WorldWideScience

Sample records for mendelevium 249

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  4. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  6. 46 CFR 169.249 - Pressure vessels.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Pressure vessels. 169.249 Section 169.249 Shipping COAST... and Certification Inspections § 169.249 Pressure vessels. Pressure vessels must meet the requirements of part 54 of this chapter. The inspection procedures for pressure vessels are contained in subpart...

  7. 7 CFR 249.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 249.3 Section 249.3 Agriculture... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.3 Administration. (a) Delegation to FNS. Within FNS, FNS shall act on behalf of the Department in the administration of...

  8. 47 CFR 24.249 - Payment issues.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Payment issues. 24.249 Section 24.249 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PERSONAL COMMUNICATIONS... issues. (a) Timing. On the day that a PCS entity files its prior coordination notice (PCN) in accordance...

  9. 7 CFR 249.12 - SFMNP costs.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false SFMNP costs. 249.12 Section 249.12 Agriculture....12 SFMNP costs. (a) General. (1) Composition of allowable costs. In general, a cost item will be... administration and operation of the SFMNP. Allowable SFMNP costs may be classified as follows: (i) Food costs and...

  10. 7 CFR 249.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 249.9 Section 249.9 Agriculture... Nutrition education. (a) Goal. Nutrition education shall emphasize the relationship of proper nutrition to... agency shall integrate nutrition education into SFMNP operations and may satisfy nutrition education...

  11. 7 CFR 249.25 - Other provisions.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions § 249...) Statistical information. FNS reserves the right to use information obtained under the SFMNP in a summary...

  12. 32 CFR 249.6 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... PRESENTATION OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.6 Responsibilities. (a) The Under... scientific and engineering societies and professional associations. (c) The Under Secretary of Defense for...

  13. 7 CFR 249.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Participant Eligibility § 249.7 Nondiscrimination. (a) Civil rights requirements. (1) The State agency must comply with the... discrimination, under the SFMNP: (i) Title VI of the Civil Rights Act of 1964; (ii) Title IX of the Education...

  14. 32 CFR 249.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.1 Purpose. This part amplifies... scientific and technical papers; provides guidance for reviewing and presenting papers containing export... scientific and technical papers; and provides criteria for identifying fundamental research activities...

  15. 32 CFR 249.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.4 Policy. It is DoD policy to: (a) Encourage the presentation of scientific and technical information generated by or for the Department of... DoD employee and contractor papers intended for presentation at scientific and technical conferences...

  16. 7 CFR 249.13 - Program income.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions § 249.13 Program income. Program income means gross income the State agency earns from grant supported... property. The State agency must retain Program income earned during the agreement period and use it for...

  17. 7 CFR 249.15 - Closeout procedures.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions § 249.15 Closeout procedures. (a) General. State agencies must submit to FNS a final closeout report for... procedures. When grants to State agencies are terminated, the following procedures shall be followed in...

  18. 7 CFR 249.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 249.11 Section 249.11... § 249.11 Financial management system. (a) Disclosure of expenditures. The State agency must maintain a financial management system that provides accurate, current and complete disclosure of the financial status...

  19. 46 CFR 249.10 - Non-discrimination policy.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Non-discrimination policy. 249.10 Section 249.10... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.10 Non-discrimination policy. To administer effectively the policy regarding non-discrimination against U.S. insurers in other countries, as...

  20. 7 CFR 58.249 - Instant nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Instant nonfat dry milk. 58.249 Section 58.249... Products Bearing Usda Official Identification § 58.249 Instant nonfat dry milk. (a) Only instant nonfat dry milk manufactured and packaged in accordance with the requirements of this part and with the applicable...

  1. 7 CFR 249.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 249.1 Section 249.1... AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.1 General purpose and scope. (a) This part announces regulations under which the Secretary of Agriculture shall...

  2. 17 CFR 249.0-1 - Availability of forms.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 249.0-1 Section 249.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS, SECURITIES EXCHANGE ACT OF 1934 § 249.0-1 Availability of forms. (a) This part identifies and describes the...

  3. 28 CFR 2.49 - Place of revocation hearing.

    Science.gov (United States)

    2010-07-01

    ... PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.49 Place... conditions are met: (1) The parolee has not been convicted of a crime committed while under supervision; and...

  4. 7 CFR 249.5 - Selection of new State agencies.

    Science.gov (United States)

    2010-01-01

    ... criteria to rank and approve State plans submitted in accordance with § 249.4. In making this ranking, FNS... estimated to be served, and the projected benefit level. Approval of a State Plan does not equate to an...

  5. 48 CFR 249.110 - Settlement negotiation memorandum.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation... Settlement negotiation memorandum. Follow the procedures at PGI 249.110 for preparation of a settlement negotiation memorandum. ...

  6. Maternal and perinatal mortality figures in 249 South African ...

    African Journals Online (AJOL)

    the PMR for the black population is considerably hi9her than for the other ethnic groups. That said, perinatal mortality levels in South African blacks still compare favourably with figures from other African cQuntries.12. In conclusion, the MMRs and PMRs found in our survey of. 249 South African hospitals - though not truly.

  7. 40 CFR 180.249 - Alachlor; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Alachlor; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.249 Alachlor; tolerances for residues. (a) General. Tolerances are established for combined residues of...

  8. 17 CFR 249.331 - Form N-CSR, certified shareholder report.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified shareholder report. 249.331 Section 249.331 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Required Under Sections 13 and 15(d) of the Securities Exchange Act of 1934 § 249.331 Form N-CSR, certified...

  9. 48 CFR 52.249-7 - Termination (Fixed-Price Architect-Engineer).

    Science.gov (United States)

    2010-10-01

    ... Architect-Engineer). 52.249-7 Section 52.249-7 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.249-7 Termination (Fixed-Price Architect-Engineer). As prescribed in 49.503(b), insert the following clause in solicitations and contracts for architect-engineer services when a fixed-price contract...

  10. Evaluation of neutron nuclear data for 249Cf

    International Nuclear Information System (INIS)

    Zhou Delin; Yu Baosheng; Yuan Hanrong; Liu Tong; Zhang Jin; Su Zongdi; Yan Shiwei; Wang Cuilan; Zhang Jingshang

    1992-01-01

    A complete set of neutron nuclear data from 10 -5 eV to 20 MeV in ENDF/B-6 format has been evaluated for 249 Cf based on measured data, systematics predications and model theory calculations. The evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) reaction cross sections, the resolved and unresolved resonance parameters, the angular and energy distributions of emitted neutrons and the average number of neutrons emitted per fission. The numerical data are available in ENDF/B-6 format

  11. Preliminary results of the 249Cf + 48Ca experiment

    International Nuclear Information System (INIS)

    Patin, J B; Moody, K J; Stoyer, M A; Wild, J F; Shaughnessy, D A; Stoyer, N J

    2003-01-01

    The results of a detailed analysis performed on the data obtained in the 249 Cf + 48 Ca bombardment is presented. This analysis is independent of the original data analysis performed in Dubna in which two possible decay chains were found. The first decay chain consisted of an evaporation residue implantation followed by two alpha decays and then a spontaneous fission. The second decay chain consisted of an evaporation residue implantation followed by an immediate spontaneous fission event. This analysis confirms that the two interesting events are present in the data. A summary of the two events will be given as well as a description of the analysis performed

  12. Actinide production in 136Xe bombardments of 249Cf

    International Nuclear Information System (INIS)

    Gregorich, K.E.

    1985-08-01

    The production cross sections for the actinide products from 136 Xe bombardments of 249 Cf at energies 1.02, 1.09, and 1.16 times the Coulomb barrier were determined. Fractions of the individual actinide elements were chemically separated from recoil catcher foils. The production cross sections of the actinide products were determined by measuring the radiations emitted from the nuclides within the chemical fractions. The chemical separation techniques used in this work are described in detail, and a description of the data analysis procedure is included. The actinide production cross section distributions from these 136 Xe + 249 Cf bombardments are compared with the production cross section distributions from other heavy ion bombardments of actinide targets, with emphasis on the comparison with the 136 Xe + 248 Cm reaction. A technique for modeling the final actinide cross section distributions has been developed and is presented. In this model, the initial (before deexcitation) cross section distribution with respect to the separation energy of a dinuclear complex and with respect to the Z of the target-like fragment is given by an empirical procedure. It is then assumed that the N/Z equilibration in the dinuclear complex occurs by the transfer of neutrons between the two participants in the dinuclear complex. The neutrons and the excitation energy are statistically distributed between the two fragments using a simple Fermi gas level density formalism. The resulting target-like fragment initial cross section distribution with respect to Z, N, and excitation energy is then allowed to deexcite by emission of neutrons in competition with fission. The result is a final cross section distribution with respect to Z and N for the actinide products. 68 refs., 33 figs., 6 tabs

  13. 7 CFR 249.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... workplace, and lobbying restrictions. 249.22 Section 249.22 Agriculture Regulations of the Department of.../suspension, drug-free workplace, and lobbying restrictions. The State agency must ensure compliance with the... lobbying (part 3018 of this title), where applicable. ...

  14. 48 CFR 52.249-4 - Termination for Convenience of the Government (Services) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Services) (Short Form). 52.249-4 Section 52.249-4 Federal Acquisition... (Services) (Short Form). As prescribed in 49.502(c), insert the following clause in solicitations and... termination: Termination for Convenience of the Government (Services) (Short Form) (APR 1984) The Contracting...

  15. 7 CFR 249.14 - Distribution of funds to State agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Distribution of funds to State agencies. 249.14... SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions § 249.14 Distribution of funds to State agencies. (a) State Plan and...

  16. Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249 ...

    African Journals Online (AJOL)

    cadewumi

    Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249-256 ..... In recent years the popularity of complementary medicine has increased. Much interest has been focused on exploring ... delayed the induction of glucose intolerance and euglycemia in high fructose diet fed rats. Diabegon treatment inhibits the ...

  17. 7 CFR 249.10 - Coupon, market, and CSA program management.

    Science.gov (United States)

    2010-01-01

    ..., State agencies have discretion in determining the method used for annual training purposes. At a minimum... of eligible foods directly from authorized farmers. Such foods must then be equitably divided among... not exceed $50, as stipulated in § 249.8(b). (7) The State agency shall ensure that training is...

  18. Study of the 249-251Cf + 48Ca reactions: recent results and outlook

    Science.gov (United States)

    Voinov, A. A.; Oganessian, Yu Ts; Abdullin, F. Sh; Brewer, N. T.; Dmitriev, S. N.; Grzywacz, R. K.; Hamilton, J. H.; Itkis, M. G.; Miernik, K.; Polyakov, A. N.; Roberto, J. B.; Rykaczewski, K. P.; Sabelnikov, A. V.; Sagaidak, R. N.; Shirokovsky, I. V.; Shumeiko, M. V.; Stoyer, M. A.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu S.; Utyonkov, V. K.; Vostokin, G. K.

    2018-02-01

    Experiment aiming at the synthesis of heavy isotopes of Z=118 (Og) using beam of 48Ca and a target of 249-251Cf was undertaken in October 2015 - April 2016 employing the Dubna Gas-Filled Recoil Separator (FLNR JINR). The target of mixed isotopes of 249-251Cf (50.7% of 249Cf, 12.9% of 250Cf, and 36.4% of 251Cf) was irradiated by 48Ca ions at two beam energies of 252 and 258 MeV with the corresponding accumulated beam doses of 1.6×1019 and 1.1×1019. A single event observed at lower beam energy was assigned to the isotope 294Og, the product of the reaction 249Cf(48Ca, 3n); its decay pattern and the observed radioactive properties of the nuclides in the decay chain reproduce in full those observed for 294Og in our earlier experiments of 2002-2005 and 2012. At higher beam energy we observed no decay chains that could be attributed to the isotopes of Og. The possibility of renewal of this experiment in the future is discussed.

  19. 17 CFR 249.1001 - Form SIP, for application for registration as a securities information processor or to amend such...

    Science.gov (United States)

    2010-04-01

    ... registration as a securities information processor or to amend such an application or registration. 249.1001..., SECURITIES EXCHANGE ACT OF 1934 Form for Registration of, and Reporting by Securities Information Processors § 249.1001 Form SIP, for application for registration as a securities information processor or to amend...

  20. 48 CFR 52.249-1 - Termination for Convenience of the Government (Fixed-Price) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Fixed-Price) (Short Form). 52.249-1 Section 52.249-1 Federal Acquisition... (Fixed-Price) (Short Form). As prescribed in 49.502(a)(1), insert the following clause: Termination for Convenience of the Government (Fixed-Price) (Short Form) (APR 1984) The Contracting Officer, by written notice...

  1. 48 CFR 1652.249-71 - FEHBP termination for convenience of the government-negotiated benefits contracts.

    Science.gov (United States)

    2010-10-01

    ... receipt of a Notice of Termination, and except as directed by the Contracting Officer, the Carrier shall... of the termination of work, the Contracting Officer shall pay the Carrier the amounts determined by... convenience of the government-negotiated benefits contracts. 1652.249-71 Section 1652.249-71 Federal...

  2. Numerical simulation and experimental validation of arc welding of DMR-249A steel

    Directory of Open Access Journals (Sweden)

    Rishi Pamnani

    2016-08-01

    Full Text Available The thermo-mechanical attributes of DMR-249A steel weld joints manufactured by shielded metal arc welding (SMAW and activated gas tungsten arc welding (A-GTAW processes were studied using Finite Element Model (FEM simulation. The thermal gradients and residual stresses were analyzed with SYSWELD software using double ellipsoidal heat source distribution model. The numerically estimated temperature distribution was validated with online temperature measurements using thermocouples. The predicted residual stresses profile across the weld joints was compared with the values experimentally measured using non-destructive techniques. The measured and predicted thermal cycles and residual stress profile was observed to be comparable. The residual stress developed in double sided A-GTAW joint were marginally higher in comparison to five pass SMAW joint due to phase transformation associated with high heat input per weld pass for A-GTAW process. The present investigations suggest the applicability of numerical modeling as an effective approach for predicting the thermo-mechanical properties influenced by welding techniques for DMR-249A steel weld joints. The tensile, impact and micro-hardness tests were carried to compare the welds. Considering benefits of high productivity and savings of labor and cost associated with A-GTAW compared to SMAW process, the minor variation in residual stress build up of A-GTAW joint can be neglected to develop A-GTAW as qualified alternative welding technique for DMR-249A steel.

  3. 3CR249.1 and Ton202-luminous QSOs in interacting systems

    International Nuclear Information System (INIS)

    Stockton, A.; MacKenty, J.W.

    1983-01-01

    The morphologies of the extended emission-line regions around the QSOs 3CR249.1 and Ton202 indicate that they have, in both cases, resulted from interactions between two galaxies of roughly equal mass and that the galaxies involved possessed extensive rotating gaseous disks before their encounters. These two examples provide support for the position that luminous QSOs are frequently activated by violent interactions. More generally, the distribution of gas around luminous QSOs promises to be a sensitive and useful indicator of the recent history of their physical environment. (author)

  4. Comparative Studies on microstructure, mechanical and corrosion behaviour of DMR 249A Steel and its welds

    Science.gov (United States)

    Mohammed, Raffi; Dilkush; Madhusudhan Reddy, G.; Srinivasa Rao, K.

    2018-03-01

    DMR249A Medium strength (low carbon) Low-alloy steels are used as structural components in naval applications due to its low cost and high availability. An attempt has been made to weld the DMR 249A steel plates of 8mm thickness using shielded metal arc welding (SMAW) and gas tungsten arc welding (GTAW). Welds were characterized for metallography to carry out the microstructural changes, mechanical properties were evaluated using vickers hardness tester and universal testing machine. Potentio-dynamic polarization tests were carried out to determine the pitting corrosion behaviour. Constant load type Stress corrosion cracking (SCC) testing was done to observe the cracking tendency of the joints in a 3.5%NaCl solution. Results of the present study established that SMA welds resulted in formation of relatively higher amount of martensite in ferrite matrix when compared to gas tungsten arc welding (GTAW). It is attributed to faster cooling rates achieved due to high thermal efficiency. Improved mechanical properties were observed for the SMA welds and are due to higher amount of martensite. Pitting corrosion and stress corrosion cracking resistance of SMA welds were poor when compared to GTA welds.

  5. Ternary Fission of {sup 249}Cf(n,f) and {sup 250}Cf(SF)

    Energy Technology Data Exchange (ETDEWEB)

    University of Gent, B-9000 Gent, Belgium; CEA Cadarache, F-13108 Saint-Paul-lez-Durance, France; Institute Laue-Langevin, F-38042 Grenoble, France; EC-JRC Institute for Reference Materials and Measurements, B-2440 Geel, Belgium; Wadsworth Center, New York State Department of Health, Albany NY 12201, USA; Lawrence Berkeley National Laboratory, Berkeley, CA 94720, USA; Vermote, S.; Wagemans, C.; Serot, O.; Soldner, T.; Geltenbort, P.; Gils, J. Van; Almahamid, I.; Tian, G.; Rao, L.

    2011-09-01

    During the last years, several Cm and Cf isotopes have been studied by our research group in the frame of a systematic investigation of gas emission characteristics in ternary fission. Here we report on new results on the energy distribution and the emission probability of {sup 3}H, {sup 4}He and {sup 6}He particles emitted in the spontaneous ternary fission of {sup 250}Cf (E{sub exc} = 0 MeV) and in the neutron induced ternary fission of {sup 249}Cf (E{sub exc} = 6.625 MeV). Both measurements were performed using suited and well-calibrated ΔE-E telescope detectors, at the IRMM (Geel, Belgium) for the spontaneous fission and at the very intense neutron beam PF1b at the Institute Laue-Langevin (Grenoble, France) for the neutron induced fission measurement. In this way, the existing database can be enlarged with new results for Z=98 isotopes, which is important for the systematic investigation. Moreover, the investigation of the 'isotope couple' {sup 249}Cf(n,f) - {sup 250}Cf(SF), together with corresponding data for other isotopes, will yield valuable information on the influence of the excitation energy on the particle emission probabilities.

  6. Search for a new element Z=117 among the ^249Bk + ^48Ca reaction products

    Science.gov (United States)

    Rykaczewski, K.; Oganessian, Yu; Dmitriev, S.; Utyonkov, V.; Hamilton, J.; Ramayya, A.; Henderson, R.; Moody, K.; Shaughnessy, D.; Al, M. Stoyer Et; Al, J. Roberto Et; Al, M. Ryabinin Et; et al.

    2009-10-01

    Following irradiation of Am and Cm seed isotopes at the ORNL High Flux Isotope Reactor, the ^249Bk activity (T1/2=320 d) has been separated at the ORNL Radiochemical Engineering Development Center [1] to be used as target material for a search for element Z=117 using an intense ^48 Ca beam from the U-400 cyclotron at JINR Dubna. The targets will be made from Bk nitrate at the IAR Dmitrovgrad. The search for the A=294 and A=293 isotopes of the new element Z=117 and their decay products, see [2], is scheduled to begin at the Dubna Gas Filled Recoil Separator at JINR Flerov Laboratory of Nuclear Reactions in August 2009. Details of the ^249Bk separation and experiment will be reported. [1] C.Alexander, P.Bailey, J.Ezold, M.Ferren, C.Porter, F.Riley et al., HFIR/REDC campaign 74, 2009. [2] Yu. Oganessian, J.Phys.G 34, R164,2007.

  7. Current situation of International Organization for Standardization/Technical Committee 249 international standards of traditional Chinese medicine.

    Science.gov (United States)

    Liu, Yu-Qi; Wang, Yue-Xi; Shi, Nan-Nan; Han, Xue-Jie; Lu, Ai-Ping

    2017-05-01

    To review the current situation and progress of traditional Chinese medicine (TCM) international standards, standard projects and proposals in International Organization for Standardization (ISO)/ technical committee (TC) 249. ISO/TC 249 standards and standard projects on the ISO website were searched and new standard proposals information were collected from ISO/TC 249 National Mirror Committee in China. Then all the available data were summarized in 5 closely related items, including proposed time, proposed country, assigned working group (WG), current stage and classifification. In ISO/TC 249, there were 2 international standards, 18 standard projects and 24 new standard proposals proposed in 2014. These 44 standard subjects increased year by year since 2011. Twenty-nine of them were proposed by China, 15 were assigned to WG 4, 36 were in preliminary and preparatory stage and 8 were categorized into 4 fifields, 7 groups and sub-groups based on International Classifification Standards. A rapid and steady development of international standardization in TCM can be observed in ISO/TC 249.

  8. 17 CFR 249.821 - Form PILOT, information required of self-regulatory organizations operating pilot trading systems...

    Science.gov (United States)

    2010-04-01

    ... required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this... Associations § 249.821 Form PILOT, information required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this chapter. This form shall be used by all self-regulatory...

  9. Association of chemokine receptor CX3CR1 V249I and T280M polymorphisms with chronic kidney disease

    Directory of Open Access Journals (Sweden)

    A K Yadav

    2016-01-01

    Full Text Available The chemokine fractalkine (CX3CL1 and its receptor CX3CR1 are involved in the activation of leukocytes. Two common single-nucleotide polymorphisms of the CX3CR1 gene, V249I and T280M, have been associated with reduced fractalkine signaling, leading to decreased adhesive function and leukocyte chemotaxis. We hypothesized that variation in the CX3CR1 gene could be associated with chronic kidney disease (CKD, a disease of inflammatory activation. We studied the association between CX3CR1 V249I and T280M polymorphisms, and fractalkine and highly sensitive C-reactive protein (hs-CRP levels in 123 patients with CKD and 100 healthy controls (HCs. Genotype analysis was done by polymerase chain reaction-restriction fragment length polymorphism, and fractalkine and hs-CRP levels were analyzed by enzyme-linked immunosorbent assay. MM genotype of T280M was absent in CKD patients, while in controls it was seen in 1% of the individuals. The allele frequencies in both the groups were similar (P = 0.059. Compared to HC, M280M + T280M genotype was more frequent in CKD (P = 0.041. The frequency of II genotype of V249I was 0.8% in CKD, whereas in HC, it was 2%. I249I + V249I genotype was more frequent in CKD as compared to HC (P = 0.034. No difference in allelic frequency of V249I was noted between the two groups (P = 0.061, odds ratios = 1.74, 95% confidence intervals = 0.96–3.12. Plasma fractalkine and serum hs-CRP levels were higher in CKD subjects (P = 0.004 and P 's 0.0001. No association of either genotype was found with fractalkine and hs-CRP levels. Polymorphisms at I249 and M280 genotype in CX3CR1 gene are associated with CKD; however, there was no association of fractalkine or inflammatory marker with these genotypes.

  10. Safety of quadrivalent live attenuated influenza vaccine in subjects aged 2-49years.

    Science.gov (United States)

    Baxter, Roger; Eaton, Abigail; Hansen, John; Aukes, Laurie; Caspard, Herve; Ambrose, Christopher S

    2017-03-01

    Quadrivalent live attenuated influenza vaccine (Q/LAIV) was licensed in 2012 and replaced trivalent live attenuated influenza vaccine in the United States during the 2013-2014 influenza season. This study assessed the safety of Q/LAIV in children and adults aged 2-49years. This was a prospective observational cohort study using data collected from Kaiser Permanente Northern California. Post-vaccination events of interest were any hospitalization, hospitalization for lower respiratory tract infection, and the following medically attended events: hypersensitivity, seizures/convulsions, lower respiratory tract infection, wheezing, Guillain-Barré syndrome, Bell's palsy, encephalitis, neuritis, vasculitis, and narcolepsy/cataplexy. The rates of these events during the risk interval post-vaccination were compared with rates observed during reference periods later in the follow-up (within-cohort analysis) and with rates observed in frequency-matched unvaccinated controls and inactivated influenza vaccine (IIV) recipients. A total of 62,040 eligible Q/LAIV recipients were identified during the 2013-2014 influenza season. Within-cohort comparisons of all Q/LAIV recipients as well as comparisons between Q/LAIV recipients and unvaccinated controls or IIV recipients did not show any significantly higher risk of hospitalizations or medically attended events following administration of Q/LAIV. Additional analyses by setting (clinic visits, emergency department visits, and hospital admissions) and age group (2-4, 5-8, 9-17, and 18-49years) also did not reveal clinically consistent findings that suggested any increased risk after administration of Q/LAIV. In this large population study of individuals aged 2-49years, no safety signals associated with the administration of Q/LAIV were observed. A much larger study population would be needed to confidently reject any association between Q/LAIV and very rare events, specifically those with an incidence of <1 event/10,000 person

  11. 17 CFR 249.1100 - Form MSD, application for registration as a municipal securities dealer pursuant to rule 15Ba2-1...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form MSD, application for registration as a municipal securities dealer pursuant to rule 15Ba2-1 under the Securities Exchange Act of 1934 or amendment to such application. 249.1100 Section 249.1100 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED...

  12. New Insights into the Origin of the Bering Sea from SO201 and SO249 cruises

    Science.gov (United States)

    Hoernle, K.; Werner, R.; Portnyagin, M.; Yogodzinski, G. M.; Hauff, F.; Baranov, B.; Silantyev, S.

    2016-12-01

    The origin of the Bering Sea Basin remains elusive. It is still not resolved if the basin formed by plate capture or backarc spreading. On the German R/V Sonne cruises SO201/1b-2 KALMAR in 2009 and SO249/1-2 BERING in 2016, combined with fieldwork on the Komandorsky Islands, our studies of the southern (Aleutian) and western (Kamchatka to Chukotka) margins of the Bering Sea and of the Bowers and Shirshov Ridges have provided new insights into the complex origin of the Bering marginal basin. Recent work shows that the Bowers Ridge and adjacent Bowers Basin were an active arc-backarc system in Early Oligocene to Early Miocene and were located behind the Aleutian Island Arc, also active during this time period (e.g. Wanke et al., 2013, Geology). We interpret the line of basement blocks connecting the Bowers and Shirshov Ridges to be uplifted blocks along a former strike-slip fault. NE-oriented fossil spreading centers and associated NW-oriented fracture zones in the Komandorsky Basin suggest that the Shirshov Ridge underwent counter-clockwise rotation away from the NE-trending margin of northern Kamchatka (Baranov et al., 1991, Tectonophysics). We propose that similar to the Bowers Ridge subduction beneath the eastern margin of the Shirshov Ridge in Oligocene-Miocene time also created the Komandorsky Basin by backarc spreading. The possible presence of obducted oceanic crust on the Shirshov Ridge, consistent with dredging results (Silantyev et al. 1985-86, Geochem. Int.), may explain the absence of gravity and seismic profiles characteristic of a remnant island arc, as seen on the Bowers Ridge. To explain the initiation of subduction beneath the Bowers and Shirshov Ridges in this model, seafloor underlying the main Bering Sea deep-water basin must have been relatively old in the late Paleogene. Thus, this model favors a plate capture scenario for formation of the eastern part of the Bering seafloor.

  13. Essentials and guidelines for clinical medical physics residency training programs: executive summary of AAPM Report Number 249.

    Science.gov (United States)

    Prisciandaro, Joann I; Willis, Charles E; Burmeister, Jay W; Clarke, Geoffrey D; Das, Rupak K; Esthappan, Jacqueline; Gerbi, Bruce J; Harkness, Beth A; Patton, James A; Peck, Donald J; Pizzutiello, Robert J; Sandison, George A; White, Sharon L; Wichman, Brian D; Ibbott, Geoffrey S; Both, Stefan

    2014-05-08

    There is a clear need for established standards for medical physics residency training. The complexity of techniques in imaging, nuclear medicine, and radiation oncology continues to increase with each passing year. It is therefore imperative that training requirements and competencies are routinely reviewed and updated to reflect the changing environment in hospitals and clinics across the country. In 2010, the AAPM Work Group on Periodic Review of Medical Physics Residency Training was formed and charged with updating AAPM Report Number 90. This work group includes AAPM members with extensive experience in clinical, professional, and educational aspects of medical physics. The resulting report, AAPM Report Number 249, concentrates on the clinical and professional knowledge needed to function independently as a practicing medical physicist in the areas of radiation oncology, imaging, and nuclear medicine, and constitutes a revision to AAPM Report Number 90. This manuscript presents an executive summary of AAPM Report Number 249.

  14. Analysis of decay chains of superheavy nuclei produced in the 249Bk+48Ca and 243Am+48Ca reactions

    International Nuclear Information System (INIS)

    Zlokazov, V B; Utyonkov, V K

    2017-01-01

    The analysis of decay chains starting at superheavy nuclei 293 Ts and 289 Mc is presented. The spectroscopic properties of nuclei identified during the experiments using the 249 Bk+ 48 Ca and 243 Am+ 48 Ca reactions studied at the gas-filled separators DGFRS, TASCA and BGS are considered. We present the analysis of decay data using widely adopted statistical methods and applying them to the short decay chains of parent odd- Z nuclei. We find out that the recently suggested method of analyzing decay chains by Forsberg et al may lead to questionable conclusions when applied for the analysis of radioactive decays. Our discussion demonstrates reasonable congruence of α -particle energies and decay times of nuclei assigned to isotopes 289 Mc, 285 Nh and 281 Rg observed in both reactions. (paper)

  15. Analysis of decay chains of superheavy nuclei produced in the 249Bk+48Ca and 243Am+48Ca reactions

    Science.gov (United States)

    Zlokazov, V. B.; Utyonkov, V. K.

    2017-07-01

    The analysis of decay chains starting at superheavy nuclei 293Ts and 289Mc is presented. The spectroscopic properties of nuclei identified during the experiments using the 249Bk+48Ca and 243Am+48Ca reactions studied at the gas-filled separators DGFRS, TASCA and BGS are considered. We present the analysis of decay data using widely adopted statistical methods and applying them to the short decay chains of parent odd-Z nuclei. We find out that the recently suggested method of analyzing decay chains by Forsberg et al may lead to questionable conclusions when applied for the analysis of radioactive decays. Our discussion demonstrates reasonable congruence of α-particle energies and decay times of nuclei assigned to isotopes 289Mc, 285Nh and 281Rg observed in both reactions.

  16. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  17. Recoil-range studies of heavy products of multinucleon transfer from 18O to 245Cm and 249Cf

    International Nuclear Information System (INIS)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of 245 Cm and 249 Cf with 18 O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation

  18. Radiosensibility curve with 60 Co in guinea grass (Panicum maximum Jacq.) cv. 'K-249'

    International Nuclear Information System (INIS)

    Lajonchere, G.; Mesa, A.R.; Prieto, M.; Sánchez-Quiroz, E.

    1995-01-01

    In order to select the adequate radiosensibility criterion and useful dosis were studied the effects of gamma radiation on the embryogenic callus of guinea cv. K-249. The application dosages were 0, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300 and 400 Gy and the measures evaluated were: increase of fresh mass of the callus in fresh medium, number of shoots, plantlets and total by callus and by gram of callus in regeneration medium. It was determined that the curves shaped with the number of shoots, plantlets and total by callus and by gram of callus were more radiosensible than that shoped with increase of fresh mass of the callus; as criterion of radiosensibility in this cultivar the total number of shoots and plantlets from gram of callus was selected for it's simplicity and veracity as much as in the evaluation and in the results. The useful dosis that determined one GR 10, 20, 50 and 70 percent were 16, 20, 29 and 160 Gy respectively. Albino shoots were also observed whose values were randomizely showed and it was observed albinism in 0 dosis. (author) [es

  19. Association of the PPP3CA c.249G>A variant with clinical outcomes of tacrolimus-based therapy in kidney transplant recipients

    Directory of Open Access Journals (Sweden)

    Salgado PC

    2017-03-01

    Full Text Available Patricia C Salgado,1 Fabiana DV Genvigir,1 Claudia R Felipe,2 Helio Tedesco-Silva Jr,2 Jose O Medina-Pestana,2 Sonia Q Doi,3 Mario H Hirata,1 Rosario DC Hirata1 1Department of Clinical and Toxicological Analysis, School of Pharmaceutical Sciences, University of Sao Paulo, 2Division of Nephrology, Hospital do Rim, Federal University of Sao Paulo, Sao Paulo, Brazil; 3School of Medicine, Uniformed Services University of the Health Sciences, Bethesda, MD, USA Background: The effects of genetic variants related to the pharmacodynamic mechanisms of immunosuppressive drugs on their therapeutic efficacy and safety have been poorly explored. This study was performed to investigate the influence of the PPP3CA c.249G>A variant on the clinical outcomes of kidney transplant recipients. Patients and methods: A total of 148 Brazilian patients received tacrolimus (TAC-based immunosuppressive therapy for 90 days post-kidney transplantation. The PPP3CA rs3730251 (c.249G>A polymorphism was determined by real-time polymerase chain reaction. Single-nucleotide polymorphism (SNP data for CYP3A5 rs776746 (CYP3A5*3C; g.6986A>G were used to eliminate the confounding effects of this variant. Results: The PPP3CA c.249G>A SNP did not influence early TAC exposure, renal function, or other laboratory parameters, including levels of urea, creatinine, glucose, and lipids, and blood counts. This variant also did not account for the cumulative incidence of biopsy-confirmed acute rejection or delayed graft function. Regarding adverse events, PPP3CA c.249A allele carriers initially had a 3.05-fold increased probability of treatment-induced blood and lymphatic system disorders compared with c.249GG genotype individuals (95% confidence interval: 1.10–8.48, p=0.032. However, this result was not maintained after adjusting for body weight and CYP3A5*3C SNP status (p=0.086. Conclusion: The PPP3CA c.249G>A variant does not influence the clinical outcomes of Brazilian patients in the

  20. Calculation of the evaporation residue cross sections for the synthesis of the superheavy element Z=119 via the 50Ti+249Bk hot fusion reaction

    Science.gov (United States)

    Liu, Zu-Hua; Bao, Jing-Dong

    2011-09-01

    The evaporation residue (ER) cross sections for 3n and 4n evaporation channels in the 50Ti + 249Bk reaction leading the formation of 296119 and 295119 isotopes are evaluated by means of a modified fusion-by-diffusion model. In the model, the dynamic evolution from dinucleus to mononucleus is taken into account with the two-dimensional coupled Langenvin equations. The calculated maximum ER cross sections in 3n and 4n evaporation channels of the 50Ti + 249Bk reaction are 0.17 and 0.57 pb, respectively. The cross section of 0.57 pb is close to the present experimental limit for the registration of the evaporation residual nuclei. Therefore, superheavy element 119 may be the most hopeful new element with Z>118 to be synthesized under somehow improved experimental conditions in the near future.

  1. Fibroblast Growth Factor Receptor 3 (FGFR3–Analyses of the S249C Mutation and Protein Expression in Primary Cervical Carcinomas

    Directory of Open Access Journals (Sweden)

    Haiyan Dai

    2001-01-01

    Full Text Available Fibroblast growth factor receptor 3 (FGFR3 seems to play an inhibitory role in bone development, as activating mutations in the gene underlie disorders such as achondroplasia and thanatophoric dysplasia. Findings from multiple myeloma (MM indicate that FGFR3 also can act as an oncogene, and mutation of codon 249 in the fibroblast growth factor receptor 3 (FGFR3 gene was recently detected in 3/12 primary cervical carcinomas. We have analysed 91 cervical carcinomas for this specific S249C mutation using amplification created restriction site methodology (ACRS, and detected no mutations. Immunohistochemistry was performed on 73 of the tumours. Reduced protein staining was seen in 43 (58.8% samples. Six of the tumours (8.2% revealed increased protein staining compared with normal cervical tissue. These patients had a better prognosis than those with reduced or normal levels, although not statistically significant. This report weakens the hypothesis of FGFR3 as an oncogene of importance in cervical carcinomas.

  2. Micropalaeontological dating of the basal Cretaceous section of DSDP Site 249, Leg 25, Mozambique Ridge: implications for the timing of the southern Atlantic-Indian Ocean connection

    Science.gov (United States)

    Dunay, Robert E.; Braham, William; Cooper, M. Kevin E.; Lester, Martin; Tremolada, Fabrizio

    2018-02-01

    Tectonic models suggest the absence of a deep water connection on the Mozambique Ridge during early Neocomian time. These models imply the initiation of a deep water connection between the southern Atlantic and Indian oceans formed during Barremian-earliest Aptian times. However, previous biostratigraphic studies of the earliest deep water sediments on the Mozambique Ridge suggest that the basal section is Neocomian in age. Here, we present a new biostratigraphic analysis undertaken to test this tectonic model and determine the earliest age of deep water sedimentation on the Mozambique Ridge. Core samples from the Cretaceous interval 222.05-406.32 m (Cores 19-32) of DSDP Site 249, Leg 25, were sampled for calcareous nannoplankton and palynological analysis. Most of the sampling was concentrated on the Lower Cretaceous interval below 294 m. Our results indicate that the lower sedimentary section is no older than Barremian and therefore provides support for the age proposed by the tectonic models.

