdery mildew * inducers of plant origin * inducers of chemical origin Subject RIV: EH - Ecology, Behaviour

  16. Hydrodynamic characteristics of mechanical heart valve prostheses in steady and pulsatile flow

    Czech Academy of Sciences Publication Activity Database

    Klimeš, František; Kořenář, Josef

    2002-01-01

    Roč. 9, č. 4 (2002), s. 249-258 ISSN 1210-2717 Institutional research plan: CEZ:AV0Z2060917 Keywords : mechanical heart valve prostheses * flow visualization- steady and pulsatile flow Subject RIV: BO - Biophysics

  17. 76 FR 21408 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2011-04-15

    .... Solutions, Inc., A Xerox Company. 75,210 PricewaterhouseCoopers Tampa, FL February 8, 2010. LLP, Human Resources Shared Services Center, Talent Acquisition Associates, etc. 75,258 Kaz, Inc Hudson, NY September...

  18. 36 CFR 6.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... animals, or the producing or harvesting of crops or trees. Boundaries means the limits of lands or waters...-closure care means all of the requirements prescribed by 40 CFR part 258, Criteria For Municipal Solid...

  19. Illegal Drugs and Heart Disease

    Science.gov (United States)

    ... crystal that can be smoked. Even so-called recreational cocaine users may have higher blood pressure, stiffer ... about 36.4 percent (455,668 visits) for marijuana and about 20.6 percent (258,482 visits) ...

  20. Supplementary data: Eucalyptus microsatellites mined in silico ...

    Indian Academy of Sciences (India)

    CT990393 TC 6 AGAACCAATCCAACAGGAACAT 59.735 TATTACGCCTCGTTTCTTCCAT 59.99 239. CT990393 GA | 8 GAATCTCTCTCTCTCTGGTCCG 59.581 TTTATTACGCCTCGTTTCTTCC 59.644 194. CT990367 GCC 5 TCAAGCACACTGGAACAGAAGT 59.953 GCTAGACTCATACGCCAAAACC 60.156 258.

  1. All projects related to Palestine | Page 3 | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: PEACE RESEARCH, CONFLICT RESOLUTION. Region: Israel, Middle East, Palestine, Central Asia, Far East Asia, South Asia. Program: Governance and Justice. Total Funding: CA$ 258,200.00. Youth Smoking in Stressed Environments : Determinants and Resiliency (Argentina, Colombia, Palestine). Project.

  2. Length-weight relationship and condition factor of selected finfish ...

    African Journals Online (AJOL)

    These were: Alestopetersius smykalai ( LogW = 0.0143 + 2.58LogL), Awaous lateristriga (LogW = 0.0143 + 2.58LogL), Auchenoglanis occidentalis (LogW = 0.0375 + 2.88LogL), Chrysichthys nigrodigitatus (Log W = 0.0536 + 2.97Log L), Awaous lateristriga (LogW = 0.0732 + 3.01Log L), Bostrychus africanus (LogW = 0.763 ...

  3. Population Structure of KPC-Producing Klebsiella pneumoniae Isolates from Midwestern U.S. Hospitals

    OpenAIRE

    Wright, Meredith S.; Perez, Federico; Brinkac, Lauren; Jacobs, Michael R.; Kaye, Keith; Cober, Eric; van Duin, David; Marshall, Steven H.; Hujer, Andrea M.; Rudin, Susan D.; Hujer, Kristine M.; Bonomo, Robert A.; Adams, Mark D.

    2014-01-01

    Genome sequencing of carbapenem-resistant Klebsiella pneumoniae isolates from regional U.S. hospitals was used to characterize strain diversity and the blaKPC genetic context. A phylogeny based on core single-nucleotide variants (SNVs) supports a division of sequence type 258 (ST258) into two distinct groups. The primary differences between the groups are in the capsular polysaccharide locus (cps) and their plasmid contents. A strict association between clade and KPC variant was found. The bl...

  4. Custodians of the Coast: History of the United States Army Engineers at Galveston

    Science.gov (United States)

    1977-01-01

    the New England Coast. In August, 1776, Putnam was appointed chief engineer; however, because Congress refused to authorize an engineer corps, he...years earlier. Other experiences bordered on the hilarious . One old-timer recalls a particularly turbulent occasion when the barge stationed...238 Public Law 99, 84th Congress, 258-59 Public Law 875, 81st Congress , 258-59 Putnam , Rufus, 5 Quarantines , yellow fever, 39 Quarterboat, 107

  5. Contribution of Specific Amino Acid Changes in Penicillin Binding Protein 1 to Amoxicillin Resistance in Clinical Helicobacter pylori isolates ▿

    Science.gov (United States)

    Qureshi, Nadia N.; Morikis, Dimitrios; Schiller, Neal L.

    2011-01-01

    Amoxicillin is commonly used to treat Helicobacter pylori, a major cause of peptic ulcers, stomach cancer, and B-cell mucosa-associated lymphoid tissue lymphoma. Amoxicillin resistance in H. pylori is increasing steadily, especially in developing countries, leading to treatment failures. In this study, we characterize the mechanism of amoxicillin resistance in the U.S. clinical isolate B258. Transformation of amoxicillin-susceptible strain 26695 with the penicillin binding protein 1 gene (pbp1) from B258 increased the amoxicillin resistance of 26695 to equal that of B258, while studies using biotinylated amoxicillin showed a decrease in the binding of amoxicillin to the PBP1 of B258. Transformation with 4 pbp1 fragments, each encompassing several amino acid substitutions, combined with site-directed mutagenesis studies, identified 3 amino acid substitutions in PBP1 of B258 which affected amoxicillin susceptibility (Val 469 Met, Phe 473 Leu, and Ser 543 Arg). Homology modeling showed the spatial orientation of these specific amino acid changes in PBP1 from 26695 and B258. The results of these studies demonstrate that amoxicillin resistance in the clinical U.S. isolate B258 is due solely to an altered PBP1 protein with a lower binding affinity for amoxicillin. Homology modeling analyses using previously identified amino acid substitutions of amoxicillin-resistant PBP1s demonstrate the importance of specific amino acid substitutions in PBP1 that affect the binding of amoxicillin in the putative binding cleft, defining those substitutions deemed most important in amoxicillin resistance. PMID:20956585

  6. Contribution of specific amino acid changes in penicillin binding protein 1 to amoxicillin resistance in clinical Helicobacter pylori isolates.

    Science.gov (United States)

    Qureshi, Nadia N; Morikis, Dimitrios; Schiller, Neal L

    2011-01-01

    Amoxicillin is commonly used to treat Helicobacter pylori, a major cause of peptic ulcers, stomach cancer, and B-cell mucosa-associated lymphoid tissue lymphoma. Amoxicillin resistance in H. pylori is increasing steadily, especially in developing countries, leading to treatment failures. In this study, we characterize the mechanism of amoxicillin resistance in the U.S. clinical isolate B258. Transformation of amoxicillin-susceptible strain 26695 with the penicillin binding protein 1 gene (pbp1) from B258 increased the amoxicillin resistance of 26695 to equal that of B258, while studies using biotinylated amoxicillin showed a decrease in the binding of amoxicillin to the PBP1 of B258. Transformation with 4 pbp1 fragments, each encompassing several amino acid substitutions, combined with site-directed mutagenesis studies, identified 3 amino acid substitutions in PBP1 of B258 which affected amoxicillin susceptibility (Val 469 Met, Phe 473 Leu, and Ser 543 Arg). Homology modeling showed the spatial orientation of these specific amino acid changes in PBP1 from 26695 and B258. The results of these studies demonstrate that amoxicillin resistance in the clinical U.S. isolate B258 is due solely to an altered PBP1 protein with a lower binding affinity for amoxicillin. Homology modeling analyses using previously identified amino acid substitutions of amoxicillin-resistant PBP1s demonstrate the importance of specific amino acid substitutions in PBP1 that affect the binding of amoxicillin in the putative binding cleft, defining those substitutions deemed most important in amoxicillin resistance.

  7. Carbapenemase-Producing Klebsiella pneumoniae, a Key Pathogen Set for Global Nosocomial Dominance

    Science.gov (United States)

    Nordmann, Patrice; Poirel, Laurent

    2015-01-01

    The management of infections due to Klebsiella pneumoniae has been complicated by the emergence of antimicrobial resistance, especially to carbapenems. Resistance to carbapenems in K. pneumoniae involves multiple mechanisms, including the production of carbapenemases (e.g., KPC, NDM, VIM, OXA-48-like), as well as alterations in outer membrane permeability mediated by the loss of porins and the upregulation of efflux systems. The latter two mechanisms are often combined with high levels of other types of β-lactamases (e.g., AmpC). K. pneumoniae sequence type 258 (ST258) emerged during the early to mid-2000s as an important human pathogen and has spread extensively throughout the world. ST258 comprises two distinct lineages, namely, clades I and II, and it seems that ST258 is a hybrid clone that was created by a large recombination event between ST11 and ST442. Incompatibility group F plasmids with blaKPC have contributed significantly to the success of ST258. The optimal treatment of infections due to carbapenemase-producing K. pneumoniae remains unknown. Some newer agents show promise for treating infections due to KPC producers; however, effective options for the treatment of NDM producers remain elusive. PMID:26169401

  8. Identification of esg, a genetic locus involved in cell-cell signaling during Myxococcus xanthus development.

    Science.gov (United States)

    Downard, J; Ramaswamy, S V; Kil, K S

    1993-12-01

    JD258, a Tn5 insertion mutant of Myxococcus xanthus, was shown to have major defects in three development-associated properties: expression of the developmentally regulated tps gene, spore formation, and production of multicellular fruiting bodies. The defects in tps gene expression and sporulation could be substantially corrected, at the phenotypic level, by mixing JD258 with wild-type cells (extracellular complementation). By this criterion, JD258 appeared to be a new member of a group of conditional developmental mutants that were previously characterized and placed in four extracellular complementation groups (A to D) based on the ability of mutants in one group to stimulate development in mutants belonging to a different group (D. C. Hagen, A. P. Bretscher, and D. Kaiser, Dev. Biol. 64:284-296, 1978). Mutants from groups A, B, C, and D all displayed extracellular complementation activity when mixed with JD258. These results, and other aspects of the phenotype of JD258, indicate that this mutant defines a fifth extracellular complementation group, group E. The M. xanthus esg locus identified by the Tn5 insertion in JD258 was cloned in Escherichia coli and used for further genetic analysis of the locus. These studies indicated that the esg locus resides within a 2.5-kb region of the M. xanthus chromosome and that the locus contains at least two genetic complementation groups. Our results are consistent with a model in which the esg locus controls the production of a previously unrecognized extracellular signal that must be transmitted between cells for the completion of M. xanthus development.

  9. New insight into the molecular mechanisms of the biological effects of DNA minor groove binders.

    Directory of Open Access Journals (Sweden)

    Xinbo Zhang

    Full Text Available Bisbenzimides, or Hoechst 33258 (H258, and its derivative Hoechst 33342 (H342 are archetypal molecules for designing minor groove binders, and widely used as tools for staining DNA and analyzing side population cells. They are supravital DNA minor groove binders with AT selectivity. H342 and H258 share similar biological effects based on the similarity of their chemical structures, but also have their unique biological effects. For example, H342, but not H258, is a potent apoptotic inducer and both H342 and H258 can induce transgene overexpression in in vitro studies. However, the molecular mechanisms by which Hoechst dyes induce apoptosis and enhance transgene overexpression are unclear.To determine the molecular mechanisms underlying different biological effects between H342 and H258, microarray technique coupled with bioinformatics analyses and multiple other techniques has been utilized to detect differential global gene expression profiles, Hoechst dye-specific gene expression signatures, and changes in cell morphology and levels of apoptosis-associated proteins in malignant mesothelioma cells. H342-induced apoptosis occurs in a dose-dependent fashion and is associated with morphological changes, caspase-3 activation, cytochrome c mitochondrial translocation, and cleavage of apoptosis-associated proteins. The antagonistic effect of H258 on H342-induced apoptosis indicates a pharmacokinetic basis for the two dyes' different biological effects. Differential global gene expression profiles induced by H258 and H342 are accompanied by unique gene expression signatures determined by DNA microarray and bioinformatics software, indicating a genetic basis for their different biological effects.A unique gene expression signature associated with H342-induced apoptosis provides a new avenue to predict and classify the therapeutic class of minor groove binders in the drug development process. Further analysis of H258-upregulated genes of transcription

  10. Gastrointestinal helminths in migratory Camel

    Directory of Open Access Journals (Sweden)

    S G Rewatkar

    Full Text Available Survey of gastrointestinal helminth parasites in camel migrated from U.P., M.P., and Rajasthan at Nagpur region was carried out in early summer, 2008. Total 28 samples (12 males and 16 females were collected from different places of Nagpur region. They revealed parasites as Trichuris sp.(50%, Strongyloides sp.(32.14%, Trichostrongylus sp.(10.71%, Nematodirus sp.(10.71%, Haemonchus sp.(14.28%, Eurytrema sp.(21.42% ,Eimeria sp.(25%, Entamoeba sp.(17.85% and Balantidium sp.(7.14%.All were found positive for mixed helminthic infection. [Vet World 2009; 2(7.000: 258-258

  11. Conducting polymers as sorbents of influenza viruses

    Czech Academy of Sciences Publication Activity Database

    Ivanova, V. T.; Garina, E. O.; Burtseva, E. I.; Kirillova, E. S.; Ivanova, M. V.; Stejskal, Jaroslav; Sapurina, Irina

    2017-01-01

    Roč. 71, č. 2 (2017), s. 495-503 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA16-02787S; GA MŠk(CZ) LH14199 Institutional support: RVO:61389013 Keywords : influenza viruses * conducting polymers * polyaniline Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016

  12. Sediment boron and its relation to sediment properties in a tropical estuary

    Digital Repository Service at National Institute of Oceanography (India)

    Shirodkar, P.V.; Dalal, V.N.K.

    Boron in the sediments of Mandovi estuary varied from 8.0 to 258.0 ppm with an average of 118 ppm. It showed an inverse relation to the texture of sediments and was found to be concentrated in silt and clay fraction with generally decreasing...

  13. 75 FR 69363 - HUD Multifamily Rental Projects: Regulatory Revisions

    Science.gov (United States)

    2010-11-12

    ...) mortgage- backed securities, or other bond obligations specified by HUD, any of which contains a lock-out... proposed January 21, 2010. Comment: Paragraph (a)(1) of 24 CFR 207.258 should provide for an automatic 90-day extension of the deadline for filing notice of the mortgagee's election upon request. An automatic...

  14. Preparation of leucite powders with controlled particle size distribution

    Czech Academy of Sciences Publication Activity Database

    Novotná, Martina; Kloužková, A.; Maixner, J.; Šatava, Vladimír

    2005-01-01

    Roč. 49, č. 4 (2005), s. 252-258 ISSN 0862-5468 R&D Projects: GA ČR GA104/03/0031 Institutional research plan: CEZ:AV0Z40320502 Keywords : leucite * preparation * particle size distribution Subject RIV: CA - Inorganic Chemistry Impact factor: 0.463, year: 2005

  15. Prospects for wood products trade under the new partnership for ...

    African Journals Online (AJOL)

    regional wood products trade in the countries of Sub-Sahara Africa using Ghana, Nigeria and Cameroon as case study. A total of 517 wood processing firms comprising 121 in Ghana, 258 in Nigeria and 138 in Cameroon were surveyed through the ...

  16. Waterborne Commerce of the United States, Calendar Year 1980. Part 2. Waterways and Harbors, Gulf Coast, Mississippi River System and Antilles.

    Science.gov (United States)

    1982-09-01

    3.168 68 -------------------- 1,400 1,400 --------- 2812 DYES, PIGMENT, TANINS "A T S-------------- 2813 ALCOHOLS...TAR, OhL, GAS P UTS --------------- 8 58,466 26,262 325,394 ---------- 37,429 258,325 88.243 122.793 e@12 1YES, P)N’.FT, TANIN S . ........ 365

  17. School Climate for Academic Success: A Multilevel Analysis of School Climate and Student Outcomes

    Science.gov (United States)

    Kwong, Darren; Davis, Jonathan Ryan

    2015-01-01

    This multilevel study examined the relationship between school climate and academic achievement. Using the Educational Longitudinal Survey (ELS, 2002), and a sample of 16,258 students and 1954 schools nationwide, we found that student-level perception of school climate--especially the student learning environment--was highly predictive of academic…

  18. Magritte Meets Kripkenstein

    Czech Academy of Sciences Publication Activity Database

    Hříbek, Tomáš

    1997-01-01

    Roč. 45, 3-4 (1997), s. 240-258 ISSN 0049-5123 Institutional research plan: CEZ:AV0Z9009908 Keywords : René Magritte * Michel Foucault * Saul Kripke Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. The optimum spanning catenary cable

    Science.gov (United States)

    Wang, C. Y.

    2015-03-01

    A heavy cable spans two points in space. There exists an optimum cable length such that the maximum tension is minimized. If the two end points are at the same level, the optimum length is 1.258 times the distance between the ends. The optimum lengths for end points of different heights are also found.

  20. Silica-based monolithic capillary columns modified by liposomes for characterization of analyte–liposome interactions by capillary liquid chromatography

    Czech Academy of Sciences Publication Activity Database

    Moravcová, Dana; Planeta, Josef; Wiedmer, S. K.