  3. Modified model of neutron resonances widths distributions. Results of reduced neutron widths approximation for mass region 35 ≤ A ≤ 249

    International Nuclear Information System (INIS)

    Sukhovoj, A.M.; Khitrov, V.A.

    2011-01-01

    The distributions of the reduced neutron widths of s-, p- and d-resonances of nuclei of any type from nuclear mass region 35 ≤ A ≤ 249 were approximated with maximal precision by the model which presents experimental data set as a superposition of a maximum of four independent neutron amplitudes. Under the assumption that each of these amplitudes has the Gauss distribution with the unique maximum there were determined the most probable values of contribution of each amplitude in summary width distribution, their most probable mean values and dispersions. Comparison of the obtained χ 2 values with value χ 2 at description of the experimental data by one distribution of neutron amplitudes with best fitted parameters shows that all widths from more than 157 analyzed data sets can have different types of wave functions

  4. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015 : a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, Ryan M.; Bhutta, Zulfiqar A.; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Zian; Coates, Matthew M.; Coggeshall, Megan; Dandona, Lalit; Dicker, Daniel J.; Erskine, Holly E.; Ferrari, Alize J.; Fitzmaurice, Christina; Foreman, Kyle; Forouzanfar, Mohammad H.; Fraser, Maya S.; Pullman, Nancy; Gething, Peter W.; Goldberg, Ellen M.; Graetz, Nicholas; Haagsma, Juanita A.; Hay, Simon I.; Huynh, Chantal; Johnson, Catherine; Kassebaum, Nicholas J.; Kinfu, Yohannes; Kulikoff, Xie Rachel; Kutz, Michael; Kyu, Hmwe H.; Larson, Heidi J.; Leung, Janni; Liang, Xiaofeng; Lim, Stephen S.; Lind, Margaret; Lozano, Rafael; Marquez, Neal; Mensah, George A.; Mikesell, Joe; Mokdad, Ali H.; Mooney, Meghan D.; Nguyen, Grant; Nsoesie, Elaine; Pigott, David M.; Pinho, Christine; Roth, Gregory A.; Salomon, Joshua A.; Sandar, Logan; Silpakit, Naris; Sligar, Amber; Sorensen, Reed J. D.; Stanaway, Jeffrey; Steiner, Caitlyn; Teeple, Stephanie; Thomas, Bernadette A.; Troeger, Christopher; VanderZanden, Amelia; Vollset, Stein Emil; Wanga, Valentine; Whiteford, Harvey A.; Wolock, Timothy; Zoeckler, Leo; Abate, Kalkidan Hassen; Abbafati, Cristiana; Abbas, Kaja M.; Abd-Allah, Foad; Abera, Semaw Ferede; Abreu, Daisy M. X.; Abu-Raddad, Laith J.; Abyu, Gebre Yitayih; Achoki, Tom; Adelekan, Ademola Lukman; Ademi, Zanfina; Adou, Arsene Kouablan; Adsuar, Jose C.; Afanvi, Kossivi Agbelenko; Afshin, Ashkan; Agardh, Emilie Elisabet; Agarwal, Arnav; Agrawal, Anurag; Kiadaliri, Aliasghar Ahmad; Ajala, Oluremi N.; Akanda, All Shafqat; Akinyemi, Rufus Olusola; Akinyemiju, Tomi F.; Akseer, Nadia; Al Lami, Faris Hasan; Alabed, Samer; Al-Aly, Ziyad; Alam, Khurshid; Alam, Noore K. M.; Alasfoor, Deena; Aldhahri, Saleh Fahed; Aldridge, Robert William; Alegretti, Miguel Angel; Aleman, Alicia V.; Alemu, Zewdie Aderaw; Alexander, Lily T.; Alhabib, Samia; Ali, Raghib; Alkerwi, Ala'a; Alla, Francois; Allebeck, Peter; Al-Raddadi, Rajaa; Alsharif, Ubai; Altirkawi, Khalid A.; Martin, Elena Alvarez; Alvis-Guzman, Nelson; Amare, Azmeraw T.; Amegah, Adeladza Kofi; Ameh, Emmanuel A.; Amini, Heresh; Ammar, Walid; Amrock, Stephen Marc; Andersen, Hjalte H.; Anderson, Benjamin; Anderson, Gregory M.; Antonio, Carl Abelardo T.; Aregay, Atsede Fantahun; Arnlov, Johan; Arsenijevic, Valentina S. Arsic; Al Artaman, Ali; Asayesh, Hamid; Asghar, Rana Jawad; Atique, Suleman; Arthur Avokpaho, Euripide Frinel G.; Awasthi, Ashish; Azzopardi, Peter; Bacha, Umar; Badawi, Alaa; Bahit, Maria C.; Balakrishnan, Kalpana; Banerjee, Amitava; Barac, Aleksandra; Barker-Collo, Suzanne L.; Barnighausen, Till; Barregard, Lars; Barrero, Lope H.; Basu, Arindam; Basu, Sanjay; Bayou, Yibeltal Tebekaw; Bazargan-Hejazi, Shahrzad; Beardsley, Justin; Bedi, Neeraj; Beghi, Ettore; Belay, Haileeyesus Adamu; Bell, Brent; Bell, Michelle L.; Bello, Aminu K.; Bennett, Derrick A.; Bensenor, Isabela M.; Berhane, Adugnaw; Bernabe, Eduardo; Betsu, Balem Demtsu; Beyene, Addisu Shunu; Bhala, Neeraj; Bhalla, Ashish; Biadgilign, Sibhatu; Bikbov, Boris; Bin Abdulhak, Aref A.; Biroscak, Brian J.; Biryukov, Stan; Bjertness, Espen; Blore, Jed D.; Blosser, Christopher D.; Bohensky, Megan A.; Borschmann, Rohan; Bose, Dipan; Bourne, Rupert R. A.; Brainin, Michael; Brayne, Carol E. G.; Brazinova, Alexandra; Breitborde, Nicholas J. K.; Brenner, Hermann; Brewer, Jerry D.; Brown, Alexandria; Brown, Jonathan; Brugha, Traolach S.; Buckle, Geoffrey Colin; Butt, Zahid A.; Calabria, Bianca; Campos-Novato, Ismael Ricardo; Campuzano, Julio Cesar; Carapetis, Jonathan R.; Cardenas, Rosario; Carpenter, David; Carrero, Juan Jesus; Castaneda-Oquela, Carlos A.; Rivas, Jacqueline Castillo; Catala-Lopez, Ferran; Cavalleri, Fiorella; Cercy, Kelly; Cerda, Jorge; Chen, Wanqing; Chew, Adrienne; Chiang, Peggy Pei -Chia; Chibalabala, Mirriam; Chibueze, Chioma Ezinne; Chimed-Ochir, Odgerel; Chisumpa, Vesper Hichilombwe; Choi, Jee-Young Jasmine; Chowdhury, Rajiv; Christensen, Hanne; Christopher, Devasahayam Jesudas; Ciobanu, Liliana G.; Cirillo, Massimo; Cohen, Aaron J.; Colistro, Valentina; Colomar, Mercedes; Colquhoun, Samantha M.; Cooper, Cyrus; Cooper, Leslie Trumbull; Cortinovis, Monica; Cowie, Benjamin C.; Crump, John A.; Damsere-Derry, James; Danawi, Hadi; Dandona, Rakhi; Daoud, Farah; Darby, Sarah C.; Dargan, Paul I.; das Neves, Jose; Davey, Gail; Davis, Adrian C.; Davitoiu, Dragos V.; de Castro, E. Filipa; de Jager, Pieter; De Leo, Diego; Degenhardt, Louisa; Dellavalle, Robert P.; Deribe, Kebede; Deribew, Amare; Dharmaratne, Samath D.; Dhillon, Preet K.; Diaz-Torne, Cesar; Ding, Eric L.; dos Santos, Kadine Priscila Bender; Dossou, Edem; Driscoll, Tim R.; Duan, Leilei; Dubey, Manisha; Bartholow, Bruce; Ellenbogen, Richard G.; Lycke, Christian; Elyazar, Iqbal; Endries, Aman Yesuf; Ermakov, Sergey Petrovich; Eshrati, Babak; Esteghamati, Alireza; Estep, Kara; Faghmous, Imad D. A.; Fahimi, Saman; Jose, Emerito; Farid, Talha A.; Sa Farinha, Carla Sofia e; Faro, Andre; Farvid, Maryam S.; Farzadfar, Farshad; Feigin, Valery L.; Fereshtehnejad, Seyed-Mohammad; Fernandes, Jefferson G.; Fernandes, Joao C.; Fischer, Florian; Fitchett, Joseph R. A.; Flaxman, Abraham; Foigt, Nataliya; Fowkes, F. Gerry R.; Franca, Elisabeth Barboza; Franklin, Richard C.; Friedman, Joseph; Frostad, Joseph; Hirst, Thomas; Futran, Neal D.; Gall, Seana L.; Gambashidze, Ketevan; Gamkrelidze, Amiran; Ganguly, Parthasarathi; Gankpe, Fortune Gbetoho; Gebre, Teshome; Gebrehiwot, Tsegaye Tsewelde; Gebremedhin, Amanuel Tesfay; Gebru, Alemseged Aregay; Geleijnse, Johanna M.; Gessner, Bradford D.; Ghoshal, Aloke Gopal; Gibney, Katherine B.; Gillum, Richard F.; Gilmour, Stuart; Giref, Ababi Zergaw; Giroud, Maurice; Gishu, Melkamu Dedefo; Giussani, Giorgia; Glaser, Elizabeth; Godwin, William W.; Gomez-Dantes, Hector; Gona, Philimon; Goodridge, Amador; Gopalani, Sameer Vali; Gosselin, Richard A.; Gotay, Carolyn C.; Goto, Atsushi; Gouda, Hebe N.; Greaves, Felix; Gugnani, Harish Chander; Gupta, Rahul; Gupta, Rajeev; Gupta, Vipin; Gutierrez, Reyna A.; Hafezi-Nejad, Nima; Haile, Demewoz; Hailu, Alemayehu Desalegne; Hailu, Gessessew Bugssa; Halasa, Yara A.; Hamadeh, Randah Ribhi; Hamidi, Samer; Hancock, Jamie; Handal, Alexis J.; Hankey, Graeme J.; Hao, Yuantao; Harb, Hilda L.; Harikrishnan, Sivadasanpillai; Haro, Josep Maria; Havmoeller, Rasmus; Heckbert, Susan R.; Heredia-Pi, Ileana Beatriz; Heydarpour, Pouria; Hilderink, Henk B. M.; Hoek, Hans W.; Hogg, Robert S.; Horino, Masako; Horita, Nobuyuki; Hosgood, H. Dean; Hotez, Peter J.; Hoy, Damian G.; Hsairi, Mohamed; Htet, Aung Soe; Than Htike, Maung Maung; Hu, Guoqing; Huang, Cheng; Huang, Hsiang; Huiart, Laetitia; Husseini, Abdullatif; Huybrechts, Inge; Huynh, Grace; Iburg, Kim Moesgaard; Innos, Kaire; Inoue, Manami; Iyer, Veena J.; Jacobs, Troy A.; Jacobsen, Kathryn H.; Jahanmehr, Nader; Jakovljevic, Mihajlo B.; James, Peter; Javanbakht, Mehdi; Jayaraman, Sudha P.; Jayatilleke, Achala Upendra; Jeemon, Panniyammakal; Jensen, Paul N.; Jha, Vivekanand; Jiang, Guohong; Jiang, Ying; Jibat, Tariku; Jimenez-Corona, Aida; Jonas, Jost B.; Joshi, Tushar Kant; Kabir, Zubair; Karnak, Ritul; Kan, Haidong; Kant, Surya; Karch, Andre; Karema, Corine Kakizi; Karimkhani, Chante; Karletsos, Dimitris; Karthikeyan, Ganesan; Kasaeian, Amir; Katibeh, Marzieh; Kaul, Anil; Kawakami, Norito; Kayibanda, Jeanne Francoise; Keiyoro, Peter Njenga; Kemmer, Laura; Kemp, Andrew Haddon; Kengne, Andre Pascal; Keren, Andre; Kereselidze, Maia; Kesavachandran, Chandrasekharan Nair; Khader, Yousef Saleh; Khalil, Ibrahim A.; Khan, Abdur Rahman; Khan, Ejaz Ahmad; Khang, Young-Ho; Khera, Sahil; Muthafer Khoja, Tawfik Ahmed; Kieling, Christian; Kim, Daniel; Kim, Yun Jin; Kissela, Brett M.; Kissoon, Niranjan; Knibbs, Luke D.; Knudsen, Ann Kristin; Kokubo, Yoshihiro; Kolte, Dhaval; Kopec, Jacek A.; Kosen, Soewarta; Koul, Parvaiz A.; Koyanagi, Ai; Krog, Norun Hjertager; Defo, Barthelemy Kuate; Bicer, Burcu Kucuk; Kudom, Andreas A.; Kuipers, Ernst J.; Kulkarni, Veena S.; Kumar, G. Anil; Kwan, Gene F.; Lal, Aparna; Lal, Dharmesh Kumar; Lalloo, Ratilal; Lam, Hilton; Lam, Jennifer O.; Langan, Sinead M.; Lansingh, Van C.; Larsson, Anders; Laryea, Dennis Odai; Latif, Asma Abdul; Lawrynowicz, Alicia Elena Beatriz; Leigh, James; Levi, Miriam; Li, Yongmei; Lindsay, M. Patrice; Lipshultz, Steven E.; Liu, Patrick Y.; Liu, Shiwei; Liu, Yang; Lo, Loon-Tzian; Logroscino, Giancarlo; Lotufo, Paulo A.; Lucas, Robyn M.; Lunevicius, Raimundas; Lyons, Ronan A.; Ma, Stefan; Pedro Machado, Vasco Manuel; Mackay, Mark T.; MacLachlan, Jennifer H.; Abd El Razek, Hassan Magdy; Abd El Razek, Mohammed Magdy; Majdan, Marek; Majeed, Azeem; Malekzadeh, Reza; Ayele Manamo, Wondimu Ayele; Mandisarisa, John; Mangalam, Srikanth; Mapoma, Chabila C.; Marcenes, Wagner; Margolis, David Joel; Martin, Gerard Robert; Martinez-Raga, Jose; Marzan, Melvin Barrientos; Masiye, Felix; Mason-Jones, Amanda J.; Massano, Joao; Matzopoulos, Richard; Mayosi, Bongani M.; McGarvey, Stephen Theodore; McGrath, John J.; Mckee, Martin; McMahon, Brian J.; Meaney, Peter A.; Mehari, Alem; Mehndiratta, Man Mohan; Mena-Rodriguez, Fabiola; Mekonnen, Alemayehu B.; Melaku, Yohannes Adama; Memiah, Peter; Memish, Ziad A.; Mendoza, Walter; Meretoja, Atte; Meretoja, Tuomo J.; Mhimbira, Francis Apolinary; Micha, Renata; Miller, Ted R.; Mirarefin, Mojde; Misganaw, Awoke; Mock, Charles N.; Abdulmuhsin Mohammad, Karzan; Mohammadi, Alireza; Mohammed, Shafiu; Mohan, Viswanathan; Mola, Glen Liddell D.; Monasta, Lorenzo; Montanez Hernandez, Julio Cesar; Montero, Pablo; Montico, Marcella; Montine, Thomas J.; Moradi-Lakeh, Maziar; Morawska, Lidia; Morgan, Katherine; Mori, Rintaro; Mozaffarian, Dariush; Mueller, Ulrich; Satyanarayana Murthy, Gudlavalleti Venkata; Murthy, Srinivas; Musa, Kamarul Imran; Nachega, Jean B.; Nagel, Gabriele; Naidoo, Kovin S.; Naik, Nitish; Naldi, Luigi; Nangia, Vinay; Nash, Denis; Nejjari, Chakib; Neupane, Subas; Newton, Charles R.; Newton, John N.; Ng, Marie; Ngalesoni, Frida Namnyak; Ngirabega, Jean de Dieu; Quyen Le Nguyen, [Unknown; Nisar, Muhammad Imran; Nkamedjie Pete, Patrick Martial; Nomura, Marika; Norheim, Ole F.; Norman, Paul E.; Norrving, Bo; Nyakarahuka, Luke; Ogbo, Felix Akpojene; Ohkubo, Takayoshi; Ojelabi, Foluke Adetola; Olivares, Pedro R.; Olusanya, Bolajoko Olubukunola; Olusanya, Jacob Olusegun; Opio, John Nelson; Oren, Eyal; Ortiz, Alberto; Osman, Majdi; Ota, Erika; Ozdemir, Raziye; Pa, Mahesh; Pandian, Jeyaraj D.; Pant, Puspa Raj; Papachristou, Christina; Park, Eun-Kee; Park, Jae-Hyun; Parry, Charles D.; Parsaeian, Mahboubeh; Caicedo, Angel J. Paternina; Patten, Scott B.; Patton, George C.; Paul, Vinod K.; Pearce, Neil; Pedro, Joao Mario; Stokic, Ljiljana Pejin; Pereira, David M.; Perico, Norberto; Pesudovs, Konrad; Petzold, Max; Phillips, Michael Robert; Piel, Frederic B.; Pillay, Julian David; Plass, Dietrich; Platts-Mills, James A.; Polinder, Suzanne; Pope, C. Arden; Popova, Svetlana; Poulton, Richie G.; Pourmalek, Farshad; Prabhakaran, Dorairaj; Qorbani, Mostafa; Quame-Amaglo, Justice; Quistberg, D. Alex; Rafay, Anwar; Rahimi, Kazem; Rahimi-Movaghar, Vafa; Rahman, Mahfuzar; Rahman, Mohammad Hifz Ur; Rahman, Sajjad Ur; Rai, Rajesh Kumar; Rajavi, Zhale; Rajsic, Sasa; Raju, Murugesan; Rakovac, Ivo; Rana, Saleem M.; Ranabhat, Chhabi L.; Rangaswamy, Thara; Rao, Puja; Rao, Sowmya R.; Refaat, Amany H.; Rehm, Jurgen; Reitsma, Marissa B.; Remuzzi, Giuseppe; Resnikofff, Serge; Ribeiro, Antonio L.; Ricci, Stefano; Blancas, Maria Jesus Rios; Roberts, Bayard; Roca, Anna; Rojas-Rueda, David; Ronfani, Luca; Roshandel, Gholamreza; Rothenbacher, Dietrich; Roy, Ambuj; Roy, Nawal K.; Ruhago, George Mugambage; Sagar, Rajesh; Saha, Sukanta; Sahathevan, Ramesh; Saleh, Muhammad Muhammad; Sanabria, Juan R.; Sanchez-Nino, Maria Dolores; Sanchez-Riera, Lidia; Santos, Itamar S.; Sarmiento-Suarez, Rodrigo; Sartorius, Benn; Satpathy, Maheswar; Savic, Miloje; Sawhney, Monika; Schaub, Michael P.; Schmidt, Maria Ines; Schneider, Ione J. C.; Schottker, Ben; Schutte, Aletta E.; Schwebel, David C.; Seedat, Soraya; Sepanlou, Sadaf G.; Servan-Mori, Edson E.; Shackelford, Katya A.; Shaddick, Gavin; Shaheen, Amira; Shahraz, Saeid; Shaikh, Masood Ali; Shakh-Nazarova, Marina; Sharma, Rajesh; She, Jun; Sheikhbahaei, Sara; Shen, Jiabin; Shen, Ziyan; Shepard, Donald S.; Sheth, Kevin N.; Shetty, Balakrishna P.; Shi, Peilin; Shibuya, Kenji; Shin, Min-Jeong; Shiri, Rahman; Shiue, Ivy; Shrime, Mark G.; Sigfusdottir, Inga Dora; Silberberg, Donald H.; Silva, Diego Augusto Santos; Silveira, Dayane Gabriele Alves; Silverberg, Jonathan I.; Simard, Edgar P.; Singh, Abhishek; Singh, Gitanjali M.; Singh, Jasvinder A.; Singh, Om Prakash; Singh, Prashant Kumar; Singh, Virendra; Soneji, Samir; Soreide, Kjetil; Soriano, Joan B.; Sposato, Luciano A.; Sreeramareddy, Chandrashekhar T.; Stathopoulou, Vasiliki; Stein, Dan J.; Stein, Murray B.; Stranges, Saverio; Stroumpoulis, Konstantinos; Sunguya, Bruno F.; Sur, Patrick; Swaminathan, Soumya; Sykes, Bryan L.; Szoeke, Cassandra E. I.; Tabares-Seisdedos, Rafael; Tabb, Karen M.; Takahashi, Ken; Takala, Jukka S.; Talongwa, Roberto Tchio; Tandon, Nikhil; Tavakkoli, Mohammad; Taye, Bineyam; Taylor, Hugh R.; Ao, Braden J. Te; Tedla, Bemnet Amare; Tefera, Worku Mekonnen; Ten Have, Margreet; Terkawi, Abdullah Sulieman; Tesfay, Fisaha Haile; Tessema, Gizachew Assefa; Thomson, Alan J.; Thorne-Lyman, Andrew L.; Thrift, Amanda G.; Thurston, George D.; Tillmann, Taavi; Tirschwell, David L.; Tonelli, Marcello; Topor-Madry, Roman; Topouzis, Fotis; Nx, Jeffrey Allen Towb; Traebert, Jefferson; Tran, Bach Xuan; Truelsen, Thomas; Trujillo, Ulises; Tura, Abera Kenay; Tuzcu, Emin Murat; Uchendu, Uche S.; Ukwaja, Kingsley N.; Undurraga, Eduardo A.; Uthman, Olalekan A.; Van Dingenen, Rita; Van Donkelaar, Aaron; Vasankari, Tommi; Vasconcelos, Ana Maria Nogales; Venketasubramanian, Narayanaswamy; Vidavalur, Ramesh; Vijayakumar, Lakshmi; Villalpando, Salvador; Violante, Francesco S.; Vlassov, Vasiliy Victorovich; Wagner, Joseph A.; Wagner, Gregory R.; Wallin, Mitchell T.; Wang, Linhong; Watkins, David A.; Weichenthal, Scott; Weiderpass, Elisabete; Weintraub, Robert G.; Werdecker, Andrea; Westerman, Ronny; White, Richard A.; Wijeratne, Tissa; Wilkinson, James D.; Williams, Hywel C.; Wiysonge, Charles Shey; Woldeyohannes, Solomon Meseret; Wolfe, Charles D. A.; Won, Sungho; Wong, John Q.; Woolf, Anthony D.; Xavier, Denis; Xiao, Qingyang; Xu, Gelin; Yakob, Bereket; Yalew, Ayalnesh Zemene; Yan, Lijing L.; Yano, Yuichiro; Yaseri, Mehdi; Ye, Pengpeng; Yebyo, Henock Gebremedhin; Yip, Paul; Yirsaw, Biruck Desalegn; Yonemoto, Naohiro; Yonga, Gerald; Younis, Mustafa Z.; Yu, Shicheng; Zaidi, Zoubida; Zaki, Maysaa El Sayed; Zannad, Faiez; Zavala, Diego E.; Zeeb, Hajo; Zeleke, Berihun M.; Zhang, Hao; Zodpey, Sanjay; Zonies, David; Zuhlke, Liesl Joanna; Vos, Theo; Lopez, Alan D.; Murray, Christopher J. L.

    2016-01-01

    Background Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249 causes

  5. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980–2015: a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, R.M.; Bhutta, Zulfiqar; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Z.; Coates, M.; Geleijnse, J.M.

    2016-01-01

    Background
    Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249

  6. Summary of GAO Testimony by William J. Gainer on S. 249, The "Parental and Medical Leave Act of 1987." Statement before the Subcommittee on Children, Families, Drugs, and Alcoholism, Committee on Labor and Human Resources, United States Senate.

    Science.gov (United States)

    Gainer, William J.

    Estimates of the General Accounting Office (GAO) concerning the costs of S. 249, the "Parental and Medical Leave Act of 1987," differ substantially from estimates of the U.S. Chamber of Commerce. The legislation would provide job protection to employees while allowing them 18 weeks of unpaid leave to care for a newborn or seriously ill…

  7. 48Ca+249Bk fusion reaction leading to element Z = 117: long-lived α-decaying 270Db and discovery of 266Lr.

    Science.gov (United States)

    Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Asai, M; Block, M; Boll, R A; Brand, H; Cox, D M; Dasgupta, M; Derkx, X; Di Nitto, A; Eberhardt, K; Even, J; Evers, M; Fahlander, C; Forsberg, U; Gates, J M; Gharibyan, N; Golubev, P; Gregorich, K E; Hamilton, J H; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hinde, D J; Hoffmann, J; Hollinger, R; Hübner, A; Jäger, E; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Laatiaoui, M; Lahiri, S; Lang, R; Lommel, B; Maiti, M; Miernik, K; Minami, S; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Pang, G K; Papadakis, P; Renisch, D; Roberto, J; Rudolph, D; Runke, J; Rykaczewski, K P; Sarmiento, L G; Schädel, M; Schausten, B; Semchenkov, A; Shaughnessy, D A; Steinegger, P; Steiner, J; Tereshatov, E E; Thörle-Pospiech, P; Tinschert, K; Torres De Heidenreich, T; Trautmann, N; Türler, A; Uusitalo, J; Ward, D E; Wegrzecki, M; Wiehl, N; Van Cleve, S M; Yakusheva, V

    2014-05-02

    The superheavy element with atomic number Z=117 was produced as an evaporation residue in the (48)Ca+(249)Bk fusion reaction at the gas-filled recoil separator TASCA at GSI Darmstadt, Germany. The radioactive decay of evaporation residues and their α-decay products was studied using a detection setup that allowed measuring decays of single atomic nuclei with half-lives between sub-μs and a few days. Two decay chains comprising seven α decays and a spontaneous fission each were identified and are assigned to the isotope (294)117 and its decay products. A hitherto unknown α-decay branch in (270)Db (Z = 105) was observed, which populated the new isotope (266)Lr (Z = 103). The identification of the long-lived (T(1/2) = 1.0(-0.4)(+1.9) h) α-emitter (270)Db marks an important step towards the observation of even more long-lived nuclei of superheavy elements located on an "island of stability."

  8. Measurement of the total cross section difference Δσ L in np transmission at 1.19, 2.49 and 3.65 GeV

    Science.gov (United States)

    Adiasevich, B. P.; Antonenko, V. G.; Averichev, S. A.; Azhgirey, L. S.; Ball, J.; Bazhanov, N. A.; Benda, B.; Borisov, N. S.; Borzunov, Yu. T.; Bunyatova, E. I.; Burinov, V. F.; Chernykh, E. V.; Dolgii, S. A.; Durand, G.; Dzyubak, A. P.; Fedorov, A. N.; Fimushkin, V. V.; Fontaine, J. M.; Glagolev, V. V.; Golovanov, L. B.; Grosnick, D. P.; Gurevich, G. M.; Hill, D. A.; Karpunin, A. V.; Kasprzyk, T. E.; Khachaturov, B. A.; Kirillov, A. D.; Kochelev, N. I.; Kovalenko, A. D.; Kovalev, A. I.; Kulikov, M. V.; Ladygin, V. P.; Lazarev, A. B.; Lehar, F.; de Lesquen, A.; Liburg, M. Yu.; Lopiano, D.; Lukhanin, A. A.; Maniakov, P. K.; Matafonov, V. N.; Matyushevsky, E. A.; Mgebrishvili, G.; Mironov, S. V.; Neganov, A. B.; Nikolaevsky, G. P.; Nomofilov, A. A.; Pilipenko, Yu. K.; Pisarev, I. L.; Piskunov, N. M.; Plis, Yu. A.; Polunin, Yu. P.; Polyakov, V. V.; Prokofiev, A. N.; Ronzhin, D. A.; Rukoyatkin, P. A.; Sans, J. L.; Sharov, V. I.; Shilov, S. N.; Shishov, Yu. A.; Shutov, V. B.; Sorokin, P. V.; Spinka, H. M.; Starikov, A. Yu.; Stoletov, G. D.; Strokovsky, E. A.; Strunov, L. N.; Svetov, A. L.; Teterin, V. V.; Topalov, S. V.; Trautman, V. Yu.; Tsvinev, A. P.; Usov, Yu. A.; Vikhrov, V. V.; Volkov, V. I.; Yershov, A. A.; Yershov, V. P.; Zaporozhets, S. A.; Zhdanov, A. A.

    1996-03-01

    Results of the total cross section difference Δσ L in a np transmission experiment at 1.19, 2.49 and 3.65 GeV incident neutron beam kinetic energies are presented. Measurements were performed at the Synchrophasotron of the Laboratory of High Energies of the Joint Institute for Nuclear Research in Dubna. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The present results were obtained at the highest energies of free polarized neutrons that can be reached at present. They extend the energy range of existing results from PSI, LAMPF and Saclay measured between 0.066 and 1.10 GeV. The new results are compared with Δσ L( pn) data determined as a difference between Δσ L( pd) and Δσ L( pp) ANL-ZGS measurements. The values of Δσ L for the isospin state I=0 were deduced using known pp data.

  9. Crystal structure of apatite type Ca2.49Nd7.51(SiO46O1.75

    Directory of Open Access Journals (Sweden)

    Thu Hoai Le

    2016-02-01

    Full Text Available The title compound, Ca2+xNd8–x(SiO46O2–0.5x (x = 0.49, was synthesized at 1873 K and rapidly quenched to room temperature. Its structure has been determined using single-crystal X-ray diffraction and compared with results reported using neutron and X-ray powder diffraction from samples prepared by slow cooling. The single-crystal structure from room temperature data was found to belong to the space group P63/m and has the composition Ca2.49Nd7.51(SiO46O1.75 [dicalcium octaneodymium hexakis(orthosilicate dioxide], being isotypic with natural apatite and the previously reported Ca2Nd8(SiO46O2 and Ca2.2Nd7.8(SiO46O1.9. The solubility limit of calcium in the equilibrium state at 1873 K was found to occur at a composition of Ca2+xNd8–x(SiO46O2–0.5x, where x = 0.49.

  10. Recoil-range studies of heavy products of multinucleon transfer from /sup 18/O to /sup 245/Cm and /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of /sup 245/Cm and /sup 249/Cf with /sup 18/O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation.

  11. Platone interprete di se stesso. «Menone» 98a alla luce di «Fedro» 249b-c

    Directory of Open Access Journals (Sweden)

    Lavinia Maggi

    2016-01-01

    Full Text Available La definizione di ἐπιστήμη come ὀρθὴ δόξα legata αἰτίας λογισμῷ, che compare in Menone 98a, presenta notevoli difficoltà interpretative non solo per quanto riguarda l’identificazione dell’αἰτία, ma anche per la possibilità o meno di scorgere sullo sfondo di tale enunciazione la teoria delle Idee (nella versione dei cosiddetti “dialoghi della maturità”. La questione può essere affrontata sia considerando il controverso passo all’interno del contesto più ampio del dialogo (dove compare per la prima volta la teoria dell’ἀνάμνησις, che alla teoria delle Idee è strettamente legata, ma anche in relazione a passi di altri dialoghi platonici, in particolare Fedro 249b-c: qui, dove l’epistemologia platonica si sviluppa secondo la teoria delle Idee, la volontà di Platone di alludere direttamente a Menone 98a sembra offrire una chiave interpretativa anche per quella precedente formulazione. La necessità di leggere ogni dialogo secondo le sue specificità (periodo di composizione, argomento principale, tipologia dei personaggi coinvolti non esclude infatti che, almeno in alcuni casi, Platone stabilisca dei collegamenti che consentano una continuità di lettura nel percorso di sviluppo del suo pensiero.

  12. The Modified Bentall Procedure: A Single-Institution Experience in 249 Patients with a Maximum Follow Up of 21.5 Years.

    Science.gov (United States)

    Celiento, Michele; Ravenni, Giacomo; Margaryan, Rafik; Ferrari, Gabriele; Blasi, Stefania; Pratali, Stefano; Bortolotti, Uberto

    2016-07-01

    The study aim was to evaluate the long-term clinical outcomes of the modified Bentall procedure (MBP) with a mechanical conduit. Between 1993 and 2014, a total of 249 patients (mean age 62 ± 12 years; range: 25-87 years) underwent a MBP at the authors' institution. The main indication was annuloaortic ectasia in 102 patients (41%), followed by acute aortic dissection in 82 patients (33%); moderate to severe aortic regurgitation was present in 79% of cases. A bicuspid aortic valve was found in 17% of patients, and Marfan syndrome in 7%. The mean NYHA functional class was 2.5 ± 1.1. Concomitant procedures were performed in 36 patients (14%). The mean follow up was 8.7 ± 5.0 years (range: 0.3-21.5 years) and was 99% complete. The total follow up was 6.475 patient-years (pt-yr). Operative mortality was 3% in elective cases. Age, prolonged cardiopulmonary bypass times and mechanical ventilation >96 h were independent risk factors for early mortality. Actuarial survival at 15 and 20 years was 62% and 60%, respectively. Risk factors for late mortality were age and emergency operation. Actuarial freedom from thromboembolism (linearized incidence 0.93%/pt-yr) was 82% at 15 years, and 74% at 20 years. Seven patients required reoperation (0.38%/pt-yr), with an actuarial freedom from reoperation of 91% at 15 years and 87% at 20 years. The incidence of overall valve-related complications was 0.32%/pt-yr, with actuarial freedoms of 94% at 15 and 20 years. The MBP has shown excellent long-term results with a low incidence of procedure-related complications up to 20 years postoperatively. For this reason, it is considered to be a valid option for the treatment of aortic root disease, whenever valvesparing procedures are not indicated.

  13. Health Disparities in the Relationship of Neighborhood Greenness to Mental Health Outcomes in 249,405 U.S. Medicare Beneficiaries

    Directory of Open Access Journals (Sweden)

    Scott C. Brown

    2018-03-01

    Full Text Available Prior studies suggest that exposure to the natural environment may be important for optimal mental health. The present study examines the association between block-level greenness (vegetative presence and mental health outcomes, in a population-based sample of 249,405 U.S. Medicare beneficiaries aged ≥65 years living in Miami-Dade County, Florida, USA, whose location did not change from 2010 to 2011. Multilevel analyses examined relationships between greenness, as measured by mean Normalized Difference Vegetation Index from satellite imagery at the Census block level, and each of two mental health outcomes; Alzheimer’s disease and depression, respectively, after statistically adjusting for age, gender, race/ethnicity, and neighborhood income level of the individuals. Higher block-level greenness was linked to better mental health outcomes: There was a reduced risk of Alzheimer’s disease (by 18% and depression (by 28% for beneficiaries living in blocks that were 1 SD above the mean for greenness, as compared to blocks that were 1 SD below the mean. Planned post-hoc analyses revealed that higher levels of greenness were associated with even greater mental health benefits in low-income neighborhoods: An increase in greenness from 1 SD below to 1 SD above the mean was associated with 37% lower odds of depression in low-income neighborhoods, compared to 27% and 21% lower odds of depression in medium- and high-income neighborhoods, respectively. Greenness may be effective in promoting mental health in older adults, particularly in low-income neighborhoods, possibly as a result of the increased opportunities for physical activity, social interaction, or stress mitigation.

  14. Assessment of stroke and concomitant cerebrovascular disease with heart disease requires invasive treatment: analysis of 249 consecutive patients with heart disease.

    Science.gov (United States)

    Kim, Myeong Jin; Song, Hyun; Oh, Se-Yang; Choi, Jai Ho; Kim, Bum-Soo; Kang, Joonkyu; Shin, Yong Sam

    2014-06-01

    The aim of this study was to analyze the relationships of cerebrovascular disease (CVD), heart problems, and stroke in patients who required an invasive cardiac procedure. We enrolled 249 consecutive patients who required to or underwent invasive cardiac treatment and divided into a non-CVD group (n = 116) and a CVD group (n = 133). The latter group was divided into a coronary artery disease (CAD) group (n = 118) and a non-CAD group such as cardiac structural lesions (n = 15). No significant relationship with significant cerebrovascular stenosis was observed in either the CADs or non-CADs. The incidence of past stroke was significantly higher in the CVD group than that in the non-CVD group (12.8 vs. 3.4%; p = 0.017). Previous stroke event had increased odds of having significant cerebrovascular stenosis (odds ratio, 3.919, p = 0.006). In patients with both cardiac disease and the CVD, perioperative stroke was only one case (0.9%). The main source of stroke was cardiogenic in the immediate results and cerebrovascular lesions in the delayed results (1-12 months). The risk of perioperative stroke was very low in combined cardiac disease and the CVD. However, for preventing ischemic stroke due to the predetected cerebrovascular lesions, precautionary efforts could be needed for patients undergoing an invasive cardiac procedure, and concomitant cerebrovascular lesions should be considered as main source of delayed ischemic stroke. Georg Thieme Verlag KG Stuttgart · New York.

  15. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980–2015: a systematic analysis for the Global Burden of Disease Study 2015

    OpenAIRE

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, Ryan M; Bhutta, Zulfiqar A; Carter, Austin; Casey, Daniel C; Charlson, Fiona J; Chen, Alan Zian; Coates, Matthew M; Coggeshall, Megan; Dandona, Lalit; Dicker, Daniel J; Erskine, Holly E; Ferrari, Alize J

    2016-01-01

    Summary\\ud Background Improving survival and extending the longevity of life for all populations requires timely, robust evidence\\ud on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive\\ud assessment of all-cause and cause-specifi c mortality for 249 causes in 195 countries and territories from 1980 to 2015.\\ud These results informed an in-depth investigation of observed and expected mortality patterns based on\\ud sociodemographic m...

  16. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families

    DEFF Research Database (Denmark)

    Hansen, Thomas van Overeem; Jønson, Lars; Albrechtsen, Anders

    2010-01-01

    Germ-line mutations in the tumour suppressor proteins BRCA1 and BRCA2 predispose to breast and ovarian cancer. We have recently identified a Greenlandic Inuit BRCA1 nucleotide 234T>G/c.115T>G (p.Cys39Gly) founder mutation, which at that time was the only disease-causing BRCA1/BRCA2 mutation...... identified in this population. Here, we describe the identification of a novel disease-causing BRCA1 nucleotide 4803delCC/c.4684delCC mutation in a Greenlandic Inuit with ovarian cancer. The mutation introduces a frameshift and a premature stop at codon 1572. We have also identified a BRCA1 nucleotide 249T......>A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  17. Measurement of the total cross section difference {Delta}{sigma} {sub L} in np transmission at 1.19, 2.49 and 3.65 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Adiasevich, B.P. [Rossijskij Nauchnyj Tsentr ``Kurchatovskij Inst.``, Moscow (Russian Federation); Antonenko, V.G. [Rossijskij Nauchnyj Tsentr ``Kurchatovskij Inst.``, Moscow (Russian Federation); Averichev, S.A. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Azhgirey, L.S. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Ball, J. [Laboratoire National SATURNE, CNRS/IN2P3 and CEA/DSM, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Bazhanov, N.A. [Petersburg Nuclear Physics Institute, 188350, Gatchina (Russian Federation); Benda, B. [CEA-DAPNIA, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Borisov, N.S. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Borzunov, Yu.T. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Bunyatova, E.I. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Burinov, V.F. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Chernykh, E.V. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Dolgii, S.A. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Durand, G. [CEA-DAPNIA, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Dzyubak, A.P. [Kharkov Institute of Physics and Technology, Academicheskaya str. 1, 310108 Kharkov (Ukraine); Fedorov, A.N. [Laboratory of Particle Physics, JINR, 141980 Dubna, Moscow Region (Russian Federation); Fimushkin, V.V. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Fontaine, J.M. [Laboratoire National SATURNE, CNRS/IN2P3 and CEA/DSM, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Glagolev, V.V. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Golovanov, L.B.

    1996-06-01

    Results of the total cross section difference {Delta}{sigma} {sub L} in a np transmission experiment at 1.19, 2.49 and 3.65 GeV incident neutron beam kinetic energies are presented. Measurements were performed at the Synchrophasotron of the Laboratory of High Energies of the Joint Institute for Nuclear Research in Dubna. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The present results were obtained at the highest energies of free polarized neutrons that can be reached at present. They extend the energy range of existing results from PSI, LAMPF and Saclay measured between 0.066 and 1.10 GeV. The new results are compared with {Delta}{sigma} {sub L} (pn) data determined as a difference between {Delta}{sigma} {sub L} (pd) and {Delta}{sigma} {sub L} (pp) ANL-ZGS measurements. The values of {Delta}{sigma} {sub L} for the isospin state I=0 were deduced using known pp data. (orig.). With 5 figs., 7 tabs.

  18. 7 CFR 249.6 - Participant eligibility.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Participant Eligibility... eligibility. Participants must be not less than 60 years of age, except that State agencies may exercise the...

  19. 7 CFR 249.19 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Monitoring and Review of State..., threaten, coerce, or discriminate against any individual for the purpose of interfering with any right or...

  20. 249-IJBCS-Article-Dr Adomou Aristide

    African Journals Online (AJOL)

    Dr Gatsing

    MPE and Traoré D (eds). CAB. International: UK and Cambridge; 19-39. INSAE 2002. Troisième recensement général de la population et de l'habitat. Résultats définitifs: Tableaux statistiques Cotonou,. Bénin, 4p. Lebrun J, Gilbert G. 1954. Une classification écologique des forêts du Congo. Publ. I.N.E.A.C., sér. Sc., 63: 89.

  1. 249 Marriage Counselling in Multicultural Society, Nigerian ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... The researcher sees Multicultural Counselling as a helping relationship, which involves two or more ... pastors and elders in the counselling profession. Some recommendations were made as ... Multicultural counselling is a helping relationship which involves two or more persons with different culture, ...

  2. Publications | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In North Africa and the Middle East, rapid urban expansion is stressing local water sources and food production. Research shows ... Scientists and peasants combine traditional farming techniques and cutting-edge research to grow food sustainably in the high Andes, where the ecology is rapidly changing. Research focus.

  3. 32 CFR 249.5 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... professional associations, among others, can enhance the value of research and development sponsored by the... being permitted to present such data. (4) Meetings sponsored by a United States Government agency at... correlate in place and topic with open meetings of such societies to take advantage of the fact that...

  4. 7 CFR 249.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... participant's proxy, if proxies are allowed) and the date of each distribution; (vii) The payment procedures.../proxy and (if applicable) farmer are required to sign, stamp, or otherwise endorse the coupon before it... with farmers' market projects or programs, including information and data describing the attributes of...

  5. 7 CFR 249.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... contracts for farmers, farmers' markets, roadside stands, and/or CSA programs; developing a data processing... and Rural Investment Act of 2002, 7 U.S.C. 3007. Proxy means an individual authorized by an eligible... senior. The terms proxy and authorized representative may be used interchangeably for purposes of this...

  6. 7 CFR 249.18 - Audits.

    Science.gov (United States)

    2010-01-01

    ... of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Monitoring and Review of State... State agency and their contractors, for the purpose of making surveys, audits, examinations, excerpts...

  7. China Report, Economic Affairs, No. 249

    National Research Council Canada - National Science Library

    1982-01-01

    Partial Contents: National Policy And Issues, Economic Planning, Aggregate Economic Data, Economic Management, Finance and Banking, Mineral Resources, Industry, Construction, Domestic Trade, Foreign Trade, Labor...

  8. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis.. (VII) HFODD (v2.49t): A new version of the program

    Science.gov (United States)

    Schunck, N.; Dobaczewski, J.; McDonnell, J.; Satuła, W.; Sheikh, J. A.; Staszczak, A.; Stoitsov, M.; Toivanen, P.

    2012-01-01

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme-Hartree-Fock (HF) or Skyrme-Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite-temperature formalism for the HFB and HF + BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex-breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected. New version program summaryProgram title:HFODD (v2.49t) Catalogue identifier: ADFL_v3_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADFL_v3_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GNU General Public Licence v3 No. of lines in distributed program, including test data, etc.: 190 614 No. of bytes in distributed program, including test data, etc.: 985 898 Distribution

  9. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015: a systematic analysis for the Global Burden of Disease Study 2015.

    Science.gov (United States)

    2016-10-08

    Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249 causes in 195 countries and territories from 1980 to 2015. These results informed an in-depth investigation of observed and expected mortality patterns based on sociodemographic measures. We estimated all-cause mortality by age, sex, geography, and year using an improved analytical approach originally developed for GBD 2013 and GBD 2010. Improvements included refinements to the estimation of child and adult mortality and corresponding uncertainty, parameter selection for under-5 mortality synthesis by spatiotemporal Gaussian process regression, and sibling history data processing. We also expanded the database of vital registration, survey, and census data to 14 294 geography-year datapoints. For GBD 2015, eight causes, including Ebola virus disease, were added to the previous GBD cause list for mortality. We used six modelling approaches to assess cause-specific mortality, with the Cause of Death Ensemble Model (CODEm) generating estimates for most causes. We used a series of novel analyses to systematically quantify the drivers of trends in mortality across geographies. First, we assessed observed and expected levels and trends of cause-specific mortality as they relate to the Socio-demographic Index (SDI), a summary indicator derived from measures of income per capita, educational attainment, and fertility. Second, we examined factors affecting total mortality patterns through a series of counterfactual scenarios, testing the magnitude by which population growth, population age structures, and epidemiological changes contributed to shifts in mortality. Finally, we attributed changes in life expectancy to changes in cause of death. We documented each step of the GBD 2015 estimation

  10. ¿Serían la Guardia, Tutela y Curatela Bienes Jurídicos Penales? Un Análisis Crítico de los Arts. 248 y 249 del CP a la Luz de la Exclusiva Protección de Bienes Jurídicos

    Directory of Open Access Journals (Sweden)

    Gerson Faustino Rosa

    2015-12-01

    Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.

  11. 7 CFR 249.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP... management, accountability, certification, nutrition education, financial management systems, and coupon and...

  12. 48 CFR 53.249 - Termination of contracts.

    Science.gov (United States)

    2010-10-01

    ....6: (1) SF 1034 (GAO), Public Voucher for Purchases and Services Other Than Personal. (See 49.302(a... Proposal for Cost-Reimbursement Type Contracts. (See 49.602-1(c) and 49.302.) Standard Form 1437 is... for Partial Payment. (See 49.602-4.) Standard Form 1440 is authorized for local reproduction and a...

  13. Dicty_cDB: CHB249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTAGATTTCTTGGCATAGTAAAAAATTAC sequence update 2002.10.25 Translated Amino Acid sequence hcwptgiyftthsivcv*YK...VLFA DLDFLA**ki Translated Amino Acid sequence (All Frames) Frame A: hcwptgiyftth

  14. All projects related to | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: INSTITUTION BUILDING, EVALUATION TECHNIQUES, INSTITUTIONAL FRAMEWORK, LAW, POLICY MAKING, ADMINISTRATIVE REFORM. Region: North of Sahara, South of Sahara, North and Central America, South America, Central Asia, Far East Asia, South Asia, Bolivia, Brazil, Colombia, India, Kenya, Peru.

  15. Maternal and perinatal mortality figures in 249 South African ...

    African Journals Online (AJOL)

    Objective. To detennine maternal and perinatal mortalrty ratios in a large number of South African hospitals and assess the differences in mortality figures among the main ethnic groups. Design. Questionnaire survey involving confidential reports on maternal and perinatal deaths submitted over the 5-year period 1988 ...

  16. Dicty_cDB: AFF249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequences producing significant alignments: (bits) Value N AF222688 |AF222688.1 Dictyostelium discoideum dynaco...nificant alignments: (bits) Value AF222688_1( AF222688 |pid:none) Dictyostelium discoideum dynacorti... 503

  17. 7 CFR 249.24 - Data safeguarding procedures.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... programs; and (2) Containing the receiving organization's assurance that it will not, in turn, disclose the information to a third party. (c) The Comptroller General of the United States for audit and examination...

  18. 7 CFR 249.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ... representatives of FNS of the Comptroller General of the United States to inspect, audit, and copy. Any reports... reports. State agencies must submit financial and SFMNP performance data on a yearly basis as specified by... programs. (c) Source documentation. To be acceptable for audit purposes, all financial and SFMNP...

  19. 48 CFR 52.249-14 - Excusable Delays.

    Science.gov (United States)

    2010-10-01

    ... under its terms if the failure arises from causes beyond the control and without the fault or negligence... each instance, the failure to perform must be beyond the control and without the fault or negligence of... subcontractor, and without the fault or negligence of either, the Contractor shall not be deemed to be in...

  20. 7 CFR 2.49 - Administrator, Rural Housing Service.

    Science.gov (United States)

    2010-01-01

    ... distribution systems and supplemental and supporting structures if they are eligible for Rural Utilities... to aid low-income migrant and seasonal farmworkers (42 U.S.C. 5177a). (4) Administer the rural...

  1. 249 The Effect of Inter-tribal Post Election Violence Conflict Trauma ...

    African Journals Online (AJOL)

    User

    Behaviorists see maladjusted behavior as a result of trauma that occurs as we encounter disturbing experiences within our environment such as the post election violence that occurred in early 2008. From the point of view of the classical conditioning theory, an event like unanticipated ethnic violence will trigger certain ...

  2. Strategic Forum, Number 249, October 2009. Burma in Strategic Perspective: Renewing Discussion of Options

    Science.gov (United States)

    2009-10-01

    of arrests and detentions. Beginning in mid- September 2008, Buddhist monks led the conflict until a renewed government crack- down on September 26... monks showed them- selves as the most coherent Burmese organiza- tions capable of touching the people where they live, organizing rapidly to solve local

  3. 30 CFR 250.249 - What air emissions information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... calculations, including engine size and rating, and applicable operational information. (4) You must base the... include the frequency, duration, and maximum burn rate of any flaring activity. (d) Distance to shore...

  4. 249 The study examined the effect of climate change on the health ...

    African Journals Online (AJOL)

    Osondu

    Ebong, 2010). In Nigeria just as in many developing countries in the sub-tropical .... Nigeria. The Scientific community should be involved in the studying climate change and forecasting weather and then transmitting this information to all sectors of ...

  5. : tous les projets | Page 249 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Food security, NORTH AFRICA, MIDDLE EAST, WATER MANAGEMENT, PARTNERSHIP. Région: North of Sahara, South of Sahara, Morocco. Programme: Agriculture et sécurité alimentaire. Financement total : CA$ 414,100.00. Développement de l'irrigation et partenariats public-privé au Maroc. Projet. L'agriculture est ...

  6. S.I. No 249 of 1972, Factories Ionising Radiations (Unsealed Radioactive Substances) Regulations, 1972

    International Nuclear Information System (INIS)

    1972-12-01

    The Regulations which entered into force on 1 December 1972 apply to factories in which a process involving the use of unsealed radioactive substances is carried on and where the total activity of the unsealed radioactive substances exceeds specified levels, or where there are objects contaminated in excess of certain levels. The Schedules specify the maximum radiation doses and the maximum permissible levels of contamination and provide for a classification of radionuclides [fr

  7. 7 CFR 249.8 - Level of benefits and eligible foods.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP..., wild rice, nuts of any kind (even raw), maple syrup, cider, seeds, eggs, meat, cheese, and seafood are...

  8. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.

    Science.gov (United States)

    Speliotes, Elizabeth K; Willer, Cristen J; Berndt, Sonja I; Monda, Keri L; Thorleifsson, Gudmar; Jackson, Anne U; Lango Allen, Hana; Lindgren, Cecilia M; Luan, Jian'an; Mägi, Reedik; Randall, Joshua C; Vedantam, Sailaja; Winkler, Thomas W; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M; Steinthorsdottir, Valgerdur; Stringham, Heather M; Weedon, Michael N; Wheeler, Eleanor; Wood, Andrew R; Ferreira, Teresa; Weyant, Robert J; Segrè, Ayellet V; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpeläinen, Tuomas O; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tõnu; Feitosa, Mary F; Kutalik, Zoltán; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K; Absher, Devin M; Amin, Najaf; Dixon, Anna L; Fisher, Eva; Glazer, Nicole L; Goddard, Michael E; Heard-Costa, Nancy L; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Asa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F; Myers, Richard H; Narisu, Narisu; Perry, John R B; Peters, Marjolein J; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J; Timpson, Nicholas J; Tyrer, Jonathan P; van Wingerden, Sophie; Watanabe, Richard M; White, Charles C; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I; Cooper, Matthew N; Jansson, John-Olov; Lawrence, Robert W; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T S; Almgren, Peter; Arnold, Alice M; Aspelund, Thor; Atwood, Larry D; Balkau, Beverley; Balmforth, Anthony J; Bennett, Amanda J; Ben-Shlomo, Yoav; Bergman, Richard N; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I F; Boes, Tanja; Bonnycastle, Lori L; Bornstein, Stefan R; Brown, Morris J; Buchanan, Thomas A; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P; Cavalcanti-Proença, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N M; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R; Eriksson, Johan G; Facheris, Maurizio F; Felix, Stephan B; Fischer-Posovszky, Pamela; Folsom, Aaron R; Friedrich, Nele; Freimer, Nelson B; Fu, Mao; Gaget, Stefan; Gejman, Pablo V; Geus, Eco J C; Gieger, Christian; Gjesing, Anette P; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Grässler, Jürgen; Greenawalt, Danielle M; Groves, Christopher J; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S; Havulinna, Aki S; Hayward, Caroline; Heath, Andrew C; Hengstenberg, Christian; Hicks, Andrew A; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jørgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W; Kolcic, Ivana; König, Inke R; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaløy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J; Lecoeur, Cecile; Lehtimäki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G; McArdle, Wendy L; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W; Morken, Mario A; Morris, Andrew P; Mulic, Rosanda; Ngwa, Julius S; Nelis, Mari; Neville, Matt J; Nyholt, Dale R; O'Donnell, Christopher J; O'Rahilly, Stephen; Ong, Ken K; Oostra, Ben; Paré, Guillaume; Parker, Alex N; Perola, Markus; Pichler, Irene; Pietiläinen, Kirsi H; Platou, Carl G P; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W; Ridderstråle, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R; Sandhu, Manjinder S; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S; Smit, Jan H; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M; Thompson, John R; Thomson, Brian; Tönjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B J; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I G; Voight, Benjamin F; Waite, Lindsay L; Wallaschofski, Henri; Walters, G Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H; Willemsen, Gonneke; Witte, Daniel R; Witteman, Jacqueline C; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P; Farooqi, I Sadaf; Hebebrand, Johannes; Huikuri, Heikki V; James, Alan L; Kähönen, Mika; Levinson, Douglas F; Macciardi, Fabio; Nieminen, Markku S; Ohlsson, Claes; Palmer, Lyle J; Ridker, Paul M; Stumvoll, Michael; Beckmann, Jacques S; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I; Caulfield, Mark J; Chanock, Stephen J; Collins, Francis S; Cupples, L Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Grönberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B; Hattersley, Andrew T; Hayes, Richard B; Heinrich, Joachim; Hu, Frank B; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A; Metspalu, Andres; Munroe, Patricia B; Ouwehand, Willem H; Pedersen, Oluf; Penninx, Brenda W; Peters, Annette; Pramstaller, Peter P; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J; Schwarz, Peter E H; Shuldiner, Alan R; Spector, Timothy D; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, André; Valle, Timo T; Wabitsch, Martin; Waeber, Gérard; Wareham, Nicholas J; Watkins, Hugh; Wilson, James F; Wright, Alan F; Zillikens, M Carola; Chatterjee, Nilanjan; McCarroll, Steven A; Purcell, Shaun; Schadt, Eric E; Visscher, Peter M; Assimes, Themistocles L; Borecki, Ingrid B; Deloukas, Panos; Fox, Caroline S; Groop, Leif C; Haritunians, Talin; Hunter, David J; Kaplan, Robert C; Mohlke, Karen L; O'Connell, Jeffrey R; Peltonen, Leena; Schlessinger, David; Strachan, David P; van Duijn, Cornelia M; Wichmann, H-Erich; Frayling, Timothy M; Thorsteinsdottir, Unnur; Abecasis, Gonçalo R; Barroso, Inês; Boehnke, Michael; Stefansson, Kari; North, Kari E; McCarthy, Mark I; Hirschhorn, Joel N; Ingelsson, Erik; Loos, Ruth J F

    2010-11-01

    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and ∼ 2.8 million SNPs in up to 123,865 individuals with targeted follow up of 42 SNPs in up to 125,931 additional individuals. We confirmed 14 known obesity susceptibility loci and identified 18 new loci associated with body mass index (P < 5 × 10⁻⁸), one of which includes a copy number variant near GPRC5B. Some loci (at MC4R, POMC, SH2B1 and BDNF) map near key hypothalamic regulators of energy balance, and one of these loci is near GIPR, an incretin receptor. Furthermore, genes in other newly associated loci may provide new insights into human body weight regulation.

  9. Association analyses of 249,796 individuals reveal eighteen new loci associated with body mass index

    Science.gov (United States)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian’an; Mägi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segré, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpeläinen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tõnu; Feitosa, Mary F.; Kutalik, Zoltán; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Åsa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R.B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I.F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proença, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N.M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J.C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Gräßler, Jürgen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jørgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; König, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaløy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimäki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O’Donnell, Christopher J.; O’Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Paré, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietiläinen, Kirsi H.; Platou, Carl G.P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstråle, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Tönjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B.J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kähönen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Grönberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E.H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, André; Valle, Timo T.; Wabitsch, Martin; Waeber, Gérard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O’Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H.-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Gonçalo R.; Barroso, Inês; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J.F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but the underlying genetic factors remain largely elusive. To identify genetic loci for obesity-susceptibility, we examined associations between body mass index (BMI) and ~2.8 million SNPs in up to 123,865 individuals, with targeted follow-up of 42 SNPs in up to 125,931 additional individuals. We confirmed 14 known obesity-susceptibility loci and identified 18 new loci associated with BMI (P<5×10−8), one of which includes a copy number variant near GPRC5B. Some loci (MC4R, POMC, SH2B1, BDNF) map near key hypothalamic regulators of energy balance, and one is near GIPR, an incretin receptor. Furthermore, genes in other newly-associated loci may provide novel insights into human body weight regulation. PMID:20935630

  10. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    DEFF Research Database (Denmark)

    Speliotes, Elizabeth K; Willer, Cristen J; Berndt, Sonja I

    2010-01-01

    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and ~ 2.8 million SNPs in up to 123,865 individuals with targeted follow up of 42 SN...

  11. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    E.K. Speliotes (Elizabeth); C.J. Willer (Cristen); S.I. Berndt (Sonja); K.L. Monda (Keri); G. Thorleifsson (Gudmar); A.U. Jackson (Anne); H.L. Allen; C.M. Lindgren (Cecilia); J. Luan; R. Mägi (Reedik); J.C. Randall (Joshua); S. Vedantam (Sailaja); T.W. Winkler (Thomas); L. Qi (Lu); T. Workalemahu (Tsegaselassie); I.M. Heid (Iris); V. Steinthorsdottir (Valgerdur); H.M. Stringham (Heather); E. Wheeler (Eleanor); A.R. Wood (Andrew); T. Ferreira (Teresa); R.J. Weyant (Robert); A.V. Segrè (Ayellet); K. Eestrada (Karol); L. Liang (Liming); J. Nemesh (James); J.H. Park; S. Gustafsson (Stefan); T.O. Kilpeläinen (Tuomas); J. Yang (Joanna); N. Bouatia-Naji (Nabila); T. Eesko (Tõnu); M.F. Feitosa (Mary Furlan); Z. Kutalik (Zoltán); M. Mangino (Massimo); S. Raychaudhuri (Soumya); A. Scherag (Andre); A.V. Smith (Albert Vernon); R.P. Welch (Ryan); J.H. Zhao (Jing Hua); K.K.H. Aben (Katja); D. Absher (Devin); N. Amin (Najaf); A.L. Dixon (Anna); E. Fisher (Eeva); N.L. Glazer (Nicole); M.E. Goddard (Michael); N.L. Heard-Costa (Nancy); V. Hoesel (Volker); J.J. Hottenga (Jouke Jan); A. Johansson (Åsa); T. Johnson (Toby); S. Ketkar (Shamika); C. Lamina (Claudia); S. Li (Shengxu); M.F. Moffatt (Miriam); R.H. Myers (Richard); N. Narisu (Narisu); J.R.B. Perry (John); M.J. Peters (Marjolein); M. Preuss (Michael); S. Ripatti (Samuli); F. Rivadeneira Ramirez (Fernando); C. Sandholt (Camilla); L.J. Scott (Laura); N.J. Timpson (Nicholas); J.P. Tyrer (Jonathan); S. van Wingerden (Sophie); C.C. White (Charles); F. Wiklund (Fredrik); C. Barlassina (Christina); D.I. Chasman (Daniel); M.N. Cooper (Matthew); J.O. Jansson; R.W. Lawrence (Robert); N. Pellikka (Niina); I. Prokopenko (Inga); J. Shi (Jianxin); E. Thiering (Eelisabeth); H. Alavere (Helene); M.T.S. Alibrandi (Maria); P. Almgren (Peter); A.M. Arnold (Alice); T. Aspelund (Thor); L.D. Atwood (Larry); B. Balkau (Beverley); A.J. Balmforth (Anthony); A.J. Bennett (Amanda); Y. Ben-Shlomo; R.N. Bergman (Richard); S.M. Bergmann (Sven); H. Biebermann (Heike); A.I.F. Blakemore (Alexandra); T. Boes (Tanja); L.L. Bonnycastle (Lori); S.R. Bornstein (Stefan); M.J. Brown (Morris); T.A. Buchanan (Thomas); F. Busonero; H. Campbell (Harry); F.P. Cappuccio (Francesco); C. Cavalcanti-Proença (Christine); Y.D.I. Chen (Yii-Der Ida); C.-M. Chen (Chih-Mei); P.S. Chines (Peter); R. Clarke; L. Coin (Lachlan); J. Connell (John); I.N.M. Day (Ian); M. den Heijer (Martin); J. Duan (Jubao); S. Eebrahim (Shah); P. Eelliott (Paul); R. Eelosua (Roberto); G. Eeiriksdottir (Gudny); M.R. Eerdos (Micheal); J.G. Eeriksson (Johan); M.F. Facheris (Maurizio); S.B. Felix (Stephan); P. Fischer-Posovszky (Pamela); A.R. Folsom (Aaron); N. Friedrich (Nele); N.B. Freimer (Nelson); M. Fu (Mao); S. Gaget (Stefan); P.V. Gejman (Pablo); E.J. Geus (Eeco); C. Gieger (Christian); A.P. Gjesing (Anette); A. Goel (Anuj); P. Goyette (Philippe); H. Grallert (Harald); J. Gräßler (Jürgen); D. Greenawalt (Danielle); C.J. Groves (Christopher); V. Gudnason (Vilmundur); C. Guiducci (Candace); A.L. Hartikainen; N. Hassanali (Neelam); A.S. Hall (Alistair); A.S. Havulinna (Aki); C. Hayward (Caroline); A.C. Heath (Andrew); C. Hengstenberg (Christian); A.A. Hicks (Andrew); A. Hinney (Anke); A. Hofman (Albert); G. Homuth (Georg); J. Hui (Jennie); W. Igl (Wilmar); C. Iribarren (Carlos); B. Isomaa (Bo); K.B. Jacobs (Kevin); I. Jarick (Ivonne); E. Jewell (Eelizabeth); U. John (Ulrich); T. Jørgensen (Torben); P. Jousilahti (Pekka); A. Jula (Antti); M. Kaakinen (Marika); E. Kajantie (Eero); R.C. Kaplan (Robert); S. Kathiresan (Sekar); J. Kettunen (Johannes); L. Kinnunen (Leena); J.W. Knowles (Joshua); I. Kolcic (Ivana); I.R. König (Inke); S. Koskinen (Seppo); P. Kovacs (Peter); J. Kusisto (Johanna); P. Kraft (Peter); K. Kvaløy (Kirsti); J. Laitinen (Jaana); O. Lantieri (Olivier); C. Lanzani (Chiara); L.J. Launer (Lenore); C. Lecoeur (Cécile); T. Lehtimäki (Terho); G. Lettre (Guillaume); J. Liu (Jianjun); M.L. Lokki; M. Lorentzon (Mattias); R.N. Luben (Robert); B. Ludwig (Barbara); P. Manunta (Paolo); D. Marek (Diana); M. Marre (Michel); N.G. Martin (Nicholas); W.L. McArdle (Wendy); M.I. McCarthy (Mark); B. McKnight (Barbara); T. Meitinger (Thomas); O. Melander (Olle); D. Meyre (David); K. Midthjell (Kristian); G.W. Montgomery (Grant); M.A. Morken (Mario); A.D. Morris (Andrew); R. Mulic (Rosanda); J.S. Ngwa; M. Nelis (Mari); M.J. Neville (Matthew); D.R. Nyholt (Dale); C.J. O'Ddonnell (Christopher); S. O'Rahilly (Stephen); K. Ong (Ken); B.A. Oostra (Ben); G. Paré (Guillaume); A.N. Parker (Alex); M. Perola (Markus); I. Pichler (Irene); K.H. Pietilainen (Kirsi Hannele); C.P. Platou (Carl); O. Polasek (Ozren); A. Pouta (Anneli); S. Rafelt (Suzanne); O. Raitakari (Olli); N.W. Rayner (Nigel William); M. Ridderstråle (Martin); W. Rief (Winfried); A. Ruokonen (Aimo); N.R. Robertson (Neil); P. Rzehak (Peter); V. Salomaa (Veikko); A.R. Sanders (Alan); M.S. Sandhu (Manjinder); S. Sanna (Serena); J. Saramies (Jouko); M.J. Savolainen (Markku); S. Schipf (Sabine); S. Schreiber (Stefan); H. Schunkert (Heribert); K. Silander (Kaisa); J. Sinisalo (Juha); D.S. Siscovick (David); J.H. Smit (Jan); N. Soranzo (Nicole); U. Sovio (Ulla); J. Stephens (Jonathan); I. Surakka (Ida); A.J. Swift (Amy); M.L. Tammesoo; J.-C. Tardif (Jean-Claude); M. Teder-Laving (Maris); T.M. Teslovich (Tanya); J.R. Thompson (John); B. Thomson (Brian); A. Tönjes (Anke); T. Tuomi (Tiinamaija); J.B.J. van Meurs (Joyce); G.J. van OMen; V. Vatin (Vincent); J. Viikari (Jorma); S. Visvikis-Siest (Sophie); V. Vitart (Veronique); C.I. Vogel (Carla); B.F. Voight (Benjamin); L. Waite (Lindsay); H. Wallaschofski (Henri); G.B. Walters (Bragi); E. Widen (Elisabeth); S. Wiegand (Susanna); S.H. Wild (Sarah); G.A.H.M. Willemsen (Gonneke); D.R. Witte (Deniel); J.C.M. Witteman (Jacqueline); J. Xu (Jianfeng); Q. Zhang (Qunyuan); L. Zgaga (Lina); A. Ziegler (Andreas); P. Zitting (Paavo); J.P. Beilby (John); I.S. FarOqi (Ssadaf); J. Hebebrand (Johannes); H.V. Huikuri (Heikki); A. James (Alan); M. Kähönen (Mika); D.F. Levinson (Douglas); F. MacCiardi (Fabio); M.S. Nieminen (Markku); C. Ohlsson (Claes); C. Palmer (Cameron); P.M. Ridker (Paul); M. Stumvoll (Michael); J.S. Beckmann (Jacques); H. Boeing (Heiner); E.A. Boerwinkle (Eric); D.I. Boomsma (Dorret); M. Caulfield (Mark); S.J. Chanock (Stephen); F.S. Collins (Francis); L.A. Cupples (Adrienne); J. Eerdmann (Jeanette); P. Frogue (Philippe); H. Grönberg (Henrik); U. Gyllensten (Ulf); T. Hansen (Torben); T.B. Harris (Tamara); A.T. Hattersley (Andrew); R.B. Hayes (Richard); J. Heinrich (Joachim); F.B. Hu (Frank); K. Hveem (Kristian); T. Illig (Thomas); M.R. Järvelin; J. Kaprio (Jaakko); F. Karpe (Fredrik); K-T. Khaw (Kay-Tee); L.A.L.M. Kiemeney (Bart); H. Krude; M. Laakso (Markku); D.A. Lawlor (Debbie); A. Metspalu (Andres); P. Munroe (Patricia); W.H. Ouwehand (Willem); O. Pedersen (Oluf); B.W.J.H. Penninx (Brenda); P.P. Pramstaller (Peter Paul); T. Quertermous (Thomas); T. Reinehr (Thomas); A. Rissanen (Aila); I. Rudan (Igor); N.J. Samani (Nilesh); P.E.H. Schwarz (Peter); A.R. Shuldiner (Alan); T.D. Spector (Timothy); J. Tuomilehto (Jaakko); M. Uda (Manuela); A.G. Uitterlinden (André); T.T. Valle (Timo); M. Wabitsch (Martin); G. Waeber (Gérard); N.J. Wareham (Nick); H. Watkins (Hugh); J.F. Wilson (James); A.F. Wright (Alan); M.C. Zillikens (Carola); N. ChatterjE (Nilanjan); S.A. McCarroll (Steve); S. Purcell (Shaun); E.E. Schadt (Eric); P.M. Visscher (Peter); T.L. Assimes (Themistocles); I.B. Borecki (Ingrid); P. Deloukas (Panagiotis); C.S. Fox (Caroline); L. Groop (Leif); T. Haritunians (Talin); D.J. Hunter (David); K.L. Mohlke (Karen); J.R. O'ConneL (Jeffrey); L. Peltonen (Leena Johanna); D. SchleSinger (David); D.P. Strachan (David); R.M. Watanabe (Richard); C.M. van Duijn (Cornelia); H.E. Wichmann (Heinz Erich); T.M. Frayling (Timothy); U. Thorsteinsdottir (Unnur); G.R. Abecasis (Gonçalo); M. Boehnke (Michael); K. StefanSon (Kari); K.E. North (Kari); M.I. McArthy (Mark); J.N. Hirschhorn (Joel); E. IngelSon (Erik); R.J.F. Loos (Ruth); M.N. Weedon (Michael)

    2010-01-01

    textabstractObesity is globaLy prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined aSociations betwEn body maS index and ĝ̂1/42.8 miLion SNPs in up to 123,865 individuals with targeted foLow up of

  12. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian'an; Maegi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segre, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpelaenen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tonu; Feitosa, Mary F.; Kutalik, Zoltan; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Asa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R. B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I. F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proenca, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N. M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J. C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Graessler, Juergen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jorgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; Koenig, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaloy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimaeki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O'Donnell, Christopher J.; O'Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Pare, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietilaeinen, Kirsi H.; Platou, Carl G. P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstrale, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Toenjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B. J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kaehoenen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Greonberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E. H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, Andre; Valle, Timo T.; Wabitsch, Martin; Waeber, Gerard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O'Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Goncalo R.; Barroso, Ines; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J. F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and similar to 2.8 million SNPs in up to 123,865 individuals with targeted follow up of

  13. People and things. CERN Courier, Nov 1984, v. 24(9)

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A landmark event took place at Stanford on 3-4 August in the form of a ' Pief-fest', a celebration tacked onto the end of the traditional annual Stanford Linear Accelerator Center (SLAC) Summer Institute to mark the retirement of Wolfgang 'Pief Panofsky as the Laboratory's Director.The University of California's Lawrence Berkeley Laboratory has been chosen as the host institution for the Central Design Group for the Superconducting Super Collider (SSC). The fifth Topical Workshop on Proton-Antiproton Collider Physics will be held in Saint-Vincent, Aosta Valley, Italy, from 25 February to 2 March 1985. The local users' organization at the Stanford Linear Accelerator Center is organizing a Workshop on Electron-Positron Physics at High Luminosities, to be held at SLAC from 30 November to 1 December. The Aspen (Colorado, USA) Center for Physics announces a Winter Physics Conference Series - Collider Physics at Ultrahigh Energies from 6-12 January 1985 and Electro weak Interactions from 13- 19 January. As this edition was going to press, the CERN SPS protonantiproton collider was back in action for physics for the first time since the historic run last year which produced the Z particle and the first evidence for the sixth ('top') quark

  14. 7 CFR 249.16 - Administrative appeal of State agency decisions.