    2013-01-01

    Roč. 1317, SI (2013), s. 159-166 ISSN 0021-9673 R&D Projects: GA MV VG20112015021; GA ČR(CZ) GAP206/11/0138 Institutional support: RVO:68081715 Keywords : monolithic silica capillary column * immobilized liposomes * biomimicking stationary phase Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.258, year: 2013

  1. Magnetoactive feature of in-situ polymerised polyaniline film developed on the surface of manganese–zinc ferrite

    Czech Academy of Sciences Publication Activity Database

    Babayan, V.; Kazantseva, N. E.; Sapurina, I.; Moučka, R.; Vilčáková, J.; Stejskal, Jaroslav

    2012-01-01

    Roč. 258, č. 19 (2012), s. 7707-7716 ISSN 0169-4332 R&D Projects: GA ČR GA202/09/1626 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * core–shell particles * coercivity Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.112, year: 2012

  2. Chemiluminescence of polyamides III. Luminescence accompanying thermooxidation of lactam-based polyamides stabilized by antioxidants

    Czech Academy of Sciences Publication Activity Database

    Lánská, Božena; Matisová-Rychlá, L.; Rychlý, J.

    2001-01-01

    Roč. 72, č. 2 (2001), s. 249-258 ISSN 0141-3910 R&D Projects: GA AV ČR IAA4050702; GA AV ČR KSK2050602 Institutional research plan: CEZ:AV0Z4050913 Keywords : lactam-based polyamides * antioxidants * chemiluminescence Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.905, year: 2001

  3. Ochrana biodiverzity na sklonku novověku

    Czech Academy of Sciences Publication Activity Database

    Cílek, Václav

    2009-01-01

    Roč. 64, 7 /zvláštní číslo/ (2009), [1]-[11] ISSN 1210-258X Institutional research plan: CEZ:AV0Z30130516 Keywords : biodiversity * biodiversity conservation * geodiversity * global change * climate * society and nature Subject RIV: DO - Wilderness Conservation http://www.casopis.ochranaprirody.cz/rubrika/zvlastni-cislo.html

  4. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Support at Nemours/Alfred I. duPont Hospital for Children - Duration: 3:34. Nemours 1,004 views 3: ... 258,398 views 11:08 Palliative Care at Children's of Alabama - Duration: 4:12. ChildrensofAlabama 1,307 ...

  5. Population Size and Diet of Bush Hyrax Hetrohyrax brucei (Gray ...

    African Journals Online (AJOL)

    user

    Crnokrak, P & Roff, D.A. 1999. Inbreeding depression in the wild. Heredity, 83: 260–270. Estes, R.P. 1991. The behavior guide to African mammals, including hoofed mammals, carnivores, primates. University of California Press, Berkeley, pp. 250-258. Frankham, R. 2003. Genetics and conservation biology. C.R. Biologies ...

  6. Alterations in plasma antioxidants during reperfusion of the ischemic small intestine in rats

    Czech Academy of Sciences Publication Activity Database

    Papežíková, Ivana; Lojek, Antonín; Čížová, Hana; Číž, Milan

    2006-01-01

    Roč. 81, č. 1 (2006), s. 140-147 ISSN 0034-5288 R&D Projects: GA ČR(CZ) GA524/01/1219 Institutional research plan: CEZ:AV0Z50040507 Keywords : TRAP * lipid peroxidation * uric acid Subject RIV: BO - Biophysics Impact factor: 1.258, year: 2006

  7. Reverse altitudinal cline in cold hardiness among Erebia butterflies

    Czech Academy of Sciences Publication Activity Database

    Vrba, Pavel; Konvička, Martin; Nedvěd, Oldřich

    2012-01-01

    Roč. 33, č. 4 (2012), s. 251-258 ISSN 0143-2044 Grant - others:GA ČR(CZ) GAP505/10/1630; University of South Bohemia(CZ) 144/2010/100 Institutional support: RVO:60077344 Keywords : Alpine habitats * butterfly ecology * climate change Subject RIV: EH - Ecology, Behaviour Impact factor: 0.837, year: 2012

  8. Effectiveness of Using Floating Drum Bio-Digester to Treat Domestic ...

    African Journals Online (AJOL)

    An anaerobic floating drum digester was used in treating domestic sewage. The volumetric capacity of the digester plant was estimated as 258.99 litres with a 250 litre-gas holder tank. The gas holder tank was fitted into the digester tank with a clearance of about 2cm to allow the former rise freely when biogas is generated ...

  9. Effect of fibre and digestible energy levels on growth performance ...

    African Journals Online (AJOL)

    A seventy-day feeding trial was conducted to investigate the effect of dietary fibre and digestible energy (DE) level on growth performance, apparent nutrient digestibility and caecal fermentation of growing rabbits. The experiment was laid out in a 3 × 3 factorial arrangement of 3 levels of fibre (low (249 – 258 g/kg NDF, 149 ...

  10. Imbalanced evolving self organizing learning

    Science.gov (United States)

    2014-01-10

    Selection Ranked Fitness Mutation Reinsertion Initialization Optimal Solution Convergence YN Fig. 2. The evolving learning procedure. Q. Cai et al...Neurocomputing 133 (2014) 258–270260 6 offsprings will be reinserted into the original population set. The recombined individuals are used to calculate

  11. Resensie: Chaos, of Op soek na Superman | Barendse | Tydskrif vir ...

    African Journals Online (AJOL)

    Resensie: Chaos, of Op soek na Superman. JM Barendse. Abstract. Hans Pienaar. Melville: Altoviolet, 2012. 258 pp. ISBN 978-0-620-54118-3. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/tvl.v50i2.28 · AJOL African Journals ...

  12. 78 FR 20035 - Adequacy of Oregon Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2013-04-03

    ... AGENCY 40 CFR Parts 239 and 258 Adequacy of Oregon Municipal Solid Waste Landfill Permit Program AGENCY... to the State of Oregon's approved Municipal Solid Waste Landfill (MSWLF) permit program. The approved... regulations allowing RD&D Permits to be issued to certain municipal solid waste landfills by approved states...

  13. 77 FR 65875 - Adequacy of Arizona Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2012-10-31

    ... AGENCY Adequacy of Arizona Municipal Solid Waste Landfill Permit Program AGENCY: Environmental Protection... determination to approve a modification to Arizona's municipal solid waste landfill (MSWLF) permit program to... amending the municipal solid waste landfill criteria at 40 CFR 258.4 to allow for Research, Development...

  14. Investigating Time and Spectral Dependence in Neutron Radiation Environments for Semiconductor Damage Studies

    Science.gov (United States)

    2014-09-18

    Benton, R. Sauer , and L. Kimerling, “Interstitial defect reactions in silicon,” Appl. Phys. Lett., vol. 51, pp. 256–258, 1987. 13. J. Srour, C. Marshall...vol. 55, no. 6, pp. 3055–3059, December 2008. 13. “MCNPX user’s manual , version 2.7.0,” Los Alamos National Laboratory, Albu- querque, NM, Tech

  15. Egyptian Journal of Medical Human Genetics - Vol 17, No 3 (2016)

    African Journals Online (AJOL)

    Autosomal recessive ichthyosis with limb reduction defect: A simple association and not CHILD syndrome · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Rabah M Shawky, Solaf M Elsayed, Heba Amgad, 255–258. http://dx.doi.org/10.1016/j.ejmhg.2015.08.009 ...

  16. Evaluating the Effectiveness of a Large-Scale Professional Development Programme

    Science.gov (United States)

    Main, Katherine; Pendergast, Donna

    2017-01-01

    An evaluation of the effectiveness of a large-scale professional development (PD) programme delivered to 258 schools in Queensland, Australia is presented. Formal evaluations were conducted at two stages during the programme using a tool developed from Desimone's five core features of effective PD. Descriptive statistics of 38 questions and…

  17. 2015-2016 Travel and Hospitality Expense Reports for Joanne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Date(s):. 2016-01-21. Destination(s):. Montreal. Airfare: $0.00. Other. Transportation: $258.65. Accommodation: $0.00. Meals and. Incidentals: $24.48. Other: $0.00. Total: $283.13. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.

  18. Estimating the Manpower, Personnel, and Training Requirements of the Army’s Corps Support Weapon System Using the HARDMAN Methodology. Appendices

    Science.gov (United States)

    1982-09-01

    22u2 Floor Pldttes 23 Environmaental Control Systeid~ 23Ui Hybrid Collective Protection System ( HCPE ) 23u2 Personnel Protective Equipm~ent 2303 Personnel...Hybrid Collective Protection Equipment ( HCPE ) 2302 Personnel Protective Equipment A-53 I 2303 Personnel Uecontamination Equipiment (;41l, 14113, M258

  19. 1524-IJBCS-Article-Yindubé Kan Lati

    African Journals Online (AJOL)

    Pr GATSING

    ABSTRACT. This study aimed to assess heavy metals accumulation and oxidative stress biomarkers in the fish. Sarotherodon ... heavy metals (lead, cadmium, copper and nickel) in the waters of Bè Lagoon showed levels of about 2.58 ±. 0.11 µg/l, 1.03 ± 0.15 ... proteins, and DNA (De Flora et al., 1994;. Almroth et al., 2005; ...

  20. Factors Associated with Teenagers' Willingness to Volunteer with Elderly Persons: Application of the Theory of Planned Behavior (TPB)

    Science.gov (United States)

    Reuveni, Yehudit; Werner, Perla

    2015-01-01

    The purpose of this study was to investigate the factors associated with teenagers' willingness to volunteer with elderly persons using an expanded model of the Theory of Planned Behavior (TPB). Participants consisted of 258 ninth-grade students at a large high school in the northern part of Israel. Participants completed a structured…

  1. 75 FR 82146 - Prompt Payment Interest Rate; Contract Disputes Act

    Science.gov (United States)

    2010-12-29

    ... Doc No: 2010-32856] DEPARTMENT OF THE TREASURY Fiscal Service Prompt Payment Interest Rate; Contract... period beginning January 1, 2011, and ending on June 30, 2011, the prompt payment interest rate is 2\\5/8... calculation of interest due on claims at the rate established by the Secretary of the Treasury. The Secretary...

  2. Study of Elemental Mass Distributions at Skukuza, South Afrika, during the SAFARI 2000 Dry Season Campaign

    Czech Academy of Sciences Publication Activity Database

    Maenhaut, W.; Schwarz, Jaroslav; Cafmeyer, J.; Annegarn, H. J.

    2002-01-01

    Roč. 189, - (2002), s. 254-258 ISSN 0168-583X Institutional research plan: CEZ:AV0Z4072921 Keywords : PIXE * multielement analysis * atmospheric aerosols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.158, year: 2002

  3. 47 CFR 73.558 - Indicating instruments.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Indicating instruments. 73.558 Section 73.558... Noncommercial Educational FM Broadcast Stations § 73.558 Indicating instruments. The requirements for indicating instruments described in § 73.258 are applicable to all educational FM broadcast stations licensed with a...

  4. Pancreatic Safety of Incretin-Based Drugs - FDA and EMA Assessment

    NARCIS (Netherlands)

    Egan, Amy G.; Blind, Eberhard; Dunder, Kristina; de Graeff, Pieter A.; Hummer, B. Timothy; Bourcier, Todd; Rosebraugh, Curtis

    2014-01-01

    After evaluating a safety signal regarding pancreatitis and pancreatic cancer in patients using incretin-based drugs, the Food and Drug Administration and the European Medicines Agency conclude that assertions of a causal association are inconsistent with the data. With approximately 25.8 million

  5. Parents‘ and peers‘ influence on norms and norm-breaking behavior of Slovak adolescent boys and girls

    Czech Academy of Sciences Publication Activity Database

    Ruiselová, Z.; Urbánek, Tomáš

    2008-01-01

    Roč. 50, č. 2 (2008), s. 191-200 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : adolescents * norm-breaking behavior * structural equations model Subject RIV: AN - Psychology Impact factor: 0.258, year: 2008

  6. Rôle des forêts plantées dans l’économie forestière mondiale

    Science.gov (United States)

    Joseph Buongiorno; Shushuai Zhu

    2013-01-01

    Les forets plantees, constituees par pl antati on ou ensemencemen t, jouen t un role de plus en plus important dans l'economie foresti ere mondia le, dans I a conservation des ressources, et dans Ia lu tte contre le changement cli matique. Au nivea u mondial , elles occupent 258 million d'ha, soit 6% de Ia co u verture forestiere...

  7. South African Journal for Research in Sport, Physical Education and ...

    African Journals Online (AJOL)

    Acute effect of a physical exercise session on cognitive functioning: Moderately active sportspersons versus sedentary individuals · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Karel J. Van Deventer, Carynne Cozens, Kyle D. Du Plessis, Reghard P. La Grange, 243 - 258 ...

  8. Exploring chip-capillary electrophoresis-laser-induced fluorescence field-deployable platform flexibility: Separations of fluorescent dyes by chip-based non-aqueous capillary electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Nuchtavorn, N.; Smejkal, Petr; Breadmore, M. C.; Guijt, R. M.; Doble, P.; Bek, F.; Foret, František; Suntornsuk, L.; Macka, M.

    2013-01-01

    Roč. 1286, APR (2013), s. 216-221 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : microfluidic chip CE * capillary electrophoresis * NACE * LIF detection Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.258, year: 2013

  9. Developing a Valid Version of an Inventory to Measure Anger in Mexican Adolescents of Middle School Level: The ML-STAXI-MS

    Science.gov (United States)

    Alcázar-Olán, Raúl J.; Deffenbacher, Jerry L.; Escamilla-Tecalco, Héctor

    2016-01-01

    The goals were to develop a valid version of the Multicultural Latin American Inventory of Anger Expression and Hostility (ML-STAXI) for middle school Mexican youth (ML-STAXI-MS) and to test a new Questionnaire about Anger Expression with Physical Aggression (QAEPA). Five hundred and four adolescents (258 males, 246 females); (M[subscript age] =…

  10. Consistent haul road condition monitoring by means of vehicle response normalisation with Gaussian processes

    CSIR Research Space (South Africa)

    Heyns, T

    2012-12-01

    Full Text Available -1 Engineering Applications of Artificial Intelligence December 2012/ Vol. 25(8) Consistent haul road condition monitoring by means of vehicle response normalisation with Gaussian processes T. Heyns a,b,n , J.P. de Villiers a,b , P.S. Heyns c a...

  11. Polyunsaturated eicosapentaenoic acid displaces proteins from membrane rafts by altering rafts lipid composition

    Czech Academy of Sciences Publication Activity Database

    Stuling, T. M.; Huber, J.; Leitinger, N.; Imre, E. M.; Angelisová, Pavla; Nowotny, P.; Waldhaus, W.

    2001-01-01

    Roč. 276, č. 40 (2001), s. 37335-37340 ISSN 0021-9258 R&D Projects: GA ČR GA310/99/0349 Institutional research plan: CEZ:AV0Z5052915 Keywords : membrane raft * Lck * LAT Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.258, year: 2001

  12. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 247-258. Improvements in medium range weather forecasting system of India · V S Prasad Saji Mohandas Surya Kanti Dutta M Das Gupta G R Iyengar E N Rajagopal Swati Basu · More Details Abstract Fulltext PDF. Medium range weather forecasts are being generated in real time using Global Data Assimilation ...

  13. Distributions of p-values smaller than .05 in Psychology: What is going on?

    NARCIS (Netherlands)

    Hartgerink, Chris H J; Van Aert, Robbie C M; Nuijten, Michèle B.; Wicherts, Jelte M.; Van Assen, Marcel A L M

    2016-01-01

    Previous studies provided mixed findings on pecularities in p-value distributions in psychology. This paper examined 258,050 test results across 30,710 articles from eight high impact journals to investigate the existence of a peculiar prevalence of p-values just below .05 (i.e., a bump) in the

  14. Distributions of p-values smaller than .05 in psychology : What is going on?

    NARCIS (Netherlands)

    Hartgerink, C.H.J.; van Aert, R.C.M.; Nuijten, M.B.; Wicherts, J.M.; van Assen, M.A.L.M.

    2016-01-01

    Previous studies provided mixed findings on pecularities in p-value distributions in psychology. This paper examined 258,050 test results across 30,710 articles from eight high impact journals to investigate the existence of a peculiar prevalence of p-values just below .05 (i.e., a bump) in the

  15. Natural attenuation of arsenic in soils near a highly contaminated historical mine waste dump

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Filippi, Michal; Ettler, V.; Rohovec, Jan; Mihaljevič, M.; Šebek, O.

    2012-01-01

    Roč. 414, January (2012), s. 546-555 ISSN 0048-9697 R&D Projects: GA AV ČR KJB300130702 Institutional research plan: CEZ:AV0Z30130516 Keywords : Arsenic * contaminated soil * historical mine waste dump * long-term attenuation Subject RIV: DD - Geochemistry Impact factor: 3.258, year: 2012

  16. 75 FR 11178 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-03-10

    ... Pledge of assets Records 0.25 10 4 10 Reports 2 10 4 80 Total Burden 1,314 General Description of...)); and reporting and recordkeeping requirements relating to the pledge of assets by such branches (12 CFR... collection without change, with the exception of an adjustment of -258 hours to reflect a slight decrease in...

  17. Self-regulation in the workplace : codes of conduct, social labelling and socially responsible investment

    OpenAIRE

    Urminsky, Michael

    2001-01-01

    Examines the context in which voluntary private initiatives are developing. Reviews 258 codes of conduct, looks at labour issues covered by the codes and considers the relationship between the codes and international labour standards. Investigates social labelling programmes and socially responsible investment initiatives.