    Science.gov (United States)

    2010-01-01

    ... farmer, farmers' market, roadside stand, and/or CSA program may appeal an action of the State agency... the decision. (g) Additional appeals procedures for State agencies that authorize farmers' markets and not individual farmers. A State agency that authorizes farmers' markets and not individual farmers...

  15. 75 FR 69870 - Delegation of Authority Under 18 U.S.C. 249

    Science.gov (United States)

    2010-11-16

    .... 2340A), war crimes (18 U.S.C. 2441), or recruitment or use of child soldiers (18 U.S.C. 2442). Dated..., relating to hate crimes, to the Assistant Attorney General for the Civil Rights Division, and, in limited... Shepard and James Byrd, Jr., Hate Crimes Prevention Act of 2009 (Shepard-Byrd Act). Among other things...

  16. 239,249Pu and 137Cs in the air in Kurchatov, Kazakhstan

    International Nuclear Information System (INIS)

    Lehto, J.; Salminen, S.; Jaakkola, T.

    2005-01-01

    The Semipalatinsk nuclear test site is heavily contaminated from the 465 nuclear weapons tests conducted between 1948 and 1989. Approximately 120 of these tests were surface and air explosions that resulted in the most serious contamination of the soil. Most of these surface and air explosions were carried out on the Experimental Field, on the northern part of the site, about 70 southwest of town Kurchatov. In this area the Pu fallout is even higher than 100.000 Bq/m 2 whereas in the Kurchatov area it is round 1000 Bq/m 2 . In Finland, affected only by the global fallout, a typical value is 30-40 Bq/m 2 . A Finnish team carried out air sampler testing in Kurchatov in 2000-2001. Weekly air samples of 25.000 m 3 volume were taken in a one-year period in Kurchatov. After removal from the samplers the filters were brought to Finland and the gamma nuclides were determined by gamma spectrometry in the laboratories of the Finnish Authority for Radiation and Nuclear Safety (STUK). Then in the Laboratory of Radiochemistry they were leached with concentrated nitric acid and plutonium and uranium isotopes were separated by extraction chromatography using UTEVA and TRU. Plutonium isotopes were measured by alpha spectrometry and the uranium fraction was sent to the Technical Research Centre of Finland for uranium analysis with ICP-MS. Plutonium concentrations in the air in Kurchatov varied in a 100-fold range. The median value for 239,240 Pu was 100 nBq/m 3 and the range was from 14 to 2500 nBq/m 3 . There was no clear seasonal variation seen although somewhat elevated levels were found in February to April. The air concentrations of plutonium were clearly elevated compared to the values found in countries that were affected only by the global fallout. For example, in Munich, Germany, values between 2 and 6 nBq/m 3 have been reported in 1987-1991. However, considerably higher values than those observed in this study have been reported for village Dolon, 30 kilometers east of Kurchatov, where concentrations from 7.400 to 37.000 nBq/m 3 were measured by Dubasov et al. They also determined naturally occurring 210 Po in their air filters and found that its concentration was 1000-times higher than that of plutonium. Concentration of 137 Cs in the air was mainly below the detection limit but in those samples where it was detected the average value was 3.9±1.6 μBq/m 3 . Radiation doses to the population of Kurchatov due to inhalation of air, estimated by the ICRP methodology, were found to be rather low: 0.013 μSv/a for 239,240 Pu and 0.001 μSv/a for 137 Cs at maximum. The annual dose caused by the naturally occurring 210 Po is considerably higher: 13 μSv/a.

  17. 78 FR 12140 - Agency Information Collection; Activity Under OMB Review; Part 249 Preservation of Records

    Science.gov (United States)

    2013-02-21

    ... Statistics (BTS), DOT. ACTION: Notice. SUMMARY: In compliance with the Paperwork Reduction Act of 1995... governmental parties to comment on the continuing need for and usefulness of BTS requiring certificated air... CONTACT: Jeff Gorham, Office of Airline Information, RTS-42, Room E34, RITA, BTS, 1200 New Jersey Avenue...

  18. 75 FR 3275 - Agency Information Collection; Activity Under OMB Review; Part 249, Preservation of Records

    Science.gov (United States)

    2010-01-20

    ... Statistics (BTS), DOT. ACTION: Notice. SUMMARY: In compliance with the Paperwork Reduction Act of 1995 (44 U... Information, RTS-42, Room E34-409, RITA, BTS, 1200 New Jersey Avenue, SE., Washington, DC 20590-0001...-statistical purposes. BTS hereby notifies the respondents and the public that BTS uses the information it...

  19. 48 CFR 1652.249-72 - FEHBP termination for default-negotiated benefits contracts.

    Science.gov (United States)

    2010-10-01

    ... negligence of the Carrier. Examples of such causes include (1) acts of God or of the public enemy, (2) acts... negligence of the Carrier. (d) If the failure to perform is caused by the default of a subcontractor at any... without the fault or negligence of either, the Carrier shall not be liable for any excess costs for...

  20. Study of 249BkBr3 dimorphism by absorption spectrometry and X ray diffraction

    International Nuclear Information System (INIS)

    Peterson, J.R.; Fellows, R.L.; Young, J.P.; Haire, R.G.

    1977-01-01

    The phase transformation that occurs in solid BkBr 3 was studied by absorption spectroscopy and X-ray diffraction. Both techniques were applied to each 2-12 microgram sample at ambient and elevated temperatures. Significant increases in the f-f transition intensities were observed when the crystal structure was changed from the AlCl 3 -type monoclinic to the PuBr 3 -type orthorhombic form. The high-temperature monoclinic form can be maintained at room temperature by quenching the sample from above 350 deg C. By following the absorption intensity changes, it is also possible to study the kinetics of the phase transformation in the temperature range of 200-350 deg C [fr

  1. 17 CFR 249.103 - Form 3, initial statement of beneficial ownership of securities.

    Science.gov (United States)

    2010-04-01

    ... information in investigations or litigation involving the federal securities laws or other civil, criminal, or... affecting Form 3, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  2. 17 CFR 249.104 - Form 4, statement of changes in beneficial ownership of securities.

    Science.gov (United States)

    2010-04-01

    ... can use the information in investigations or litigation involving the federal securities laws or other... citations affecting Form 4, see the List of CFR Sections Affected, which appears in the Finding Aids section...

  3. 17 CFR 249.105 - Form 5, annual statement of beneficial ownership of securities.

    Science.gov (United States)

    2010-04-01

    ... information in investigations or litigation involving the federal securities laws or other civil, criminal, or... affecting Form 5, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  4. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    Speliotes, E.K.; Willer, C.J.; Berndt, S.I.; Monda, K.L.; Thorleifson, G.; Jackson, A.U.; Lango Allen, H.; Lindgren, C.M.; Luan, J.; Mägi, R.; Hottenga, J.J.; de Geus, E.J.C.; Martin, N.G.; Willemsen, G.; Boomsma, D.I.; Penninx, B.W.J.H.; Uitterlinden, A.G.; Zillikens, M.C.; Visscher, P.M.; Peltonen, L.; van Duijn, C.M.; Thorsteinsdottir, U.; Abecasis, G.R.; Barroso, I.; Boehnke, M.; Stefansson, K.; North, K.E.; McCarthy, M.I.; Hirschhorn, J.N.; Ingelsson, E.; Loos, R.J.F.

    2010-01-01

    Obesity is globaLy prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined aSociations betwEn body maS index and ĝ̂1/42.8 miLion SNPs in up to 123,865 individuals with targeted foLow up of 42 SNPs in

  5. 14 CFR 249.20 - Preservation of records by certificated air carriers.

    Science.gov (United States)

    2010-01-01

    ..., delays and related information 3 years. (e) Sales reports: (1) Sales ticket or other similar reports from... contracts and agreements; records and agreements relating to the lease or purchase and sale of company... Do. (i) Ticket refund claims records and reports Do. (j) Records and reports relating to errors...

  6. 48 CFR 52.249-9 - Default (Fixed-Price Research and Development).

    Science.gov (United States)

    2010-10-01

    ... Officer) after receipt of the notice from the Contracting Officer specifying the failure. (b) If the... Government has an interest. (f) The Government shall pay the contract price, if separately stated, for... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of...

  7. 48 CFR 52.249-8 - Default (Fixed-Price Supply and Service).

    Science.gov (United States)

    2010-10-01

    ... such failure within 10 days (or more if authorized in writing by the Contracting Officer) after receipt... Government shall pay contract price for completed supplies delivered and accepted. The Contractor and... 10 days (or more if authorized in writing by the Contracting Officer) after receipt of the notice...

  8. Intake assessment of the food additives nitrite (E 249 and E 250) and nitrate (E 251 and E 252)

    NARCIS (Netherlands)

    Sprong RC; Niekerk EM; Beukers MH; VVH; V&Z

    2017-01-01

    Nitrate and nitrite are authorised as preservatives in certain food products, such as salami, ham (nitrite) and cheese (nitrate). They prevent food spoilage and protect the consumer against food-borne pathogens. Next to that, nitrate and nitrite play a role in food colour retention and contribute to

  9. The House of Commons of Canada, Bill C-249: An act to amend the nuclear liability act

    International Nuclear Information System (INIS)

    1996-01-01

    The purpose of this bill is to increase the maximum level of liability for which a private sector nuclear facility operator may be required to have insurance coverage from 75 million dollars to 500 million dollars. If the Governor in Council is of the opinion that liability could exceed the insured amount and a Commission created under Part II of the Act orders that further compensation should be made. At present, the Crown may make such payments but is not required to do so

  10. Photo-induced effects of the virgin Ge24.9Sb11.6S63.5 film

    Czech Academy of Sciences Publication Activity Database

    Knotek, P.; Tichý, Ladislav; Kutálek, P.

    594 Part A, Nov 2 (2015), s. 67-73 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : chalcogenides * thin film * photo induced effects Subject RIV: CA - Inorganic Chemistry Impact factor: 1.761, year: 2015 http://www.sciencedirect.com/science/article/pii/S0040609015009372

  11. SU-E-J-249: Correlation of Mean Lung Ventilation Value with Ratio of Total Lung Volumes

    International Nuclear Information System (INIS)

    Yu, N; Qu, H; Xia, P

    2014-01-01

    Purpose: Lung ventilation function measured from 4D-CT and from breathing correlated CT images is a novel concept to incorporate the lung physiologic function into treatment planning of radiotherapy. The calculated ventilation functions may vary from different breathing patterns, affecting evaluation of the treatment plans. The purpose of this study is to correlate the mean lung ventilation value with the ratio of the total lung volumes obtained from the relevant CTs. Methods: A ventilation map was calculated from the variations of voxel-to-voxel CT densities from two breathing phases from either 4D-CT or breathing correlated CTs. An open source image registration tool of Plastimatch was used to deform the inhale phase images to the exhale phase images. To calculate the ventilation map inside lung, the whole lung was delineated and the tissue outside the lung was masked out. With a software tool developed in house, the 3D ventilation map was then converted in the DICOM format associated with the planning CT images. The ventilation map was analyzed on a clinical workstation. To correlate ventilation map thus calculated with lung volume change, the total lung volume change was compared the mean ventilation from our method. Results: Twenty two patients who underwent stereotactic body irradiation for lung cancer was selected for this retrospective study. For this group of patients, the ratio of lung volumes for the inhale (Vin ) and exhale phase (Vex ) was shown to be linearly related to the mean of the local ventilation (Vent), Vin/Vex=1.+0.49*Vent (R2=0.93, p<0.01). Conclusion: The total lung volume change is highly correlated with the mean of local ventilation. The mean of local ventilation may be useful to assess the patient's lung capacity

  12. SU-E-T-249: Neutron Model Upgrade for Radiotherapy Patients Monitoring Using a New Online Detector

    Energy Technology Data Exchange (ETDEWEB)

    Irazola, L; Sanchez Doblado, F. [Departamento de Fisiologia Medica y Biofisica, Universidad de Sevilla (Spain); Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Lorenzoli, M; Pola, A. [Politecnico di Milano, Departimento di Ingegneria Nuclear, Milano (Italy); Terron, J.A. [Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Bedogni, R. [Laboratori Nazionali di Frascati, Istituto Nazionale di Fisica Nucleare (INFN) (Italy); Sanchez Nieto, B. [Instituto de Fisica, Pontificia Universidad Catolica de Chile, Santiago (Chile); Romero-Exposito, M. [Departamento de Fisica, Universitat Autonoma de Barcelona (Spain)

    2014-06-01

    Purpose: The purpose of this work is to improve the existing methodology to estimate neutron equivalent dose in organs during radiotherapy treatments, based on a Static Random Access Memory neutron detector (SRAMnd) [1]. This is possible thanks to the introduction of a new digital detector with improved characteristics, which is able to measure online the neutron fluence rate in the presence of an intense photon background [2]. Its reduced size, allows the direct estimation of doses in specific points inside an anthropomorphic phantom (NORMA) without using passive detectors as TLD or CR-39. This versatility will allow not only to improve the existing models (generic abdomen and H and N [1]) but to generate more specific ones for any technique. Methods: The new Thermal Neutron Rate Detector (TNRD), based on a diode device sensitized to thermal neutrons, have been inserted in 16 points of the phantom. These points are distributed to infer doses to specific organs. Simultaneous measurements of these devices and a reference one, located in front of the gantry, have been performed for the mentioned generic treatments, in order to improve the existing model. Results: These new devices have shown more precise since they agree better with Monte Carlo simulations. The comparison of the thermal neutron fluence, measured with TNRD, and the existing models, converted from events to fluence, shows an average improvement of (3.90±3.37) % for H and N and (12.61±9.43) % for abdomen, normalized to the maximum value. Conclusion: This work indicates the potential of these new devices for more precise neutron equivalent dose estimation in organs, as a consequence of radiotherapy treatments. The simplicity of the process makes possible to establish more specific models that will provide a better dose estimation. References[1] Phys Med Biol 2012; 57:6167–6191.[2] A new active thermal neutron detector. Radiat. Prot. Dosim. (in press)

  13. SU-F-T-249: Application of Human Factors Methods: Usability Testing in the Radiation Oncology Environment

    Energy Technology Data Exchange (ETDEWEB)

    Warkentin, H [Cross Cancer Institute, Edmonton, AB (Canada); Bubric, K [Alberta Health Services, Calgary, AB (Canada); Giovannetti, H [Jack Ady Cancer Centre, Lethbridge, AB (Canada); Graham, G [Tom Baker Cancer Centre, Calgary, AB (Canada); Clay, C [Central Alberta Cancer Centre, Red Deer, AB (Canada)

    2016-06-15

    Purpose: As a quality improvement measure, we undertook this work to incorporate usability testing into the implementation procedures for new electronic documents and forms used by four affiliated radiation therapy centers. Methods: A human factors specialist provided training in usability testing for a team of medical physicists, radiation therapists, and radiation oncologists from four radiotherapy centers. A usability testing plan was then developed that included controlled scenarios and standardized forms for qualitative and quantitative feedback from participants, including patients. Usability tests were performed by end users using the same hardware and viewing conditions that are found in the clinical environment. A pilot test of a form used during radiotherapy CT simulation was performed in a single department; feedback informed adaptive improvements to the electronic form, hardware requirements, resource accessibility and the usability testing plan. Following refinements to the testing plan, usability testing was performed at three affiliated cancer centers with different vault layouts and hardware. Results: Feedback from the testing resulted in the detection of 6 critical errors (omissions and inability to complete task without assistance), 6 non-critical errors (recoverable), and multiple suggestions for improvement. Usability problems with room layout were detected at one center and problems with hardware were detected at one center. Upon amalgamation and summary of the results, three key recommendations were presented to the document’s authors for incorporation into the electronic form. Documented inefficiencies and patient safety concerns related to the room layout and hardware were presented to administration along with a request for funding to purchase upgraded hardware and accessories to allow a more efficient workflow within the simulator vault. Conclusion: By including usability testing as part of the process when introducing any new document or procedure into clinical use, associated risks can be identified and mitigated before patient care and clinical workflow are impacted.

  14. Prototype coupling of the CFD software ansys CFX with the 3D neutron kinetic core model DYN3D - 249

    International Nuclear Information System (INIS)

    Kliem, S.; Rohde, U.; Schutze, J.; Frank, Th.

    2010-01-01

    The CFD code ANSYS CFX has been coupled with the neutron-kinetic core model DYN3D. ANSYS CFX calculates the fluid dynamics and related transport phenomena in the reactor's coolant and provides the corresponding data to DYN3D. In the fluid flow simulation of the coolant, the core itself is modeled within the porous body approach. DYN3D calculates the neutron kinetics and the fuel behavior including the heat transfer to the coolant. The physical data interface between the codes is the volumetric heat release rate into the coolant. In the prototype that is currently available, the coupling is restricted to single-phase flow problems. In the time domain an explicit coupling of the codes has been implemented so far. Steady-state and transient verification calculations for a small-size test problem confirm the correctness of the implementation of the prototype coupling. This test problem was a mini-core consisting of nine real-size fuel assemblies. Comparison was performed with the DYN3D standalone code. In the steady state, the effective multiplication factor obtained by the ANSYS CFX/DYN3D codes shows a deviation of 9.8 pcm from the DYN3D stand-alone solution. This difference can be attributed to the use of different water property packages in the two codes. The transient test case simulated the withdrawal of the control rod from the central fuel assembly at hot zero power. Power increase during the introduction of positive reactivity and power reduction due to fuel temperature increase are calculated in the same manner by the coupled and the stand-alone codes. The maximum values reached during the power rise differ by about 1 MW at a power level of 50 MW. Beside the different water property packages, these differences are caused by the use of different flow solvers. (authors)

  15. SU-F-T-249: Application of Human Factors Methods: Usability Testing in the Radiation Oncology Environment

    International Nuclear Information System (INIS)

    Warkentin, H; Bubric, K; Giovannetti, H; Graham, G; Clay, C

    2016-01-01

    Purpose: As a quality improvement measure, we undertook this work to incorporate usability testing into the implementation procedures for new electronic documents and forms used by four affiliated radiation therapy centers. Methods: A human factors specialist provided training in usability testing for a team of medical physicists, radiation therapists, and radiation oncologists from four radiotherapy centers. A usability testing plan was then developed that included controlled scenarios and standardized forms for qualitative and quantitative feedback from participants, including patients. Usability tests were performed by end users using the same hardware and viewing conditions that are found in the clinical environment. A pilot test of a form used during radiotherapy CT simulation was performed in a single department; feedback informed adaptive improvements to the electronic form, hardware requirements, resource accessibility and the usability testing plan. Following refinements to the testing plan, usability testing was performed at three affiliated cancer centers with different vault layouts and hardware. Results: Feedback from the testing resulted in the detection of 6 critical errors (omissions and inability to complete task without assistance), 6 non-critical errors (recoverable), and multiple suggestions for improvement. Usability problems with room layout were detected at one center and problems with hardware were detected at one center. Upon amalgamation and summary of the results, three key recommendations were presented to the document’s authors for incorporation into the electronic form. Documented inefficiencies and patient safety concerns related to the room layout and hardware were presented to administration along with a request for funding to purchase upgraded hardware and accessories to allow a more efficient workflow within the simulator vault. Conclusion: By including usability testing as part of the process when introducing any new document or procedure into clinical use, associated risks can be identified and mitigated before patient care and clinical workflow are impacted.

  16. 75 FR 19880 - Safety Zone; BW PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico

    Science.gov (United States)

    2010-04-16

    ..., cruise ships, tugs with tows and the occasional recreational vessel. The deepwater area also includes an... zone around the FPSO BW PIONEER which is an offshore production facility that is typically ship-shaped... governments and would either preempt State law or impose a substantial direct cost of compliance on them. We...

  17. Cause-specific mortality for 249 causes in Brazil and states during 1990–2015: a systematic analysis for the global burden of disease study 2015

    Directory of Open Access Journals (Sweden)

    Elisabeth B. França

    2017-11-01

    Full Text Available Abstract Background Reliable data on cause of death (COD are fundamental for planning and resource allocation priorities. We used GBD 2015 estimates to examine levels and trends for the leading causes of death in Brazil from 1990 to 2015. Methods We describe the main analytical approaches focused on both overall and specific causes of death for Brazil and Brazilian states. Results There was an overall improvement in life expectancy at birth from 1990 to 2015, but with important heterogeneity among states. Reduced mortality due to diarrhea, lower respiratory infections, and other infectious diseases contributed the most for increasing life expectancy in most states from the North and Northeast regions. Reduced mortality due to cardiovascular diseases was the highest contributor in the South, Southeast, and Center West regions. However, among men, intentional injuries reduced life expectancy in 17 out of 27 states. Although age-standardized rates due to ischemic heart disease (IHD and cerebrovascular disease declined over time, these remained the leading CODs in the country and states. In contrast, leading causes of premature mortality changed substantially - e.g., diarrheal diseases moved from 1st to 13th and then the 36th position in 1990, 2005, and 2015, respectively, while violence moved from 7th to 1st and to 2nd. Overall, the total age-standardized years of life lost (YLL rate was reduced from 1990 to 2015, bringing the burden of premature deaths closer to expected rates given the country’s Socio-demographic Index (SDI. In 1990, IHD, stroke, diarrhea, neonatal preterm birth complications, road injury, and violence had ratios higher than the expected, while in 2015 only violence was higher, overall and in all states, according to the SDI. Conclusions A widespread reduction of mortality levels occurred in Brazil from 1990 to 2015, particularly among children under 5 years old. Major shifts in mortality rates took place among communicable, maternal, neonatal, and nutritional disorders. The mortality profile has shifted to older ages with increases in non-communicable diseases as well as premature deaths due to violence. Policymakers should address health interventions accordingly.

  18. 33 CFR 207.249 - Ouachita and Black Rivers, Ark. and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of...

    Science.gov (United States)

    2010-07-01

    ... not provided as part of the Red River Locks and Dams. When water levels rise to within 2 feet of the.... and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of the Black River; the Red River, La., Mile 6.7 (Junction of Red, Atchafalaya and Old Rivers) to Mile 276.0 (Shreveport, La.); use...

  19. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  20. Measurement of the total cross section difference ΔσL in np transmission at 1.19, 2.49 and 3.65 GeV

    International Nuclear Information System (INIS)

    Averichev, S.A.; Ball, J.; Bazhanov, N.A.; Dzyubak, A.P.; Fedorov, A.N.; Grosnick, D.P.; Gurevich, G.M.

    1996-01-01

    Results of the total cross section difference Δσ L in a np transmission experiment are presented. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The new results are compared with Δσ L (pn) data determined as a difference between Δσ L (pd) and Δσ L (pp) ANL-ZGS measurements. The values of Δσ L for the isospin state I=0 were deduced using known pp data. (author)

  1. Book Review: Philosophy and geometry: theoretical and historical issues. Lorenzo Magnani, Kluwer Academic Publishers, Dordrecht, 2001, pp. xix + 249, US 88. ISBN 0-792-36933-5

    Science.gov (United States)

    Torretti, Roberto

    The best philosophers have been fascinated with geometry ever since the inception of both traditions in 5th century Greece. They have perceived the apparent certainty of geometrical propositions as an intimation that an equally secure knowledge can be had on a subject of the greatest practical concern, viz., the principles of morals. They also have sought to find-as is their wont-reasons for that certainty. This search has given rise to the theoretical and historical issues magisterially reviewed in this book by Lorenzo Magnani. He focuses his attention especially on Kant (Chapters 2 and 3), Poincaré (Chapter 5) and Husserl (Chapter 7.2), and on their original and importantly different ways of explaining the true nature and source of geometrical truth. Despite their diversity, all three can be said to share a trait that is rarely emphasized and which Magnani brings out in full force in his study of Kant. Chapter 2 is called "Geometry: the Model of Knowledge", and his detailed and very able presentation of Kant's philosophy of geometry in this chapter and the next stresses the paradigmatic role of geometrical knowledge in Kant's conception of science. This role is even clearer in the case of Poincaré, whose conventionalism was rooted in his view of geometry but was eventually extended to all the foundations of physics. An enterprising scholar might even try to make a similar point with regard to Husserl, whose views on the establishment of objectivity and science appear to fit geometry better than any other branch of knowledge.

  2. 17 CFR 249.240f - Form 40-F, for registration of securities of certain Canadian issuers pursuant to section 12(b...

    Science.gov (United States)

    2010-04-01

    ... obligations; and (4) The aggregate market value of the public float of the registrant's outstanding equity... of Canada or a Province or Territory of Canada. 3. For purposes of this Form, the “public float” of... securities is in bankruptcy or receivership or has an accumulated capital deficit, in which case one-third of...

  3. 17 CFR 249.220f - Form 20-F, registration of securities of foreign private issuers pursuant to section 12(b) or (g...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 20-F, registration of securities of foreign private issuers pursuant to section 12(b) or (g), annual and transition reports...-F, registration of securities of foreign private issuers pursuant to section 12(b) or (g), annual...

  4. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    Energy Technology Data Exchange (ETDEWEB)

    Nawrocki, J [Duke University Medical Physics Graduate Program, Durham, NC (United States); Chino, J; Craciunescu, O [Duke University Medical Center Department of Radiation Oncology, Durham, NC (United States); Das, S [University of North Carolina School of Medicine, Chapel Hill, NC (United States)

    2015-06-15

    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation.

  5. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  6. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125579)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  7. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125648)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  8. Nuclear Liability Act of 8 March 1968 (No. 45) as amended by an Act of 10 May 1974 (No. 249) and by an Act of 22 December 1982 (No. 1275)

    International Nuclear Information System (INIS)

    1983-11-01

    The amendments to this Act fall into two categories. The first category of amendments enabled Sweden to ratify two 1982 Protocols amending the Paris Convention and the Brussels Supplementary Convention respectively. The other amendments raise the nuclear operator's liability from 50 million to 500 million Swedish crowns per incident and introduce a State liability over and above compensation available under the Brussels Convention, thus raising the aggregate amount of compensation to 3,000 million Swedish crowns. (NEA) [fr

  9. 47 CFR 15.249 - Operation within the bands 902-928 MHz, 2400-2483.5 MHz, 5725-5875 MHZ, and 24.0-24.25 GHz.

    Science.gov (United States)

    2010-10-01

    ... emissions from intentional radiators operated within these frequency bands shall comply with the following: Fundamental frequency Field strength of fundamental (millivolts/meter) Field strength of harmonics (microvolts..., point-to-point operation as referred to in this paragraph shall be limited to systems employing a fixed...

  10. Measurement of the total cross section difference {Delta}{sigma}{sub L} in np transmission at 1.19, 2.49 and 3.65 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Averichev, S.A. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Azhgirey, L.S. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of Nuclear Problems; Benda, B. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee; Adiasevich, B.P. [Russian Research Centre Kurchatov Inst., Moscow (Russian Federation); Ball, J. [Laboratoire National Saturne - Centre d`Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France); Bazhanov, N.A. [AN SSSR, Leningrad (Russian Federation). Inst. Yadernoj Fiziki; Dzyubak, A.P. [AN Ukrainskoj SSR, Kharkov (Ukraine). Fiziko-Tekhnicheskij Inst.; Fedorov, A.N. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of Particle Physics; Grosnick, D.P. [Argonne National Lab., IL (United States). High Energy Physics Div.; Gurevich, G.M. [AN SSSR, Moscow (Russian Federation). Inst. Yadernykh Issledovanij] [and others

    1996-01-01

    Results of the total cross section difference {Delta}{sigma}{sub L} in a np transmission experiment are presented. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The new results are compared with {Delta}{sigma}{sub L}(pn) data determined as a difference between {Delta}{sigma}{sub L}(pd) and {Delta}{sigma}{sub L}(pp) ANL-ZGS measurements. The values of {Delta}{sigma}{sub L} for the isospin state I=0 were deduced using known pp data. (author). Submitted to Zeitschrift fuer Physik, C (DE); 51 refs.

  11. The mechanism of the glycosylase reaction with hOGG1 base-excision repair enzyme: concerted effect of Lys249 and Asp268 during excision of 8-oxoguanine

    Czech Academy of Sciences Publication Activity Database

    Šebera, Jakub; Hattori, Y.; Sato, D.; Řeha, David; Nencka, Radim; Kohno, T.; Kojima, C.; Tanaka, Y.; Sychrovský, Vladimír

    2017-01-01

    Roč. 45, č. 9 (2017), s. 5231-5242 ISSN 0305-1048 R&D Projects: GA ČR GA13-27676S Institutional support: RVO:61388963 ; RVO:61388971 Keywords : 8-oxoguanine * hOGG1 * QM/MM * NMR * base-excision repair Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 10.162, year: 2016 https://academic.oup.com/nar/article-lookup/doi/10.1093/nar/gkx157

  12. Assessment of dietary exposure to annatto (E160b), nitrites (E249-250), sulphites (E220-228) and tartaric acid (E334) in the French population: the second French total diet study.

    Science.gov (United States)

    Bemrah, N; Vin, K; Sirot, V; Aguilar, F; Ladrat, A-C; Ducasse, C; Gey, J-L; Rétho, C; Nougadere, A; Leblanc, J-C

    2012-01-01

    The results of the assessment of the dietary exposure to annatto, nitrites, tartaric acid and sulphites within the framework of the second French total diet study (TDS) are reported. These 4 additives were selected from the Bemrah et al. study [Bemrah N, Leblanc JC, Volatier JL. 2008. Assessment of dietary exposure in the French population to 13 selected food colours, preservatives, antioxidants, stabilizers, emulsifiers and sweeteners. Food Addit Contam B. 1(1):2-14] on 13 food additives which identified a possible health risk for annatto, sulphites and nitrites and a lack of data for tartaric acid. Among the composite samples selected for the whole TDS, 524 were analysed for additives (a sample was analysed for a given additive when it was identified as a major contributor for this additive only): 130 for tartaric acid, 135 for nitrites, 59 for annatto and 200 for sulphites. Estimated concentrations (minimum lower bound to maximum upper bound) vary nationally from 0 to 9 mg/kg for annatto, 0 to 420 mg/kg for tartaric acid, 0 to 108 mg/kg for sulphites and 0 to 3.4 mg/kg for nitrites. Based on the analytical results, the dietary exposure was calculated for adults and children, separately, using lower bound and upper bound assumptions. The European ADIs for these 4 additives were not exceeded except for the dietary exposure for sulphites among 2.9% of the adult population, where the major contributors were alcoholic drinks and especially wine under both hypotheses (lower and upper bound).

  13. The activation of N-glycosidic bond cleavage performed by base-excision repair enzyme hOGG1; Theoretical study of the role of Lys 249 residue in activation of G, OxoG and FapyG

    Czech Academy of Sciences Publication Activity Database

    Šebera, Jakub; Trantírek, L.; Tanaka, Y.; Nencka, Radim; Fukal, J.; Sychrovský, Vladimír

    2014-01-01

    Roč. 4, č. 83 (2014), s. 44043-44051 ISSN 2046-2069 R&D Projects: GA ČR GA13-27676S Grant - others:GA AV ČR(CZ) M200551205; GA MŠk(CZ) ED1.1.00/02.0068; GA MŠk(CZ) EE2.3.20.0042 Program:ED Institutional support: RVO:61388963 Keywords : DFT * QM/MM * Fukui indices * hOGG1 * aromaticity * 8-OxoG Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.840, year: 2014

  14. Comment on "Application of the variable projection scheme for frequency-domain full-waveform inversion" (M. Li, J. Rickett, and A. Abubakar, GEOPHYSICS, 78, no. 6, R249-R257)

    NARCIS (Netherlands)

    Aravkin, Aleksandr Y.; Herrmann, Felix J.; van Leeuwen, Tristan

    In the paper “Application of the variable projection scheme for frequency-domain full-waveform inversion,” Li et al. (2013) discuss a method for source estimation in the context of frequency-domain full-waveform inversion (FWI). This method is an extension of earlier work by Aravkin et al. (2012),

  15. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125647)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  16. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  17. ORF Alignment: NC_003074 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LLIEKARIEKNHEVLEMGCGWGTFAIEVVKRTG 180 ... Query: 249 FMDKFFSCCEDALAENGIFVLQFTAIPEALY...DESRLTSGFITEYIFPGGCLPSLARVTSA 308 ... FMDKFFSCCEDALAENGIFVLQFTAIPEALYDESRLTSGFITEYIFPGGCLPSLARVTSA Sbjct: 241 FMDKFFSCCEDALAENGIFVLQFTAIPEALYDESRLTSGFITEYIFPGGCLPSLARVTSA 300 ...

  18. ORF Alignment: NC_005362 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LATTELQKVPATIISRTQRYNFKRIDQHDLIARMT 180 ... Query: 249 IEQVLLNLLNGKTSAALEIVHALLQDGASTKNILDELISLTVKGMLAI 296 ... ... ... IEQVLLNLLNGKTSAALEIVHALLQDGASTKNILDELISLTVKGMLAI Sbjct: 241 IEQVLLNLLNGKTSAALEIVHALLQDGASTKNILDELISLTVKGMLAI 288

  19. ORF Alignment: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 190 IDDEPISASIFDFGLYFYHNAKELVKIGKGPYFYLPKMEHHMEVKLWNDIFCVAQDFIGM 249 ... IDDEPISASIFDFGLYFYHNAKELVKI...GKGPYFYLPKMEHHMEVKLWNDIFCVAQDFIGM Sbjct: 1 ... IDDEPISASIFDFGLYFYHNAKELVKIGKGPYFYLPKMEHHMEVKLWNDIFCVAQDFIG

  20. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PKLLNIHGRPQTVDGKI 60 ... Query: 249 AQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFKKVDVPLLGIVENMSYFIAPDTGKR 308 ... ... AQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFKKVDVPLLGIVENMSYFIAPDTGKR Sbjct: 121 AQLTMAQQVPLAGAVIVSTPQDLALIDAR

  1. Struggling to Improve Our Understanding of Nursing Student Information Needs. A review of: Gannon‐Leary, Pat, Graham Walton, Raffik Cader, Julie Derbyshire, and Ann Smith. “Use of Evidence by Nursing Students: An Interdisciplinary Study.” Library & Information Science Research 28.2 (Mar. 2006: 249‐64.

    Directory of Open Access Journals (Sweden)

    Michael Corkett

    2007-06-01

    Full Text Available Objective – To identify the sources used by student nurses when undertaking a health needs analysis of particular client groups, and to determine students’ ease in accessing source materials.Design – Case series, incorporating citation analysis and focus groups.Setting – Honours Nursing Studies program (Adult Branch, Northumbria University, Newcastle upon Tyne, United Kingdom.Subjects – Citation analysis: 40 students undertaking health needs analysis assignment. Focus groups: 2 groups of 8 students.Methods – Subjects for the citation analysis were not randomly selected. Citation analysis was performed and references tabulated using a previously piloted proforma. Distribution of references between sources was measured using quantitative analysis. Focus groups consisted of self selecting volunteers from the student cohort undertaking the assignment. Issues of potential bias/coercion relating to research team members being group participant tutors were addressed. Results were analysed through the categorisation of key themes.Main results – The mean number of sources cited per assignment was 16. More than half( 56% of the sources were published after 1999. Twenty‐nine percent of citations were published between 1996 and 1999, and 12% between 1990 and 1995. Only small percentages were published in the 1980s (2% and 1970s (1%. Journals (37% formed the largest body of references, followed by books at 27%. UK government publications accounted for 14% of total references; Web based resources totalled 12%. Students acknowledged the importance of supporting assignments with references. Government publications were recognised as high quality pieces of evidence. Difficulty was experienced extrapolating evidence from different care settings and moving outside of usual parameters. Students indicated that statistical data was hard to find. Those without home Internet facilities had greater difficulty in accessing information than students with such facilities. Support from information professionals was received, but quality was variable.Conclusion – Doubts exist as to whether opportunities for student learning to inform educators are being fully exploited. Upon completion of assignments students are arguably in a better position to debate subjects more deeply and so advance understanding. Potential for peer group development may be lost. Collaboration between nursing academics and information professionals offers potential for nursing students and health professionals to advance their exploitation and evaluation of information resources.

  2. Retraction Notice to ;Fabrication, electromagnetic characteristics of microwave absorbers containing Li0.35Zn0.3Fe2.35O4 micro-belts, nickel-coated carbon fibers; [J. Magn. Magn. Mater. 345 (2013) 249-254

    Science.gov (United States)

    Zhao, Bin; Wang, Qilei; Zhang, Cunrui

    2017-08-01

    This article has been retracted: please see Elsevier Policy on Article Withdrawal (http://www.elsevier.com/locate/withdrawalpolicy) This article has been retracted at the request of the Editor-in-Chief. The authors have plagiarized part of a paper that had already appeared in Ceram. Int., 39 (2013) 2317-2322, http://dx.doi.org/10.1016/j.ceramint.2012.08.079.

  3. Roman for unge - og deres voksne - fra Nick Hornby

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2007-01-01

    Nick Hornby: SLAM. Oversat fra engelsk. af Jan Hansen. 280 sider, 249 kr. Lindhardt og Ringhof. Fire stjerner Udgivelsesdato: 071207......Nick Hornby: SLAM. Oversat fra engelsk. af Jan Hansen. 280 sider, 249 kr. Lindhardt og Ringhof. Fire stjerner Udgivelsesdato: 071207...

  4. Gclust Server: 154467 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 154467 CEL_Y48E1B.12_17537265 Cluster Sequences - 249 csc-1: Chromosome Segregation and Cytokines...ces - Sequence length 249 Representative annotation csc-1: Chromosome Segregation and Cytokines

  5. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PQPVVDAAIQALQDPKNHG 60 ... Query: 129 PAYPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAP 188 ... ... ... PAYPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAP Sbjct: 121 PAYPAH...FRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAP 180 ... Query: 249 GWRVGFVVGNRHVIQGLRTLKTNLDYGIFXXXXXXXX

  6. Author Index

    Indian Academy of Sciences (India)

    Author Index. Alecian, E. see Samadhi, R., 171; see Goupil, M.-J., 249. Antia, H. M. Helioseismology, 161. Ashoka, B. N. see Seetha, S., 301. Baudin, F. see Samadhi, R., 171. Boehm, T. see Goupil, M.-J., 249. Catala, C. see Goupil, M.-J., 249. Cunha Margarida S. Asteroseismic Theory of Rapidly Oscillating Ap Stars, 213.

  7. 76 FR 81761 - Mine Safety Disclosure

    Science.gov (United States)

    2011-12-28

    ...-related discrimination and miners' applications for compensation after a mine has been idled by a closure... Parts 229, 239 and 249 Mine Safety Disclosure; Final Rule #0;#0;Federal Register / Vol. 76, No. 249... 17 CFR Parts 229, 239 and 249 [Release Nos. 33-9286; 34-66019; File No. S7-41-10] RIN 3235-AK83 Mine...

  8. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  9. Recommendation Analysis for an Ambulatory Surgical Center at Brooke Army Medical Center

    Science.gov (United States)

    2005-06-10

    specialize in what they do best (Slackman, 1988). The SA-MM consists of BAMC, Wilford Hall Medical Center (WHMC), Randolph Clinic, and Brooks Clinic. MG ...Component for APVs $819.18 $819.18 $819.18 $819.18 Total Outpatient Visit Cost Avoidance Savings $1,117,747 $3,249,856 $3,249,856 $3,249,856 "SCý ECAP -TURE

  10. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  11. Iron-substituted AB5-type MH electrode

    Indian Academy of Sciences (India)

    substituted AB5-type MH electrode. SUMITA SRIVASTAVAa,∗ and R K UPADHYAYAb. aDepartment of Physics, Government P.G. College, Uttarkashi 249 193, India. bDepartment of Physics, Government P.G. College, Rishikesh 249 201, India.

  12. 77 FR 62273 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-10-12

    ... data requirement is to make financial information easier for investors to analyze and assist issuers in... Act of 1934 (15 U.S.C. 78a et seq.) to submit specified financial information to the Commission and... 249.240f and 17 CFR 249.306). In interactive data format, financial statement information could be...

  13. METHODS OF AVAILABLE POTASSIUM ASSESSMENT IN ...

    African Journals Online (AJOL)

    AGROSEARCH UIL

    An alternative rationale for corn N fertilizer recommendations. J. Prod. Agric. 7: 243-249. Vanotti, M. B. and Bundy, L. G. 1994b. Corn nitrogen recommendations based on yield response data. J. Prod. Agric. 7: 249-256. Wild, A. A. 1971. The potassium status of soils in the savanna zone of Nigeria. Expl. Agric. 7: 257-270. 87.

  14. 77 FR 58799 - Radio Broadcasting Services; Roaring Springs, TX

    Science.gov (United States)

    2012-09-24

    ...] Radio Broadcasting Services; Roaring Springs, TX AGENCY: Federal Communications Commission. ACTION... substituting Channel 227A for vacant Channel 249A at Roaring Springs, Texas, and by substituting Channel 249C3 for vacant Channel 276C3, at Roaring Springs, Texas. The proposal is part of a contingently filed...

  15. 78 FR 40402 - Radio Broadcasting Services; Roaring Springs, Texas

    Science.gov (United States)

    2013-07-05

    ... Broadcasting Services; Roaring Springs, Texas AGENCY: Federal Communications Commission. ACTION: Final rule... Channel 249A at Roaring Springs, Texas, and allots FM Channel 249C3 and deletes FM Channel 276C3 at Roaring Springs. These allotment changes are part of a rule making and hybrid application proposal...

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 23, Issue 3. March 2018, pages 245-413. pp 245-248 Editorial. Editorial · More Details Abstract Fulltext PDF. pp 249-249 Science Smiles. Science Smiles · More Details Abstract ...

  17. Browse Title Index - African Journals Online

    African Journals Online (AJOL)

    Items 201 - 249 of 249 ... Abstract PDF. Kathryn M Gow. Vol 11, No 1 (2011), The “Lived Pain” Experience: The Case of Women Undergoing IVF treatments, Abstract PDF. Hilla Ha'elyon, Chen Gross, Chen Gross. Vol 1, No 1 (2001), The “Things Themselves” in Phenomenology, Abstract PDF. Peter Willis. Vol 16, No 1-2 (2016) ...

  18. Review of: Islam, Migration and Integration: The Age of Securitization

    DEFF Research Database (Denmark)

    Vinding, Niels Valdemar

    2010-01-01

    Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55.......Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55....

  19. A Study to Develop Alternative Approaches for Implementing Product Line Management in the South Texas Veterans Health Care System

    Science.gov (United States)

    1997-05-01

    GME Correlation Bed Size 1.000 .249** .249" 1.000 Sig . GME (2-tailed) Bed Size .004 .004 N...28144 San Francisco VAMC 4150 Clement Street San Francisco CA 94121 Sepulveda VAMC 6111 Plummer Street Sepulveda CA 91343 Sioux Falls VAMC 2501 W

  20. 75 FR 21455 - Large Trader Reporting System

    Science.gov (United States)

    2010-04-23

    ... Exchange Commission 17 CFR Parts 240 and 249 Large Trader Reporting System; Proposed Rule #0;#0;Federal... COMMISSION 17 CFR Parts 240 and 249 RIN 3235-AK55 Large Trader Reporting System AGENCY: Securities and... (``Exchange Act'') to establish a large trader reporting system. The proposal is intended to assist the...

  1. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.

    2008-01-01

    Roč. 275, podzim (2008), s. 249-249 ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  2. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  3. Strategic tariff protection, market conduct, and government commitment levels in developing economies

    Czech Academy of Sciences Publication Activity Database

    Ionascu, D.; Žigić, Krešimir

    -, č. 249 (2005), s. 1-43 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : optimal tariff protection * government non-commitment regime * symmetric versus asymmetric information Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp249.pdf

  4. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available v. oryzae ... KACC10331] gb|AAW75848.1| Dehydrogenases with different ... specificities (relat... NC_006834 gi|58582217 >1hxhA 4 249 11 249 8e-34 ... ref|YP_201233.1| Dehydrogenases with different specificiti...es (related to short-chain ... alcohol dehydrogenases) [Xanthomonas oryzae p

  5. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  6. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  7. Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition

    Czech Academy of Sciences Publication Activity Database

    Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.

    2014-01-01

    Roč. 565, 28 August (2014), s. 249-260 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014

  8. Possibilities of RCH-microscopy in the reptilian research

    Czech Academy of Sciences Publication Activity Database

    Žižka, Zdeněk

    2002-01-01

    Roč. 51, č. 3 (2002), s. 249-252 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z5020903 Keywords : reptilia * integument * replica Subject RIV: EE - Microbiology, Virology Impact factor: 0.234, year: 2002

  9. African Journal for the Psychological Study of Social Issues - Vol 9 ...

    African Journals Online (AJOL)

    Product's promotion patterns and their effects on consumers' purchase intentions, brand loyalty and attitude · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. NA Shenge, 249-256 ...

  10. Podíl "paleolitických" versus "neolitických" haploskupin Y chromozomu u české populace

    Czech Academy of Sciences Publication Activity Database

    Kráčmarová, A.; Bruchová, H.; Černý, Viktor; Brdička, R.

    2006-01-01

    Roč. 58, č. 2 (2006), s. 237-249 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeogenetics * Y chromosome * migrations Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. The genus Surirella (Bacillariophyta) in the sub-Antarctic and maritime Antarctic region

    Czech Academy of Sciences Publication Activity Database

    Van de Vijver, B.; Cocquyt, Ch.; De Haan, M.; Kopalová, Kateřina; Zidarova, R.

    2013-01-01

    Roč. 28, č. 1 (2013), s. 93-108 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : Bacillariophyta * Surirella * Bacillariophyta Subject RIV: EF - Botanics Impact factor: 1.000, year: 2013

  12. Aulacoseira kruegeriana (Bacillariophyta, Coscinodiscophyceae): a new centric diatom from high-elevation Andean streams of Bolivia

    Czech Academy of Sciences Publication Activity Database

    Morales, E. A.; Rivera, S. F.; Rubin, S. D. C.; Vis, M. L.; Houk, Václav

    2015-01-01

    Roč. 30, č. 3 (2015), s. 269-277 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : centric diatoms * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 1.868, year: 2015

  13. Morphology and taxonomy of an almost forgotten fossil diatom Gaillonella sculpta EHRENBERG (Bacillariophyceae)

    Czech Academy of Sciences Publication Activity Database

    Usoltseva, M.; Houk, Václav

    2016-01-01

    Roč. 31, č. 1 (2016), s. 39-49 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : Miocene * Gaillonella * Pseudoaulacosira * taxonomy * valve ultrastructure. * Bacillariophyceae Subject RIV: EF - Botanics Impact factor: 1.677, year: 2016

  14. 77 FR 13150 - Notice of Lodging of Third Amendment to Consent Decree Under the Clean Air Act

    Science.gov (United States)

    2012-03-05

    ... the coke drum steam vents and coker quench water tank. COPC also will pay civil penalties of $249,000... comment period, the Third Amendment may be examined on the following Department of Justice Web site: http...

  15. Review of chromosome races in blind mole rats (Spalax and Nannospalax)

    Czech Academy of Sciences Publication Activity Database

    Arslan, A.; Kryštufek, B.; Matur, F.; Zima, Jan

    2016-01-01

    Roč. 65, č. 4 (2016), s. 249-301 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : karyotype * evolution * cytotypes * speciation Subject RIV: EG - Zoology Impact factor: 0.739, year: 2016

  16. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

    2016-01-01

    Roč. 10, č. 35 (2016), s. 242-249 ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  17. Magnetické pole Země a jeho možný vliv na živé organizmy

    Czech Academy of Sciences Publication Activity Database

    Střeštík, Jaroslav

    2004-01-01

    Roč. 54, č. 4 (2004), s. 249-251 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z3012916 Keywords : geomagnetic activity * geomagnetic storms * human beings Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  18. Cyanobacterial water-bloom of Limnoraphis robusta in the Lago Mayor of the Lake Titicaca. Can it develop?

    Czech Academy of Sciences Publication Activity Database

    Komárková, Jaroslava; Montoya, H.; Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 249-258 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * water bloom * Titicaca Lake Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  19. The Role of Personalities in Passing-Down the Tradition within the System of Culture

    Czech Academy of Sciences Publication Activity Database

    Pospíšilová, Jana; Stefanović-Banović, Milesa

    LXV, č. 2 (2017), s. 249-254 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Personalities * Ethnology * Tradition * System of Culture Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. Implications of the Revised Consensus Body Mass Indices for Asian Indians on Clinical Obstetric Practice

    OpenAIRE

    Aziz, Nuzhat; Kallur, Sailaja Devi; Nirmalan, Praveen Kumar

    2014-01-01

    Background: The body mass index (BMI) categories for Asian Indians has been revised based on consensus guidelines. The revised guidelines categorize overweight as a BMI of 23.0 – 24.9 and obesity as a BMI≥25.

  1. Disease: H01357 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available .01.002 ... PMID:20672788 (drug) ... AUTHORS ... Usatine RP, Riojas M ... TITLE ... Diagnosis and management of contact dermatitis. ... JOURNAL ... Am Fam Physician 82:249-55 (2010) ...

  2. Development and validation of a spectroscopic method for the ...

    African Journals Online (AJOL)

    ) as the solvent system. All solutions were analyzed for absorbance spectrophotometrically at 205 and 249 ... fluoromertric method [10], micellar electrokinetic chromatographic method [11], bioanalytical method [12], photochemical reaction [13] ...

  3. Devitrification kinetics of Sb2O3-PbI2 glasses

    Czech Academy of Sciences Publication Activity Database

    Legouera, M.; Rahal, F.; Kostka, Petr; Poulain, M.

    2009-01-01

    Roč. 34, č. 4 (2009), s. 249-266 ISSN 0151-9107 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystallization kinetics * nucleation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.250, year: 2009

  4. A new temperature-dependent equation of state of solids

    Indian Academy of Sciences (India)

    Author Affiliations. Kamal Kapoor1 Anuj Kumar2 Narsingh Dass1. Physics Department, College of Engineering Roorkee, Roorkee 247 667, India; Physics Department, Gurukul Kangri Vishwavidyalaya, Haridwar 249 404, India ...

  5. The first complete mitochondrial genome from Bostrychus genus ...

    Indian Academy of Sciences (India)

    2013-08-12

    ) mitochon- drial genome. Genes encoded on the heavy or light strands are shown outside or inside the circular gene map, respectively. Inner ring displays the GC content. Journal of Genetics, Vol. 92, No. 2, August 2013. 249 ...

  6. The how of WOW: a guide to giving a speech that will positively blow 'em away

    National Research Council Canada - National Science Library

    Carlson, Tony

    2005-01-01

    ... Your Speech 249 Appendix D- How About the ROI? 265 Index 269 ... 11182$ CNTS 01-19-05 10:15:57 PS PAGE vi AcknowledgmentsAcknowledgments In the general chatter after a major speech given by a client ...

  7. 77 FR 37066 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

    Science.gov (United States)

    2012-06-20

    .... over Downie R., Downieville, 12000400 Jersey Bridge, (Highway Bridges of California MPS) CA 49 from...., 2-364 Fairview Terr., 12-249 Hillcrest Terr., 82, 176 Forest Hills Ave., Hartford, 12000410 [FR Doc...

  8. Consumer response to packaging design: The role of packaging materials and graphics in sustainability perceptions and product evaluations

    NARCIS (Netherlands)

    Steenis, N.D.; Herpen, E. van; Lans, I.A. van der; Ligthart, T.N.; Trijp, H.C.M. van

    2017-01-01

    Building on theories of cue utilization, this paper investigates whether and how packaging sustainability influences consumer perceptions, inferences and attitudes towards packaged products. A framework is tested in an empirical study among 249 students using soup products varying in packaging

  9. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13472223 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  10. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003037 gi|16263528 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  11. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933642 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  12. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27376010 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  13. Temperature, salinity, oxygen, nutrients and productivity profile data from THOMAS G. THOMPSON Cruise 001, 19651014 to 19651207 in the Caribbean Sea and the northeastern tropical Pacific Ocean (NODC Accession 7100507)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains a copy of University of Washington Department of Oceanography Technical Report No. 249, Physical, chemical, and productivity data from a...

  14. Hydrodynamic characteristics of mechanical heart valve prostheses in steady and pulsatile flow

    Czech Academy of Sciences Publication Activity Database

    Klimeš, František; Kořenář, Josef

    2002-01-01

    Roč. 9, č. 4 (2002), s. 249-258 ISSN 1210-2717 Institutional research plan: CEZ:AV0Z2060917 Keywords : mechanical heart valve prostheses * flow visualization- steady and pulsatile flow Subject RIV: BO - Biophysics

  15. Prevalence, dynamics, and biochemical predictors of optic nerve remyelination after methanol-induced acute optic neuropathy: a 2-year prospective study in 54 patients

    Czech Academy of Sciences Publication Activity Database

    Nurieva, O.; Kotíková, K.; Urban, P.; Pelclová, D.; Petřík, V.; Navrátil, Tomáš; Zakharov, S.

    2016-01-01

    Roč. 147, č. 1 (2016), s. 239-249 ISSN 0026-9247 Institutional support: RVO:61388955 Keywords : methanol optic neuropathy * visual evoked potentials * remyelination Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.282, year: 2016

  16. Radio Frequency Radiation Dosimetry Handbook (Fifth Edition)

    Science.gov (United States)

    2009-07-01

    BODY TO RFR .............................. 213 7.4 THERMAL WAVE EFFECTS...249 8.12 SIGNS AND SYMPTOMS OF RFR OVEREXPOSURE...INSTRUMENTATION FOR MEASURING RFR FIELDS ............................... 267 9.4 DEVELOPMENT OF RFR INSTRUMENTATION

  17. Particle Flow Modelling in Slurry-Fed Stirred Vessels

    Czech Academy of Sciences Publication Activity Database

    Scargiali, F.; Grisafi, F.; Čermáková, Jiřina; Machoň, V.; Brucato, A.

    2004-01-01

    Roč. 27, č. 3 (2004), s. 249-256 ISSN 0930-7516 Institutional research plan: CEZ:AV0Z4072921 Keywords : solids * dispersion Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.791, year: 2004

  18. Fúzní palivo a obnovitelné zdroje

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír

    2015-01-01

    Roč. 65, č. 5 (2015), s. 249-252 ISSN 0375-8842 Keywords : nuclear fusion * fusion fuel power plant * renewable source * fusion energy Subject RIV: JF - Nuclear Energetics http://www.casopisenergetika.cz

  19. Aggarwal, Dr Rakesh

    Indian Academy of Sciences (India)

    Specialization: Immunisation, Public Health, Gastrointestinal & Liver Diseases, Viral Hepatitis, Epidemiology and Health Economics Address: Department of Gastroenterology, Sanjay Gandhi Postgraduate Institute of Medical Sciences, Raebareli Road, Lucknow 226 014, U.P.. Contact: Office: (0522) 249 4431. Residence: ...

  20. EST Table: BB985913 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/08/28 30 %/249 aa FBpp0129766|DereGG112...EDICTED: similar to putative lysosomal glucocerebrosidase [Tribolium castaneum] BB985877 MSV3 ...

  1. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  2. Ionic conductivity study of Lil-Ga2S3-GeS2 chalcogenide glasses using a random – walk approach

    Czech Academy of Sciences Publication Activity Database

    Patil, S. D.; Konale, M. S.; Kolář, J.; Shimakawa, K.; Zima, Vítězslav; Wágner, T.

    2015-01-01

    Roč. 87, č. 3 (2015), s. 249-259 ISSN 0033-4545 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * impedance spectroscopy * ionic conductivity Subject RIV: CA - Inorganic Chemistry Impact factor: 2.615, year: 2015

  3. Factors affecting haematological indices in free-living fish populations

    Czech Academy of Sciences Publication Activity Database

    Lusková, Věra

    1998-01-01

    Roč. 67, č. 4 (1998), s. 249-255 ISSN 0001-7213. [International ichthyohaematology conference /5./. Protivín, 30.11.1998-03.12.1998] R&D Projects: GA ČR GA514/95/0203; GA AV ČR IAA6087704 Subject RIV: EH - Ecology, Behaviour Impact factor: 0.288, year: 1998 http://vfu-www.vfu.cz/acta-vet/vol67/249-98.htm

  4. The PIN-FORMED (PIN) protein family of auxin transporters

    Czech Academy of Sciences Publication Activity Database

    Křeček, Pavel; Skůpa, Petr; Libus, Jiří; Naramoto, S.; Tejos, R.; Friml, J.; Zažímalová, Eva

    2009-01-01

    Roč. 10, č. 12 (2009), s. 249.1-249.11 ISSN 1474-760X R&D Projects: GA MŠk(CZ) LC06034; GA AV ČR KJB600380904; GA AV ČR(CZ) IAA601630703 Institutional research plan: CEZ:AV0Z50380511 Keywords : PIN protein family * auxin efflux carriers * auxin transport Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.626, year: 2009

  5. Managing ICT deployment in schools

    CSIR Research Space (South Africa)

    Herselman, M

    2014-12-01

    Full Text Available to ensure that the Blogs are constantly updated, social media accounts and records are kept and branding is done. Therefore a communications strategy was developed with guidelines on branding and ways of communication on the initiative. It was important... ....................................................................................................... 247 Section 8. The use of social media in the management of an ICT for Education initiative . 249 8.1 Introduction ..................................................................................................... 249 8.2 Literature Review...

  6. Review: Personal Effects of Divorce in Relation to Children / Recension: Efectos personales del divorcio respecto de los hijos

    Directory of Open Access Journals (Sweden)

    Teresa Duplá Marín

    2013-05-01

    Full Text Available Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270. Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270.

  7. Environmentally Controlled Infrared Spectroscopy System for Fundamental Studies of Polymer Electrolyte Membranes

    Science.gov (United States)

    2015-10-15

    and experimental vibrational spectroscopy of ionomers. Presented at the 249th ACS National Meeting & Exposition, Denver, CO, March 22-26, 2015. PMSE ...hydration, for quantum dot preparation. Presented at the 249th ACS National Meeting & Exposition, Denver, CO, March 22-26, 2015. PMSE 476. Romeo...Presented at the 250th ACS National Meeting & Exposition, Boston, MA, August 16-20, 2015. PMSE 388. Vong, A.; Kendrick, I.; Doan, J.; Smotkin, E. S

  8. Predictive Validity of UAS/RPA Sensor Operator Training Qualification Measures

    Science.gov (United States)

    2015-01-30

    Requalification Training, n = 430, r = .583 and .553; MQ-9 Initial Qualification/ Requalification Training, n = 249, r = .357 and .334). Although current...n = 461), MQ-1B Initial Qualification and Requalification Training course (MQ-1 IQRT, n = 430), or the MQ-9 Initial Qualification and... Requalification Training course (MQ-9 IQRT, n = 249). To qualify for entrance into the US Air Force, applicants must achieve a score at or above the 36th

  9. Polymorphism of the Fractalkine Receptor CX3CR1 and Systemic Sclerosis-associated Pulmonary Arterial Hypertension

    Directory of Open Access Journals (Sweden)

    Bianca Marasini

    2005-01-01

    Full Text Available Fractalkine (FKN and its receptor CX3CR1 are critical mediators in the vascular and tissue damage of several chronic diseases, including systemic sclerosis (SSc and pulmonary arterial hypertension (PAH. Interestingly, the V249I and T280M genetic polymorphisms influence CX3CR1 expression and function. We investigated whether these polymorphisms are associated with PAH secondary to SSc. CX3CR1 genotypes were analyzed by PCR and sequencing in 76 patients with limited SSc and 204 healthy controls. PAH was defined by colorDoppler echocardiography. Homozygosity for 249II as well as the combined presence of 249II and 280MM were significantly more frequent in patients with SSc compared to controls (17 vs 6%, p = 0.0034 and 5 vs 1%, p = 0.0027, respectively. The 249I and 280M alleles were associated with PAH (odd ratio [OR] 2.2, 95% confidence interval [CI] 1.01-4.75, p = 0.028 and OR 7.37, 95%CI: 2.45-24.60, p = 0.0001, respectively. In conclusion, the increased frequencies of 249I and 280M CX3CR1 alleles in a subgroup of patients with SSc-associated PAH suggest a role for the fractalkine system in the pathogenesis of this condition. Further, the 249I allele might be associated with susceptibility to SSc.

  10. Nuclear spectroscopic study of the 117In and 77Se using angular correlation technique

    International Nuclear Information System (INIS)

    Zamboni, C.B.

    1981-01-01

    The integral pertubed angular correlation technique has been used to measure the g-factor of the 587 KeV(3/2 - ) state in 117 In. The measurements were made in an external magnetic field of 26 Kg. The 1303-273 KeV gamma cascade in 117 In populated from the beta decay of 117 Cd was utilized for the measurement. The result is g(587 KeV) = -0.233+-0.057. The present result shows the 587 KeV state may not be a simple P 3/2 proton hole state but rather a complex admixture of different configurations. The g-factor of the 249 KeV state in 77 Se has also been measured by the time differential pertubed angular correlation (TDPAC) method in an external magnetic field of 25 Kg. The 755-249 KeV gamma cascade in 77 Se populated from the electron capture decay of 57h 77 Br utilized for the measurement. The g-factor is determined to be g(249 KeV) = 0.486 +- 0.009. In addition the half life of the 249 KeV state in 77 Se has also been measured by the delayed gamma-gamma coincidence method utilizing the gamma cascades 572-249 KeV and 750-249 KeV in 77 Se. The resulting value of the half life is T 1/2 (249 KeV) = (9.56 +- 0.10)ns. The experimental results are discussed in terms of nuclear models applicable for nuclei in this mass region. (author) [pt

  11. Antibody-Mediated BRCC36 Silencing: A Novel Approach for Targeted Breast Cancer Therapy

    Science.gov (United States)

    2009-06-01

    Hejna J, Grompe M, D’Andrea AD. 2001. Interaction of the Fanconi anemia proteins and BRCA1 in a common pathway. Mol Cell 7(2):249-62. Houghtaling...Interaction of the Fanconi anemia proteins and BRCA1 in a common pathway. Mol Cell 7: 249-62. Houghtaling S, Newell A, Akkari Y, Taniguchi T, Olson S...following UV radiation in human breast cancer cells. Oncogene 21(29):4481-9. Boulton SJ, Martin JS, Polanowska J, Hill DE , Gartner A, Vidal M. 2004

  12. CX3CR1 is a modifying gene of survival and progression in amyotrophic lateral sclerosis.

    Directory of Open Access Journals (Sweden)

    Alan Lopez-Lopez

    Full Text Available The objective of this study was to investigate the association of functional variants of the human CX3CR1 gene (Fractalkine receptor with the risk of Amyotrophic Lateral Sclerosis (ALS, the survival and the progression rate of the disease symptoms in a Spanish ALS cohort. 187 ALS patients (142 sporadic [sALS] and 45 familial and 378 controls were recruited. We investigated CX3CR1 V249I (rs3732379 and T280M (rs3732378 genotypes and their haplotypes as predictors of survival, the progression rate of the symptoms (as measured by ALSFRS-R and FVC decline and the risk of suffering ALS disease. The results indicated that sALS patients with CX3CR1 249I/I or 249V/I genotypes presented a shorter survival time (42.27 ± 4.90 than patients with 249V/V genotype (67.65 ± 7.42; diff -25.49 months 95%CI [-42.79,-8.18]; p = 0.004; adj-p = 0.018. The survival time was shorter in sALS patients with spinal topography and CX3CR1 249I alleles (diff =  -29.78 months; 95%CI [-49.42,-10.14]; p = 0.003. The same effects were also observed in the spinal sALS patients with 249I-280M haplotype (diff =  -27.02 months; 95%CI [-49.57, -4.48]; p = 0.019. In the sALS group, the CX3CR1 249I variant was associated with a faster progression of the disease symptoms (OR = 2.58; 95IC% [1.32, 5.07]; p = 0.006; adj-p = 0.027. There was no evidence for association of these two CX3CR1 variants with ALS disease risk. The association evidenced herein is clinically relevant and indicates that CX3CR1 could be a disease-modifying gene in sALS. The progression rate of the disease's symptoms and the survival time is affected in patients with one or two copies of the CX3CR1 249I allele. The CX3CR1 is the most potent ALS survival genetic factor reported to date. These results reinforce the role of the immune system in ALS pathogenesis.

  13. First dedicated observations of runaway electrons in the COMPASS tokamak

    Czech Academy of Sciences Publication Activity Database

    Vlainić, M.; Mlynář, Jan; Weinzettl, Vladimír; Papřok, Richard; Imríšek, Martin; Ficker, Ondřej; Vondráček, Petr; Havlíček, Josef

    2015-01-01

    Roč. 60, č. 2 (2015), s. 249-255 ISSN 0029-5922. [Kudowa Summer School 2014 "Towards Fusion Energy"/12./. Kudowa Zdrój, 09.06.2014-13.06.2014] R&D Projects: GA MŠk(CZ) LM2011021 Institutional support: RVO:61389021 Keywords : plasma diagnostics * runaway electrons * tokamak Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.546, year: 2015 http://www.nukleonika.pl/www/back/full/vol60_2015/v60n2p249f.pdf

  14. The asian tapeworm, Bothriocephalus acheilognathi in the intestine of largemouth yellowfish, Labeobarbus Kimberleyensis, of the Vaal River system in South Africa as metal bioindicators

    OpenAIRE

    2008-01-01

    The use of intestinal parasites as indicators of pollution has increased in Europe due to the fact that parasites accumulate more of the available metals than their hosts. Eighty Largemouth yellowfish, Labeobarbus kimberleyensis (Gilchrist and Thompson, 1913) were collected between April 2005 and February 2006 with gill nets at RAU Island (26° 52, 249’ S, 28 10, 249’ E) in the Vaal Dam. The fish were killed, weighed and their lengths determined. Muscle, liver and spinal cord tissues were col...

  15. Two-quasineutron states in 98248Cf and 98250Cf and the neutron-neutron residual interactions

    International Nuclear Information System (INIS)

    Katori, K.; Ahmad, I.; Friedman, A. M.

    2008-01-01

    Two-quasineutron states in 248 Cf and 250 Cf were investigated by single-neutron transfer reactions, 249 Cf(d,t) 248 Cf and 249 Cf(d,p) 250 Cf. The majority of levels observed were assigned to 12 bands in 248 Cf and six bands in 250 Cf, constructed from the single-particle states in neighboring Cf nuclei. The effective two-body interactions between two odd neutrons coupled outside a deformed core were deduced from the differences in the energies of the bandheads formed by the parallel and antiparallel coupling of the intrinsic spins of the two single-particle states

  16. Physical Challenges Associated with Deployment-Related Injuries

    Science.gov (United States)

    2011-04-06

    was categorized into: underweight (គ.5), healthy (18.5–24.9), overweight (25.0–29.9), and obese (≥30.0) [21]. Vocational Outcomes. The vocational...Cohort of US Military Medical Students. J Am Board Fam Med 2008, 21:165–167. 21. Centers for Disease Control and Prevention. Division of Nutrition ... underweight (គ.5), healthy (18.5–24.9), overweight (25.0–29.9), and obese (≥30.0). bClinically significant increase in BMI.[27] Characteristics Body mass

  17. Relevance of Radiocaesium Interception Potential (RIP) on a worldwide scale to assess soil vulnerability to 137Cs contamination

    NARCIS (Netherlands)

    Vandebroek, L.; Hees, Van M.; Delvaux, B.; Spaargaren, O.; Thiry, Y.

    2012-01-01

    The extent of radiocaesium retention in soil is important to quantify the risk of further foodchain contamination. The Radiocaesium Interception Potential (RIP – Cremers et al., 1988, Nature 335, 247–249) is an intrinsic soil parameter which can be used to categorize soils or minerals in terms of

  18. Antifolate drug resistance: Novel mutations and haplotype ...

    Indian Academy of Sciences (India)

    A total of 249 fever cases from Arunachal Pradesh, NEIndia, were screened for malaria, and of these, 75 were found to be positive for Plasmodium falciparum. Samples weresequenced and analysed with the help of BioEdit and ClustalW. Three novel point mutations were found in the dhps genewith 10 haplotypes along ...

  19. A DDC Bibliography on Computers in Information Sciences. Volume I. Information Sciences Series.

    Science.gov (United States)

    Defense Documentation Center, Alexandria, VA.

    The unclassified and unlimited bibliography compiles references dealing specifically with the role of computers in information sciences. The volume contains 249 annotated references grouped under two major headings: Time Shared, On-Line, and Real Time Systems, and Computer Components. The references are arranged in accesion number (AD-number)…

  20. In some symmetric spaces monotonicity properties can be reduced to the cone of rearrangements

    Czech Academy of Sciences Publication Activity Database

    Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav

    2016-01-01

    Roč. 90, č. 1 (2016), s. 249-261 ISSN 0001-9054 Institutional support: RVO:67985840 Keywords : symmetric spaces * K-monotone symmetric Banach spaces * strict monotonicity * lower local uniform monotonicity Subject RIV: BA - General Mathematics Impact factor: 0.826, year: 2016 http://link.springer.com/article/10.1007%2Fs00010-015-0379-6

  1. Subjektivní blahobyt v České republice a střední Evropě: makro- a mikro-determinanty

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří

    2014-01-01

    Roč. 62, č. 2 (2014), s. 249-270 ISSN 0032-3233 R&D Projects: GA ČR(CZ) GAP404/11/1521 Institutional support: RVO:68378025 Keywords : subjective well-being * life satisfaction * Central Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.650, year: 2014

  2. The Lemmatization of Loan Words in the isiNdebele–English ...

    African Journals Online (AJOL)

    user

    imagama/Dictionary. 187 die rede ... huldig Aitchison (2001: 249) die siening dat taal geleidelik omvorm word en nie onveranderd kan bly nie. Aan die ..... challenge in a language where its history of recognition is still in its infancy. IsiNdebele has ...

  3. A survey for piroplasmids in horses and Bactrian camels in North-Eastern Mongolia

    Czech Academy of Sciences Publication Activity Database

    Sloboda, M.; Jirků, Milan; Lukešová, D.; Qablan, M.; Batsukh, Z.; Fiala, Ivan; Horin, P.; Modrý, David; Lukeš, Julius

    2011-01-01

    Roč. 179, 1-3 (2011), 246-249 ISSN 0304-4017 R&D Projects: GA ČR GA523/09/1972 Institutional research plan: CEZ:AV0Z60220518 Keywords : Piroplasmosis * Babesia * Theileria * Horse * Bactrian camel * Dog Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.579, year: 2011

  4. Low 25(OH) vitamin D concentrations in international UK track and ...

    African Journals Online (AJOL)

    by analysing blood results from elite athletes on the British athletics team (N=63; mean ± standard deviation (SD) age 24.9±4.2 years). Athletes on the elite programme were offered blood tests through the winter and summer of 2009 and were eligible for inclusion in the study. Results. Nineteen per cent (n=12) of athletes in ...

  5. Chemiluminescence of polyamides III. Luminescence accompanying thermooxidation of lactam-based polyamides stabilized by antioxidants

    Czech Academy of Sciences Publication Activity Database

    Lánská, Božena; Matisová-Rychlá, L.; Rychlý, J.

    2001-01-01

    Roč. 72, č. 2 (2001), s. 249-258 ISSN 0141-3910 R&D Projects: GA AV ČR IAA4050702; GA AV ČR KSK2050602 Institutional research plan: CEZ:AV0Z4050913 Keywords : lactam-based polyamides * antioxidants * chemiluminescence Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.905, year: 2001

  6. Chloroguanide metabolism in relation to the efficacy in malaria prophylaxis and the S-mephenytoin oxidation in Tanzanians

    DEFF Research Database (Denmark)

    Skjelbo, E; Mutabingwa, T K; Bygbjerg, Ib Christian

    1996-01-01

    S-Mephenytoin and chloroguanide (proguanil) oxidation was studied in 216 tanzanians. The mephenytoin S/R ratio in urine ranged from 0.9, were arbitrarily defined as poor metabolizers of mephenytoin. The chloroguanide/cycloguanil ratio ranged from 0.82 to 249. There was a significant correlation b...

  7. Vliv vegetačního krytu na disipaci energie a vodní režim v krajině - dopady na interakce biotických a abiotických složek v povrchových vodách

    Czech Academy of Sciences Publication Activity Database

    Pechar, Libor; Pokorný, Jan; Procházka, J.; Wotavová, K.; Pecharová, E.; Švehla, J.

    2004-01-01

    Roč. 3, č. 21 (2004), s. 249-255 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] Institutional research plan: CEZ:AV0Z6087904 Keywords : Landscape function * water cycle * remote sensing Subject RIV: DO - Wilderness Conservation

  8. Effect of fibre and digestible energy levels on growth performance ...

    African Journals Online (AJOL)

    A seventy-day feeding trial was conducted to investigate the effect of dietary fibre and digestible energy (DE) level on growth performance, apparent nutrient digestibility and caecal fermentation of growing rabbits. The experiment was laid out in a 3 × 3 factorial arrangement of 3 levels of fibre (low (249 – 258 g/kg NDF, 149 ...