  18. Existují prostorově kontextové vlivy na volební chování i v relativně nacionalizovaném stranickém systému? Příklad Česka

    Czech Academy of Sciences Publication Activity Database

    Bernard, Josef; Kostelecký, Tomáš; Šimon, Martin

    2014-01-01

    Roč. 119, č. 3 (2014), s. 240-258 ISSN 1212-0014 R&D Projects: GA ČR(CZ) GAP408/12/1442 Institutional support: RVO:68378025 Keywords : contextual effect * electoral behaviour * neighbourhood effect Subject RIV: AO - Sociology, Demography Impact factor: 0.558, year: 2014

  19. Diplomats at War: A Critical Analysis of American and Confederate Diplomacy, 1861-1862

    Science.gov (United States)

    2014-06-13

    home office the following: “He is, I understand, a rough farmer who began life as a farm labourer and got on by a talent for... satisfaction .258 Furthermore, Dayton’s ability to circumvent the issue until further battlefield success worked in the favor of the United States. As proof

  20. Assessment of the properties of diethyl phosphite as a novel anticorrosion pigment in organic coatings

    Czech Academy of Sciences Publication Activity Database

    Nechvílová, K.; Kalendová, A.; Schmidová, E.; Bober, Patrycja

    2017-01-01

    Roč. 71, č. 2 (2017), s. 423-438 ISSN 0366-6352 Institutional support: RVO:61389013 Keywords : diethyl phosphite * conductive polymers * polyaniline Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016

  1. Immunomodulation by probiotics: efficacy and safety evaluation

    NARCIS (Netherlands)

    Ezendam J; Opperhuizen A; Loveren H van; TOX

    2005-01-01

    Probiotics are non-pathogenic bacteria that are used as functional food components with claimed health-promoting effects. In the European Union probiotics are regulated via the Novel Foods Regulation (258/97/EC). This regulation is only applied to strains that were not used before 1997 and concerns

  2. Story of Fission

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 3. Story of Fission: Unlocking Power of the Nucleus. Amit Roy. General Article Volume 21 Issue 3 March 2016 pp 247-258. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/021/03/0247-0258 ...

  3. Explosive hazards in polyaniline chemistry

    Czech Academy of Sciences Publication Activity Database

    Stejskal, Jaroslav; Bober, Patrycja; Trchová, Miroslava; Prokeš, J.

    2017-01-01

    Roč. 71, č. 2 (2017), s. 387-392 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : polyaniline * oxidation of aniline * safety hazards Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016

  4. Structural Insight into Specificity of Interactions between Nonconventional Three-finger Weak Toxin from Naja kaouthia (WTX) and Muscarinic Acetylcholine Receptors

    Czech Academy of Sciences Publication Activity Database

    Lyukmanova, E. N.; Shenkarev, Z. O.; Shulepko, M. A.; Paramonov, A. S.; Chugunov, A. O.; Janíčková, Helena; Dolejší, Eva; Doležal, Vladimír; Utkin, Y.N.; Tsetlin, V.I.; Arseniev, A. S.; Efremov, R. G.; Dolgikh, D. A.; Kirpichnikov, M. P.

    2015-01-01

    Roč. 290, č. 39 (2015), s. 23616-23630 ISSN 0021-9258 R&D Projects: GA ČR(CZ) GA14-05696S Institutional support: RVO:67985823 Keywords : computer modeling * G protein-coupled receptor (GPCR) * site-directed mutagenesis Subject RIV: ED - Physiology Impact factor: 4.258, year: 2015

  5. liver cirrhosis from autoimmune hepatitis in a nigerian woman

    African Journals Online (AJOL)

    like autoimmune thyroiditis, celiac disease and ulcerative colitis, with about 25% having cirrhosis at ... to immunosuppressive therapy. Keywords: Autoimmune hepatitis, Autoimmune liver disease, Chronic liver disease, Nigeria ... who is also exposed to environmental triggering factors.2,5,8 Subsequently, the autoimmune.

  6. Total Oxidation of Ethanol and Toluene over Ceria-Zirconia Supported Platinum Catalysts.

    Czech Academy of Sciences Publication Activity Database

    Topka, Pavel; Kaluža, Luděk; Gaálová, Jana

    2016-01-01

    Roč. 70, č. 7 (2016), s. 898-906 ISSN 0366-6352 R&D Projects: GA ČR GP13-24186P Institutional support: RVO:67985858 Keywords : oxidation * volatile organic compounds * platinum Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.258, year: 2016

  7. Emergence of pan-resistance in KPC-2 carbapenemase-producing Klebsiella pneumoniae in Crete, Greece : a close call

    NARCIS (Netherlands)

    Bathoorn, E.; Tsioutis, C.; Da Silva-Voorham, Júlia; Scoulica, E. V.; Ioannidou, E.; Zhou, K.; Rossen, J. W.; Gikas, A.; Friedrich, A. W.; Grundmann, H.

    Molecular resistance markers for pan-resistant isolates of KPC-producing Klebsiella pneumoniae were identified and showed core-genome MLST to be a promising tool for tracking outbreaks and transmission pathways.KPC-2-producing Klebsiella pneumoniae (KPC-KP) ST258 has been rapidly expanding and is

  8. An outbreak of colistin-resistant Klebsiella pneumoniae carbapenemase-producing Klebsiella pneumoniae in the Netherlands (July to December 2013), with inter-institutional spread

    NARCIS (Netherlands)

    Weterings, V.; Zhou, K.; Rossen, J. W.; van Stenis, D.; Thewessen, E.; Kluytmans, J.; Veenemans, J.

    We describe an outbreak of Klebsiella pneurnonine carbapenemase (KPC)-producing Klebsiella pneumoniae (KPC-KP) ST258 that occurred in two institutions (a hospital and a nursing home) in the Netherlands between July and December 2013. In total, six patients were found to be positive for KPC-KP. All

  9. An outbreak of colistin-resistant Klebsiella pneumoniae carbapenemase-producing Klebsiella pneumoniae in the Netherlands (July to December 2013), with inter-institutional spread

    NARCIS (Netherlands)

    Weterings, V; Zhou, K; Rossen, J W; van Stenis, D; Thewessen, E; Kluytmans, J; Veenemans, J

    We describe an outbreak of Klebsiella pneumoniae carbapenemase (KPC)-producing Klebsiella pneumoniae (KPC-KP) ST258 that occurred in two institutions (a hospital and a nursing home) in the Netherlands between July and December 2013. In total, six patients were found to be positive for KPC-KP. All

  10. Tick-borne encephalitis virus neutralization by high dose intravenous immunoglobulin

    Czech Academy of Sciences Publication Activity Database

    Elsterová, Jana; Palus, Martin; Širmarová, J.; Kopecký, J.; Niller, H.H.; Růžek, Daniel

    2017-01-01

    Roč. 8, č. 2 (2017), s. 253-258 ISSN 1877-959X R&D Projects: GA MZd(CZ) NV16-34238A Institutional support: RVO:60077344 Keywords : flavivirus * ticks * neutralizing antibodies * ivig * antibody-dependent enhancement * ammunotherapy Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.230, year: 2016

  11. ANALYSIS OF CASE HISTORIES OF PERSONAL INDEX USE.

    Science.gov (United States)

    JAHODA, G.; AND OTHERS

    CASE HISTORIES ARE SUMMARIZED FOR 12 RESEARCHERS IN SCIENCE AND ENGINEERING AT THE FLORIDA STATE UNIVERSITY, I.E., 6 CHEMISTS, 4 BIOLOGISTS, 1 ENGINEER, AND 1 METEOROLOGIST. OVER A 10-MONTH PERIOD, 258 HISTORIES WERE OBTAINED. THE DATA DO NOT PERMIT THE DETERMINATION WITH CERTAINTY THE TYPE OF SUBJECT INDEX MOST SUITABLE FOR A PARTICULAR TYPE OF…

  12. Fostering Healthy Lifestyles in the African American Population

    Science.gov (United States)

    Murimi, Mary; Chrisman, Matthew S.; McAllister, Tiffany; McDonald, Olevia D.

    2015-01-01

    Approximately 8.3% of the U.S. population (25.8 million people) is affected by type 2 diabetes. The burden of diabetes is disproportionately greater in the African American community. Compared with non-Hispanic Caucasian adults, the risk of diagnosed type 2 diabetes was 77% higher among non-Hispanic Blacks, who are 27% more likely to die of…

  13. A New Gonad-Infecting Species of Philometra (Nematoda: Philometridae) from the Atlantic Spanish Mackerel Scomberomorus maculatus (Scombridae) off the Atlantic Coast of Florida and South Carolina

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Bakenhaster, M.; de Buron, I.

    2013-01-01

    Roč. 99, č. 2 (2013), s. 290-296 ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Gulf of Mexico * Philometra * Parasitic nematode * USA Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013

  14. Time evolution of the drop size distribution for liquid-liquid dispersion in an agitated tank

    Czech Academy of Sciences Publication Activity Database

    Šulc, R.; Kysela, Bohuš; Ditl, P.

    2018-01-01

    Roč. 72, č. 3 (2018), s. 543-553 ISSN 0366-6352 R&D Projects: GA ČR GA16-20175S Institutional support: RVO:67985874 Keywords : liquid–liquid dispersion * drop breakup * drop size distribution * time evolution Subject RIV: BK - Fluid Dynamics Impact factor: 1.258, year: 2016

  15. Interfaces study of all-polysaccharide composite films

    Czech Academy of Sciences Publication Activity Database

    Šimkovic, I.; Kelnar, Ivan; Mendichi, R.; Tracz, A.; Filip, J.; Bertók, T.; Kasák, P.

    2018-01-01

    Roč. 72, č. 3 (2018), s. 711-718 ISSN 0366-6352 Institutional support: RVO:61389013 Keywords : all-polysaccharide composites * elemental analysis * film properties study Subject RIV: JI - Composite Materials OBOR OECD: Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics Impact factor: 1.258, year: 2016

  16. Ethylene Synthesis and Auxin Augmentation in Pistil Tissues are Important for Egg Cell Differentiation after Pollination in Maize

    Czech Academy of Sciences Publication Activity Database

    Mól, R.; Filek, M.; Macháčková, Ivana; Rochon, E.

    2004-01-01

    Roč. 45, č. 10 (2004), s. 1396-1405 ISSN 0032-0781 R&D Projects: GA AV ČR KSK5052113 Keywords : egg cell maturation * growth regulators * Maize Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.258, year: 2004

  17. TRADITION, MODERNISM, AND APARTHEID1

    African Journals Online (AJOL)

    momentary) presence, being would not be possible. First, the One .... 2016:258). 7 Berger (2003) showed quite convincingly that Heidegger's thought oscillates between the extremes of radical activity (the early Heidegger) and a passive waiting upon the gods to save us in a time of Seinsvergessenheit (the later Heidegger).

  18. EFSA NDA Panel (EFSA Panel on Dietetic Products, Nutrition and Allergies), 2013 . Scientific Opinion on Rooster Combs Extract

    DEFF Research Database (Denmark)

    Tetens, Inge; Poulsen, Morten

    Following a request from the European Commission, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to carry out the additional assessment for „Rooster Combs Extract‟ (RCE) as a food ingredient in the context of Regulation (EC) No 258/97, taking into account the comments...

  19. The effect of CoQ10 and vitamin E on serum total sialic acid, lipid ...

    African Journals Online (AJOL)

    Administrator

    2011-06-13

    Jun 13, 2011 ... Seyrek K, Seyrek-Intas K, Keskin A, Kargın-Kiral F, Musal B, Toplu N. (2005). Biochemical and histochemical studies on the occurrence of sialic acids in mammary tumours of bitches. Res. Med. Vet-Toulouse,. 156: 258-263. Simpson C, Herr H, Courville KA (2004). Concurrent therapies that protect against ...

  20. Sources of Stress for Teachers Working in Private Elementary Schools and Methods of Coping with Stress

    Science.gov (United States)

    Aydin, Bahri; Kaya, Ayça

    2016-01-01

    The aim of this study is to determine the sources of stress for classroom teacher and branch teachers working in private elementary schools and methods that are used by them in order to cope with the stress. In this research, qualitative and quantitative methods have been used jointly. The group consisted of 258 private elementary school teachers…

  1. 75 FR 71467 - Exelon Nuclear Texas Holdings, LLC, Early Site Permit Application for the Victoria County Station...

    Science.gov (United States)

    2010-11-23

    ... documents. If you do not have access to ADAMS or if there are problems in accessing the documents located in... the membership of the Board will be published in the Federal Register at a later date. The NRC staff.... (c) A completed Form FD-258 (fingerprint card), signed in original ink, and submitted in accordance...

  2. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... 2003 pp 61-77. Indian Ocean surface winds from NCMRWF analysis as compared to QuikSCAT and moored buoy winds ... Skills of different mesoscale models over Indian region during monsoon season: Forecast errors · Someshwar Das ... pp 247-258. Improvements in medium range weather forecasting system of India.

  3. Fulltext PDF

    Indian Academy of Sciences (India)

    Petrol abundances in basalts and metabasalts from the. Troodos Massif, Cyprus; Contrib. Mineral. Petrol. 57 245-258. Subbarao K V, Reddy V V, Reddy G R and Sukheswala R N. 1979 Rare earth element geochemistry of basalt-spilite association of Bombay and Carlsberg Ridge—a preliminary study; J. Geol. Soc. India 20 ...

  4. Fingerprint Analysis with Marked Point Processes

    DEFF Research Database (Denmark)

    Forbes, Peter G. M.; Lauritzen, Steffen; Møller, Jesper

    We present a framework for fingerprint matching based on marked point process models. An efficient Monte Carlo algorithm is developed to calculate the marginal likelihood ratio for the hypothesis that two observed prints originate from the same finger against the hypothesis that they originate from...... different fingers. Our model achieves good performance on an NIST-FBI fingerprint database of 258 matched fingerprint pairs....

  5. Zpráva z 12. konference Evropské sociologické asociace „Differences, Inequalities and Sociological Imagination

    Czech Academy of Sciences Publication Activity Database

    Vohlídalová, Marta

    2016-01-01

    Roč. 52, č. 2 (2016), s. 255-258 ISSN 0038-0288 R&D Projects: GA MŠk(CZ) LE12003 Institutional support: RVO:68378025 Keywords : 12th ESA conference Subject RIV: AO - Sociology, Demography Impact factor: 0.143, year: 2016

  6. Pattern of surgical admissions to Tikur Anbessa Hospital, Addis ...

    African Journals Online (AJOL)

    developing countries is mainly performed on acute and curable conditions('). ... 550. 2. Gastric outlet obstruction (PUD). 265. 3. Appendicitis. 258. 4. Intestinal obstruction. 229. 5. Oesophageal carcinoma. 114. 6. Abdominal trauma. 102. 7. Other GI diseases ... managing special referred cases, the majority of admission were ...

  7. 75 FR 50930 - Final Determination To Approve Alternative Final Cover Request for the Lake County, Montana Landfill

    Science.gov (United States)

    2010-08-18

    ... infiltration and erosion. The regulation requires final cover systems to be designed and constructed to: (1... of earthen material, and (3) Minimize erosion of the final cover by the use of an erosion layer that... infiltration layer specified in paragraphs (a)(1) and (a)(2) of 40 CFR 258.60, and (2) An erosion layer that...

  8. Naše nivy v proměnách času. II. Osud niv v dnešní době

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2003-01-01

    Roč. 58, č. 5 (2003), s. 131-136 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : processes affecting the floodplains * soil erosion * water nills Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000510.pdf

  9. Impact of project funding on the implementation of LEEMP ...

    African Journals Online (AJOL)

    The implementation process could make a project succeed, fail or even abandoned midstream. Information gathered from LEEMP in Imo State indicates that out of the 258 development projects embarked upon by LEEMP, only 24.4% have been completed while 75.6% are at their various completion stages after committing ...

  10. Punniyamurthy, Prof. Tharmalingam

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 2016 Section: Chemistry. Punniyamurthy, Prof. Tharmalingam Ph.D. (IIT, Kanpur), FRSC. Date of birth: 3 June 1964. Specialization: Synthetic Organic Chemistry Address: Department of Chemistry, Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 258 ...

  11. Beyond the Resignation Debate: A New Framework for Civil-Military Dialogue

    Science.gov (United States)

    2015-01-01

    recent years. For example, Risa A. Brooks, associate professor of political science at Marquette Uni- versity, considers the potential costs and...Leadership in Wartime (New York: Free Press, 2002), 258–64; Feaver, Armed Servants, 68–75; and Risa A. Brooks, “Militaries and Political Activity in

  12. Effects of Storage Temperature, pH and Time on Urinary Albumin ...

    African Journals Online (AJOL)

    Dr Olaleye

    methods of sample preparation in the measurement of urinary albumin. Diabetologia 36:993-997. Doumas B.T. and Peters Jr. T. (1997): Serum and urine albumin: a progress report on their measurement and clinical significance Clin Chim Acta 258: 3-20. Elving L.D, Bekkeren J.A, Janson M.J., Angelino C.M., de Nobel E.

  13. Die ontogenetische Entwicklung des Gebisses beim Grossen mausohr (Myotis Myotis, Chiroptera)

    Czech Academy of Sciences Publication Activity Database

    Míšek, Ivan; Witter, K.

    2002-01-01

    Roč. 89, - (2002), s. 1-6 ISSN 0043-535X R&D Projects: GA ČR GP304/01/P021; GA ČR GA304/02/0448; GA AV ČR KSK6005114 Keywords : large mouse-eared * odontogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.258, year: 2002

  14. Fast Transition between High-soft and Low-soft States in GRS 1915 ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    intensity in GRS 1758 − 258. Though transition from low-hard to high-soft states are seen in many Galactic black hole candidate sources, a transition between two different intensity states (high and low) with similar physical parameters of the accretion disk was not observed in GRS 1915 + 105 or in any other black hole ...