  9. Improvement in field trapping capability of (Nd, Eu, Gd) Ba.sub.2./sub.Cu.sub.3./sub.O.sub.y./sub. and Ag.sub.2./sub.O addition

    Czech Academy of Sciences Publication Activity Database

    Muralidhar, M.; Jirsa, Miloš; Sakai, N.; Murakami, M.

    2001-01-01

    Roč. 40, č. 11 (2001), s. 6329-6334 ISSN 0021-4922 R&D Projects: GA AV ČR IAA1010919 Institutional research plan: CEZ:AV0Z1010914 Keywords : melt-textured materials * single domain * microstructure * flux pinning * critical current density * trapped filed Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.249, year: 2001

  10. 75 FR 3277 - Notice of Final Federal Agency Actions on State Highway 99 (Segment F-2) in Texas

    Science.gov (United States)

    2010-01-20

    ... road with intermittent frontage roads, grade-separated intersections with exit and entrance ramps at five intersecting roadways, and elevated directional interchanges at State Highway 99 and State Highway... 249 near Boudreaux Road. It will then proceed northeast through Harris County and end at I-45 north of...

  11. Estrogenic activity of environmental polycyclic aromatic hydrocarbons in uterus of immature Wistar rats

    Czech Academy of Sciences Publication Activity Database

    Kummer, V.; Mašková, J.; Zralý, Z.; Neča, J.; Šimečková, P.; Vondráček, Jan; Machala, M.

    2008-01-01

    Roč. 180, č. 3 (2008), s. 212-221 ISSN 0378-4274 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : polycyclic aromatic hydrocarbons * rat immature uterothrophic assay * estrogen receptor Subject RIV: BO - Biophysics Impact factor: 3.249, year: 2008

  12. Guild composition and seasonal distribution of insects on Protea ...

    African Journals Online (AJOL)

    1990-06-12

    Jun 12, 1990 ... with special reference to insect-plant interactions. Ph.D. thesis, University of Stellenbosch, Stellenbosch. 117 pp. DONNELLY, D. & GILIOMEE, J.H. 1985. Community structure of epigaeic ants (Hymenoptera: Formicidae) in fynbos. 249 vegetation in the Jonkershoek Valley. J. eN. Soc. sth. Afr. 48: 247-257.

  13. Pesticide residues in fruit and vegetables from Africa - a Nordic Project

    DEFF Research Database (Denmark)

    Petersen, Annette

    . Most of the samples came from South Africa (249), followed by Egypt (129), Morocco (92) and Kenya (88). In total 45 different commodities were analyzed, oranges (162) being the largest group, followed by beans with pods (80) and table grapes (71). In the analytical scope 220 to 345 pesticides...

  14. Glass melting and its innovation potentials : the role of glass flow in the bubble-removal process

    Czech Academy of Sciences Publication Activity Database

    Němec, Lubomír; Cincibusová, P.

    2008-01-01

    Roč. 52, č. 4 (2008), s. 240-249 ISSN 0862-5468 R&D Projects: GA MPO 2A-1TP1/063 Institutional research plan: CEZ:AV0Z40320502 Keywords : bubble removal * temperature gradients * glass-flow patterns, Subject RIV: CA - Inorganic Chemistry Impact factor: 0.644, year: 2008

  15. Quasi-linear heating and acceleration in bi-Maxwellian plasmas

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Passot, T.; Sulem, P. L.; Trávníček, Pavel M.

    2013-01-01

    Roč. 20, č. 12 (2013), 122306/1-122306/6 ISSN 1070-664X Institutional support: RVO:68378289 Keywords : plasma electromagnetic waves * plasma nonlinear phenomena * diffusion Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013 http://scitation.aip.org/content/aip/journal/pop/20/12/10.1063/1.4846955

  16. Establishment of target and invasive plant species on a reclaimed coal mining dump in relation to their occurrence in the surroundings

    Czech Academy of Sciences Publication Activity Database

    Kabrna, M.; Hendrychová, M.; Prach, Karel

    2014-01-01

    Roč. 28, č. 4 (2014), s. 242-249 ISSN 1748-0930 R&D Projects: GA ČR(CZ) GAP505/11/0256 Institutional support: RVO:67985939 Keywords : mining * reclamation * vascular plants Subject RIV: EH - Ecology, Behaviour Impact factor: 0.562, year: 2014

  17. APPLICATTON OF SCTENTIF'IC PRINCIPLES IN MERINO SHEEP ...

    African Journals Online (AJOL)

    J. Diary Sci.,42: 115. POGGEMOEL, D.G. & VAN DER MERWE, C.A., 1975. Die gebruik van seleksie-indekse by Merinoskape. S. Afr. J. Anim. Scr 5 ,249. ROBERTSON, A., 1953. A numerical description of breed structure. J. agric. Sct., Camb.43:344. ROBERTSON, A., 1954. Artificial insemination and livestock improvement.

  18. Effect of intranasal recombinant Mannheimia haemolytica ...

    African Journals Online (AJOL)

    ADEYEYE

    2015-03-20

    Mar 20, 2015 ... DC (1997). Serotyping and enzyme characterization of Pasteurella hemolytica and. Pasteurella multocida isolates recovered from pneumonic lungs of stressed feeder calves. Current. Microbiology, 34(4):244-249. Tenuche O, Emikpe BO & Sabri MY (2013). Cellular and mucosal responses in the respiratory.

  19. Examining Intrinsic Thalamic Resting State Networks Using Graph Theory Analysis : Implications for mTBI detection

    Science.gov (United States)

    2012-08-01

    McGraw-Hill, Jan. 2000. [15] R.W. Cox, “AFNI: software for analysis and visualization of functional magnetic resonance neuroimages”, Computers...Network homogeneity reveals decreased integrity of default-mode network in ADHD ”, J Neuroscience Met. Vol. 169, no. 1, pp. 249-254, 2008. [25

  20. 75 FR 66621 - Reporting of Proxy Votes on Executive Compensation and Other Matters

    Science.gov (United States)

    2010-10-28

    ... Exchange Commission 17 CFR Parts 240, 249, 270 et al. Reporting of Proxy Votes on Executive Compensation... RIN 3235-AK67 Reporting of Proxy Votes on Executive Compensation and Other Matters AGENCY: Securities... Section 13(f) of the Securities Exchange Act to report annually how it voted proxies relating to executive...

  1. The labour ward analgesic service at King Edward VIII Hospital ...

    African Journals Online (AJOL)

    Abstract The provision of analgesic services to the labour ward at King Edward VIII Hospital was studied during a I-week period. Of249 patients, 113 (45%) received no analgesia whatsoever. Intramuscular pethidine was the commonest form of analgesia and was used in 97 patients (39%). Thirty-six patients (14%) received ...

  2. Maximum effort in the minimum-effort game

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Normann, H.-T.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  3. Sokoto Journal of Veterinary Sciences Occurrence of parasite eggs ...

    African Journals Online (AJOL)

    ADEYEYE

    water and water supplies contaminated with sewage for irrigation, post-harvest ... and washed in distilled water (1500 mls) in a plastic container. .... Pharmaceutical Biology, 3: 249-259. Beuchat LR (2002). Ecological factors influencing survival and growth of human pathogens on raw fruits and vegetables. Microbes and.

  4. Do vaginal lactobacilli prevent preterm labour?

    African Journals Online (AJOL)

    De Wet GH. Hool1 P, Gouban P. The association between Chlamydia cervicitis. chorioamnionitis ano neonatal complications. Arch. Gynecol Obster 1991: 249: 79-85. 19. Donders GGG. Desmyter J, De Wet OH. Van Assche AA. The association of gonorrhoea and syphilis with premature birth and low birth wi!"ight. Genitourin.

  5. Copper(I) Chelation by Tetradentate NSSN Donor Ligands: Reversible Oxidation but no Oxygenation

    Czech Academy of Sciences Publication Activity Database

    Schnödt, J.; Sieger, M.; Sarkar, B.; Fiedler, Jan; Manzur, J.; Su, Ch. Y.; Kaim, W.

    2011-01-01

    Roč. 637, 7-8 (2011), s. 930-934 ISSN 0044-2313 R&D Projects: GA ČR GA203/09/0705 Institutional research plan: CEZ:AV0Z40400503 Keywords : benzimidazole ligands * coordination geometry * copper Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.249, year: 2011

  6. Optical properties of erbium doped antimony based glasses: Promising visible and infrared amplifiers materials

    Czech Academy of Sciences Publication Activity Database

    Hamzaoui, M.; Soltani, M.; Baazouzi, M.; Tioua, B.; Ivanova, Z.G.; Lebullenger, R.; Poulain, M.; Zavadil, Jiří

    2012-01-01

    Roč. 249, č. 11 (2012), s. 2213-2221 ISSN 0370-1972 R&D Projects: GA ČR GAP106/12/2384 Institutional support: RVO:67985882 Keywords : Glasses * Rare earths * Photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2012

  7. Gclust Server: 92000 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 92000 PPT_104282 Cluster Sequences Related Sequences(249) 305 fgenesh1_pg.scaffold_...10636000001; no annotation 1 1.00e-35 14.29 0.0 0.0 0.0 0.0 0.0 Show 92000 Cluster ID 92000 Sequence ID PPT_

  8. Genetic diversity in Balkhi, Hashtnagri and Michni sheep ...

    African Journals Online (AJOL)

    hope&shola

    2010-11-08

    Nov 8, 2010 ... Detecting immigration by using multilocus genotypes. Proc. Natl. Acad. Sci. USA, 94: 9197-9221. Raymond M, Rousset F (1995). GENEPOP (version 4.0): population genetic software for exact test and ecumenicism. J. Hered. 86: 248-. 249. Saitbekova NS, Gaillard C, Obexer-Ruff G, Dolf G (1999). Genetic.

  9. The Sound of Freedom. Naval Weapons Technology at Dahlgren, Virginia, 1918-2006

    Science.gov (United States)

    2006-01-01

    Electromagnetic Weapons Division into the Navy Electric Weapons Office with which to manage the development of a full-scale POC rail gun. Additionally... Electromagnetic Weapons Division, 249 electronic jamming equipment, 206 Electronic Numerical Integrator and Computer (ENIAC), 93, 94 The Sound of

  10. Management practices and production constraints of central ...

    African Journals Online (AJOL)

    management practices of central highland goats and their major constraints. ... a basic education. Almost all 249 (99.6%) of the respondents practiced a mixed crop livestock production system, and majority of them (85.2%) reared goats ..... owners and the children who often keep the goats do not have adequate aware-.

  11. Metabolic and hormonal responses of growing modern meat type chickens to fasting

    Science.gov (United States)

    The present study compared the effects of fasting on circulating concentrations of glucose, insulin and glucagon in male and female modern meat-type chickens (Ross 708) at three ages (19 d, 33 d and 47 d). Plasma concentrations of glucose were reduced by fasting with reductions of 24.9% (19-d-old),...

  12. ORF Alignment: NC_006366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006366 gi|54292957 >2bjvA 9 226 34 249 5e-52 ... gb|AAC36805.1| HrpS [Pantoea stewartii subsp. stewart...ii] pir||S36185 wtsA protein ... - Erwinia stewartii sp|P36219|WTSA_ERWST Pathoge

  13. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54295748 >2bjvA 9 226 34 249 5e-52 ... gb|AAC36805.1| HrpS [Pantoea stewartii subsp. stewart...ii] pir||S36185 wtsA protein ... - Erwinia stewartii sp|P36219|WTSA_ERWST Pathoge

  14. Balti kirjakultuuri mitmekeelsest loomust / Liina Lukas

    Index Scriptorium Estoniae

    Lukas, Liina, 1970-

    2008-01-01

    Poleemika senise rahvuslik-keelelise lähenemisega eesti varasemale kirjandusloole. 17. saj. Eestimaal viljeldud uusladina luulest Euroopa kirjandusnähtuste taustal (ka Reiner Brockmanni eestikeelsest juhuluuleharrastusest) ning 19. saj. lõpuni püsinud mitmekeelsusest siinses kultuuris. Ka ettepanek kasutada seoses Eestimaa mitmekeelse kultuuriga "balti kirjakultuuri" mõistet. Sisaldab bibliograafiat. Autorist lk. 249

  15. Theoretical Analysis and Preparation of Tapered Suspended Core Microstructure Fibers

    Czech Academy of Sciences Publication Activity Database

    Martan, Tomáš; Kaňka, Jiří; Kašík, Ivan; Matějec, Vlastimil

    2009-01-01

    Roč. 3, č. 3 (2009), s. 233-249 ISSN 1559-9612 Institutional research plan: CEZ:AV0Z20670512 Keywords : tapered fibers * optical sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.354, year: 2009

  16. How to hatch from an egg of great structural strength. A study of the common cuckoo

    Czech Academy of Sciences Publication Activity Database

    Honza, Marcel; Picman, J.; Grim, T.; Novák, V.; Čapek Jr., Miroslav; Mrlík, Vojtěch

    2001-01-01

    Roč. 32, č. 3 (2001), s. 249-255 ISSN 0908-8857 R&D Projects: GA AV ČR IAA6087801 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cuculus canorus * eggs Subject RIV: EG - Zoology Impact factor: 1.353, year: 2001

  17. On the complex oscillation of differential polynomials generated by ...

    Indian Academy of Sciences (India)

    49 (2004) 897–911. [24] Liu M-S and Zhang X-M, Fixed points of meromorphic solutions of higher order linear differential equations, Ann. Acad. Sci. Fenn. Math. 31 (2006) 191–211. [25] Shea D and Sons L, Value distibution theory for meromorphic functions of slow growth in the disk, Houston J. Math. 12(2) (1986) 249–266.

  18. Effect of long term cropping hybrid sorrel (Rumex patientia x Rumex tianshanicus) on soil biota

    Czech Academy of Sciences Publication Activity Database

    Heděnec, Petr; Novotný, D.; Usťak, S.; Honzík, R.; Váňa, V.; Petříková, V.; Frouz, Jan

    2015-01-01

    Roč. 78, July (2015), s. 92-98 ISSN 0961-9534 R&D Projects: GA MŠk(CZ) 7E08081 Institutional support: RVO:60077344 Keywords : basal soil respiration * composition of soil biota * hybrid sorrel * microbial biomass C * specific microbial respiration (qCO2) Subject RIV: DF - Soil Science Impact factor: 3.249, year: 2015

  19. Imprints of climate forcings in global gridded temperature data

    Czech Academy of Sciences Publication Activity Database

    Mikšovský, Jiří; Holtanová, E.; Pišoft, P.

    2016-01-01

    Roč. 7, č. 1 (2016), s. 231-249 ISSN 2190-4979 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : atlantic multidecadal osciallation * pacific decadal oscillation * surface-temperature * 20th century reanalysis * southern-oscilation * internal variability * irradiance Subject RIV: EH - Ecology, Behaviour Impact factor: 3.635, year: 2016

  20. Correlation between morphological characters and estimated bunch ...

    African Journals Online (AJOL)

    The methodology of multiple linear regression (MLR) was used to estimate bunch weight. The most significant variables that were measured included number of leaves at harvest, number of fruits per bunch, FW, FL, rachis weight (RW) and stalk length (SL), generating the following prediction equation: BW= -5.249 + ...

  1. A multi breed reference improves genotype imputation accuracy in Nordic Red cattle

    DEFF Research Database (Denmark)

    Brøndum, Rasmus Froberg; Ma, Peipei; Lund, Mogens Sandø

    2012-01-01

    the subsequent effect of the imputed HD data on the reliability of genomic prediction. HD genotype data was available for 247 Danish, 210 Swedish and 249 Finnish Red bulls, and for 546 Holstein bulls. A subset 50 of bulls from each of the Nordic Red populations was selected for validation. After quality control...

  2. Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe.

    Science.gov (United States)

    Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix

    2013-03-01

    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.

  3. Human Betacoronavirus 2c EMC/2012–related Viruses in Bats, Ghana and Europe

    Science.gov (United States)

    Annan, Augustina; Baldwin, Heather J.; Corman, Victor Max; Klose, Stefan M.; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K.V.; Lina, Peter H.C.; Godlevska, Elena V.; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian

    2013-01-01

    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats. PMID:23622767

  4. Nuclear shell effect and collinear tripartition of nuclei

    Indian Academy of Sciences (India)

    2015-08-04

    Aug 4, 2015 ... [15] G Royer, J. Phys. G: Nucl. Part. Phys. 21, 249 (1995). [16] K Manimaran and M Balasubramaniam, Phys. Rev. C 83, 034609 (2011). [17] K R Vijayaraghavan, W von Oertzen and M Balasubramaniam, Eur. Phys. J. A 48, 27 (2012). [18] G Audi, A H Wapstra and C Thibault, Nucl. Phys. A 729, 337 (2003).

  5. Assessment of anaemia and iron status of school age children (aged ...

    African Journals Online (AJOL)

    -12 years in some rural communities in Nigeria as well as identify factors associated with anemia in the children. A total of 249 school children, 120 males and 129 females aged between 7-12 years were used in the study. Haemomoglobin ...

  6. Degradation of PET, PEEK and PI induced by irradiation with 150 keV Ar+ and 1.76 MeV He+ ions

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Havránek, Vladimír; Švorčík, V.; Suzuki, T.; Djourelov, N.

    2005-01-01

    Roč. 240, 1/2 (2005), s. 245-249 ISSN 0168-583X R&D Projects: GA MŠk(CZ) OC 527.100 Institutional research plan: CEZ:AV0Z10480505 Keywords : irradiated polymers * ion beam modification * ERDA Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.181, year: 2005

  7. Information Systems and Technology Sourcing Strategies and Performance of E-Retailers

    Science.gov (United States)

    Tsai, Juliana Yuh-Shun

    2012-01-01

    The e-Retail industry has grown rapidly over the last few years and is projected to continue its upward trend as consumers shift from traditional channels to online channels. In March 2010, Forrester Research forecasted that online retail sales will grow by 10% a year for the next 5 years and e-Retail sales will amount to $249 billion by 2014.…

  8. Significance of transition between Talchir Formation and Karharbari ...

    Indian Academy of Sciences (India)

    intracontinental ranges: High and Middle Atlas, Morocco;. Geol. Rundschau 81 249–259. Goldring R and Bridges P 1973 Sublittoral sheet sandstones;. J. Sediment. Petrol. 43 736–747. Gray J M 1996 Glacio-Isostasy, Glacio-Eustasy and rela- tive sea-level change; In: Past Glacial Environments: Sed- iments, Forms and ...

  9. An Improved Consensus Linkage Map of Barley Based on Flow-Sorted Chromosomes and Single Nucleotide Polymorphism Markers

    Czech Academy of Sciences Publication Activity Database

    Munoz-Amatriain, M.; Moscou, M. J.; Bhat, P. R.; Bartoš, Jan; Suchánková, Pavla; Šimková, Hana; Endo, T. R.; Fenton, R. D.; Lonardi, S.; Castillo, A. M.; Doležel, Jaroslav; Close, T. J.

    2011-01-01

    Roč. 4, č. 3 (2011), s. 238-249 ISSN 1940-3372 R&D Projects: GA MŠk(CZ) LC06004; GA MŠk ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : Chromosomes sorting * Barley * Nucleotide polymorphism Subject RIV: EB - Genetics ; Molecular Biology

  10. Examining the Impact of the ABRACADABRA (ABRA) Web-Based Literacy Program on Primary School Students in Hong Kong

    Science.gov (United States)

    Mak, Barley S. Y.; Cheung, Alan C. K.; Guo, Xin; Abrami, Philip C.; Wade, Anne

    2017-01-01

    The current paper examined the effects of A Balanced Reading Approach for Children Always Designed to Achieve Best Results for All (ABRA), a web-based literacy programme developed by the the Centre for the Study of Learning and Performance (CSLP) at Concordia University, on primary school children in Hong Kong. The participants were 249 Primary 1…

  11. Beiträge zur Kenntnis der Pupillacea VII. Über zwei Wenig Bekannte Valloniidae

    NARCIS (Netherlands)

    Gittenberger, E.

    1977-01-01

    Spermodea spermatia (Da Silva e Castro) (Fig. 2) Helix spermatia J. da Silva e Castro, 1887: 249 (Locus typicus: "au bois de Bussaco", Bugaco, 40°22'N 8°21'W, etwa 15 km nnö. von Coimbra, Beira Litoral, Portugal — ? Syntypus: MHNG-Bgt2)). — A. Locard, 1899: 61. Helix (Acanthinula) spermatia — C. A.

  12. ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...

    African Journals Online (AJOL)

    DELL

    Background: Subarachnoid Haemorrhage (SAH) has been shown to have a global incidence of 2-49 cases per 100 000 population, and it is associated with a high morbidity and mortality. There is a scarcity of data regarding this condition in Kenya. This paper presents the causes and risk factors for this condition in patients ...

  13. Microwave-assisted synthesis and photoluminescence properties of ...

    Indian Academy of Sciences (India)

    2017-11-11

    Nov 11, 2017 ... Sasakura H 1984 Appl. Phys. Lett. 45 960. [5] Barrow W A, Coovert R E and King C N 1984 SID Sympo- sium Digest of Technical Papers, San Francisco, CA, USA, p 249. [6] Tanaka S, Shankar V, Shiiki M, Deguchi H and May K H. 1985 SID Symposium Digest of Technical Papers, Orlando,. FL, USA, p 255.

  14. THE DIVISION OF ENERGY DURING GROWTH

    African Journals Online (AJOL)

    The other 3 died of acute pneumonia relatively early during the experiment. ... the periodic antibiotic treatment, the lambs were also treated twice ..... pigs. hoc. 6th Symp. on Energt Metab. of Fmm Aninuls. Hohenhein, B.R.D. E.A.A.P. htbl. No. 14, pp.249-25r. THORBEK, GRETE & NEERGAARD, LISE, 1970. Construction and ...

  15. 75 FR 67395 - Iron Construction Castings From Brazil, Canada, and China; Determinations

    Science.gov (United States)

    2010-11-02

    ... countervailing duty order on heavy iron construction castings from Brazil, the antidumping duty order on heavy iron construction castings from Canada, and the antidumping duty orders on iron construction castings...), entitled Iron Construction Castings from Brazil, Canada, and China: Investigation Nos. 701-TA-249 and 731...

  16. Equus burchelli antiquorum

    African Journals Online (AJOL)

    ABNORMALITIES OF THE ZEBRA. STALLION (EQUUS BURCHELLI. ANTIQUORUM). O. L. SMUTS. National Parks Board o/Trustees, Skukuza days from the mean lambing interval of 249 days it may be deduced that the female bushbuck is capable of conception on an average of 69 days following the birth of each lamb ...

  17. An appraisal of the utilisation of social media for political ...

    African Journals Online (AJOL)

    The study is a survey aimed at examining the utilisation of social media for political communication during the 2011 presidential election in Nigeria. The rationale behind the study was to determine whether voters' choice of presidential candidates was influenced by their social media use. 249 respondents selected through ...

  18. Untitled

    Indian Academy of Sciences (India)

    Rev. 135A 1691. Berne B J and Pecora R 1976 Dynamic light scattering (New York : John Wiley). Celasco M, Fiorillo F and Mazzetti P 1976 Phys. Rey. Lett. 36 38. Harrison W A 1966 Pseudopotentials in the theory of metals (Reading, Mass.: Benjamin). Van Hove L. 1954 Phys. Rev. 95 249. Vineyard G H 1958 Phys. Rev.

  19. The practice of continuous sedation until death in nursing homes in flanders, belgium: a nationwide study

    NARCIS (Netherlands)

    Rys, S.; Mortier, F.; Deliens, L.; Bilsen, J.

    2014-01-01

    Results The response rate was 65.5%, and 249 nurses reported a case of CSD (57.6%). Most individuals had cancer (33.6%) or dementia (32.8%); lacked competence (65.7%); and had severe pain (71.2%), fatigue (62.3%), loss of dignity (59%), anxiety (58.4%), and longing for death (58.4%). Intractable

  20. Quantum criticality in CaRuO.sub.3./sub. - influence of Ti substitution

    Czech Academy of Sciences Publication Activity Database

    Baran, A.; Zorkovská, A.; Kajňaková, M.; Šebek, Josef; Šantavá, Eva; Bradaric, I.; Feher, A.

    2012-01-01

    Roč. 249, č. 8 (2012), 1607-1612 ISSN 0370-1972 Institutional research plan: CEZ:AV0Z10100520 Keywords : magnetism * non-Fermi liquids * phase separation * quantum criticality * ruthenates Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2012

  1. Observations on the lambing interval of the cape bushbuck ...

    African Journals Online (AJOL)

    A record of births from three Cape bushbuck ewes at Queens Park Zoo, East London, from November 1971 to December 1974, indicated that the mean lambing interval of Tragelaphus scriptus sylvaticus in captivity is 249 days and that ewes reach sexual maturity at approximately one year of age.

  2. 75 FR 79320 - Security-Based Swap Data Repository Registration, Duties, and Core Principles

    Science.gov (United States)

    2010-12-20

    ... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 240 and 249 [Release No. 34-63347; File No. S7-35-10] RIN 3235-AK79 Security-Based Swap Data Repository Registration, Duties, and Core Principles Correction In proposed rule document 2010-29719 beginning on page 77306 in the issue of December 10, 2010...

  3. Mechanism of reactive compatibilization of a blend of recycled LDPE/HIPS using an EPDM/SB/aromatic diamine co-additive system

    Czech Academy of Sciences Publication Activity Database

    Pospíšil, Jan; Fortelný, Ivan; Michálková, Danuše; Kruliš, Zdeněk; Šlouf, Miroslav

    2005-01-01

    Roč. 90, č. 2 (2005), s. 244-249 ISSN 0141-3910 R&D Projects: GA AV ČR KSK4050111; GA ČR GA106/02/1248 Keywords : pre-aged LDPE * blend s LDPE-HIPS * recycled upgrading Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.749, year: 2005

  4. The Roles of Corporate Governance in Bank Failures during the Recent Financial Crisis

    NARCIS (Netherlands)

    Berger, A.N.; Imbierowicz, B.; Rauch, C.

    2012-01-01

    Abstract: This paper analyzes the roles of corporate governance in bank defaults during the recent financial crisis of 2007-2010. Using a data sample of 249 default and 4,021 no default US commercial banks, we investigate the impact of bank ownership and management structures on the probability of

  5. Platinum Acetylide Two-Photon Chromophores (Postprint)

    Science.gov (United States)

    2007-01-01

    D. L.; Ehrlich, J. E.; Erskine, L. L.; Heikal, A. A.; Kuebler, S. M.; Le , I. Y. S.; McCord-Maughon, D.; Qin, J.; Rockel, H.; Rumi, M.; Wu, X. L...Chem. ReV. 2005, 249, 1491. (73) Parola, S.; Ortenblad, M.; Chaput, F.; Desroshes, C.; Miele , P.; Baldeck, P. L.; Malmstrom, E.; Lindgren, M

  6. Platinum Acetylide Two-Photon Chromophores (Preprint)

    Science.gov (United States)

    2007-04-01

    Kuebler, S. M.; Le , I. Y. S.; McCord-Maughon, D.; Qin, J.; Rockel, H.; Rumi, M.; Wu, X. L.; Marder, S. R.; Perry, J., Nature 1999,398,51. 11. Denk, W...Y.; Haskins-Glusac, K.; Schanze, K. S., Coord. Chem. Rev. 2005,249, 1491. 71. Parola, S.; Ortenblad, M.; Chaput, F.; Desroshes, C.; Miele , P

  7. Vaccinia virus Vaccinia complement control protein: Multi-functional ...

    Indian Academy of Sciences (India)

    Unknown

    Mysteries of the smallpox vaccine. 141. Viral mimicry. Viral mimicry of the complement system. 249. Viral molecules. Vaccinia complement control protein: Multi-functional pro- tein and a potential wonder drug. 265. Viral pneumonia. Severe acute respiratory syndrome (SARS): an old virus jumping into a new host or a new ...

  8. The Research Laboratory of Electronics Progress Report Number 136, 1 January-31 December 1993

    Science.gov (United States)

    1994-06-01

    the previous four years for of gravitational lensing-the distortion of radio the Office of Solar System Exploration of the signals from distant radio...355 Energia Nucleare e Energie Alternative (Italy) 249 Geophysics 325 Energy transfer 133 Geraci, James R. 35, 37 Entin, Ilya 209, 225 Gold, Bernard 317

  9. Effect of Load History on Fatigue Life.

    Science.gov (United States)

    1980-06-01

    Polymer Science, Pt. C. No. 12, pp. 249-261, 1966. 46. Haward , R.N., Ed., The Physics of Glassy Polymers, John Wiley & Sons, New York, 1973. 47. Crank, J...WIM H.M., and Kamp, John L.H., "Non Hookeon Behavior in the Fibre Direction of Carbon-Fibre Composites and the Influence of Fibre Waviness on the

  10. Electrochromic devices employing methacrylate-based polymer electrolytes

    Czech Academy of Sciences Publication Activity Database

    Reiter, Jakub; Krejza, O.; Sedlaříková, M.

    2009-01-01

    Roč. 93, č. 2 (2009), s. 249-255 ISSN 0927-0248 R&D Projects: GA AV ČR KJB400320701; GA MŠk LC523 Institutional research plan: CEZ:AV0Z40320502 Keywords : polymer electrolyte * electrochromism * methacrylate Subject RIV: CA - Inorganic Chemistry Impact factor: 3.858, year: 2009

  11. Characterization of spirochetal isolates from arthropods collected in South Moravia, Czech Republic, using fatty acid methyl esters analysis

    Czech Academy of Sciences Publication Activity Database

    Čechová, L.; Durnová, E.; Šikutová, Silvie; Halouzka, Jiří; Němec, M.

    2004-01-01

    Roč. 808, č. 2 (2004), s. 249-254 ISSN 1570-0232 R&D Projects: GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : spirochetes * arthropods * fatty acid methyl esters Subject RIV: EE - Microbiology, Virology Impact factor: 2.176, year: 2004

  12. 48 CFR 49.115 - Settlement of terminated incentive contracts.

    Science.gov (United States)

    2010-10-01

    ... any adjustment of target cost resulting from the partial termination. The contracting officer shall adjust the target cost, if required. (2) Complete termination. The parties shall negotiate the settlement... Revision—Firm Target, and 52.249-2, Termination for Convenience of the Government (Fixed-Price). (1...

  13. Untitled

    Indian Academy of Sciences (India)

    The Source of Acetylcholine in the Frog's Heart on Direct Electrical Stimulation . . . . Inderjit Singh, Sunita Inderjit Singh and O. P. Bhatmagar 249. The Skull of Hemirhamphus xanthopterus Cuv. & Val. . . . . . . . . . . . P. N. Mathur, Narain Khattar and Kumari M. Zachariah 255. Studies on the Microbial Spoilage of Canned Food.

  14. “AS IF NOTHING HAD HAPPENED”? KARL BARTH AND THE ...

    African Journals Online (AJOL)

    escape the knowledge that we do theology “after Barth” (Webster 2005:249;. Thomas, Brouwer & McCormack 2012), .... to that of Hennie Pieterse (1995); or the different kind of language and tone. Cilliers and Campbell ... expansive text of Preaching fools, there is – especially in light of the above critique on Tisdale's use of ...

  15. Attention-Deficit, Fear and Aggression in Iranian Preschool Students with Regard to Gender Differences

    Science.gov (United States)

    Sheikhzade, Mostafa; Assemi, Arezoo

    2013-01-01

    The cause of most adult psychopathologies or behavioural disorders can be traced back to childhood. In this study, we examine the attention-deficit, fear and aggression in Iran's preschool students in Oshnaviye city. In this analytical-descriptive study, 50 students were selected through stratified sampling method from 249 students. Data were…

  16. "I Like to Plan Events": A Document Analysis of Essays Written by Applicants to a Public Relations Program

    Science.gov (United States)

    Taylor, Ronald E.

    2016-01-01

    A document analysis of 249 essays written during a 5-year period by applicants to a public relations program at a major state university in the southeast suggests that there are enduring reasons why students choose to major in public relations. Public relations is described as a major that allows for and encourages creative expression and that…

  17. Locomotor diseases among male long-haul truck drivers and other professional drivers

    DEFF Research Database (Denmark)

    Jensen, Anker; Kaerlev, Linda; Tüchsen, Finn

    2007-01-01

    -249) and for other truck drivers (SHR: 130, 95% CI: 108-156) compared to bus drivers (SHR: 110, 95% CI: 79-149). All drivers had high SHR for lesions of the ulnar nerve (SHR: 159, 95% CI: 119-207), especially bus drivers (SHR: 197, 95% CI: 116-311). Long-haul truck drivers had high SHRs for synovitis and bursitis...

  18. Graph-Theoretic Statistical Methods for Detecting and Localizing Distributional Change in Multivariate Data

    Science.gov (United States)

    2015-06-01

    of each method. Number of IQR deviations above the third quartile M ed ia n A la rm T im e 0 1.5 2 3 5 0 50 0 10 00 15 00 20 00 Half Factor...Kotsiantis, S. B. (2007). Supervised Machine Learning: A Review of Classification Techniques. Informatica , 31, 249–268. 122 Koul, H. L., & Qian, L

  19. 76 FR 72389 - Pacific Fishery Management Council; Public Meetings/Workshop

    Science.gov (United States)

    2011-11-23

    ... accessible to people with disabilities. Requests for sign language interpretation or other auxiliary aids... time zones or to view the webinar in languages other than English, go to https://nwfsc.webex.com/nwfsc... is not a toll-free number) and use the access code 805-527-249 when prompted. A public listening...

  20. Becov Castle project - Way to Middle Ages

    Czech Academy of Sciences Publication Activity Database

    Durdík, Tomáš

    2010-01-01

    Roč. 64, jaro (2010), s. 241-249 ISSN 1875-2896. [Meeting of Europa Nostra Scientific Council /45./. Rhodos, 09.10.2009-15.10.2009] Institutional research plan: CEZ:AV0Z80020508 Keywords : Bečov * castle * castellology * architecture * medieval archaeology * Bohemia * Middle Ages Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. An evaluation of selected Neidium species from the Antarctic Region

    Czech Academy of Sciences Publication Activity Database

    Hamilton, P. B.; De Haan, M.; Kopalová, Kateřina; Zidarova, R.; Van de Vijver, B.

    2014-01-01

    Roč. 29, č. 1 (2014), s. 27-40 ISSN 0269-249X R&D Projects: GA MŠk ME 934; GA MŠk ME 945 Institutional support: RVO:67985939 Keywords : Bacillariophyta * biogeography * Neidium Subject RIV: EF - Botanics Impact factor: 1.746, year: 2014

  2. Comprehensive Inventory and Determinations of Eligibility for Fort Riley Buildings: 1857-1963

    Science.gov (United States)

    2009-09-01

    personal property, the Division needed to move “315 dogs, nine cats, and two monkeys as pets .”249 To ac- complish the move, an estimated 15,420 packing...DeHaviland U-1 Otter , designed to haul cargo and passengers in and out of confined areas.316 Big news arrived on 21 July 1955, with receipt of a

  3. The Role of Psychosocial Characteristics in Criminal Convictions among Cocaine and Gambling Clients in Treatment

    Science.gov (United States)

    Martin, Gina; Macdonald, Scott; Ishiguro, Sonya

    2013-01-01

    This study assessed the relative importance of problem gambling, cocaine use and selected psychosocial characteristics in predicting criminal convictions. A self-administered questionnaire was completed by clients when admitted to a treatment program for a primary problem with cocaine (n = 300), gambling (n = 199), or tobacco (n = 249). The…

  4. 78 FR 4766 - Adoption of Updated EDGAR Filer Manual

    Science.gov (United States)

    2013-01-23

    ... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 232, 239, 249, 269, 274 [Release Nos. 33-9382; 34-68644; 39-2488; IC-30348] Adoption of Updated EDGAR Filer Manual AGENCY: Securities and Exchange... EDGAR Filer Manual, Volume II: EDGAR Filing should then be followed. Along with the adoption of the...