  15. Progress in emerging techniques for characterization of immobilized viable whole-cell biocatalysts

    Czech Academy of Sciences Publication Activity Database

    Bučko, M.; Vikartovská, A.; Schenkmayerová, A.; Tkáč, J.; Filip, J.; Chorvát Jr., D.; Neděla, Vilém; Ansorge-Schumacher, M.B.; Gemeiner, P.

    2017-01-01

    Roč. 71, č. 11 (2017), s. 2309-2324 ISSN 0366-6352 Institutional support: RVO:68081731 Keywords : bioelectrocatalysis * imaging techniques * immobilized whole-cell biocatalyst * multienzyme cascade reactions * online kinetics Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Bioprocessing technologies (industrial processes relying on biological agents to drive the process) biocatalysis, fermentation Impact factor: 1.258, year: 2016

  16. 75 FR 73162 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-11-29

    ... military retirement and gambling winnings. Form 945-V, Payment Voucher, is used if you are making a payment.... Type of Review: Extension without change to a currently approved collection. Title: REG-106177-97 (NPRM.... Estimated Total Burden Hours: 4,258,260 hours. OMB Number: 1545-21.75. Type of Review: Extension without...

  17. 76 FR 70118 - Notice of Public Meetings for the Draft Environmental Impact Statement for Basing of MV-22 and H...

    Science.gov (United States)

    2011-11-10

    ... 100, Pearl Harbor, HI 96860-3134. Mailed comments must be postmarked no later than December 27, 2011... Division, Attn: EV21, MV-22/H-1 EIS Project Manager, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI 96860... consequences that may result from the basing of Osprey tiltrotor (MV-22) and Cobra and Huey attack and utility...

  18. 75 FR 47562 - Notice of Intent To Prepare an Environmental Impact Statement for the Basing of MV-22 and H-1...

    Science.gov (United States)

    2010-08-06

    ...-22/H-1 EIS Project Manager, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI 96860- 3134. FOR FURTHER... (MV-22) Osprey aircraft and H-1 Cobra and Huey attack helicopters in support of III Marine... Light Attack Helicopter (HMLA) squadron composed of 18 AH-1Z and 9 UH-1Y helicopters. Because the...

  19. 77 FR 48969 - Record of Decision for the U.S. Marine Corps Basing of MV-22 and H-1 Aircraft in Support of III...

    Science.gov (United States)

    2012-08-15

    ... Division, Attn: EV21, MV-22/H-1 EIS Project Manager, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI 96860... (up to 12 MV-22 Osprey per squadron, for a total of 24 aircraft) and one Marine Light Attack Helicopter (HMLA) squadron (15 AH-1 Cobra attack and 12 UH-1 Huey utility helicopters, for a total of 27...

  20. Distribution of Aceria carvi nal. in caraway (Carum carvi L.) growing areas of Bohemia

    Czech Academy of Sciences Publication Activity Database

    Reindl, František; Kameníková, L.; Kurowská, M.; Zemková-Rovenská, Gabriela; Zemek, Rostislav

    2004-01-01

    Roč. 7, - (2004), 255-256 ISSN 1335-258X R&D Projects: GA ČR(CZ) GA522/02/1490 Institutional research plan: CEZ:AV0Z5007907 Keywords : Aceria carvi * caraway * Eryophyoid mites Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  1. Cytotoxicity of poly(p-phenylenediamine)

    Czech Academy of Sciences Publication Activity Database

    Kuceková, Z.; Rejmontová, P.; Humpolíček, P.; Kašpárková, V.; Bober, Patrycja; Sáha, P.; Stejskal, Jaroslav

    2017-01-01

    Roč. 71, č. 2 (2017), s. 367-372 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : cytotoxicity * poly(p-phenylenediamine) * mouse embryonic fibroblasts Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016

  2. Body Dissatisfaction and Characteristics of Disordered Eating among Black and White Early Adolescent Girls and Boys

    Science.gov (United States)

    Jung, Jaehee; Forbes, Gordon B.

    2013-01-01

    Multiple measures of body dissatisfaction and behaviors associated with disordered eating were studied in 258 White girls, 223 White boys, 106 Black girls, and 82 Black boys. All participants were unpaid volunteers between the ages of 12 and 15 attending six middle schools in Delaware and Maryland. On two self-ideal figure drawing discrepancy…

  3. Evaluation of the performance of the novel PapilloCheck HPV genotyping test by comparison with two other genotyping systems and the HC2 test

    DEFF Research Database (Denmark)

    Schopp, Betti; Holz, Barbara; Zago, Manola

    2010-01-01

    lowest sensitivity for HPV 56 (40.5%). Multiple infection rates ranged from 25.8% (PGMY09/11 PCR-LBA), over 39.5% (PapilloCheck) to 55.9% (SPF10 PCR LiPav1). In samples with higher viral DNA load detection rates and concordance between the genotyping tests increases. The kappa values in comparison...

  4. Development of ICP-MS and ICP-OES methods for determination of gadolinium in samples related to hospital waste water treatment

    Czech Academy of Sciences Publication Activity Database

    Bendakovská, L.; Krejčovská, A.; Černohorský, T.; Zelenková, Jana

    2016-01-01

    Roč. 70, č. 9 (2016), s. 1155-1165 ISSN 0366-6352 Institutional support: RVO:67985874 Keywords : gadolinium * rare-earth elements * bioaccumulation * gadolinium anomaly * inductively coupled plasma mass spectrometry (ICP-MS) * inductively coupled plasma optical emission spectrometry (ICP-OES) Subject RIV: BK - Fluid Dynamics Impact factor: 1.258, year: 2016

  5. Profile of genetic disorders prevalent in northeast region of Cairo ...

    African Journals Online (AJOL)

    Rabah M. Shawky

    2012-02-04

    Feb 4, 2012 ... magnitude of the problem so that the national program for the prevention of genetic disorders can be implemented. У 2012 Ain ..... when sampling was done on the same day and one or two days after the last seizure (p ..... 32.31%) compared to mean maternal age (25.8 years) [5]. In. Table 4 Varieties of ...

  6. 77 FR 66850 - Public Workshop on Burkholderia: Exploring Current Issues and Identifying Regulatory Science Gaps

    Science.gov (United States)

    2012-11-07

    ...,'' The New England Journal of Medicine, vol. 367(11), pp. 1035-1044, 2012. 4. Limmathurotsakul D., W... Research Microbiologist,'' The New England Journal of Medicine, vol. 345(4), pp. 256-258, 2001. 7. Gregory... Incidence of Human Melioidosis in Northeast Thailand,'' American Journal of Tropical Medicine and Hygiene...

  7. Bt-potatoes resistant to the Colorado potato beetle affect performance of the Egyptian armyworm, Spodoptera littoralis

    Czech Academy of Sciences Publication Activity Database

    Hussein, Hany; Sehnal, František; Habuštová, Oxana

    2005-01-01

    Roč. 8, č. 2 (2005), s. 38-41 ISSN 1335-258X R&D Projects: GA ČR GA522/02/1507 Institutional research plan: CEZ:AV0Z50070508 Keywords : Bt-toxin * Cry3 Aa * Spodoptera littoralis Subject RIV: ED - Physiology

  8. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Journal of Astrophysics and Astronomy. 258 pages Volume 38 Issue 3 September 2017. Special issue on "Physics of Neutron Stars and Related Objects". Guest Editors: Dipankar Bhattacharya, K. S. Dwarakanath and Sushan Konar. 116 pages Volume 38 Issue 2 June 2017. Special Section on "AstroStat". Guest Editors: S ...

  9. Polypyrrole nanotubes: the tuning of morphology and conductivity

    Czech Academy of Sciences Publication Activity Database

    Sapurina, Irina; Li, Yu; Alekseeva, E.; Bober, Patrycja; Trchová, Miroslava; Morávková, Zuzana; Stejskal, Jaroslav

    2017-01-01

    Roč. 113, 24 March (2017), s. 247-258 ISSN 0032-3861 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : conducting polymer * conductivity * dyes Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 3.684, year: 2016

  10. Application of Error Correcting Codes in Fault-Tolerant Logic Design for VLSI Circuits

    Science.gov (United States)

    1992-08-14

    computing, pp 258-265, test conf., Philadelphia, PA. pp 435-445, Oct. 1983. 1983. 10. Sandip Kundu,"Design of multioutput CMOS 3. J.P. Hayes,"ault Modellin...34T 151 F. 1. Ferguson and 1. P. Shen. "Extraction and simulation of realistic 1101 S Kundu. "Deign of multioutput CMOS combinational ogi. :r. CMOS

  11. The Investigation of Relationship among Relational-Interdependent Self-Construal, Cyberbullying, and Psychological Disharmony in Adolescents: An Investigation of Structural Equation Modelling

    Science.gov (United States)

    Cetin, Bayram; Eroglu, Yuksel; Peker, Adem; Akbaba, Sirri; Pepsoy, Sevim

    2012-01-01

    The aim of this study is to investigate the effect of relational-interdependent self-construal on cyberbullying and the effect of cyberbullying on psychological disharmony. Participants were 258 high school students. In this study, the Relational-Interdependent Self-Construal Scale, the Revised Cyberbullying Inventory, and the Depression, Anxiety,…

  12. Organoleptic qualities and acceptability of fortified rice in two Southeast Asian countries

    DEFF Research Database (Denmark)

    Khanh Van, Tran; Burja, Kurt; Thuy Nga, Tran

    2014-01-01

    the acceptability of two types of fortified rice (cold and hot extruded) in Vietnam and Cambodia, triangle tests were conducted in Vietnam (53 women) and Cambodia (258 adults), testing fortified rice against conventional rice, with participants being asked to score the organoleptic qualities. In addition, Cambodian...

  13. Deformation effects in rock massifs and their long-term monitoring

    Czech Academy of Sciences Publication Activity Database

    Košťák, Blahoslav

    2006-01-01

    Roč. 39, č. 3 (2006), s. 249-258 ISSN 1470-9236 R&D Projects: GA MŠk(CZ) OC 625.10 Institutional research plan: CEZ:AV0Z30460519 Keywords : anchors * extensometers * monitoring Subject RIV: DO - Wilderness Conservation Impact factor: 0.778, year: 2006

  14. Retention, Progression and the Taking of Online Courses

    Science.gov (United States)

    James, Scott; Swan, Karen; Daston, Cassandra

    2016-01-01

    Online learning continues to grow at post-secondary institutions across the United States, but many question its efficacy, especially for students most at-risk for failure. This paper engages that issue. It examines recent research on the success of community college students who take online classes and explores similar comparisons using 656,258

  15. Patterns of upper gastrointestinal diseases based on endoscopy in ...

    African Journals Online (AJOL)

    Majority of the patients had abnormal findings with gastritis being the most common (25.8%). It is concluded that gastritis is an important cause of morbidity in Kenya. Oesophagitis, mainly due to gastroesopahageal reflux disease, seems to be on the increase. Gastric cancer is not as rare as previously thought and peptic ...

  16. Health beliefs and teenage condom use : A prospective study

    NARCIS (Netherlands)

    Abraham, CS; Sheeran, P; Abrams, D; Spears, R

    1996-01-01

    Results from a longitudinal survey of sexual behaviour and HIV-relevant cognitions amongst 258 sexually-active adolescents are reported. Demographic characteristics, previous sexual experience, prior condom use, beliefs specified by the health belief model (I-IBM), peer norms regarding condom use

  17. Diagnostics for a troubled backbone: testing topological hypotheses of trapelioid lichenized fungi in a large-scale phylogeny of Ostropomycetidae (Lecanoromycetes)

    Czech Academy of Sciences Publication Activity Database

    Resl, P.; Schneider, K.; Westberg, M.; Printzen, C.; Palice, Zdeněk; Thor, G.; Fryday, A.; Mayrhofer, H.; Spribille, T.

    2015-01-01

    Roč. 73, č. 1 (2015), s. 239-258 ISSN 1560-2745 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Ostropomycetidae * paraphyly * taxon sampling Subject RIV: EF - Botanics Impact factor: 6.991, year: 2015

  18. Multi-anode sawtooth SDD for X-ray spectroscopy fabricated on NTD wafers

    Czech Academy of Sciences Publication Activity Database

    Sonsky, J.; Hollander, RW.; van Eijk, SWE.; Sarro, PM.; Kushpil, Vasilij

    2001-01-01

    Roč. 48, č. 3 (2001), s. 258-261 ISSN 0018-9499 R&D Projects: GA AV ČR KSK2067107 Keywords : charge sharing * multi- anode linear drift detectors * sawtooth design Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.771, year: 2001

  19. Native grass facilitates mycorrhizal colonisation and P uptake of tree seedlings in two anthropogenic substrates

    Czech Academy of Sciences Publication Activity Database

    Batkhuugyin, Enkhtuya; Pöschl, M.; Vosátka, Miroslav

    2005-01-01

    Roč. 166, 1-4 (2005), s. 217-236 ISSN 0049-6979 R&D Projects: GA ČR(CZ) GA526/99/0895 Institutional research plan: CEZ:AV0Z60050516 Keywords : degraded ecosystems * arbuscular mycorrhizal fungi * phosphorus transfer Subject RIV: EF - Botanics Impact factor: 1.258, year: 2005

  20. Outcomes of Neurogenic Bowel Management in Individuals Living With a Spinal Cord Injury for at Least 10 Years

    NARCIS (Netherlands)

    Adriaansen, JJE; van Asbeck, Floris W A; Kuppevelt, D.; Snoek, G.J.; Post, MWM

    2015-01-01

    OBJECTIVE: To describe bowel management and its outcomes in individuals living with a spinal cord injury (SCI) for at least 10 years. DESIGN: Cross-sectional multicenter study. SETTING: Dutch community. PARTICIPANTS: Individuals (N=258; age range, 28-65y) who acquired their SCI between 18 and 35

  1. Outcomes of Neurogenic Bowel Management in Individuals Living With a Spinal Cord Injury for at Least 10 Years

    NARCIS (Netherlands)

    Adriaansen, Jacinthe J.; van Asbeck, Floris W.; van Kuppevelt, Dirk; Snoek, Govert J.; Post, Marcel W.

    Objective: To describe bowel management and its outcomes in individuals living with a spinal cord injury (SCI) for at least 10 years. Design: Cross-sectional multicenter study. Setting: Dutch community. Participants: Individuals (N=258; age range, 28-65y) who acquired their SCI between 18 and 35

  2. South African Journal of Philosophy - Vol 21, No 4 (2002)

    African Journals Online (AJOL)

    Self-Formation and the speculative: Gadamer and Lacan · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Andrea Hurst, 258-273. http://dx.doi.org/10.4314/sajpem.v21i4.31351 ...

  3. Parity-Induced Protection Against Breast Cancer

    Science.gov (United States)

    2001-07-01

    et al., 1995; Panico et al., 1996). Consistent with this, Areg is overexpressed in hyperplastic stages of mammary tumor development in MMTV-PyMT and MT...breast cancer before and after the menopause., American Journal of Epidemiology 112, 258-68. 35 Proprietary Data D’Cruz et al. Panico , L., D’Antonio

  4. The Galactic unclassified B[e] star HD50138 II. Interferometric constraints on the close circumstellar environment

    Czech Academy of Sciences Publication Activity Database

    Borges Fernandes, M.; Meilland, A.; Bendjoya, P.; de Souza, A.D.; Niccolini, G.; Chesneau, O.; Millour, F.; Spang, A.; Stee, P.; Kraus, Michaela

    2011-01-01

    Roč. 258, April (2011), A20/1-A20/9 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030701 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * winds * outflows Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011

  5. Analysis of 155 cases of head and neck cancers seen over a 3-year ...

    African Journals Online (AJOL)

    Carcinomas (44.5%) was the most common malignant lesion with squamous cell carcinoma been the most common. The next most common lesions were the Lymphomas (25.8%). The neck (29.7%) was the most commonly affected site followed by the oral cavity (22.5%) while the parotid region and the larynx with 1.9% ...

  6. Rapeseed oil as feedstock for high functionality polyol synthesis

    Czech Academy of Sciences Publication Activity Database

    Kirpluks, M.; Kalnbunde, D.; Walterová, Zuzana; Cabulis, U.

    2017-01-01

    Roč. 5, 3-4 (2017), s. 258-270 ISSN 2164-6325 Institutional support: RVO:61389013 Keywords : polyols * polyurethane foams * renewable raw materials Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.812, year: 2016

  7. Nigerian indigenous yoghurt (kindirmo) production using ...

    African Journals Online (AJOL)

    user

    2011-01-24

    Jan 24, 2011 ... thermophilus mutants as starter culture ... It should be noted that, the “kindirmo” produced in this work was not from a mixed culture of ..... Antioxidant activity of some yogurt starter cultures. Asian-. Australasian J. Anim. Sci. 18(2): 255-258. http://www.cat.inist.fr.?amodele=afficheN&cpsidt+16401200.

  8. Parent-Child Cultural Orientations and Child Adjustment in Chinese American Immigrant Families

    Science.gov (United States)

    Chen, Stephen H.; Hua, Michelle; Zhou, Qing; Tao, Annie; Lee, Erica H.; Ly, Jennifer; Main, Alexandra

    2014-01-01

    Direct and indirect/mediated relations of (a) children's and parents' cultural orientations and (b) parent-child gaps in cultural orientations to children's psychological adjustment were examined in a socioeconomically diverse sample of 258 Chinese American children (age = 6-9 years) from immigrant families. Parents reported on children's and…

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    John McCarthy – Father of Artificial Intelligence · V Rajaraman · More Details Fulltext PDF. Volume 19 Issue 3 March 2014 pp 242-258 General Article. Cloud Computing · V Rajaraman · More Details Fulltext PDF. Volume 19 Issue 10 October 2014 pp 917-935 General Article. Steve Jobs - Who Blended Art with Technology.