  5. Histological and biochemical evaluations of the liver and kidney of ...

    African Journals Online (AJOL)

    sunny t

    2016-03-16

    249. Bourgois JJ(1989). Tephrosia vogelii, une plante ichtyotoxique utilisée pour la pêche aux Comores. Bull. Soc. Roy. Bot. de Belgique 133:81-. 86. Dzenda T, Ayo JO, Adelaiye AB, Adaudi AO (2008). Ethno medical and.

  6. The effectiveness of selected housing subsidies in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Sunega, Petr; Boelhouwer, P.

    2009-01-01

    Roč. 24, č. 3 (2009), s. 249-269 ISSN 1566-4910 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : Housing policy * Welfare economics * Subsidy effectiveness Subject RIV: AH - Economics http://www.springerlink.com/content/y8km555k622v8vu0/

  7. Structural Identification of Lentinus edodes Cellulose Derivative that ...

    African Journals Online (AJOL)

    Zjalic S, Reverberi M, Ricelli A, Mario Granito V, Fanelli. C, Adele Fabbri A. Trametes versicolor: a possible tool for aflatoxin control. Int J Food Microbiol 2006;. 107: 243-249. 7. Yan FY, Krishniah D, Rajin M, Bono A. Cellulose extraction from palm kernel cake using liquid phase oxidation. J Eng Sci Technol 2009; 4: 57-68. 8.

  8. M R Sudarsana Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. M R Sudarsana Kumar. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar ...

  9. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K Rajendra Babu. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K ...

  10. C M K Nair

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M K Nair. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K Nair.

  11. Observations of taxa of Melosira sensu lato among the slides from the Grunow Diatom Collection in Vienna (Austria). Part 1

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav; Klee, R.; Passauer, U.

    2007-01-01

    Roč. 22, č. 1 (2007), s. 57-80 ISSN 0269-249X R&D Projects: GA ČR GA205/05/0204 Institutional research plan: CEZ:AV0Z60050516 Keywords : diatoms * taxonomy * revision Subject RIV: EF - Botanics Impact factor: 0.673, year: 2007

  12. Quasistatic normal-compliance contact problem of visco-elastic bodies with Coulomb friction implemented by QP and SGBEM

    Czech Academy of Sciences Publication Activity Database

    Vodička, R.; Mantič, V.; Roubíček, Tomáš

    2017-01-01

    Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.357, year: 2016 http://www.sciencedirect.com/science/article/pii/S037704271630499X

  13. Construction of PVX virus-expression vector to express enterotoxin ...

    African Journals Online (AJOL)

    user

    2011-02-07

    Feb 7, 2011 ... systems for transient production of recombinant tallergens in. Nicotiana benthamiana. Methods, 32: 227-234. Xu CG. Wang WZ (1999). High level expression of fusion gene of. Heat-stable enterotoxin(ST1) and Heat-Labile enterotoxin B subunit(LTB). Acta Veterinaria et Zootechnica Sinic, 30: 249-253.

  14. Disease: H01996 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available -diagnosed condition? ... JOURNAL ... Mol Cell Endocrinol 249:1-9 (2006) DOI:10.1016/j.mce.2006.02.003 ... PMID:158...fication of the first mutation in two brothers and restoration of activity by protein complementation. ... JOURNAL ... J Clin Endocrinol Metab 90:4101-7 (2005) DOI:10.1210/jc.2005-0123

  15. An integrated catalog of reference genes in the human gut microbiome

    NARCIS (Netherlands)

    Li, J.; Jia, H.; Cai, X.; Zhong, H.; Feng, Q.; Sunagawa, S.; Arumugam, M.; Kultima, J.R.; Prifti, E.; Nielsen, T.; Juncker, A.S.; Manichanh, C.; Chen, B.; Zhang, W.; Levenez, F.; Xu, X.; Xiao, L.; Liang, S.; Zhang, D.; Zhang, Z.; Chen, W.; Zhao, H.; Al-Aama, J.Y.; Edris, S.; Yang, H.; Hansen, H.; Nielsen, H.B.; Brunak, S.; Kristiansen, K.; Guarner, F.; Pedersen, O.; Doré, J.; Ehrlich, S.D.; Bork, P.; Wang, J.; Vos, de W.M.; Tims, S.; Zoetendal, E.G.; Kleerebezem, M.

    2014-01-01

    Many analyses of the human gut microbiome depend on a catalog of reference genes. Existing catalogs for the human gut microbiome are based on samples from single cohorts or on reference genomes or protein sequences, which limits coverage of global microbiome diversity. Here we combined 249 newly

  16. Modeling population dynamics of two cockroach species: Effects of the circadian clock, interspecific competition and pest control

    Czech Academy of Sciences Publication Activity Database

    Wu, H. H.; Lee, H. J.; Horng, S. B.; Berec, Luděk

    2007-01-01

    Roč. 249, - (2007), s. 473-486 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : German cockroach * Blattella germanica * Blatella bisignata Subject RIV: EH - Ecology, Behaviour Impact factor: 2.323, year: 2007

  17. On the exact solutions of nonlinear diffusion-reaction equations with ...

    Indian Academy of Sciences (India)

    physics pp. 249–256. On the exact solutions of nonlinear diffusion-reaction equations with quadratic and cubic nonlinearities. R S KAUSHAL1, RANJIT KUMAR2 and AWADHESH PRASAD2. 1Department of Physics, Ramjas College, University of Delhi, Delhi 110 007, India. 2Department of Physics and Astrophysics, ...

  18. 48 CFR 49.402-1 - The Government's right.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false The Government's right. 49... MANAGEMENT TERMINATION OF CONTRACTS Termination for Default 49.402-1 The Government's right. Under contracts containing the Default clause at 52.249-8, the Government has the right, subject to the notice requirements...

  19. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Dinesh Kumar. Articles written in Pramana – Journal of Physics. Volume 57 Issue 2-3 August-September 2001 pp 235-249. Single photons, dileptons and hadrons from relativistic heavy ion collisions and quark-hadron phase transition · Dinesh Kumar Srivastava · More Details Abstract Fulltext PDF. The production of single ...

  20. Microwave Faraday effect in n-type germanium

    NARCIS (Netherlands)

    Bouwknegt, A.; Volger, J.

    The Faraday rotation, ellipticity and the accompanying magneto-absorption were determined from measurements with the crossed wave guide coupler device, at room temperature, at 24.9 GHz. The complex conductivity tensor elements of n-type germanium were deduced from this complete Faraday effect, with

  1. Safety in Numbers

    Science.gov (United States)

    2010-11-27

    Bicocca. Dipartimento di Informatica , Sistemistica e Comunicazione. Laboratorio di Test e Analisi del Software, Milano. Technical Report LTA:2004:05...Communications of the ACM, 1981. 24(9): pp. 563-573. 76. Thomas Reps, On the sequential nature of interprocedural program-analysis problems. Acta Informatica

  2. degradation products predict outcotne in gestational proteinuric ...

    African Journals Online (AJOL)

    Scientific Publications, 1989: 249-305. 3. Rodgers GM, Taylor RN, Roberts J. Preeclampsia is associated witb a serum factor cytotoxic to human endotbelial cells. Am J. Obstel Gyneco11988; 159: 908-914. 4. Davey DA, MacGillivray 1. The classification and definition of tbe hypertensive disorders of pregnancy. Am J Obstel ...

  3. New methodology for capillary electrophoresis with ESI-MS detection: Electrophoretic focusing on inverse electromigration dispersion gradient. High-sensitivity analysis of sulfonamides in waters

    Czech Academy of Sciences Publication Activity Database

    Malá, Zdeňka; Gebauer, Petr; Boček, Petr

    2016-01-01

    Roč. 935, SEP (2016), s. 249-257 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GA16-09135S Institutional support: RVO:68081715 Keywords : electrophoretic focusing * CE-ESI-MS * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.950, year: 2016

  4. Diel variations in the photosynthetic parameters of Prochlorococcus strain PCC 9511: Combined effects of light and cell cycle

    Czech Academy of Sciences Publication Activity Database

    Bruyant, F.; Babin, M.; Genty, B.; Prášil, Ondřej; Behrenfeld, M. J.; Claustre, H.; Bricaud, A.; Garczarek, L.; Holtzendorff, J.; Koblížek, Michal; Doušová, Helena; Partensky, F.

    2005-01-01

    Roč. 50, č. 3 (2005), s. 850-863 ISSN 0024-3590 R&D Projects: GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z50200510 Keywords : prochlorococcus * phytoplankton Subject RIV: EE - Microbiology, Virology Impact factor: 3.249, year: 2005

  5. 76 FR 8946 - Security Ratings

    Science.gov (United States)

    2011-02-16

    ... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 200, 229, 230, 232, 239, 240, and 249 [Release No. 33-9186; 34-63874; File No. S7-18-08] RIN 3235-AK18 Security Ratings AGENCY: Securities and Exchange... relating to the use of security ratings by credit rating agencies in our rules and forms. In this release...

  6. 76 FR 46603 - Security Ratings

    Science.gov (United States)

    2011-08-03

    ... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 200, 229, 230, 232, 239, 240, and 249 [Release No. 33-9245; 34-64975; File No. S7-18-08] RIN 3235-AK18 Security Ratings AGENCY: Securities and Exchange... requirements under the Securities Act of 1933 and the Securities Exchange Act of 1934 for securities offering...

  7. Cyberbullying Behaviors among Female College Students: Witnessing, Perpetration, and Victimization

    Science.gov (United States)

    Selkie, Ellen M.; Kota, Rajitha; Moreno, Megan

    2016-01-01

    Problem: Cyberbullying is common among adolescents, and emerging studies also describe this phenomenon in college students. Less is known about specific cyberbullying behaviors and roles in cyberbullying incidents experienced by college females. Methods: 249 female students from 4 colleges completed online surveys assessing involvement in 11…

  8. Radiation hardness properties of full-3D active edge silicon sensors

    Czech Academy of Sciences Publication Activity Database

    Da Via, C.; Hasi, J.; Kenney, C.; Linhart, V.; Parker, S.; Slavíček, T.; Watts, S. J.; Bém, Pavel; Horažďovský, T.; Pospíšil, S.

    2008-01-01

    Roč. 587, 2-3 (2008), s. 243-249 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : silicon detectors * radiation hardness * 3D Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.019, year: 2008

  9. Deformation effects in rock massifs and their long-term monitoring

    Czech Academy of Sciences Publication Activity Database

    Košťák, Blahoslav

    2006-01-01

    Roč. 39, č. 3 (2006), s. 249-258 ISSN 1470-9236 R&D Projects: GA MŠk(CZ) OC 625.10 Institutional research plan: CEZ:AV0Z30460519 Keywords : anchors * extensometers * monitoring Subject RIV: DO - Wilderness Conservation Impact factor: 0.778, year: 2006

  10. 75 FR 26310 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-05-11

    .... Index Fund. 237 COST Costco Wholesale 288 KBH KB Home. Corp. 239 MJN Mead Johnson 289 CREE Cree Inc... Act. \\4\\ Index products would be included in the expansion if the underlying index level was under 200... Fund. 155 CIEN Ciena Corp. 248 ACL Alcon Inc. 157 AMLN Amylin 249 STP Suntech Power Pharmaceuticals Inc...

  11. 78 FR 3393 - Agency Information Collection Activities: Proposed Collection; Comment Request-Senior Farmers...

    Science.gov (United States)

    2013-01-16

    ....23(b) Financial/recipient reports. 51 1 51 40 2,040 Subtotal (Reporting Requirements).... 1,598 1,598... 1995, this notice invites the general public and other public agencies to comment on this proposed... 7 CFR Part 249. The purposes of the SFMNP are to provide resources in the form of fresh, nutritious...

  12. Effects of the endemic earthworm .i.Allolobophora hrabei./i. (Černosvitov, 1935) on soil microbial communities of steppe grasslands

    Czech Academy of Sciences Publication Activity Database

    Jirout, Jiří; Pižl, Václav

    2014-01-01

    Roč. 76, September (2014), s. 249-256 ISSN 0038-0717 R&D Projects: GA ČR GAP504/12/0536 Institutional support: RVO:60077344 Keywords : bacteria * archaea * fungi * community composition * DGGE * earthworm Subject RIV: EH - Ecology, Behaviour Impact factor: 3.932, year: 2014

  13. ER disruption and GFP degradation during non-regenerable transformation of flax with Agrobacterium tumefaciens

    Czech Academy of Sciences Publication Activity Database

    Bleho, J.; Obert, B.; Takáč, T.; Petrovská, Beáta; Heym, C.; Menzel, D.; Šamaj, J.

    2012-01-01

    Roč. 249, č. 1 (2012), s. 53-63 ISSN 0033-183X Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : Agrobacterium rhizogenes * Agrobacterium tumefaciens * Endoplasmic reticulum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.855, year: 2012

  14. Predictive accuracy of backpropagation neural network ...

    Indian Academy of Sciences (India)

    river basin, Chile; Global Planet. Change 47 212–220. Mohan S 1991 Intercomparison of evapotranspiration esti- mates; Hydrol. Sci. J. 36(5) 447–460. Nandagiri L and Kovoor G 2006 Performance evaluation of reference evapotranspiration equations across a range of. Indian climates; J. Irrig. Drain. Eng. 132(3) 238–249.

  15. 76 FR 33419 - Nationally Recognized Statistical Rating Organizations

    Science.gov (United States)

    2011-06-08

    ... 232, 240, 249, et al. Nationally Recognized Statistical Rating Organizations; Proposed Rule #0;#0...-11] RIN 3235-AL15 Nationally Recognized Statistical Rating Organizations AGENCY: Securities and... rating organizations (``NRSROs''). In addition, in accordance with the Dodd-Frank Act, the Commission is...

  16. 75 FR 36035 - Endangered and Threatened Wildlife and Plants; Listing the Cumberland Darter, Rush Darter...

    Science.gov (United States)

    2010-06-24

    ..., Cookeville, TN 38501; telephone 931-528-6481; facsimile 931- 528-7075. If you use a telecommunications device... Cumberland darter, Etheostoma susanae (Jordan and Swain), is a medium-sized member of the fish tribe... susanae by Jordan and Swain (1883, pp. 249-250) from tributaries of the Clear Fork of the Cumberland River...

  17. Combination of micropreparative solution isoelectric focusing and high-performance liquid chromatography for differentiation of biofilm-positive and biofilm-negative Candida parapsilosis group from vascular catheter

    Czech Academy of Sciences Publication Activity Database

    Vykydalová, Marie; Horká, Marie; Růžička, F.; Duša, Filip; Moravcová, Dana; Kahle, Vladislav; Šlais, Karel

    2014-01-01

    Roč. 812, Feb (2014), s. 243-249 ISSN 0003-2670 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Candida parapsilosis group * biofilm * sonicate from vascular cathether * sIEF * HPLC Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.513, year: 2014 http://hdl.handle.net/11104/0230766

  18. On the Evolutionary Stage of the Unclassified B[e] Star CD-42°11721

    Czech Academy of Sciences Publication Activity Database

    Borges Fernandes, M.; Kraus, Michaela; Lorenz Martins, S.; de Araújo, F. X.

    2007-01-01

    Roč. 377, č. 3 (2007), s. 1343-1362 ISSN 0035-8711 R&D Projects: GA AV ČR KJB300030701 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * emission-line * identification Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.249, year: 2007

  19. Download this PDF file

    African Journals Online (AJOL)

    STORAGESEVER

    2009-11-02

    Nov 2, 2009 ... ascorbate specific peroxidase in spinach chloroplasts. Plant Cell. Physiol. 22: 867-880. Noctor G, Foyer CH (1998). Ascorbate and glutathione: Keeping active oxygen under control. Annu. Rev. Plant Physiol. Plant Mol. Biol. 49: 249-279. Rehman S, Harris PJC, Bourne WF, Wilkin J (1996). The effect of.

  20. Desiccation-induced changes in viability, lipid peroxidation and ...

    African Journals Online (AJOL)

    user

    2012-05-31

    May 31, 2012 ... ascorbate peroxidase in spinach chloroplasts. Plant Cell Physiol., 22: 867-880. Noctor G, Foyer CH (1998) Ascorbate and glutathione: keeping active oxygen under control. Annu. Rev. Plant Physiol. Plant Mol. Biol., 49: 249-279. Oliver AE, Leprince O, Wolkers WF, Hincha DK, Heyer AG, Growe JH. (2001).

  1. April 2001

    African Journals Online (AJOL)

    2001-04-04

    Apr 4, 2001 ... depressive psychosis, 12.7% were alcoholics while 24.9% had psychiatric morbility with no obvious causes. Overall. 57% had neurotic disorders. In the past ... immunisation. The mental health act of 1989(10) allows mental patients to be treated in any hospital or nursing home alongside patients with other ...

  2. Chakraborty, Prof. Ranajit

    Indian Academy of Sciences (India)

    Elected: 2006 Honorary. Chakraborty, Prof. Ranajit. Date of birth: 1946. Address: Director, Center for Computational Genomics, University of North Texas, HSC, 3500 Camp Bowie Blvd, CBH 249, Fort Worth, TX 76107, U.S.A.. Contact: Office: (+1-817) 735 2421. Fax: (+1-817) 735 5016. Email: ranajit.chakraborty@unthsc.

  3. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... for energy and momentum. pp 249-256 Research Articles. On the exact solutions of nonlinear diffusion-reaction equations with quadratic and cubic nonlinearities .... down the rate of coarsening. pp 299-304 Research Articles. Chaotic-to-ordered state transition of cathode-sheath instabilities in DC glow discharge plasmas.

  4. Proceedings (Mathematical Sciences) SUBJECT INDEX

    Indian Academy of Sciences (India)

    299. Automorphism group. Semisymmetric cubic graphs of order 16p2. 19. Bernoulli polynomial. On the general Dedekind sums and its reciprocity formula. 1 ... and x = f(t,x,xσ ) on time scales 249. Density of states. Regularity of the interband light absorption coefficient. 351. Lifshitz tails for the interband light absorp-.

  5. Myths and Misconceptions in Popular Psychology: Comparing Psychology Students and the General Public

    Science.gov (United States)

    Furnham, Adrian; Hughes, David J.

    2014-01-01

    This study examined the prevalence of psychological myths and misconceptions among psychology students and within the general population. In total, 829 participants completed a 249-item questionnaire designed to measure a broad range of psychological myths. Results revealed that psychological myths and misconceptions are numerous and widely held.…

  6. Solar H(alpha) Oscillations from Intensity and Doppler Observations (Postprint)

    Science.gov (United States)

    2013-03-01

    brightenings in filaments FL3 and FL4 in this global picture . A comparison with other large-amplitude filament oscilla- tions as reviewed by...249 Neidig, D., Wiborg, P., Confer, M., et al. 1998, in ASP Conf. Ser. 140, Synoptic Solar Physics, ed. K. S. Balasubramaniam, J. Harvey, & D. Rabin

  7. Book Review

    Directory of Open Access Journals (Sweden)

    Dedy Darnaedi

    2012-12-01

    Full Text Available B.S. Parris, R. Kiew, R.C.K. Chung, L.G. Saw  & E. Soepadmo (eds. 2010. Flora of Peninsular Malaysia, Series I. Ferns and Lycophytes. Vol  1.  Malayan Forest Records No. 48. Forest Research Institute Malaysia, Ministry of Natural Resources and Environment, Malaysia, 249 pp. Price: RM80/USD60. 

  8. Diagnosis and Elimination of Thallium after an Intentional Intoxication

    Czech Academy of Sciences Publication Activity Database

    Pelclová, D.; Šenholdová, Z.; Lukáš, E.; Urban, P.; Ridzoň, P.; Vlček, K.; Navrátil, Tomáš

    2007-01-01

    Roč. 101, č. 14 (2007), s. 249-250 ISSN 0009-2770. [Mezioborová česko-slovenská toxikologická konference /12./. Praha, 11.06.2007-13.06.2007] Institutional research plan: CEZ:AV0Z40400503 Keywords : Prussian blue * excretion * neurological * alopecia Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.683, year: 2007

  9. Sobre la historia de la traducción en España

    Directory of Open Access Journals (Sweden)

    Manuel Bruña Cuevas

    2011-01-01

    Full Text Available A propósito de la obra de Francisco Lafarga y Luis Pegenaute (eds., Diccionario histórico de la traducción en España (Madrid, Gredos, 2009; 1232 páginas. ISBN: 978-84-249-3626-6.

  10. Dependence of the human skin protection against the UV solar carcinoma radiation on the sunscreens and cosmetics layer thickness

    Czech Academy of Sciences Publication Activity Database

    Stádník, Bohumil; Jirásková, M.

    2000-01-01

    Roč. 45, č. 3 (2000), s. 241-249 ISSN 0001-7043 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : cancer * fluorescence * patient diagnosis Subject RIV: JB - Sensors, Measurment, Regulation

  11. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K Ankamma. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  12. G Chandramohan Reddy

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Chandramohan Reddy. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara ...

  13. Optical transients

    Czech Academy of Sciences Publication Activity Database

    Hudec, René; Wenzel, W.

    1999-01-01

    Roč. 39, 1-6 (1999), s. 249-252 ISSN 0888-6512 R&D Projects: GA MŠk ME 002 Institutional research plan: CEZ:AV0Z1003909 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.392, year: 1998

  14. Meditation or medication? Preventing relapse in recurrent depression

    NARCIS (Netherlands)

    Huijbers, M.J.

    2017-01-01

    In this study, 249 patients with recurrent depression participated in mindfulness-based cognitive therapy (MBCT), a group training that improves skills to cope with difficult thoughts and emotions. Afterwards, half of the group was asked to stop taking their antidepressants, whereas the other half

  15. The Contributions of Agricultural Growth to Poverty Reduction in ...

    African Journals Online (AJOL)

    At the Household level, the base simulation has provided a poverty incidence of 40.2 percent in rural areas with 11.2 and 24.9 poverty gap and severity respectively for the year 1995/96. Given the actual and base simulation poverty measures and assuming the percentage change in percapita value added of agricultural ...

  16. Physical Activity of Male and Female Adolescents Living in a Town and a City in the Context of Public Health Recommendations

    Science.gov (United States)

    Mynarski, Wladyslaw; Nawrocka, Agnieszka; Rozpara, Michal; Garbaciak, Wieslaw

    2012-01-01

    Study aim: To assess the physical activity of male and female adolescents from Poland living in a town (Czechowice-Dziedzice) and in a city (Katowice). Material and methods: The research involved 431 high school students aged 16-18 years (249 from Czechowice-Dziedzice and 182 from Katowice). Physical activity was measured by the short form of the…

  17. Some aspects of water quality characteristics in small shallow ...

    African Journals Online (AJOL)

    The water quality in eight small reservoirs (0.065-0.249 km2) in both the rugged escarpment landscape above the rift valley floor and the stepped plateau above them were studied between 1998 and 2000. Water transparency was measured using a 20cm Secchi visibility disk. Total dissolved solids (TDS) and electrical ...

  18. Family Characteristics of Children with Dyslexia.

    Science.gov (United States)

    Melekian, Badrig A.

    1990-01-01

    A retrospective review of 249 French children (ages 8-15) with severe dyslexia found that families were characterized by low occupational status and educational level for parents and predominance of high-ranking children in large sibships. Parental age and matrimonial status seemed unimportant. (Author/JDD)

  19. A study of physicians' interest in advising (recommending vasectomy in Egypt

    Directory of Open Access Journals (Sweden)

    Ahmed M. Hassanin

    2017-12-01

    Conclusion: However more than half of physicians had a positive perception of vasectomy, only 24.9% advised Egyptian men to undergo the procedure. Sociocultural factors and religious issues hindered physicians to recommend vasectomy in Egypt. Vasectomy was recommended when it was absolutely needed.

  20. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... procedures (as defined in paragraph (c) of this section) and internal control over financial reporting (as... management must evaluate, with the participation of the company's principal executive and principal financial... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249...

  1. degradation products predict outcotne in gestational proteinuric ...

    African Journals Online (AJOL)

    laboratory, and goat antimouse immunoglobulin conju- gated to peroxidase. Statistical methods. In phase 1 of the study mean values for each group were ... Medical Disorders in Obstetric Praccice. 2nd ed. Oxford: Blackwell. Scientific Publications, 1989: 249-305. 3. Rodgers GM, Taylor RN, Roberts J. Preeclampsia is ...

  2. Primary and secondary infection with human parvovirus B19 in ...

    African Journals Online (AJOL)

    Abstract A study of human parvovirus B19 infection in. I 967 pregnant women ofall races in Johannesburg revealed an overall prevalence of 24,9% for IgG antibodies and 3,3% for IgM antibodies. Ofthe 64. IgM-positive sera indicating active infection, 62 were resistant to urea denaturation. No differ- ences in the prevalence ...

  3. 373-IJBCS-Article-Adeduntan Adeniyi

    African Journals Online (AJOL)

    Dr Gatsing

    Poisoning from apricot seeds. J. A. M. A.,. 249: 241-256. Shimizu P, Yazawa M, Takede N. 1992. Aromatic acid in leaves of Morus alba and their possible medical value. Sericologia, 32(4): 633 – 636. Steel RCD, Torrie JH. 1960. Principles and. Procedures of Statistics (1st edn). McGraw-Hill: New York. United Nations. 1993.

  4. Low Temperature Fluorination of Aerosol Suspensions of Hydrocarbons Utilizing Elemental Fluorine.

    Science.gov (United States)

    1984-03-30

    1, 1976, 146. (69) Mousseron, M.; Granger, R.; Valette, J. Bull. Soc. Chem. France , 1946, 249. (70) Kucera, J. J.; Carpenter, P. C. J. Am. Chem. Soc...Fluorine Chem., 1978, 11, 527. 0 Hauptschein, M.; Braid, M. J. Am. Chem. Soc., 1961, 83, 2383. P Olah, G, A.; Bollinger , J. M. J. Am. Chem. Soc., 1968

  5. Dieting, Dietary Restraint, and Binge Eating Disorder among Overweight Adolescents in Turkey

    Science.gov (United States)

    Bas, Murat; Bozan, Nuray; Cigerim, Nevin

    2008-01-01

    The purpose of this study was to determine the relationship among dieting, dietary restraint, disinhibition, hunger, and binge eating among overweight adolescent girls. Participants were 743 overweight adolescent girls between 16 and 19 years of age. The mean BMI was 24.9 [+ or -] 0.8 kg/[m[superscript 2] in the low-restraint group and 25.1 [+ or…

  6. World Weather Extremes. Revision,

    Science.gov (United States)

    1985-12-01

    very high latitudes where there is less moisture. 174J.p. Verdou, Extremes climatiques mondiales" [World Climatic- - E~tremes], France. Meteorologie...air pressure less than 92 kilopascals (27.17 inches) and winds over 249 kilometers per hour (155 miles per hour), and they cause " catastrophic " damage

  7. No effect on survival of home psychosocial intervention in a randomized study of Danish colorectal cancer patients

    DEFF Research Database (Denmark)

    Ross, Lone; Frederiksen, Kirsten; Boesen, Sidsel H

    2009-01-01

    Objective: We investigated whether regular home visits to persons with newly diagnosed colorectal cancer influenced their overall survival and selected immune parameters.Methods: A total of 249 Danish colorectal cancer patients undergoing abdominal surgery were randomly assigned to a control...

  8. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  9. Harmonic decomposition of two-particle angular correlations in Pb-Pb collisions at sqrt(sNN) = 2.76 TeV

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Abelev, B.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Čepila, J.; Krus, M.; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Pachr, M.; Petráček, V.; Petráň, M.; Pospíšil, V.; Šmakal, R.; Šumbera, Michal; Tlustý, D.; Vajzer, Michal; Wagner, V.; Zach, Č.; Závada, Petr

    2012-01-01

    Roč. 708, 3-5 (2012), s. 249-264 ISSN 0370-2693 R&D Projects: GA MŠk LA08015 Institutional support: RVO:61389005 ; RVO:68378271 Keywords : quark-gluon plasma * ALICE Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.569, year: 2012

  10. Powerhouse down: Complex II dissociation in the respiratory chain

    Czech Academy of Sciences Publication Activity Database

    Hwang, M.-S.; Rohlena, Jakub; Dong, L.-F.; Neužil, Jiří; Grimm, S.

    2014-01-01

    Roč. 19, Part A SI (2014), 20-28 ISSN 1567-7249 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA ČR GAP301/12/1851 Institutional support: RVO:86652036 Keywords : Mitochondria * Apoptosis * Complex II Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.249, year: 2014

  11. Properties of horizontal flows inside and outside a solar pore

    Czech Academy of Sciences Publication Activity Database

    Roudier, T.; Bonet, J. A.; Sobotka, Michal

    2002-01-01

    Roč. 395, č. 1 (2002), s. 249-255 ISSN 0004-6361 R&D Projects: GA AV ČR IAA3003903; GA AV ČR KSK2043105 Institutional research plan: CEZ:AV0Z1003909 Keywords : sun granulation * photosphere * sunspots Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.781, year: 2002

  12. Preface to the injection tables

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    Twelve groups of dogs received intravenous injections of various doses of 226 Ra, 239 Pu, 228 Ra, 228 Th, 90 Sr, 241 Am, 249 Cf, or 252 Cf at approximately 17 months of age. The animals were euthanized when death appeared imminent. Data are presented on the calculated radiation dose to the skeleton and pathological changes observed at autopsy

  13. [Current situation of awareness and use of banned pesticides among vegetable greenhouse farmers in a town of Ledu County, China].

    Science.gov (United States)

    Guo, Ying-hua; Xing, Yong-hua; Ji, Wen-wu; Zhou, Jian; Sun, Jian; Niu, Zhao-di; Yang, Hui-fang

    2013-09-01

    To investigate the awareness and use of banned pesticides among vegetable greenhouse farmers in a town of Ledu County, Qinghai Province, China and to provide a basis for the management and control of banned pesticides. Local residents who lived in a town of Ledu County for more than 5 years were selected as subjects in August 2012. A questionnaire survey was conducted in 267 vegetable greenhouse farmers who were selected from five villages of the town by cluster random sampling. Of the 267 subjects, 249 (93.26%) completed and returned the questionnaires. Eighty-seven (34.9%) of the 249 subjects were aware of banned pesticides, and the banned pesticide awareness rate varied significantly among the subjects with different education levels (χ(2) = 11.061, P = 0.011). Only education level entered the regression equation in non-conditional logistic regression analysis. Only five (2.0%) of the 249 subjects knew the banned pesticides as well as the details. All the 249 subjects used banned pesticides to varying degrees in the past 5 years. Only 9.0% (17/189) of the vegetable greenhouse farmers knew the time pesticides were initially banned in China. The banned pesticide awareness rate is relatively low in the town of Ledu County, and this rate is influenced by education level. It is needed to spread the knowledge and hazards of banned pesticides.

  14. 76 FR 72661 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2011-11-25

    ...) Depth in feet above State City/town/county Source of flooding Location ** ground [caret] Elevation in meters (MSL) Existing Modified Town of Richland, New York New York Town of Richland........ Lake Ontario Entire shoreline within Selkirk Shores State Park boundary None +249 New York Town of Richland...

  15. Fast detection of a (CA).sub.18 microsatellite repeat in the IgE receptor gene by capillary electrophoresis with laser-induced fluorescence detection

    Czech Academy of Sciences Publication Activity Database

    Klepárník, Karel; Malá, Zdeňka; Haváč, Zdeněk; Blažková, M.; Hollá, L.; Boček, Petr

    1998-01-01

    Roč. 19, č. 2 (1998), s. 249-255 ISSN 0173-0835 R&D Projects: GA ČR GA203/95/0497; GA ČR GA203/97/0347; GA AV ČR IAA4031703; GA MŠk VS96021 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.054, year: 1998

  16. India : tous les projets | Page 10 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    End Date: 1 décembre 2012. Sujet: LEGISLATIVE BODIES, INTERNATIONAL LAW, REGULATIONS, NATIONAL LEVEL. Région: Argentina, Brazil, China, Colombia, India, Canada. Programme: Emploi et croissance. Financement total : CA$ 249,943.00. Programme de formation en actuariat Inde-Canada (Waterloo). Projet.

  17. Reasons For Preference Of Delivery In Spiritual Church-Based ...

    African Journals Online (AJOL)

    Results: Various reasons for preferring church delivery included: Spiritual protection against satanic attacks and safe delivery in 975 (36.8%) lack of funds in 629(30.5%), harsh attitude of health workers in 249 (12.1%), convenience in 212 (10.3%), faith in God and previous delivery in church 83 (4.0%) each help and good ...

  18. Quantum coherent control of the vibrational dynamics of a ...

    Indian Academy of Sciences (India)

    2014-02-12

    Feb 12, 2014 ... Home; Journals; Pramana – Journal of Physics; Volume 82; Issue 2. Quantum coherent ... H J Strydom. Contributed Papers Volume 82 Issue 2 February 2014 pp 249-253 ... A second laser would then allow for mode selective chemistry to interact selectively with the excited population. Alternatively the ...

  19. Fulltext PDF

    Indian Academy of Sciences (India)

    Asteroseismology ofγ Scuti Stars: Problems and Prospects (M.-J. Goupil, M. A. Dupret,. R. Samadi, T. Boehm, E. Alecian, J. C. Suarez, Y. Lebreton & C. Catala), 249. Pulsations in Subdwarf B Stars (C. Simon Jeffery), 261. Lessons for Asteroseismology from White Dwarf Stars (Travis S. Metcalfe), 273. On the Analysis of Light ...

  20. Differential expression of carotenoid biosynthetic pathway genes in ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... Tomato (Solanum lycopersicum L.) is one of the model plants to study the carotenoid biosynthesis. In the present study, the fruit carotenoid content were quantified at different developmental stages for two contrasting genotypes viz. IIHR-249-1and IIHR-2866 by UPLC. Lycopene content was high in ...

  1. Molecular characterization of phytoplasmas in lilies with fasciation in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Bertaccini, A.; Fránová, Jana; Botti, S.; Tabanelli, D.

    2005-01-01

    Roč. 249, - (2005), s. 79-85 ISSN 0378-1097 R&D Projects: GA AV ČR(CZ) IBS5051014 Institutional research plan: CEZ:AV0Z50510513 Keywords : phytoplasma * Lilium spp. * molecular characterization Subject RIV: EE - Microbiology, Virology Impact factor: 2.057, year: 2005

  2. Lidová náboženská četba na prahu 21. století

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2008-01-01

    Roč. 95, č. 3 (2008), s. 225-249 ISSN 0009-0794 R&D Projects: GA ČR GA403/06/0574 Institutional research plan: CEZ:AV0Z70280505 Keywords : Popular religion * Czech Republic * Sociology of religion Subject RIV: AO - Sociology, Demography

  3. "Euroopa viimased metslased" : eestlased saksa koloniaaldiskursis 1770-1870 / Ulrike Plath

    Index Scriptorium Estoniae

    Plath, Ulrike

    2008-01-01

    Eesti ja läti pärisorjade võrdlemisest metslastega, eestlaste "eksoteerimisest", põhjuseks keelesugulus saamide ja samojeedidega. Pikemalt Johann Georg Kohli teosest "Die Völker Europas" (1868). Baltisaksa koloniaaldiskursi kujunemisest 19. sajandil. Sisaldab bibliograafiat. Autorist lk. 249

  4. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 109; Issue 2. Volume 109, Issue 2 ... pp 207-209. Bay of Bengal Monsoon Experiment (BOBMEX) — A component of the Indian Climate Research Programme (ICRP) ... pp 249-254. BOBMEX-98 Pilot: Measurement and analysis of incoming shortwave radiation data.

  5. Carbon Dioxide Emissions Reduction Estimates: Potential Use of ...

    African Journals Online (AJOL)

    , substituting a fraction of the currently used petroleum fuels ... Out of the 1,249,170 tCO2e emitted in 2007, the emissions of CO2 from gasoline and diesel were 25 % and 39 %, respectively. 151,950 vehicles using gasoline were circulating on ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 249 ... Issue, Title. Vol 30, No 2 (2010), 'Akuchanywa apha please' No peeing here please: The language of signage in Cape Town, Abstract. Tessa Dowling. Vol 34, No 1 (2014), 'Welcome to proper mall': The language on signs in Diepsloot, Johannesburg, Abstract. Tessa Dowling. Vol 36, No 2 (2016) ...

  7. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. John Bernet. Articles written in Journal of Biosciences. Volume 28 Issue 3 April 2003 pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati Mullick Akhilesh K Singh Arvind Sahu · More Details Abstract Fulltext PDF. The complement system is a potent ...