  10. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  11. Newborn screening for hemoglobinopathies at Muhimbili National ...

    African Journals Online (AJOL)

    Results: Out of 2,053 samples analyzed, the prevalence of hemoglobinopathies was 18.2% (n=374). The percentages of children with defined hemoglobinopathies included 12.6% (n=258) with sickle cell trait (Hb FAS); 0.9% (n=19) as sickle cell carrier or Hb S Beta+ -thalassemia (Hb FSA); 0.54% (n=11) had SCA or Hb S ...

  12. Determination of the distribution constants of aromatic compounds and steroids in biphasic micellar phosphonium ionic liquid/aqueous buffer systems by capillary electrokinetic chromatography

    Czech Academy of Sciences Publication Activity Database

    Lokajová, Jana; Railila, A.; King, A. W. T.; Wiedmer, S. K.

    2013-01-01

    Roč. 1308, Sep 20 (2013), s. 144-151 ISSN 0021-9673 Institutional support: RVO:61388963 Keywords : critical micelle concentration * electrokinetic chromatography * distribution constant * PeakMaster * phosphonium ionic liquid Subject RIV: CC - Organic Chemistry Impact factor: 4.258, year: 2013

  13. Český ráj ve světle nových poznatků

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2006-01-01

    Roč. 61, č. 1 (2006), s. 5-8 ISSN 1210-258X Institutional research plan: CEZ:AV0Z30130516 Keywords : Bohemian Paradise * sandstone rock towns * wetlands * calcareous sandstones * replic species Subject RIV: DO - Wilderness Conservation http://www.casopis.ochranaprirody.cz/res/data/003/000482.pdf

  14. Chemistry is Evergreen

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 3. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry. Swagata Dasgupta. General Article Volume 14 Issue 3 March 2009 pp 248-258. Fulltext. Click here to view fulltext PDF. Permanent link:

  15. Book Review | Leibowitz | Critical Studies in Teaching and Learning

    African Journals Online (AJOL)

    Thesen, L and Cooper, L. (eds.) 2014. Risk in Academic Writing: Postgraduate Students, their Teachers and the Making of Knowledge. Bristol: Multilingual Matters. ISBN: 978-1-78309-104-1 (Pbk), xiv + 258 pp. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  16. Hydrodesulfurization Activities of NiMo Catalysts Supported on Mechanochemically Prepared Al‐Ce Mixed Oxides.

    Czech Academy of Sciences Publication Activity Database

    Jirátová, Květa; Spojakina, A.; Kaluža, Luděk; Palcheva, R.; Balabánová, Jana; Tyuliev, G.

    2016-01-01

    Roč. 37, č. 2 (2016), s. 258-267 ISSN 0253-9837 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : nickel * molybdenum * alumina Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.813, year: 2016

  17. Potential of the strain of entomopathogenic fungus Isaria fumosorosea CCM 8637 as a biological control agent against Cameraria ohridella and other pests

    Czech Academy of Sciences Publication Activity Database

    Zemek, Rostislav; Prenerová, Eva; Awad, Mona; Hussein, Hany

    2012-01-01

    Roč. 15, - (2012), s. 79-80 ISSN 1335-258X R&D Projects: GA MŠk 2B06005 Grant - others:European Social Fund(CZ) CZ.1.07/2.4.00/12.0082 Institutional support: RVO:60077344 Keywords : biological control * horse chestnut leaf miner * Colorado potato beatle

  18. Structural Characterization of Phosducin and Its Complex with the 14-3-3 Protein

    Czech Academy of Sciences Publication Activity Database

    Kacířová, Miroslava; Košek, Dalibor; Kádek, Alan; Man, Petr; Večeř, J.; Herman, P.; Obšilová, Veronika; Obšil, Tomáš

    2015-01-01

    Roč. 290, č. 26 (2015), s. 16246-16260 ISSN 0021-9258 Grant - others:GA ČR(CZ) GAP305/11/0708 Institutional support: RVO:67985823 ; RVO:61388971 Keywords : Phosducin * 14-3-3 protein * fluorescence spectroscopy * SAXS * hydrogen - deuterium exchange Subject RIV: CE - Biochemistry Impact factor: 4.258, year: 2015

  19. Komplexní terapie vrozené katarakty a zavedení screeningu v České republice

    Czech Academy of Sciences Publication Activity Database

    Filouš, A.; Korynta, J.; Čihař, M.; Zoban, P.; Rodný, S.; Michálek, Jiří; Hložánek, M.

    2000-01-01

    Roč. 56, č. 4 (2000), s. 258-261 ISSN 1211-9059. [Vědecký pracovní den ČOS , Sympozium dětské oftalmologie /3./. Ostrava, Litomyšl, 00.00.2000] R&D Projects: GA AV ČR KSK2050602 Subject RIV: FF - HEENT, Dentistry

  20. Assessing Neurophysiologic Markers for Training and Simulation to Develop Expertise in Complex Cognitive Tasks

    Science.gov (United States)

    2010-09-01

    Trowbridge & Cason , 1932) demonstrated that mere rote repetition was not sufficient to ensure performance improvement. There also appear to be limits on the...Trowbridge, M. H., & Cason , H. (1932). An experimental study of Thorndike’s theory of learning. Journal of General Psychology, 7, 245-258. 117 van

  1. 197 impact of project funding on the implementation of leemp ...

    African Journals Online (AJOL)

    2007-10-31

    Oct 31, 2007 ... Abstract. Project success depends on good planning and implementation strategy. The implementation process could make a project succeed, fail or even abandoned midstream. Information gathered from LEEMP in Imo State indicates that out of the 258 development projects embarked upon by LEEMP, ...

  2. High capacity of plant regeneration from callus of interspecific hybrids with cultivated barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.

    1986-01-01

    explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....

  3. Recruiters, Advertising, and Navy Enlistments,

    Science.gov (United States)

    1979-10-01

    standards and perhaps recruiters’ efforts. Another factor that has a sizable effect is unemployment. A one- point increase in the youth unemployment rate...one-percentage-point increase in the youth unemployment rate would yield 1,717 HSGs and 1,258 (73 percent) would be in the upper mental groups. The

  4. Student-Athletes' Misperceptions of Male and Female Peer Drinking Norms: A Multi-Site Investigation of the "Reign of Error"

    Science.gov (United States)

    Perkins, H. Wesley; Craig, David W.

    2012-01-01

    Data from student-athletes at 15 colleges and universities (N = 4,258) document extensive misperceptions of peer drinking norms and their association with personal quantity of alcohol consumed. Regardless of actual drinking norms at each school, student-athletes commonly overestimated the alcohol consumption norms (both quantity and frequency…

  5. Predictors of mortality in patients initiating antiretroviral therapy in ...

    African Journals Online (AJOL)

    a history of oral candidiasis (HR 2.58, 95% CI 1.37 - 4.88) remained significant in multivariate analysis. A history of tuberculosis was not a significant predictor of mortality. Conclusions. Simple clinical and laboratory data independently predict mortality and allow for risk stratification in patients initiating ART in South Africa.

  6. Standard model on D-branes

    Indian Academy of Sciences (India)

    which was done in collaboration with George Kraniotis and Alex Love, and I thank them too for innumerable enjoyable discussions. References. [1] P Candelas, G T Horowitz, A Strominger and E Witten, Nucl. Phys. B258, 46 (1985). [2] D Bailin, G Kraniotis and A Love, Proc. Cairo International Conference on High Energy.

  7. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Little Stars 12,195 views 10:35 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society 4,258 views 3:29 Pediatric Palliative ... views 3:34 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,474 views 5: ...

  8. Development of chronic daily headache : A clinical study

    NARCIS (Netherlands)

    Spierings, E.L.H.; Schroevers, M.; Honkoop, P.C.; Sorbi, M.

    1998-01-01

    We studied the development of chronic daily headache in 258 headache practice patients, 50 men and 208 women. Chronic daily headache was defined as headaches occurring at least 5 days per week for at least 1 year. Twenty-two percent of the patients had daily headaches from the onset, and 78%

  9. Presentation of chronic daily headache : A clinical study

    NARCIS (Netherlands)

    Spierings, E L H; Schroevers, M.; Honkoop, P.C.; Sorbi, M.

    We studied the presentation of chronic daily headache in 258 patients from a private headache practice, 50 men and 208 women. Chronic daily headache was defined as headaches, occurring at least 5 days per week for at least 1 year. Seventy-seven percent of the patients experienced the onset of

  10. reproductive biology and condition factor of the catfish bagrus docmak

    African Journals Online (AJOL)

    Preferred Customer

    of 534 (258 males and 276 females) Bagrus docmak (Forsskål) in Lake Chamo were studied from samples taken during February 1995 to .... During the past several decades, the water level of the lake has declined considerably and this has ..... turbot (Sco reference to feeding and growth in the juvenile stage. Unpubl. PhD.

  11. Behavior of rigid and flexible culvert pipes under deep fill.

    Science.gov (United States)

    1977-01-01

    Along a section of Interstate 77 in Carroll County, in the mountainous region of southwestern Virginia, it was necessary to construct a fill approximately 258 ft (78 m) deep. The flow of a mountain stream had to be carried through this massive embank...

  12. A common variant in chromosome 9p21 associated with coronary ...

    Indian Academy of Sciences (India)

    3Tata Proteomics and Coagulation Unit, 4Thrombosis Research Institute, Narayana Hrudayalaya Hospital, 258/A. Bommasandra Industrial Area, Anekal Taluk, Bangalore 560 099, India ... these preliminary findings, high throughput investigations on the involvement of multiple variants are being initiated from this region.

  13. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. A Abdel-Hafiez. Articles written in Pramana – Journal of Physics. Volume 65 Issue 2 August 2005 pp 245-258 Research Articles. A package for gamma-ray spectrum analysis and routine neutron activation analysis · M E Medhat A Abdel-Hafiez Z Awaad M A Ali · More Details ...

  14. 8 CFR 251.1 - Arrival manifests and lists.

    Science.gov (United States)

    2010-01-01

    ... performed, the master or agent shall note which exception listed in section 258 of the Act permits the work.... (A) To invoke the exception for tankers, the master or agent shall note on the manifest that the.... (iv) If longshore work will be performed under the prevailing practice exception, the master or agent...

  15. Přírodní prostředí a vznik velkoměst

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2001-01-01

    Roč. 56, č. 10 (2001), s. 292-295 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : natural environments * origin of cities Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000446.pdf

  16. America's Star Libraries, 2010: Top-Rated Libraries

    Science.gov (United States)

    Lyons, Ray; Lance, Keith Curry

    2010-01-01

    The "LJ" Index of Public Library Service 2010, "Library Journal"'s national rating of public libraries, identifies 258 "star" libraries. Created by Ray Lyons and Keith Curry Lance, and based on 2008 data from the IMLS, it rates 7,407 public libraries. The top libraries in each group get five, four, or three stars. All included libraries, stars or…

  17. America's Star Libraries: Top-Rated Libraries

    Science.gov (United States)

    Lance, Keith Curry; Lyons, Ray

    2009-01-01

    "Library Journal"'s national rating of public libraries, the "LJ" Index of Public Library Service 2009, Round 2, identifies 258 "star" libraries. Created by Keith Curry Lance and Ray Lyons and based on 2007 data from the IMLS, it rates 7,268 public libraries. The top libraries in each group get five, four, or three stars. All included libraries,…

  18. ALPHA,·ANTITRYPSIN DEFICIENCY*

    African Journals Online (AJOL)

    1971-02-06

    Feb 6, 1971 ... Lieberman," in fact, found that 15·2% of 66 patients hospitalized with pulmonary emphysema had heterozygous alpha,-antitrypsin deficiency. The over-all incidence of the deficiency was 25'8% in this group. Of patients under the age of 50 years, 47·8% had deficient levels. If such observations are confirmed ...

  19. 75 FR 53220 - Adequacy of New Hampshire Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2010-08-31

    ... AGENCY 40 CFR Parts 239 and 258 Adequacy of New Hampshire Municipal Solid Waste Landfill Permit Program... modification to New Hampshire's approved municipal solid waste landfill (MSWLF) program. The approved... March 22, 2004, EPA issued a final rule amending the municipal solid waste landfill criteria in 40 CFR...

  20. 76 FR 303 - Alaska: Adequacy of Alaska's Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2011-01-04

    ... AGENCY 40 CFR Parts 239 and 258 Alaska: Adequacy of Alaska's Municipal Solid Waste Landfill Permit... proposes to approve Alaska's modification of its approved Municipal Solid Waste Landfill (MSWLF) permit... Domenic Calabro, Office of Air, Waste, and Toxics, U.S. EPA, Region 10, 1200 Sixth Avenue, Suite 900...

  1. 78 FR 5350 - Adequacy of Massachusetts Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2013-01-25

    ... AGENCY 40 CFR Parts 239 and 258 Adequacy of Massachusetts Municipal Solid Waste Landfill Permit Program... approve Massachusetts's modification of its approved Municipal Solid Waste Landfill Program. On March 22... be issued to certain municipal solid waste landfills by approved states. On December 7, 2012...

  2. 78 FR 20073 - Adequacy of Oregon's Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2013-04-03

    ... AGENCY 40 CFR Parts 239 and 258 Adequacy of Oregon's Municipal Solid Waste Landfill Permit Program AGENCY... modification to the State of Oregon's approved Municipal Solid Waste Landfill Program. On March 22, 2004, EPA... certain municipal solid waste landfills by approved states. On June 14, 2012, Oregon submitted an...

  3. 78 FR 5288 - Adequacy of Massachusetts Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2013-01-25

    ... AGENCY 40 CFR Parts 239 and 258 Adequacy of Massachusetts Municipal Solid Waste Landfill Permit Program... modification to Massachusetts's approved municipal solid waste landfill (MSWLF) program. The approved... INFORMATION: A. Background On March 22, 2004, EPA issued a final rule amending the municipal solid waste...

  4. 75 FR 53268 - Adequacy of New Hampshire Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2010-08-31

    ... AGENCY 40 CFR Parts 239 and 258 Adequacy of New Hampshire Municipal Solid Waste Landfill Permit Program... approve New Hampshire's modification of its approved Municipal Solid Waste Landfill Program. On March 22... be issued to certain municipal solid waste landfills by approved states. On June 28, 2010 New...

  5. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Special Issues. Journal of Astrophysics and Astronomy. 258 pages Volume 38 Issue 3 September 2017. Special issue on "Physics of Neutron Stars and Related Objects". Guest Editors: Dipankar Bhattacharya, K. S. Dwarakanath and Sushan Konar. 116 pages Volume 38 Issue 2 June 2017. Special Section on "AstroStat".

  6. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  7. Description of two new nematode species, parasites of the Mississippi paddlefish Polyodon spathula (Walbaum) (Acipenseriformes: Polyodontidae)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Kuchta, Roman

    2013-01-01

    Roč. 99, č. 4 (2013), s. 680-685 ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Camallanus * Syngnathinema * Polyodon Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013

  8. Why Don't They Do It? A Study on the Implementation of Extensive Reading in Taiwan

    Science.gov (United States)

    Huang, Yi-Cheng

    2015-01-01

    The study aims to verify whether extensive reading (ER) is able to promote senior high school students' English reading motivation and foster positive attitude towards reading in English. It further explores the teachers' perceptions of and the challenges faced in the implementation of ER activities. An ER activity was held for 12 weeks with 258

  9. Formation of bacterial and fungal biofilm on conducting polyaniline

    Czech Academy of Sciences Publication Activity Database

    Mikušová, N.; Humpolíček, P.; Růžička, J.; Capáková, Z.; Janů, K.; Kašpárková, V.; Bober, Patrycja; Stejskal, Jaroslav; Koutný, M.; Filatová, K.; Lehocký, M.; Ponížil, P.

    2017-01-01

    Roč. 71, č. 2 (2017), s. 505-512 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : bacteria * filamentous fungi * biofilm Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016

  10. Time dependent thermal treatment of oxidized MWCNTs studied by the electron and mass spectroscopy methods

    Czech Academy of Sciences Publication Activity Database

    Stobinski, L.; Lesiak, B.; Zemek, Josef; Jiříček, Petr

    2012-01-01

    Roč. 258, č. 20 (2012), s. 7912-7917 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10100521 Keywords : MWCNTs * ox-MWCNTs * functional materials * electron spectroscopy * mass spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.112, year: 2012

  11. Prostatic Duct Adenocarcinoma with Endometrioid Features: Report ...

    African Journals Online (AJOL)

    mn

    4, 2009. 257. 257-258. Case Report. Prostatic Duct Adenocarcinoma with Endometrioid. Features: Report of a Rare Case and Brief Review of the Literature ... 3. adenocarcinoma of the prostate: A distinctive tumor of probable prostatic duct origin. Cancer. 1976;. May;37(5):2255-62. Cohen RJ, Wheeler TM, Bonkhoff H, ...

  12. Department of Defense Index of Specifications and Standards. Part 1. Alphabetical Listing

    Science.gov (United States)

    1989-07-01

    MIL-D-23296A 6810 aS 14 Jun 72 OS Diethylene Glycol Dibutyl Ether , Technical...NOTICE 1 Ethylene Glycol Monoethyl Ether Acetate, Technical ....................................... MII.*E.71125 6810 EA 08 Mar 89 EA 68 NOTICE 1...A.A.415 5136 t 13 Nov 79 258 ALPHABETICAL LISTING DOCUMENT TITLE NUMBER FSC PREP DATE CUSTODIAN Diethylene Glycol

  13. Radar Spectrum Engineering and Management (Ingenierie et gestion du spectre radar)

    Science.gov (United States)

    2017-04-01

    industry, and academic experts in various facets of radar technology is needed to address the spectrum problems facing current (legacy) and future radar...Radar Applications”, IEEE International RF and Microwave Conference 2013, pp. 258-262, Penang, Malaysia , 9-11 December 2013. [88] A.A. Salah, R.S.A

  14. 76 FR 74813 - Notice of Quarterly Report (July 1, 2011-September 30, 2011)

    Science.gov (United States)

    2011-12-01

    ...-- pensions. Debit/smart cards issued. Mortgage bonds registered. Value of registered mortgage bonds. Clearing... of health centers available in the Alatona. Number of affected people who have been compensate...) legislation passed. Health Project $38,973,258 Increase the $16,198,584 Treatment of diabetes. adoption of...

  15. Sesbania sesbim and" Tl1'hroSia wgeDi,at Gairo in Moro.goro ...

    African Journals Online (AJOL)

    Development. pp 231-258. Ok'alebo, J. R.,,Gathua, K. W., and Woomer, P.L.. 1993. Laboratory methods of soil plant analy- sis: A working manual. Soil Science Society of. East Africa. Technical publication no. 1. Marvel. EPZ (Kenya) LTD, Nairobi, Kenya. 88 pp. Oldeman, L. R., Hakkeling, R. T. A. and Sombroek,. W. G. 1991.

  16. Contribution to the study of rutin stability in the achenes of Tartary buckwheat (Fagopyrum tataricum)

    Czech Academy of Sciences Publication Activity Database

    Kalinová Pexová, J.; Vrchotová, Naděžda; Tříska, Jan

    2018-01-01

    Roč. 258, aug (2018), s. 314-320 ISSN 0308-8146 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:86652079 Keywords : hexane * lyophilisation * methanol * quercetin * rutin-degradating enzyme * temperature Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.529, year: 2016

  17. Chráněná území ve světle své krajinné historie. Blanský les a tajemství Vyšenských kopců

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2002-01-01

    Roč. 57, č. 6 (2002), s. 179-183 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Protected Areas * Blanský les Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000452.pdf

  18. 28 CFR 16.203 - Closed meetings-Formal procedure.

    Science.gov (United States)

    2010-07-01

    ...) The Commission, by majority vote, may close to public observation any meeting or portion thereof, and... through 2.58 (parole, release, supervision, and recommitment of prisoners, youth offenders, and juvenile.... (d) Voting and certification. (1) A separate recorded vote of the Commission shall be taken with...

  19. Original Research Psychometric evaluation of the Shona version of ...

    African Journals Online (AJOL)

    Providing care for a patient with cancer can negatively affect the health and psychosocial well-being of informal caregivers. However, social support ..... Relationship to patient. Parent. 7 (5.8). Spouse. 3 (2.5). Sibling. 31 (25.8). Child. 10 (8.3). Grandchild. 52 (43.3). Highest level of education Primary. 22 (18.3). Secondary.

  20. Distribution of stoneflies of the family Taeniopterygidae (Plecoptera) in the Czech Republic: earlier data, new records and recent distributional changes

    Czech Academy of Sciences Publication Activity Database

    Bojková, J.; Soldán, Tomáš; Špaček, J.; Straka, M.

    2011-01-01

    Roč. 60, č. 3 (2011), s. 239-258 ISSN 1211-3026 Grant - others:Czech Science Foundation(CZ) GAP505/10/P302 Program:GP Institutional research plan: CEZ:AV0Z50070508 Keywords : Plecoptera * Taeniopterygidae * historical and earlier data Subject RIV: EH - Ecology, Behaviour

  1. Post-operative wound infection in developing country - A ...

    African Journals Online (AJOL)

    Elizabeth Central Hospital, Blantyre, Malawi over a three-month period from April to June, 1985. The methods whereby wound sepsis data were obtained are presented. The results show an overall infection rate of 25.8% and that for clean wounds of 14.8%. These figures are relatively unfavourable and an attempt is made ...

  2. Female reproductive anatonlY and developnlent of ovarian follicles ...

    African Journals Online (AJOL)

    Rhinolophidae). J. Linn. Soc. Zool. 40: 143-161. BRAMBELL, ·F.W.G. 1928. The development and morphology of the gonads of the mouse. Part III. The growth of the follicles. Proc. R. Soc. B 103: 258-272. CARTER, D.C. 1970. Chiropteran reproduction. In: About bats. A chiropteran biology symposium. (eds) Slaughter, B.H. ...

  3. Automatická kontrola barevných značek automobilových pružin

    Czech Academy of Sciences Publication Activity Database

    Čepl, J.; Ivanov, Georgi; Kratochvíl, Aleš; Hiklová, Helena; Hrabovský, Miroslav

    2009-01-01

    Roč. 54, č. 9 (2009), 255-258 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : colour marks * automobile spring Subject RIV: BH - Optics, Masers, Lasers

  4. Relational Benefits of Relational Aggression: Adaptive and Maladaptive Associations with Adolescent Friendship Quality

    Science.gov (United States)

    Banny, Adrienne M.; Heilbron, Nicole; Ames, Angharad; Prinstein, Mitchell J.

    2011-01-01

    Two longitudinal studies examined associations between relational aggression and friendship quality during adolescence. In Study 1, 62 adolescents in Grades 6 (25.8%), 7 (32.3%), and 8 (41.9%) completed assessments of friendship affiliations, relational and overt aggression, and friendship quality at 2 time points, 1 year apart. Results using…

  5. Effective model for in-medium (K)over-barN interactions including the L=1 partial wave

    Czech Academy of Sciences Publication Activity Database

    Cieplý, Aleš; krejčiřík, V.

    2015-01-01

    Roč. 940, AUG (2015), s. 311-330 ISSN 0375-9474 R&D Projects: GA ČR(CZ) GA15-04301S Institutional support: RVO:61389005 Keywords : kaon-nucleon interactions * baryon resonances * in-medium hadron properties Subject RIV: BE - Theoretical Physics Impact factor: 1.258, year: 2015

  6. Disease: H00429 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DR:D02077] Thiazide ... ICD-10: N25.8 MeSH: D000141 OMIM: 604278 PMID:11045400 (gene) ... AUTHORS ... Rodriguez-Sor...r studies. ... JOURNAL ... Pediatr Nephrol 14:1121-36 (2000) ... PMID:12138150 (gene, env_factor, marker) ... AUTHORS ... Rodriguez

  7. Disease: H00241 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 21-36 (2000) ... PMID:12138150 (gene, env_factor, marker) ... AUTHORS ... Rodriguez Soriano J ... TITLE ... Renal tub...5400 (gene) ... AUTHORS ... Rodriguez-Soriano J ... TITLE ... New insights into the pat...nous potassium supplement Sodium bicarbonate [DR:D01203] ... ICD-10: N25.8 MeSH: D000141 OMIM: 259730 PMID:1104

  8. Poly(4-amino-2,1,3-benzothiadiazole) films: preparation, characterization and applications

    Czech Academy of Sciences Publication Activity Database

    Broncová, G.; Shishkanova, T.V.; Dendisová, M.; Člupek, M.; Kubáč, David; Matějka, P.

    2017-01-01

    Roč. 71, č. 2 (2017), s. 359-366 ISSN 0366-6352 Institutional support: RVO:61388971 Keywords : Conducting polymer * Polyaminobenzo-thiadiazole * Electropolymerization Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.258, year: 2016

  9. In-vitro Release Study of Carvedilol Phosphate Matrix Tablets ...

    African Journals Online (AJOL)

    properties and therapeutic efficacy. Drugs 1993; 45: 232-258. 19. Ruffolo RR Jr, Gellai M, Hieble JP, Willette RN,. Nichols AJ. The pharmacology of carvedilol. Eur J Clin Pharmacol 1990;38: S82-88. 20. Korsmeyer RW, Gurny R, Doelker E, Buri P, Peppas. NA. Mechanism of solute release from porous hydrophilic polymers.

  10. Biodiverzita a geodiverzita

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2005-01-01

    Roč. 60, č. 7 (2005), s. 195-200 ISSN 1210-258X Institutional research plan: CEZ:AV0Z30130516 Keywords : geofactors * Ecophenomena * hot spots of Biodiversity , Subject RIV: EG - Zoology http://www.casopis.ochranaprirody.cz/res/data/003/000478.pdf

  11. USSR Report, Political and Sociological Affairs, No. 1406, Selections from Soviet Foreign Policy Journals.

    Science.gov (United States)

    1983-05-09

    production and fifth in proven reserves. 2. "Lecturas de politica exterior mexicana," Mexico City, 1979, p 258. 3. J. Lopez Portillo, "Primer Informe de...SOTSIALIZMA No 4, 1976; T. Araujo, Ŕ capitalismo monopolista de Estado no Brasil e suas particularidades. Tese de doutoramento em candidato de ciencias

  12. Transport properties and microstructure changes of talc characterized by emanation

    Czech Academy of Sciences Publication Activity Database

    Pérez-Maqueda, L. A.; Balek, Vladimír; Poyato, J.; Šubrt, Jan; Beneš, M.; Ramírez-Valle, V.; Buntseva, I.M.; Beckman, I. N.; Pérez-Rodríguez, J. L.

    2008-01-01

    Roč. 92, č. 1 (2008), s. 253-258 ISSN 1388-6150 R&D Projects: GA MŠk LC523 Grant - others:MST(ES) MAT 2005-04838 Institutional research plan: CEZ:AV0Z40320502 Keywords : DTA emanation thermal analysis * microstructure changes * radon diffusion Subject RIV: CA - Inorganic Chemistry Impact factor: 1.630, year: 2008

  13. Nodal sets of thin curved layers

    Czech Academy of Sciences Publication Activity Database

    Krejčiřík, David; Tušek, M.

    2015-01-01

    Roč. 258, č. 2 (2015), s. 281-301 ISSN 0022-0396 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : convex domain * wave-guides * asyptotics Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015

  14. Cloning, Characterization, Controlled Overexpression, and Inactivation of the Major Tributyrin Esterase Gene of Lactococcus lactis

    NARCIS (Netherlands)

    Fernández, Leonides; Beerthuyzen, Marke M.; Brown, Julie; Siezen, Roland J.; Coolbear, Tim; Holland, Ross; Kuipers, Oscar P.

    2000-01-01

    The gene encoding the major intracellular tributyrin esterase of Lactococcus lactis was cloned using degenerate DNA probes based on 19 known N-terminal amino acid residues of the purified enzyme. The gene, named estA, was sequenced and found to encode a protein of 258 amino acid residues. The

  15. Data of evolutionary structure change: 1DCLB-3DIFA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DCLB-3DIFA 1DCL 3DIF B A PSALTQ-PPSASGSLGQSVTISCTGTSSNVGGYNYVSWY... ALA CA 311 ALA CA 334 3DIF... A 3DIFA DQDSKDSTYSM...SER CA 190 THR CA 215 VAL CA 258 3DIF... A 3DIFA CEATHKTSTSPI

  16. 78 FR 39439 - Companies Holding Certificates of Authority as Acceptable Sureties on Federal Bonds and as...

    Science.gov (United States)

    2013-07-01

    ... SERVICE INSURANCE COMPANY, INC. (NAIC 42897) BUSINESS ADDRESS: 150 Northwest Point Blvd., Suite 300, Elk... Boulevard, Suite300, Rocky Hill, CT 06067. PHONE: (860) 258-3500. UNDERWRITING LIMITATION b/: $17,204,000... COMPANY (NAIC 12777) BUSINESS ADDRESS: 15 Mountain View Road, Warren, NJ 07059. PHONE: (212) 612-4000...

  17. 77 FR 39322 - Companies Holding Certificates of Authority as Acceptable Sureties on Federal Bonds and as...

    Science.gov (United States)

    2012-07-02

    ... INSURANCE COMPANY, INC. (NAIC 42897) BUSINESS ADDRESS: 150 Northwest Point Blvd., Suite 300, Elk Grove..., Rocky Hill, CT 06067. PHONE: (860) 258-3500. UNDERWRITING LIMITATION b/: $10,301,000. SURETY LICENSES c... (NAIC 10499) 3 CHUBB INDEMNITY INSURANCE COMPANY (NAIC 12777) BUSINESS ADDRESS: 15 Mountain View Road...

  18. Helping Patients Cope with Inflammatory Bowel Disease.

    Science.gov (United States)

    1984-01-01

    patients to do what works for them. Suggest postponing meals or eating lightly if travel is planned shortly after the planned mealtime. Peristalsis ...American Journal of Nursing,.73(2), 258-261. Latimer-, P.R. (1983). Functional Gastrointestinal Disorders: A Behavioral Medicine Approach. New York

  19. Social Skills Expression of Senior High School Age Students in Physical Education Classes

    Science.gov (United States)

    Akelaitis, Arturas V.

    2015-01-01

    The main purpose of the present study is to reveal the peculiarities of social skills expression of senior high school age students in physical education classes. The independent random sample consisted of 244 (15-16 years old) students and 258 (17-18 years old) students, of which there were 224 boys and 278 girls. L. Bulotaite and V. Gudžinskiene…

  20. Reduction of surface subsidence risk by fly ash exploitation as filling material in deep mining areas

    Czech Academy of Sciences Publication Activity Database

    Trčková, Jiřina; Šperl, Jan

    2010-01-01

    Roč. 53, č. 2 (2010), s. 251-258 ISSN 0921-030X Institutional research plan: CEZ:AV0Z30460519 Keywords : undermining * subsidence of the surface * impact reduction Subject RIV: DO - Wilderness Conservation Impact factor: 1.398, year: 2010 www.springerlink.com/content/y8257893528lp56w/

  1. Central Gi(2) proteins, sympathetic nervous system and blood pressure regulation

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef

    2016-01-01

    Roč. 216, č. 3 (2016), s. 258-259 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : inhibitory G proteins * sympathetic nervous system * central blood pressure control Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.867, year: 2016

  2. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Shahzada Asad. Articles written in Journal of Biosciences. Volume 38 Issue 2 June 2013 pp 251-258 Articles. Bioluminescent bioreporter for assessment of arsenic contamination in water samples of India · Pratima Sharma Shahzada Asad Arif Ali · More Details Abstract Fulltext PDF.

  3. A Quantitative Study of the Relationship between Distributed Leadership and Organizational Citizenship Behavior: Perceptions of Turkish Primary School Teachers

    Science.gov (United States)

    Kilinç, Ali Çagatay

    2014-01-01

    The purpose of this study was to determine the relationship between primary school teachers' perceptions on distributed leadership and organizational citizenship behaviors (OCBs). A total of 258 teachers employed in 14 primary schools located in Kastamonu, Turkey participated in this study. Data of the study was collected through "Distributed…

  4. Dicty_cDB: Contig-U04484-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F04, complete se... 37 7.4 4 ( FG300472 ) 1108793371523 New World Screwworm Larvae 9387 EST... 35 7.4 3 ( AC...258-141F23, WORKING DRAFT... 39 7.5 3 ( FG293793 ) 1108770683019 New World Screww

  5. AcEST: BP911525 [AcEST

    Lifescience Database Archive (English)

    Full Text Available delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD...RATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=1 Length = 1081 Score =...YLLRFMIDCDVVGMNWIHLPASKYQ 258 >sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD

  6. Students (female physical capacity assessment depending on physical activity.

    Directory of Open Access Journals (Sweden)

    Skyriene V.

    2011-06-01

    Full Text Available Assessment of the social sciences university students (female physical capacity assessment depending on the chosen form of physical activity. Revealed that physical activity within the subject "Physical training" allows students (female to achieve a number of indicators average or above average for the citizens of the republic level of physical fitness. In experiment took part 258 students.

  7. 78 FR 65302 - Notice of Public Meetings for the Draft Environmental Impact Statement/Overseas Environmental...

    Science.gov (United States)

    2013-10-31

    ... Impact Statement/Overseas Environmental Impact Statement (EIS/OEIS) for the Mariana Islands Training and...-See, Naval Facilities Engineering Command, Pacific. Attention: MITT EIS/OEIS, 258 Makalapa Drive... period for the Draft EIS/OEIS for the Mariana Islands Training and Testing Study Area has been extended...

  8. Chráněná krajinná území ve světle své krajinné historie : Slovenský kras - glaciální refugium na okraji Karpat

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2000-01-01

    Roč. 55, č. 7 (2000) ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Slovak Karst * protected areas * nature protection Subject RIV: DO - Wilderness Conservation http://www.casopis.ochranaprirody.cz/res/data/003/000433.pdf

  9. Alkylsulfonates as probes of uncoupling protein transport mechanism. Ion pair transport demonstrates that direct H(+) translocation by UCP1 is not necessary for uncoupling

    Czech Academy of Sciences Publication Activity Database

    Jabůrek, M.; Vařecha, M.; Ježek, Petr; Garlid, K. D.

    2001-01-01

    Roč. 276, č. 34 (2001), s. 31897-31905 ISSN 0021-9258 R&D Projects: GA AV ČR IAA5011106 Grant - others:NIH(US) DK56273 Institutional research plan: CEZ:AV0Z5011922 Keywords : mitochondrial uncoupling proteins * alkylsulfonates * ion pair transport Subject RIV: CE - Biochemistry Impact factor: 7.258, year: 2001

  10. sY116, a human Y-linked polymorphic STS

    Indian Academy of Sciences (India)

    1995 Current protocols in human genetics. Wiley, New York. Foote S., Vollrath D., Hilton A. and Page D. C. 1992 The human Y chromosome: overlapping DNA clones spanning the euchro- matic region. Science 258, 60±66. Foresta C., Ferlin A., Garolla A., Rossato M., Barbaux S. and. De B. A. 1997 Y chromosome deletions ...

  11. Nanostructured Metal Oxides for Stoichiometric Degradation of Chemical Warfare Agents

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Henych, Jiří; Janos, P.; Skoumal, M.

    2016-01-01

    Roč. 236, č. 2016 (2016), s. 239-258 ISSN 0179-5953 R&D Projects: GA ČR(CZ) GAP106/12/1116 Institutional support: RVO:61388980 Keywords : chemical warfare agent * metal nanoparticle * unique surface-chemistry * mesoporous manganese oxide Subject RIV: CA - Inorganic Chemistry Impact factor: 3.930, year: 2016

  12. Molecular Epidemiology, Sequence Types, and Plasmid Analyses of KPC-Producing Klebsiella pneumoniae Strains in Israel▿

    Science.gov (United States)

    Leavitt, Azita; Carmeli, Yehuda; Chmelnitsky, Inna; Goren, Moran G.; Ofek, Itzhak; Navon-Venezia, Shiri

    2010-01-01

    Sporadic isolates of carbapenem-resistant KPC-2-producing Klebsiella pneumoniae were isolated in Tel Aviv Medical Center during 2005 and 2006, parallel to the emergence of the KPC-3-producing K. pneumoniae sequence type 258 (ST 258). We aimed to study the molecular epidemiology of these isolates and to characterize their blaKPC-carrying plasmids and their origin. Ten isolates (8 KPC-2 and 2 KPC-3 producing) were studied. All isolates were extremely drug resistant. They possessed the blaKPC gene and varied in their additional beta-lactamase contents. The KPC-2-producing strains belonged to three different sequence types: ST 340 (n = 2), ST 277 (n = 2), and a novel sequence type, ST 376 (n = 4). Among KPC-3-producing strains, a single isolate (ST 327) different from ST 258 was identified, but both strains carried the same plasmid (pKpQIL). The KPC-2-encoding plasmids varied in size (45 to 95 kb) and differed among each of the STs. Two of the Klebsiella blaKPC-2-carrying plasmids were identical to plasmids from Escherichia coli, suggesting a common origin of these plasmids. These data indicate that KPC evolution in K. pneumoniae is related to rare events of interspecies spread of blaKPC-2-carrying plasmids from E. coli followed by limited clonal spread, whereas KPC-3 carriage in this species is related almost strictly to clonal expansion of ST 258 carrying pKpQIL. PMID:20350950

  13. Molecular epidemiology, sequence types, and plasmid analyses of KPC-producing Klebsiella pneumoniae strains in Israel.

    Science.gov (United States)

    Leavitt, Azita; Carmeli, Yehuda; Chmelnitsky, Inna; Goren, Moran G; Ofek, Itzhak; Navon-Venezia, Shiri

    2010-07-01

    Sporadic isolates of carbapenem-resistant KPC-2-producing Klebsiella pneumoniae were isolated in Tel Aviv Medical Center during 2005 and 2006, parallel to the emergence of the KPC-3-producing K. pneumoniae sequence type 258 (ST 258). We aimed to study the molecular epidemiology of these isolates and to characterize their bla(KPC)-carrying plasmids and their origin. Ten isolates (8 KPC-2 and 2 KPC-3 producing) were studied. All isolates were extremely drug resistant. They possessed the bla(KPC) gene and varied in their additional beta-lactamase contents. The KPC-2-producing strains belonged to three different sequence types: ST 340 (n = 2), ST 277 (n = 2), and a novel sequence type, ST 376 (n = 4). Among KPC-3-producing strains, a single isolate (ST 327) different from ST 258 was identified, but both strains carried the same plasmid (pKpQIL). The KPC-2-encoding plasmids varied in size (45 to 95 kb) and differed among each of the STs. Two of the Klebsiella bla(KPC-2)-carrying plasmids were identical to plasmids from Escherichia coli, suggesting a common origin of these plasmids. These data indicate that KPC evolution in K. pneumoniae is related to rare events of interspecies spread of bla(KPC-2)-carrying plasmids from E. coli followed by limited clonal spread, whereas KPC-3 carriage in this species is related almost strictly to clonal expansion of ST 258 carrying pKpQIL.

  14. Molecular analysis of retinal fascin gene 2 (FSCN2), a candidate gene for progressive rod-cone degeneration in dogs

    Czech Academy of Sciences Publication Activity Database

    Horák, Pavel; Knoll, Aleš

    2006-01-01

    Roč. 9, Mimoriadne číslo (2006), s. 62-64 ISSN 1335-258X. [XXII. dni genetiky. 12.09.2006-14.09.2006, Nitra] Institutional research plan: CEZ:AV0Z50450515 Keywords : pig * polymorphism * LEPR and H-FABP genes Subject RIV: EB - Genetics ; Molecular Biology

  15. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Elementary? Question Answering, IBM's Watson, and the Jeopardy! Challenge · Raman Chandrasekar · More Details Fulltext PDF. pp 242-258 General Article. Cloud Computing · V Rajaraman · More Details Fulltext PDF. pp 259-282 General Article. Drug Metabolism: A Fascinating Link Between Chemistry and Biology.

  16. Patel, Prof. Bhisma Kumar

    Indian Academy of Sciences (India)

    Elected: 2018 Section: Chemistry. Patel, Prof. Bhisma Kumar Ph.D. (IIT, Kanpur), FNASc. Date of birth: 6 August 1965. Specialization: Organic Synthesis, Reaction Mechanisms, Green Chemistry Address: Department of Chemistry, Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 258 2307

  17. Water SA - Vol 44, No 2 (2018)

    African Journals Online (AJOL)

    Potential of dyes as draw solutions in forward osmosis for the South African textile industry. Marshall Sheldon, Estella Zandile Jingxi, Debbie De Jager, Robyn Augustine, Jasmina Korenak, C Helix-Nielsen, Irena Petrinic, 258-268. Driving factors of temporary and permanent shallow lakes in and around Hwange National ...

  18. Expression of the Bacillus thuringiensis toxin from maize does not affect epigeic communities of carabid beetles and spiders

    Czech Academy of Sciences Publication Activity Database

    Spitzer, L.; Růžička, Vlastimil; Hussein, Hany; Habuštová, Oxana; Sehnal, František

    2004-01-01

    Roč. 7, č. 4 (2004), s. 110-112 ISSN 1335-258X R&D Projects: GA AV ČR KJB6007304 Institutional research plan: CEZ:AV0Z5007907 Keywords : GMO * Bt maize * agroecosystems Subject RIV: EH - Ecology, Behaviour

  19. Insect communities on maize expressing a Bt-toxin

    Czech Academy of Sciences Publication Activity Database

    Habuštová, Oxana; Sehnal, František; Hussein, Hany

    2005-01-01

    Roč. 1, - (2005), s. 9-11 ISSN 1335-258X R&D Projects: GA AV ČR(CZ) KJB6007304 Institutional research plan: CEZ:AV0Z50070508 Keywords : GMO * arthropod communities * Bt maize Subject RIV: EH - Ecology, Behaviour

  20. DMPD: Modulation of Toll-interleukin 1 receptor mediated signaling. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 15662540 Modulation of Toll-interleukin 1 receptor mediated signaling. Li X, Qin J.... J Mol Med. 2005 Apr;83(4):258-66. Epub 2005 Jan 21. (.png) (.svg) (.html) (.csml) Show Modulation of Toll-i...nterleukin 1 receptor mediated signaling. PubmedID 15662540 Title Modulation of Toll-interleukin 1 receptor

  1. The remarkable discreteness of being

    Indian Academy of Sciences (India)

    2014-03-15

    Mar 15, 2014 ... ... examples where these facts play, or could play, important roles: the spatial distribution of species, the structuring of biodiversity and the. (Darwinian) evolution of altruistic behaviour. [Houchmandzadeh B 2014 The remarkable discreteness of being. J. Biosci. 39 249–258] DOI 10.1007/s12038-013-9350-7.

  2. Psychiatric morbidity among physically ill patients in a Ugandan ...

    African Journals Online (AJOL)

    EB

    disorders. Hence, as suggested by Clarke and colleagues (1989) 9, patients should not be assessed for mental disorders after ruling out a physical illness .... ns. Table 3: Frequency of the psychiatric disorders. Psychiatric disorder. Prevalence in study sample (N =258). Major depression. 33.7% (87). Anxiety disorder.

  3. Cognitive behavioral therapy for treatment of primary care patients ...

    African Journals Online (AJOL)

    2014-03-31

    Mar 31, 2014 ... from such a condition. Mental illness accounts for 11% of the burden of disease in EMRO countries (4). In a study conducted in Lebanon, it was shown that the lifetime pre- valence of mental health disorders reaches up to 25.8% of the population. The most commonly diagnosed disorders were anxiety ...

  4. Trajectories of Physical Discipline: Early Childhood Antecedents and Developmental Outcomes

    Science.gov (United States)

    Lansford, Jennifer E.; Criss, Michael M.; Dodge, Kenneth A.; Shaw, Daniel S.; Pettit, Gregory S.; Bates, John E.

    2009-01-01

    This study examined childhood antecedents and developmental outcomes associated with trajectories of mild and harsh parental physical discipline. Interview, questionnaire, and observational data were available from 499 children followed from ages 5 to 16 and from 258 children in an independent sample followed from ages 5 to 15. Analyses indicated…

  5. Středoevropské bezlesí v čase a prostoru. V. Otázka přirozeného bezlesí v českých zemích a na Slovensku

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2004-01-01

    Roč. 59, č. 6 (2004), s. 169-175 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000467.pdf

  6. Středoevropské bezlesí v čase a prostoru. III. Historie lesa a bezlesí v kvartéru

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2004-01-01

    Roč. 59, č. 3 (2004), s. 71-78 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000464.pdf

  7. Středoevropské bezlesí v čase a prostoru. VI. Osudy bezlesí v dnešní době

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2004-01-01

    Roč. 59, č. 7 (2004), s. 202-207 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000468.pdf

  8. Středoevropské bezlesí v čase a prostoru. I. Vstupní úvaha

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2004-01-01

    Roč. 59, č. 1 (2004), s. 4-9 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000462.pdf

  9. Středoevropské bezlesí v čase a prostoru. II. Doklady z minulosti a jejich výpověď

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2004-01-01

    Roč. 59, č. 2 (2004), s. 38-43 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000463.pdf

  10. Středoevropské bezlesí v čase a prostoru. IV. Vývoj v poledové době

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2004-01-01

    Roč. 59, č. 4 (2004), s. 99-106 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Woodland * Open Country * Human Impact Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000465.pdf

  11. Rural Homelessness in Northwest Ohio: Reasons, Patterns, Statistics, and Trends.

    Science.gov (United States)

    Podlin, Georgette A.

    Rural homelessness in America is difficult to define, to count, and to see. This article reports the findings of a 1993 county-wide study of rural homelessness. During a one year survey, 118 homeless households were interviewed. Of those surveyed, 25.8 percent were male adults, 30.9 percent were female adults, and 43.2 percent were children.…

  12. Study of the influencing effect of pigments on the photoageing of terpenoid resins used as pictorial media

    Czech Academy of Sciences Publication Activity Database

    Doménech-Carbó, M.T.; Kučková, Štěpánka; de la Cruz-Canizares, J.; Osete-Cortina, L.

    2006-01-01

    Roč. 1121, č. 2 (2006), s. 248-258 ISSN 0021-9673 Institutional research plan: CEZ:AV0Z40320502 Keywords : GC-MS * FTIR * terpenoid resin * colophony * Mexican copal Subject RIV: CA - Inorganic Chemistry Impact factor: 3.554, year: 2006

  13. Investigation of medical board reports of disability due to mental health problems

    Directory of Open Access Journals (Sweden)

    Mesut Yildiz

    2016-06-01

    Conclusion: We think that this report might be helpful for regulations related to disabled people, and might guide adult psychiatric services for patients who present to medical boards for disability due to mental health problems. [Cukurova Med J 2016; 41(2.000: 253-258

  14. Hot or Not: An Analysis of Online Professor-Shopping Behavior of Business Students

    Science.gov (United States)

    Hossain, Tarique M.

    2010-01-01

    With the proliferation of Web sites that allow students to praise or disparage their instructors depending on their whims, instructors across the country essentially are becoming subjects of comparison shopping by prospective students. Using a sample survey of 258 students majoring in business at a public university on the west coast of the United…

  15. Purification and characterisation of Cyclodextrin glycosyltransferase ...

    African Journals Online (AJOL)

    EXPER

    2012-06-05

    Jun 5, 2012 ... affinity chromatography were 25.8 and 17.8%, respectively. ... industrial applications according to its characteristic found in the current study. ..... and single step purification of cyclodextrin glycosyltransferase from alkalophilic Bacillus firmus by ion extchange chromatography. Biochem. Eng. J., 39: 510-515.

  16. Development of ICP-MS and ICP-OES methods for determination of gadolinium in samples related to hospital waste water treatment

    Czech Academy of Sciences Publication Activity Database

    Bendakovská, L.; Krejčovská, A.; Černohorský, T.; Zelenková, Jana

    2016-01-01

    Roč. 70, č. 9 (2016), s. 1155-1165 ISSN 0366-6352 Institutional support: RVO:67985874 Keywords : gadolinium * rare-earth elements * bioaccumulation * gadolinium anomaly * inductively coupled plasma mass spectrometry ( ICP -MS) * inductively coupled plasma optical emission spectrometry ( ICP - OES ) Subject RIV: BK - Fluid Dynamics Impact factor: 1.258, year: 2016

  17. Repetitive Inductions of Bioluminescence of Pseudomonas putida TVA8 Immobilized by Adsorption on Optical Fibre.

    Czech Academy of Sciences Publication Activity Database

    Zajíc, J.; Bittner, M.; Brányik, T.; Solovyev, Andrey; Šabata, Stanislav; Kuncová, Gabriela; Pospíšilová, M.

    2016-01-01

    Roč. 70, č. 7 (2016), s. 877-887 ISSN 0366-6352 Institutional support: RVO:67985858 Keywords : whole-cell biosensor * bioluminiscent bioreporter * optical fibre sensor Subject RIV: CC - Organic Chemistry Impact factor: 1.258, year: 2016

  18. The seasonal distribution of airborne fungi in two hospitals in Istanbul

    African Journals Online (AJOL)

    Among the 257 micro fungi isolated from this hospital, the most common species were Alternaria alternata (25.8%), Cladosporium cladosporioides (21.9%), Penicillium glabrum (12.9%), Penicillium brevicompactum (7.4%) and Cladosporium herbarum (3.9%). In KYSH, the highest number of fungi was isolated in summer ...

  19. Conducting polymer hydrogels

    Czech Academy of Sciences Publication Activity Database

    Stejskal, Jaroslav

    2017-01-01

    Roč. 71, č. 2 (2017), s. 269-291 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : aerogel * conducting polymers * conductivity Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016

  20. Magnitude and gender distribution of obesity and abdominal ...

    African Journals Online (AJOL)

    Background: Obesity and abdominal adiposity are associated with increased cardiovascular morbidity in diabetes. This study evaluated their magnitude and gender distribution in Nigerians with Type 2 DM attending a tertiary care clinic. Patients and Methods: 258 consecutive patients with type 2 DM were evaluated.

  1. Children's Adjustment Problems in Families Characterized by Men's Severe Violence toward Women: Does Other Family Violence Matter?

    Science.gov (United States)

    McDonald, Renee; Jouriles, Ernest N.; Tart, Candyce D.; Minze, Laura C.

    2009-01-01

    Objective: This research examined whether additional forms of family violence (partner-child aggression, mother-child aggression, and women's intimate partner violence [IPV]) contribute to children's adjustment problems in families characterized by men's severe violence toward women. Methods: Participants were 258 children and their mothers…

  2. Teachers' Perception of Inclusion of NIV/AIDS in the School ...

    African Journals Online (AJOL)

    Teachers are potential instrument in driving home any curriculum document designed for the maximum benefit of the learners and their perception on every thing relating to education matters a lot. The population for the study was 5550 teachers teaching in 258 public secondary schools in Enugu State. The sample for the ...

  3. A model of the guinea-pig ventricular cardiac myocyte incorporating a transverse–axial tubular system

    Czech Academy of Sciences Publication Activity Database

    Pásek, Michal; Šimurda, J.; Orchard, C.; Christé, G.

    2008-01-01

    Roč. 96, 1-3 (2008), s. 258-280 ISSN 0079-6107 Institutional research plan: CEZ:AV0Z20760514 Keywords : guinea pig * cardiac cell * transverse-axial tubular system * quantitative model Subject RIV: BO - Biophysics Impact factor: 6.388, year: 2008

  4. Bory v reliktním ekosystému nížinné tajgy na Dokesku - využití, péče a ochrana

    Czech Academy of Sciences Publication Activity Database

    Sádlo, Jiří; Petřík, Petr; Boublík, K.

    2012-01-01

    Roč. 67, č. 2 (2012), s. 8-11 ISSN 1210-258X R&D Projects: GA AV ČR IAAX00050801 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : pine forest * forestry * conservation Subject RIV: EF - Botanics

  5. Obstructive sleep apnoea among older patients attending the ...

    African Journals Online (AJOL)

    Aim: To determine the risk of obstructive sleep apnoea and sleep difficulties among older patients attending the geriatric clinic at the University College Hospital ... 95% CI=4.975-32.258) to be the most significant factors in the males, while obesity (OR=11.364; 95% CI=6.711-19.231) alone was the most significant factor to ...

  6. 78 FR 13222 - Procedures for the Handling of Retaliation Complaints Under Section 1558 of the Affordable Care Act

    Science.gov (United States)

    2013-02-27

    ... of when the alleged violation occurs. Under Delaware State College v. Ricks, 449 U.S. 250, 258 (1980... complaint, i.e., that the protected activity, alone or in combination with other factors, affected in some... protected activity. A contributing factor is ``any factor which, alone or in connection with other factors...

  7. Rural Women\\'s Response To Selected Crop Production ...

    African Journals Online (AJOL)

    The study centered on rural women's response to selected crop production technologies in Imo State with a view to making policy recommendations. Structured questionnaire and interview schedule were administered through the assistance of extension agents to 258 randomly sampled rural women farmers from the three ...

  8. The detection, rate and manifestation of residual sexuality in apomictic populations of Pilosella (Asteraceae, Lactuceae)

    Czech Academy of Sciences Publication Activity Database

    Krahulcová, Anna; Rotreklová, O.; Krahulec, František

    2014-01-01

    Roč. 49, č. 2 (2014), s. 239-258 ISSN 1211-9520 R&D Projects: GA ČR GAP506/10/1363 Institutional support: RVO:67985939 Keywords : facultative apomixis * haploid parthenogenesis * interspecific hybridization * Pilosella * residual sexuality Subject RIV: EF - Botanics Impact factor: 1.778, year: 2014

  9. 2008 AESON JOURNAL

    African Journals Online (AJOL)

    OLUWOLE AKINNAGBE

    2.58. Monitoring and evaluation system. 2.84. Interpretation of collective bargaining contract or personnel policy. 2.11. Channels for adjustment or redressal of grievances. 2.18. Lines of organizational communication. 3.10. Methods of human relationships. 3.42. Performance feedback. 2.97. Patterns of role clarification. 3.11.

  10. Problémy s volebními průzkumy

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich

    2005-01-01

    Roč. 12, č. 3 (2005), s. 239-258 ISSN 1211-3247 Institutional research plan: CEZ:AV0Z70280505 Keywords : election studies * public opinion polls * polls and democracy Subject RIV: AO - Sociology, Demography http:// www.iips.cz

  11. Khat Chewing and Mental Distress: A Community Based Study, in ...

    African Journals Online (AJOL)

    BACKGROUND: Khat (Catha edulis) contains a psychoactive substance, cathinone, which produces central nervous system stimulation analogous to amphetamine. It is believed that ... Using cut-off point 7 out of 20 on the Self Reporting Questionnaire-20, 25.8% of the study population was found to have mental distress.

  12. ESLP, přístup k neregistrovaným léčivům a soucit: na okraj rozsudku Christozov a další v. Bulharsko

    Czech Academy of Sciences Publication Activity Database

    Malíř, Jan

    2014-01-01

    Roč. 22, č. 7 (2014), s. 258-262 ISSN 1210-6410 R&D Projects: GA ČR GAP408/12/2564 Institutional support: RVO:68378122 Keywords : private life * treatment * medicinal products Subject RIV: AG - Legal Sciences

  13. La edad de la empatía. Lecciones de la naturaleza para una sociedad más justa y solidaria, por Fran de Waal

    Directory of Open Access Journals (Sweden)

    Cecilia Milito Barone

    2015-07-01

    Full Text Available Rsseña del libro Fran de Waal, La edad de la empatía. Lecciones de la naturaleza para una sociedad más justa y solidaria (Barcelona: Tusquets Editores, 2011, 258 pp. ISBN: 978-84-8383-350-6

  14. Asymptotic stability of thermoelastic systems of Bresse type

    Czech Academy of Sciences Publication Activity Database

    Dell'Oro, Filippo

    2015-01-01

    Roč. 258, č. 11 (2015), s. 3902-3927 ISSN 0022-0396 Institutional support: RVO:67985840 Keywords : Bresse system * Gurtin-Pipkin law * contraction semigroup Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022039615000376

  15. Erratum

    African Journals Online (AJOL)

    EB

    Transition protein 1 (during histone to protamine replacement). 7186. Hs.522506. Histone deacetylase 5. 10014. Hs.438782. In 1998, Zhu et al18. firstly used DNA array technology to global monitor the levels of about. 6600 human mRNAs in HCMV-infected cells as compared with uninfected ones. The level of 258. mRNAs ...

  16. High Surface Area MoO3/MgO: Preparation by Reaction of MoO3 and MgO in Methanol or Ethanol Slurry and Activity in Hydrodesulphurization of Benzothiophene

    Czech Academy of Sciences Publication Activity Database

    Klicpera, Tomáš; Zdražil, Miroslav

    2001-01-01

    Roč. 216, 1-2 (2001), s. 41-50 ISSN 0926-860X R&D Projects: GA AV ČR IAA4072802 Institutional research plan: CEZ:AV0Z4072921 Keywords : magnesia support * molybdena catalyst s * slurry impregnation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.258, year: 2001

  17. AMOUNT TO EXPROPRIATION? AN ANALYSIS OF THE Agri SA

    African Journals Online (AJOL)

    Examiner

    MEC for Public Transport, Roads and Works, Gauteng Provincial Government 2009 6 SA 391 (CC);. Harksen v Lane 1998 1 SA 300 (CC) and compare Tongaat Group Ltd v Minister of Agriculture. 1977 2 SA 961 (A) 972; Pretoria City Council v Modimola 1966 3 SA 250 (A) 258; Wallis v. Johannesburg City Council 1981 3 ...

  18. Seznam prioritních invazních druhů pro ČR

    Czech Academy of Sciences Publication Activity Database

    Pergl, Jan; Sádlo, Jiří; Petrusek, A.; Pyšek, Petr

    2016-01-01

    Roč. 71, č. 2 (2016), s. 29-33 ISSN 1210-258X Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : invasion * plants * animals Subject RIV: EH - Ecology, Behaviour

  19. Anaesthetic and Obstetric challenges of morbid obesity in ...

    African Journals Online (AJOL)

    Other findings included macrosomia (7 or 25.8%), gestational diabetes (13%) and pregnancy induced hypertension (7 or 22.5%).There were two neonatal deaths but no maternal deaths. Conclusion: The prevalence rate of morbid obesity is about 10% in Nigerian women of child bearing age. This mirrors a World Health ...

  20. Myocardial resistance to ischemic and reperfusion injuries under conditions of chronic administration of opioid receptor agonists and antagonists

    Czech Academy of Sciences Publication Activity Database

    Lishmanov, Yu. B.; Stakheev, D. L.; Krylatov, A. V.; Naryzhnaya, N. V.; Maslov, L. N.; Ovchinnikov, M. V.; Kolář, František

    2008-01-01

    Roč. 145, č. 6 (2008), s. 696-699 ISSN 0007-4888 R&D Projects: GA ČR(CZ) GA305/07/0875 Institutional research plan: CEZ:AV0Z50110509 Keywords : arrhythmias * infarction * opioids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 0.258, year: 2008

  1. Role of ATP-sensitive K+-channels in antiarrhythmic and cardioprotective action of adaptation to intermittent hypobaric hypoxia

    Czech Academy of Sciences Publication Activity Database

    Kolář, František; Neckář, Jan; Ošťádal, Bohuslav; Maslov, L. N.; Stakheev, D. L.; Tayurskaya, A. S.; Lishmanov, Yu. B.

    2008-01-01

    Roč. 145, č. 4 (2008), s. 418-421 ISSN 0007-4888 R&D Projects: GA ČR(CZ) GA305/07/0875 Institutional research plan: CEZ:AV0Z50110509 Keywords : arrhythmias * myocardial infarction * K(ATP) channels Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 0.258, year: 2008

  2. Distinct carbohydrate recognition domains of an invertebrate defense molecule recognize gram-negative and gram-positive bacteria

    Czech Academy of Sciences Publication Activity Database

    Bilej, Martin; De Baetselier, P.; Van Dijck, E.; Stijlemans, B.; Colige, A.; Beschin, A.

    2001-01-01

    Roč. 276, č. 49 (2001), s. 45840-45847 ISSN 0021-9258 R&D Projects: GA ČR GA310/99/1385; GA ČR GA310/00/1372 Institutional research plan: CEZ:AV0Z5020903 Keywords : lipopolysaccharide * coelomic cytolytic factor * prophenoloxidase Subject RIV: EC - Immunology Impact factor: 7.258, year: 2001

  3. Geographical Difference of the Interaction of Sex With Treatment Strategy in Patients With Multivessel Disease and Left Main Disease: A Meta-Analysis From SYNTAX (Synergy Between PCI With Taxus and Cardiac Surgery), PRECOMBAT (Bypass Surgery Versus Angioplasty Using Sirolimus-Eluting Stent in Patients With Left Main Coronary Artery Disease), and BEST (Bypass Surgery and Everolimus-Eluting Stent Implantation in the Treatment of Patients With Multivessel Coronary Artery Disease) Randomized Controlled Trials

    NARCIS (Netherlands)

    Sotomi, Yohei; Onuma, Yoshinobu; Cavalcante, Rafael; Ahn, Jung-Min; Lee, Cheol Whan; van Klaveren, David; de Winter, Robbert J.; Wykrzykowska, Joanna J.; Farooq, Vasim; Morice, Marie-Claude; Steyerberg, Ewout W.; Park, Seung-Jung; Serruys, Patrick W.

    2017-01-01

    The impact of sex on clinical outcomes of percutaneous coronary intervention and coronary artery bypass graft for patients with multivessel coronary disease and unprotected left main disease could be dissimilar between Western and Asian populations. 2=58%). The present meta-analysis suggested the

  4. Keeping Special Forces Special: Regional Proficiency in Special Forces

    Science.gov (United States)

    2011-12-01

    communicating and teaching across intercultural barriers. Special Forces Soldiers use their interpersonal skills to obtain and maintain appropriate...or in a simulated environment with native speakers .”258 Immersion programs were “overwhelmingly described as effective and useful” by the LCNA...target language increases intercultural adjustment.”263

  5. Neural model of the genetic network

    Czech Academy of Sciences Publication Activity Database

    Vohradský, Jiří

    2001-01-01

    Roč. 276, č. 39 (2001), s. 36168-36173 ISSN 0021-9258 R&D Projects: GA ČR GA204/00/1253 Institutional research plan: CEZ:AV0Z5020903 Keywords : bacteriophage * neural network Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.258, year: 2001

  6. An Examination of Family Physicians Plan Implementation in Rural ...

    African Journals Online (AJOL)

    Razieh Mirzaeian

    the strengths and weaknesses of the Family Physician Plan in the Iranian villages based on the perspectives of the family physicians, managers, employees and clients in the health system in. 2014. Subjects and ...... 19.4. Lack of proper link between the physician and the middle and assistant personnel. 41.9. 25.8. 21. 11.3 ...

  7. Book Review Severe Emotional Disturbance in Children and ...

    African Journals Online (AJOL)

    2004, Brunner-Routledge, Taylor and Francis Group, New York, NY, USA 258 pages, 10 colour plates (8 pages) Paperback ISBN 1-58391-212-6, R324.73. Hardback ISBN 1-58391-211-8, R940 Journal of Child and Adolescent Mental Health 2006, 18(2): 83–84 ...

  8. HTS Teologiese Studies / Theological Studies

    African Journals Online (AJOL)

    ... women in modern South Africa, as many women do not own productive land and are poor. Thirdly, this article poses the question: What implications do the ideologies of Ernesto 'Che' Guevara and the hermeneutical approach of Fernando F. Segovia to ancient texts bear on the reading of Ruth 4 and Leviticus 25:8–55 in ...

  9. Assessing the Desired and Actual Levels of Teachers' Participation in Decision-Making in Secondary Schools of Ethiopia

    Science.gov (United States)

    Bademo, Yismaw; Tefera, Bekalu Ferede

    2016-01-01

    This study was conducted to assess the desired and actual levels of teachers' participation in decision-making process in Ethiopian secondary schools. For this, the study employed a cross-sectional survey design collecting data from sampled secondary school teachers (n = 258) found in Assosa Zone, Benishangual Gumuz Regional state, Ethiopia.…

  10. Simple automated liquid chromatographic system for splitless nano column gradient separations

    Czech Academy of Sciences Publication Activity Database

    Šesták, Jozef; Duša, Filip; Moravcová, Dana; Kahle, Vladislav

    2013-01-01

    Roč. 1276, FEB (2013), s. 26-32 ISSN 0021-9673 R&D Projects: GA MV VG20112015021; GA MV VG20102015023 Institutional support: RVO:68081715 Keywords : liquid chromatography * automation * splitless gradient * nano columns * alkylphenones Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.258, year: 2013

  11. Srstnatka huňatá (Trichia villosula)

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2001-01-01

    Roč. 56, č. 4 (2001), s. 112-113 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : molluscs * snails * Trichia villosula Subject RIV: EG - Zoology http://www.casopis.ochranaprirody.cz/res/data/003/000440.pdf

  12. Ochlupka rezavá (Pseudotrichia rubiginosa)

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2001-01-01

    Roč. 56, č. 1 (2001), s. 16-17 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : molluscs * Pseudotrichia rubiginosa * malacology Subject RIV: EG - Zoology http://www.casopis.ochranaprirody.cz/res/data/003/000437.pdf

  13. First description of the gravid female of Philometra rubra (Leidy, 1856) (Nematoda: Philometridae), a parasite of the abdominal cavity of temperate basses Morone Spp. (Moronidae: Perciformes) in North America

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; de Buron, I.; Measures, L.

    2013-01-01

    Roč. 99, č. 3 (2013), s. 496-500 ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * North America Subject RIV: EA - Cell Biology Impact factor: 1.258, year: 2013

  14. Investigating Burnout among Elementary and Secondary School Music Educators: A Replication

    Science.gov (United States)

    Bernhard, H. Christian II

    2016-01-01

    The primary purpose of the study was to compare perceived levels of burnout among music educators by grade level taught, state teaching certification status, and music specialization. The secondary purpose was to examine relationships among perceived burnout, and academic as well as personal variables. Participants for the study were 258

  15. Diversity of cyanobacteria on rock surfaces

    Czech Academy of Sciences Publication Activity Database

    Hauer, Tomáš; Mühlsteinová, Radka; Bohunická, Markéta; Kaštovský, J.; Mareš, Jan

    2015-01-01

    Roč. 24, č. 4 (2015), s. 759-779 ISSN 0960-3115 R&D Projects: GA ČR GA15-11912S Institutional support: RVO:67985939 Keywords : cyanobacteria * diversity * rock surfaces Subject RIV: EH - Ecology, Behaviour Impact factor: 2.258, year: 2015

  16. The instrumental resolution of a moire extensometer in light of its recent automatisation

    Czech Academy of Sciences Publication Activity Database

    Rowberry, Matthew David; Kriegner, D.; Holý, V.; Frontera, C.; Llull, M.; Olejník, Kamil; Martí, Xavier

    2016-01-01

    Roč. 91, SEP (2016), s. 258-265 ISSN 0263-2241 R&D Projects: GA MŠk LM2010008 Institutional support: RVO:67985891 ; RVO:68378271 Keywords : geological discontinuity monitoring * mechanical extensometer * moire patterns * instrumental resolution Subject RIV: JB - Sensors, Measurment, Regulation; BM - Solid Matter Physics ; Magnetism (FZU-D) Impact factor: 2.359, year: 2016

  17. The introns in FLOWERING LOCUS T-LIKE (FTL) genes are useful markers for tracking paternity in tetraploid Chenopodium quinoa Willd

    Czech Academy of Sciences Publication Activity Database

    Štorchová, Helena; Drabešová, Jana; Cháb, David; Kolář, Jan; Jellen, E.N.

    2015-01-01

    Roč. 62, č. 6 (2015), s. 913-925 ISSN 0925-9864 R&D Projects: GA ČR(CZ) GAP506/12/1359 Institutional support: RVO:61389030 Keywords : Ancestry * Chenopodium quinoa * FLOWERING LOCUS T-LIKE (FTL) genes Subject RIV: EF - Botanics Impact factor: 1.258, year: 2015

  18. Teaching about Implicit Prejudices and Stereotypes: A Pedagogical Demonstration

    Science.gov (United States)

    Adams, Virgil H., III; Devos, Thierry; Rivera, Luis M.; Smith, Heather; Vega, Luis A.

    2014-01-01

    Social psychology instructors from five distinct state universities in California examined the effect of incorporating the implicit association test (IAT) in a teaching module on students' perceived knowledge of implicit biases and motivation to control prejudice. Students (N = 258) completed a knowledge survey on prejudice, stereotypes, and…

  19. Bílé Karpaty - kraj květnatých luk, bučin a vápenitých pramenišť

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2002-01-01

    Roč. 57, č. 10 (2002), s. 306-312 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : landscape * Carpatians * natural history Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000505.pdf

  20. The Effects of Psychopathology on the Pain Expression of Children and Youth with Intellectual and Developmental Disabilities

    Science.gov (United States)

    Breau, Lynn M.; Camfield, Carol S.

    2011-01-01

    Behavioral pain assessment is possible for children and youth with intellectual and developmental disabilities (IDD). However, pain behavior is often misinterpreted as reflecting psychopathology. We examined whether psychopathology alters pain behavior. Caregivers of 123 children (56 girls ages 40 to 258 months) completed the Non-Communicating…