  8. On Peano's theorem in Banach spaces

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Johanis, M.

    2010-01-01

    Roč. 249, č. 12 (2010), s. 3342-3351 ISSN 0022-0396 R&D Projects: GA AV ČR IAA100190801 Institutional research plan: CEZ:AV0Z10190503 Keywords : diferential equations Subject RIV: BA - General Mathematics Impact factor: 1.261, year: 2010 http://www.sciencedirect.com/science/article/pii/S0022039610003505

  9. Verteerbaarheid en voederwaarde van diverse kwaliteiten graskuil en van CCM bij biologische zeugen = Digestibility and nutritive value of several qualities of grass silage and of CCM in organic housed gestating sows

    NARCIS (Netherlands)

    Peet-Schwering, van der C.M.C.; Binnendijk, G.P.; Diepen, van J.T.M.

    2010-01-01

    The chemical composition, digestibility and energy value of five qualities of grass silage and of CCM (Corn cob mix) were investigated in organic housed gestating sows. The dry matter content of the five grass silages varied between 21.3 and 24.9%. The energy value per kg dry matter varied between

  10. Mechanism of Action of Botulinum Neurotoxin and Overview of Medical Countermeasures for Intoxication

    Science.gov (United States)

    2008-01-01

    a recent study from our laboratory, TVL was injected locally in the rat extensor digitorum longus (EDL) muscle 30 min before a local injection of 0.6...1996. Effect of 3,4-diaminopyridine on rat extensor digitorum longus muscle paralyzed by local injection of botulinum neurotoxin. Toxieon 34:237-249

  11. Neutron Field Measurement of p(35)+Be Source using the Multi-foil Activation Method

    Czech Academy of Sciences Publication Activity Database

    Štefánik, Milan; Bém, Pavel; Majerle, Mitja; Novák, Jan; Šimečková, Eva; Štursa, Jan

    2017-01-01

    Roč. 2017, č. 11 (2017), č. článku 249. E-ISSN 1742-3406 Institutional support: RVO:61389005 Keywords : p+Be * Be target * neutron spectrum Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Atomic, molecular and chemical physics (physics of atoms and molecules including collision, interaction with radiation, magnetic resonances, Mössbauer effect)

  12. The Human Breast Cancer Cell DNA Synthesome Can Serve as a Novel In Vitro Model System for Studying the Mechanisms of Action of Anticancer Drugs

    Science.gov (United States)

    2001-07-01

    on an Old Drug. Critical Reviews in Oncology/Hematology, 29: 249-255. of Pharmacognosy , P-12, 1992. RAO, K. V.; MCBRIDE, T. J.; OLESON, J. (1968) J... Pharmacognosy , P-12. SEKOWSKI, J. W. et al. (1998) Human Breast Cancer Cells Contain an Error- prone DNA Replication Apparatus. Cancer Research, 58

  13. Noeggerathiaceae from the Carboniferous basins of the Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Z.; Bek, Jiří

    2003-01-01

    Roč. 125, 3-4 (2003), s. 249-284 ISSN 0034-6667 R&D Projects: GA AV ČR IAA3013902 Institutional research plan: CEZ:AV0Z3013912 Keywords : palaeobotany * palynology * Carboniferous Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.935, year: 2003

  14. 17 CFR 242.609 - Registration of securities information processors: form of application and amendments.

    Science.gov (United States)

    2010-04-01

    ... information processors: form of application and amendments. 242.609 Section 242.609 Commodity and Securities....609 Registration of securities information processors: form of application and amendments. (a) An application for the registration of a securities information processor shall be filed on Form SIP (§ 249.1001...

  15. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3. Volume 115, Issue 3. August 2005, pages 241-369. pp 241-249. Some Properties of ... with some properties which are mathematically and statistically interesting. pp 251-257. Homeomorphisms and the Homology of Non-Orientable Surfaces.

  16. Influence of infection on malaria-specific antibody dynamics in a cohort exposed to intense malaria transmission in northern Uganda

    NARCIS (Netherlands)

    Proietti, C.; Verra, F.; Bretscher, M.T.; Stone, W.J.R.; Kanoi, B.N.; Balikagala, B.; Egwang, T.G.; Corran, P.; Ronca, R.; Arca, B.; Riley, E.M.; Crisanti, A.; Drakeley, C.; Bousema, T.

    2013-01-01

    The role of submicroscopic infections in modulating malaria antibody responses is poorly understood and requires longitudinal studies. A cohort of 249 children /=20 years was recruited in an area of intense malaria transmission

  17. Foreign body impacted in the Jejunum

    African Journals Online (AJOL)

    xp

    28:298-305, 1999. 3. Jasperson D. Drug-induced oesophageal disorders: pathogenesis, incidence, prevention and management. Drug. Saf 22:237-249, 2000. 4. Jones A. Caustic ingestion and foreign bodies: damage to the upper gastrointestinal tract. In: Wyllie R,. Hyams JS(Ed).Pediatric Gastrointestinal and Liver Disease ...

  18. Water Quality Management Studies, Alabama River, R. E. ’Bob’ Woodruff, William ’Bill’ Dannelly and Claiborne Lakes - August-December 1977.

    Science.gov (United States)

    1983-03-01

    249, 264, 277. BOKAGINACEAE (E) Heliotropium sp.: 48. VERBENAU1AE (E) Lippia lanceolata Michaux: 6, 10, 152. LAMIACEAE (E) Lycopus sp.: 54, 55, 57...257. CAMPANULACEAE (E) Sphenoclea zeylanica Caertn.: 9, 69, 92, 93. ASTERACEAE (E) Bidens sp.: 57, 58. (E) Eclipta alba (L.) Hassk.: 132, 142-146, 149

  19. Psychology and the increasing crime rate in Nigeria | Fagbohungbe ...

    African Journals Online (AJOL)

    No Abstract Available African Journal for the Psychological Study of Social Issues Vol.5(2) 2000: 249-262. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  20. Trifluoromethanesulfonic acid promoted Dakin–West reaction: An ...

    Indian Academy of Sciences (India)

    MS received 30 December 2010; revised 13 September 2011; accepted 22 September 2011. Abstract. Trifluoromethanesulfonic acid promoted efficient condensation of an aromatic ..... Daehn U, Hagenmaier H, Hoehne H, Koenig W A, Wolf. G and Zaehner H 1976 Arch. Microbiol. 107 249. 6. Dakin H D and West R 1928 J.

  1. Root-sprouting in myco-heterotrophic plants: prepackaged symbioses or overcoming meristem limitation?

    Czech Academy of Sciences Publication Activity Database

    Klimešová, Jitka

    2007-01-01

    Roč. 173, - (2007), s. 8-10 ISSN 0028-646X Institutional research plan: CEZ:AV0Z60050516 Keywords : root sprouting * bud bank * Myco-heterotrophic plants Subject RIV: EF - Botanics Impact factor: 5.249, year: 2007

  2. E-Learning in European Higher Education Institutions: Results of a Mapping Survey Conducted in October-December 2013

    Science.gov (United States)

    Gaebel, Michael; Kupriyanova, Veronika; Morais, Rita; Colucci, Elizabeth

    2014-01-01

    The present study on e-learning intends to contribute to closing a data gap and to stimulate the discussion on the further development of national and European policies on the issue and to support its systematic institutional take-up. It draws upon a survey conducted by the European University Association between October and December 2013. 249

  3. Oxidation of LDL and extent of peripheral atherosclerosis

    NARCIS (Netherlands)

    Vijver, L.P.L. van de; Kardinaal, A.F.M.; Duyvenvoorde, W. van; Kruijssen, D.A.C.M.; Grobbee, D.E.; Poppel, G. van; Princen, H.M.G.

    1999-01-01

    Evidence has accumulated for oxidative modification of low-density lipoproteins (LDL) to play an important role in the atherogenic process. Therefore, we investigated the relation between susceptibility of LDL to oxidation and risk of peripheral atherosclerosis among 249 men between 45 and 80 years

  4. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 28; Issue 3. Issue front cover thumbnail. Volume 28, Issue 3. April 2003, pages 248-358. Viral Evasion of Host Responses. pp 248-248. Preface · Shahid Jameel · More Details Fulltext PDF. pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati ...

  5. The list of cyanobacterial species of the Czech Republic to the end of 2009

    Czech Academy of Sciences Publication Activity Database

    Kaštovský, J.; Hauer, Tomáš; Komárek, Jiří; Skácelová, O.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 245-249 ISSN 1802-5439 R&D Projects: GA ČR GA206/08/0318 Institutional research plan: CEZ:AV0Z60050516 Keywords : checklist * cyanobacteria * Czech Republic Subject RIV: EF - Botanics Impact factor: 0.978, year: 2010

  6. Control of Chaos: New Perspectives in Experimental and Theoretical Science. International Journal of Bifurcation and Chaos in Applied Sciences and Engineering. Theme Issue. Part 2, Volume 8, Number 9, September 1998.

    Science.gov (United States)

    1998-09-01

    Publishing Company DIFFUSION PARAMETER CONTROL OF SPATIOTEMPORAL CHAOS RAUL MONTAGNE* Instituto de Fisica, Facultad de Ciencias & Facultad de Ingenieria ...aerospace, chemical, civil, computer, information, mechanical, software , telecommunication, etc.) the local and global manifestations of Chaos and Bifurcation...LASERS BY FEEDBACK AND NONFEEDBACK METHODS PIERRE GLORIEUX Laboratoire de Spectroscopie Hertzienne, URA CNRS 249, Centre d’Etudes et Recherches sur les

  7. Assessment of Body perception, Psychological Distress, and ...

    African Journals Online (AJOL)

    2018-02-07

    Feb 7, 2018 ... Background: Obesity can lead to psychological, social, and medical problems that may negatively ... mass index (BMI) of ≥18.5–24.9 kg/m² were assigned to the control group; BMI ≥. 30 kg/m² were ... Son: Body perception, psychological distress, quality of life among obese and nonobese subjects. 1303.

  8. Coping with Workplace Stress: A Multiple-Group Comparison of Female Managers and Clerical Workers.

    Science.gov (United States)

    Long, Bonita C.

    1998-01-01

    A causal model of workplace stress was refined and cross-validated. Multivariate analysis and multiple-group structural equation modeling were used to investigate the effects of social roles on patterns of coping with workplace stress and job satisfaction. Differences found between managers (n=249) and clerical workers (n=214) suggest power and…

  9. Belongingness and Suicidal Ideation in College Students

    Science.gov (United States)

    Ploskonka, Rachel A.; Servaty-Seib, Heather L.

    2015-01-01

    Objective: In this study, the relationships between 3 specific domains of belongingness (ie, family, peers, and academic institution) were examined with respect to suicidal ideation. Participants: A sample (N = 249) of undergraduate students was recruited from a large, midwestern university during the Spring 2013 semester. Methods: Multiple…

  10. effect of stocking density on production of clarias gariepinus

    African Journals Online (AJOL)

    DR. AMINU

    system in Nigeria. Nigeria Journal of. Science. Sci. Ass. of Nig 12p. Rahman, M. A., Mazid, M A., Rahman, M. R., Khan, M. N.,. Hossain, M. A. and Hussain, M. G. (2005):. Effect of stocking density on survival and growth of critically endangered mashseer, Tor putitora. (Hamilton), in nursery ponds. Aquaculture 249: 275-284.

  11. Neonatal Outcome of Term Breech Births: A 15-Year Review at the ...

    African Journals Online (AJOL)

    Of 249 term singleton infants in breech presentation, 73 (29.31%) were born by elective cesarean section and 176 (70.67%) were allowed for trial of vaginal delivery with 136 (54.61%) delivered vaginally and 40 (16.06%) delivered by intra-labor cesarean section. Compared to infants born by elective cesarean section, ...

  12. Tracking the Environment in Australian Children's Literature: The Children's Book Council of Australia Picture Book of the Year Awards 1955-2014

    Science.gov (United States)

    Babb, Yeyoung May; McBurnie, Janine; Miller, Kelly K.

    2018-01-01

    Popular and accessible before television and the internet, picture books capture the context of the time they were created and influence the generations of children who consume them. Depictions of the natural world have changed across several generations of picture books as seen in illustrations of all 249 books of an influential collection, the…

  13. 78 FR 5544 - Self-Regulatory Organizations; Chicago Board Options Exchange, Incorporated; Notice of Filing and...

    Science.gov (United States)

    2013-01-25

    ... approach in current Rule 5.8, which states that strike price interval, bid/ask differential and continuity...\\ Similarly, Rule 24.9(b)(1)(A) states that strike price interval, bid/ask differential and continuity rules... counter to efforts to mitigate the number of quotes collected and disseminated. The Exchange also believes...

  14. Physical mapping of 5S and 45S rDNA in Chrysanthemum and ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 91; Issue 2. Physical mapping of 5S and 45S rDNA in Chrysanthemum and related genera of the Anthemideae by FISH, and species relationships. Magdy Hussein Abd El-Twab Katsuhiko Kondo. Research Note Volume 91 Issue 2 August 2012 pp 245-249 ...

  15. Book Review Paediatric Trauma and Child Abuse By Sebastian van ...

    African Journals Online (AJOL)

    Book Review Paediatric Trauma and Child Abuse By Sebastian van As and Sudeshni Naidoo S (editors) 2007. Michael Hendricks. Abstract. Oxford University Press, Cape Town Softback, ISBN 978-0-19-576259-4, ZAR 249 344 pages. Journal of Child and Adolescent Mental Health 2008, 20(2): 137–138.

  16. Andromeda's Liberation in Monastery. Kosmas Damian Asam’s Fresco Painting at Břevnov (1726) Revisited

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan

    2010-01-01

    Roč. 46, č. 46 (2010), s. 234-249 ISSN 0046-1628 R&D Projects: GA AV ČR(CZ) IAA800090902 Institutional research plan: CEZ:AV0Z90090514 Keywords : frescoes * ancient mythology * monastery * Baroque Subject RIV: AA - Philosophy ; Religion

  17. Music during Lectures: Will Students Learn Better?

    Science.gov (United States)

    Dosseville, Fabrice; Laborde, Sylvain; Scelles, Nicolas

    2012-01-01

    We investigated the influence of music during learning on the academic performance of undergraduate students, and more particularly the influence of affects induced by music. Altogether 249 students were involved in the study, divided into a control group and an experimental group. Both groups attended the same videotaped lecture, with the…

  18. Birth weight and systolic blood pressure in adolescence and adulthood

    DEFF Research Database (Denmark)

    Gamborg, Michael; Byberg, Liisa; Rasmussen, Finn

    2007-01-01

    The authors investigated the shape, sex- and age-dependency, and possible confounding of the association between birth weight and systolic blood pressure (SBP) in 197,954 adults from 20 Nordic cohorts (birth years 1910-1987), one of which included 166,249 Swedish male conscripts. Random-effects m...

  19. Determination of dissociation constants of cytokinins by capillary zone electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Barták, P.; Bednář, P.; Stránský, Z.; Boček, Petr; Vespalec, Radim

    2000-01-01

    Roč. 878, č. 2 (2000), s. 249-259 ISSN 0021-9673 R&D Projects: GA MŠk VS96021; GA AV ČR IAA4031703; GA ČR GA203/99/0044 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.551, year: 2000

  20. On some singular limits in damped radiation hydrodynamics

    Czech Academy of Sciences Publication Activity Database

    Blanc, X.; Ducomet, B.; Nečasová, Šárka

    2016-01-01

    Roč. 13, č. 2 (2016), s. 249-271 ISSN 0219-8916 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible * Euler * dam ping Subject RIV: BA - General Mathematics Impact factor: 0.940, year: 2016 http://www.worldscientific.com/doi/10.1142/S0219891616500089

  1. AcEST: DK946532 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FV Structural polyprotein OS=Barmah forest virus... 29 6.3 >sp|Q12594|DMAW_CLAFS ...+ + + C++ PPS S L HF Sbjct: 218 HCAVSTTHQTPDWFPLLCVQSPPSTSPFLGHF 249 >sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest

  2. The Carcinogenic Potential of JP-8 and Tungsten in C57BL/6 Mice

    Science.gov (United States)

    2011-01-31

    has been reported to decrease inflammation, but this was specific to xanthine oxidase activity associated with TNF-α and did not influence the other...molybdenum: Effect of tungsten on xanthine oxidase and sulfite oxidase in the rat, Journal of Biological Chemistry 249(3) (1974) 859-866. Annual

  3. fistule et kyste nasofrontaux : a propos d'un cas naso frontal fistula

    African Journals Online (AJOL)

    familial frontonasal dermoid cysts: A mother and her identical twin daughters. Int J Pediatr Otorhinolaryngol 2001;57:249-53. (7) Rubin G, Scienza R, Pasqualin A, et al.Craniocerebral epidermoids and dermoids. A review of 44 cases. Acta Neurochir 1989;97:1-16. (8) Maniglia AJ, Goodwin J, Arnold JE, Ganz E. Intracranial ...

  4. Diskurzivní analýza v soudobé sociální psychologii: teorie, koncepty a aplikace

    Czech Academy of Sciences Publication Activity Database

    Zábrodská, Kateřina

    2010-01-01

    Roč. 54, č. 3 (2010), s. 249-262 ISSN 0009-062X R&D Projects: GA ČR GPP407/10/P146 Institutional research plan: CEZ:AV0Z70250504 Keywords : discourse analysis * conversation analysis * critical discursive psychology Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010

  5. Assessing ground compaction via time lapse surface wave analysis

    Czech Academy of Sciences Publication Activity Database

    Dal Moro, Giancarlo; Al-Arifi, N.; Moustafa, S.S.R.

    2016-01-01

    Roč. 13, č. 3 (2016), s. 249-256 ISSN 1214-9705 Institutional support: RVO:67985891 Keywords : Full velocity spectrum (FVS) analysis * ground compaction * ground compaction * phase velocities * Rayleigh waves * seismic data inversion * surface wave dispersion * surface waves Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.699, year: 2016

  6. The remarkable discreteness of being

    Indian Academy of Sciences (India)

    2014-03-15

    Mar 15, 2014 ... ... examples where these facts play, or could play, important roles: the spatial distribution of species, the structuring of biodiversity and the. (Darwinian) evolution of altruistic behaviour. [Houchmandzadeh B 2014 The remarkable discreteness of being. J. Biosci. 39 249–258] DOI 10.1007/s12038-013-9350-7.

  7. Gclust Server: 39739 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 39739 PHRA_96515 Cluster Sequences Related Sequences(163) 249 C_scaffold_82000018; ...no annotation 2 1.00e-25 0.0 22.22 0.0 0.0 0.0 0.0 Show 39739 Cluster ID 39739 Sequence ID PHRA_96515 Link t

  8. Kala töötlemine : [andmeid aastatest 1995-2004] / Maarja Purik

    Index Scriptorium Estoniae

    Purik, Maarja

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 49-52. Kalatöötlemise osatähtsus toiduainetööstuses moodustas 2004. a. 11,9% ja ekspordis 24,9%. Tabelid. Diagrammid

  9. Online Students' Expectations: Enhancing the Fit between Online Students and Course Design

    Science.gov (United States)

    Brinkerhoff, Jonathan; Koroghlanian, Carol M.

    2007-01-01

    Learner analysis and needs assessments are basic elements of all instructional design models and are of concern to those designing distance education courses. Mismatches between students' expectations and actual course features may impact learning. This investigation surveyed 249 geographically dispersed online students for the course features…

  10. Epstein-Barr virus-induced systemic lupus erythematosus

    African Journals Online (AJOL)

    Ngou J. Graafland H, Segondy M. Antibodies against polypeptides of purified. Epstein-Barr virus in sera grown from patients with connective tissue diseases'. J Autoimmun 1992; 5: 243-249. 4. Stancek D, Rovensky J. Enhancement of Epstein-Barr virus antibody production in systemic lupus erythematosus patients.

  11. Species and hybrid richness in spined loaches of the genus Cobitis (Teleostei:Cobitidae), with a checklist of European forms and suggestions for conservation

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Ráb, Petr

    2001-01-01

    Roč. 59, - (2001), s. 75-89 ISSN 0022-1112 R&D Projects: GA ČR GA206/00/0668; GA AV ČR KSK6005114 Keywords : biodiversity * unisexual fish * conservation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.249, year: 2001

  12. Hydrogen and chlorine isotope exchange in n-methylimidazolium chloride

    International Nuclear Information System (INIS)

    Szydlowski, J.; Kimizuka, W.

    1993-01-01

    Isotope exchange of deuterium and 36 Cl between N-methylimidazolium chloride and gaseous hydrogen chloride has been studied over the temperature range of 249-322 K. A mechanism of exchange for both atoms is proposed and the equilibrium isotope effect of deuterium accompanying this reaction is discussed. (author) 10 refs.; 1 tab

  13. Factors associated with the referral of anxious children to mental health care: the influence of family functioning, parenting, parental anxiety and child impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  14. Factors associated with the referral of anxious children to mental health care: The influence of family functioning, parenting, parental anxiety and child impairment.

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, Susan M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8–13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  15. Factors Associated with the Referral of Anxious Children to Mental Health Care: the Influence of Family Functioning, Parenting, Parental Anxiety and Child Impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  16. Neetika Sharma

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Neetika Sharma. Articles written in Pramana – Journal of Physics. Volume 80 Issue 2 February 2013 pp 237-249 Research Articles. Quadrupole moments of low-lying baryons with spin − 1 2 + spin − 3 2 + and spin − 3 2 + → 1 2 + transitions · Neetika Sharma Harleen Dahiya.

  17. Fission decay properties of ultra neutron-rich uranium isotopes

    Indian Academy of Sciences (India)

    The series of uranium isotopes around it with = 154-172 are identified to be thermally fissile on the basis of the fission barrier and neutron separation energy systematics; a manifestation of the close shell nature of = 162 (or 164). We consider here the thermal neutron fission of a typical representative 249U nucleus in ...

  18. Optimal drinking water composition for caries control in populations

    DEFF Research Database (Denmark)

    Bruvo, M.; Ekstrand, K.; Arvin, Erik

    2008-01-01

    in the numbers of decayed, filled, and missing tooth surfaces (DMF-S) among 52,057 15-year-old schoolchildren in 249 Danish municipalities. Both ions had reducing effects on DMF-S independently of each other, and could be used in combination for the design of optimal drinking water for caries control...

  19. Investigating Forest Inventory and Analysis-collected tree-ring data from Utah as a proxy for historical climate

    Science.gov (United States)

    R. Justin DeRose; W. Shih-Yu (Simon) Wang; John D. Shaw

    2012-01-01

    Increment cores collected as part of the periodic inventory in the Intermountain West were examined for their potential to represent growth and be a proxy for climate (precipitation) over a large region (Utah). Standardized and crossdated time-series created from pinyon pine (n=249) and Douglas-fir (n=274) increment cores displayed spatiotemporal patterns in growth...

  20. NIGERIAN VETERINARY JOURNAL

    African Journals Online (AJOL)

    ADEYEYE

    demonstration of congenital absence of epidermis or mucosal epithelium in an animal (Benoit-Biancamano et al., ... clear absence of strata of the epidermal layer from the stratum spinosum to the stratum corneum (Figure 2). .... Genetics Selection Evolution,. BioMed Central, 35 (2), pp.249-256. . MORIELLO, K.A. Congenital ...

  1. RBS-channeling, ERDA and XRD study of lithium tantalate modified by annealed proton exchange (APE)

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Salavcová, L.; Špirková, J.; Groetzschel, R.; Eichhorn, F.

    2006-01-01

    Roč. 249, 1-2 (2006), s. 339-342 ISSN 0168-583X R&D Projects: GA AV ČR(CZ) KJB100480601 Institutional research plan: CEZ:AV0Z10480505 Keywords : RBS-channeling * ERDA * LiTaO3 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.946, year: 2006

  2. Intervence rizikových faktorů aterosklerózy a kardiovaskulární úmrtnost. 20letá primárně preventivní studie z pohledu statistika

    Czech Academy of Sciences Publication Activity Database

    Reissigová, Jindra; Tomečková, Marie

    2003-01-01

    Roč. 45, - (2003), s. 249-255 ISSN 0010-8650 R&D Projects: GA MŠk LN00B107 Keywords : primary prevention study * longitudinal study * risk factors * atherosclerosis * mortality * cardiovascular disease Subject RIV: BA - General Mathematics

  3. The Relationship between the Values of Primary School and Music Teacher Candidates and Their Cheating Attitudes

    Science.gov (United States)

    Saracaloglu, Asuman Seda; Gerçeker, Ceren Saygi; Aladag, Soner

    2018-01-01

    The aim of this research is to examine the relationship between the values of primary and music teacher candidates and their cheating attitudes in terms of different variables. The study group of the research is composed of 249 students who are studying at the Departments of Primary School Teaching and Music Education at Adnan Menderes University…

  4. Přírodní materiály bohaté montmorillonitem: simultánní měření dilatace a sorpce

    Czech Academy of Sciences Publication Activity Database

    Hanus, R.; Kolaříková, I.; Brabec, Libor; Kočiřík, Milan; Přikryl, R.; Jelínek, E.; Zikánová, Arlette

    2005-01-01

    Roč. 99, č. 4 (2005), s. 246-249 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GA104/02/1464 Institutional research plan: CEZ:AV0Z40400503 Keywords : bentonite * montmorrilonite * adsorption * Ca2+ Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.445, year: 2005

  5. Pleolipoviridae, a newly proposed family comprising archaeal pleomorphic viruses with single-stranded or double-stranded DNA genomes

    Czech Academy of Sciences Publication Activity Database

    Pietilä, M.K.; Roine, E.; Sencilo, Ana; Bamford, D.H.; Oksanen, H.M.

    2016-01-01

    Roč. 161, č. 1 (2016), s. 249-256 ISSN 0304-8608 R&D Projects: GA ČR(CZ) GAP302/11/ 1940 Institutional support: RVO:61388971 Keywords : VIRION ARCHITECTURE * HALOVIRUSES * SPINDLE Subject RIV: EE - Microbiology, Virology Impact factor: 2.058, year: 2016

  6. Revisiting perceptual compensation for effects of reverberation in speech identifcation

    DEFF Research Database (Denmark)

    Nielsen, Jens Bo; Dau, Torsten

    2010-01-01

    in the human auditory system [Watkins (2005). J. Acoust. Soc. Am. 118, 249-262]. In the present study, the reverberant test-word was embedded in additional non-reverberant carriers, such as white noise, speech-shaped noise and amplitude modulated noise. In addition, a reference condition was included where...

  7. African Journal of Psychiatry - Vol 9, No 4 (2006)

    African Journals Online (AJOL)

    The barriers preventing effective treatment of South African patients with mental health problems · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. L Trump, C Hugo, 249-260. http://dx.doi.org/10.4314/ajpsy.v9i4.30224 ...

  8. The prevalence of hypertension and the relationship with body ...

    African Journals Online (AJOL)

    Hypertension, defined as the average of two separate BP (BP) readings, where the systolic BP and diastolic BP is >95th percentile for age, sex and height, was determined by means of an Omron 705CP-II. Results. The overall prevalence of prehypertension and hypertension was 8.5% and 24.9%, respectively. Both systolic ...

  9. Academic Politics, Morale, and Involvement: Preliminary Findings of the Stanford Project on Academic Governance.

    Science.gov (United States)

    Ecker, George Paul; Baldridge, J. Victor

    This document was prepared as a preliminary report on the findings of the Stanford Project on Academic Governance, a comparative study of the politics of decisionmaking in colleges and universities in the United States. The project is using data gathered from faculty members and administrators in a sample of 249 colleges and universities, as well…

  10. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

    2009-01-01

    Roč. 237, č. 3 (2009), s. 249-257 ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  11. Distribution of iron, cobalt , zinc and selenium in macrofungi

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jan; Řanda, Zdeněk

    2007-01-01

    Roč. 6, č. 4 (2007), s. 249-259 ISSN 1617-416X Institutional research plan: CEZ:AV0Z10480505 Keywords : ectomycorrhizal fungi * instrumental neutron activation analysis * terrestrial saprobes Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.259, year: 2007

  12. Neutron diffraction studies on La 2- Dy Ca 2 Ba 2 Cu 4+2

    Indian Academy of Sciences (India)

    Structural studies on Dy-substituted La-2125 type superconductors have been carried out by neutron diffraction experiments at room temperature using a monochromatic neutron beam of wavelength () = 1.249 Å. A series of samples with La2-DyCa2Ba2Cu4+2O stoichiometric composition, for = 0.1-0.5, have ...

  13. Search for single production of a vector-like quark via a heavy gluon in the 4b final state with the ATLAS detector in pp collisions at √s = 8 TeV

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2016-01-01

    Roč. 758, Jul (2016), 249-268 ISSN 0370-2693 Institutional support: RVO:68378271 Keywords : CERN LHC Coll * background * composite * benchmark * gluon * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  14. Control of Metastatic Colonization in Prostate Cancer: The Functional Mechanism of Metastasis Suppression by JNKK1/MKK4

    Science.gov (United States)

    2012-09-01

    19a. NAME OF RESPONSIBLE PERSON USAMRMC a. REPORT U b. ABSTRACT U c. THIS PAGE U UU 2 19b. TELEPHONE NUMBER (include area code ...prostate. Clin Cancer Res 1997;3: 249–56. 4. Cher ML, de Oliveira JG, Beaman AA, Nemeth JA, Hussain M, Wood DP, Jr. Cellular proliferation and prevalence

  15. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|24111904 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  16. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062018 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  17. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15829852 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  18. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128549 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  19. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800273 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  20. 75 FR 53987 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-09-02

    ..., Washington, DC 20549-0213. Extension: Rule 15Ba2-1 and Form MSD; SEC File No. 270-0088; OMB Control No. 3235... by a bank municipal securities dealer must be filed on Form MSD (17 CFR 249.1100). The Commission uses the information contained in Form MSD to determine whether bank municipal securities dealers meet...

  1. A general method for the calculation of absolute trace gas concentrations in air and breath from selected ion flow tube mass spectrometry data

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Dryahina, Kseniya; Smith, D.

    249-250, - (2006), s. 230-239 ISSN 1387-3806 R&D Projects: GA ČR GA202/03/0827 Institutional research plan: CEZ:AV0Z40400503 Keywords : selected ion flow tube * mass spectrometry * SIFT-MS * trace gas analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.337, year: 2006

  2. Recent natural hybridization between two allopolyploid wheatgrasses (Elytrigia, Poaceae): Ecological and evolutionary implications

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta

    2007-01-01

    Roč. 100, - (2007), s. 249-260 ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007

  3. Diversity of Pneumocystis jirovecii Across Europe

    DEFF Research Database (Denmark)

    Alanio, Alexandre; Gits-Muselli, Maud; Guigue, Nicolas

    2017-01-01

    validated short tandem repeat (STR) markers on 249 samples (median: 17 per centre interquartile range [11-20]) from PCP patients of 16 European centres. Mixtures of STR markers (i.e., ≥2 alleles for ≥1 locus) were detected in 67.6% (interquartile range [61.4; 76.5]) of the samples. Mixture was significantly...

  4. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Ranjit Kumar. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 249-256 Research Articles. On the exact solutions of nonlinear diffusion-reaction equations with quadratic and cubic nonlinearities · R S Kaushal Ranjit Kumar Awadhesh ...

  5. The Mediterranean: high discovery rates for a well-studied trematode fauna

    Czech Academy of Sciences Publication Activity Database

    Pérez-del-Olmo, A.; Kostadinova, Aneta; Gibson, D. I.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 249-256 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Digenean species diversity * marine fishes * parasites Subject RIV: EG - Zoology Impact factor: 1.181, year: 2016

  6. C P Vinod

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C P Vinod. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 247-249 Experimental Techniques. A method employing STM for the estimation of relative changes in the work function of modified metal tips · R B Sharma C P Vinod G U Kulkarni.

  7. All projects related to | Page 2 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The 2014 Ebola outbreak in West Africa claimed the lives of tens of thousands of people, with Guinea, Liberia, and Sierra Leone severely hit by this crisis. Region: South of Sahara, Guinea, Liberia, Nigeria, Sierra Leone, Republic of Congo, Canada. Program: Food, Environment, and Health. Total Funding: CA$ 249,188.00.

  8. Profesoři jmenovaní v letech 1948-1950 na českých vysokých školách

    Czech Academy of Sciences Publication Activity Database

    Devátá, Markéta

    2003-01-01

    Roč. 43, 1-2 (2003), s. 191-249 ISSN 0323-0562 R&D Projects: GA MŠk LN00A041 Institutional research plan: CEZ:AV0Z8063914 Keywords : education * Czech higher education * the 20th century Subject RIV: AB - History

  9. Absent testis: does it exist in 46,XY males?

    African Journals Online (AJOL)

    Annals of Pediatric Surgery 2013, 9:79–80. Keywords: absent testis, undescended testis, vanishing testis. Al Noor Hospital, Abu Dhabi, UAE. Correspondence to Mohamed Amin ElGohary, FRCS, Al Noor Hospital,. PO Box 48481, Abu Dhabi, UAE. Tel: + 971 506 225 532; fax: + 971 249 44470; e-mail: amingoh@gmail.com.

  10. Experience with 500 Consecutive Patients on Somatom AR. T ...

    African Journals Online (AJOL)

    All the CT examinations were performed on Siemens Somatom AR. T CT scanner using existing departmental scanning protocol. Results: About equal numbers of male [249] and female [251] patients were recorded in this study, their ages ranging between 1-month neonates to 86 years old. Most requests [73.4%] fall within ...

  11. Carboxyl-functionalized magnetic microparticle carrier for isolation and identification of DNA in dairy products

    Czech Academy of Sciences Publication Activity Database

    Horák, Daniel; Rittich, B.; Španová, A.

    2007-01-01

    Roč. 311, č. 1 (2007), s. 249-254 ISSN 0304-8853 R&D Projects: GA ČR GA525/05/0311 Institutional research plan: CEZ:AV0Z40500505 Keywords : magnetic particles * DNA * magnetite Subject RIV: GM - Food Processing Impact factor: 1.704, year: 2007

  12. A Method to Identify Best Available Technologies (BAT) for Hydrogenation Reactors in the Pharmaceutical Industry

    Czech Academy of Sciences Publication Activity Database

    Le Doan, T.V.; Stavárek, Petr; de Bellefon, C.

    2012-01-01

    Roč. 2, č. 3 (2012), s. 77-82 ISSN 2062-249X Grant - others:IMPULSE(XE) FP6-NMP2-CT-2005-011816 Institutional support: RVO:67985858 Keywords : hydrogenation * pharmaceuticals * methodology Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.091, year: 2012

  13. Effect of thermal treatment on mechanically milled cobalt powder

    CSIR Research Space (South Africa)

    Bolokang, AS

    2012-03-01

    Full Text Available ;23:249-57. 18 [19] Ou XQ, Song M, Shen TT, Xiao DH, He YH. Fabrication and mechanical properties of ultrafine grained WC-10Co-0.45Cr3C2-0.25VC alloys. Int J Refract Met Hard Mater 2011;29:260-7. [20] Enayati MH, Aryanpour GR, Ebnonnasir A. Production...

  14. Morphology and ultrastructure of the freshwater fossil diatom Aulacoseira campylosira (Ehrenberg) comb. nov. from Ehrenberg type material

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav

    2010-01-01

    Roč. 25, č. 2 (2010), s. 307-321 ISSN 0269-249X R&D Projects: GA ČR GA205/05/0204 Institutional research plan: CEZ:AV0Z60050516 Keywords : centric diatoms * morphology * taxonomy Subject RIV: EF - Botanics Impact factor: 1.030, year: 2010

  15. Four new non-marine diatom taxa from the Subantactic and Antarctic Regions

    Czech Academy of Sciences Publication Activity Database

    Van de Vijver, B.; Sterken, M.; Vyverman, W.; Mataloni, G.; Nedbalová, L.; Kopalová, K.; Elster, Josef; Verleyen, E.; Sabbe, K.

    2010-01-01

    Roč. 25, č. 2 (2010), s. 431-443 ISSN 0269-249X R&D Projects: GA MŠk ME 945 Institutional research plan: CEZ:AV0Z60050516 Keywords : South Shetland islands * East Antarctica * diatoms Subject RIV: EF - Botanics Impact factor: 1.030, year: 2010

  16. Re-examination of a Sphaerotermia and a Gaillonella (Bacillariophyceae) from the Ehrenberg Collection, Berlin (Germany)

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav

    2010-01-01

    Roč. 25, č. 2 (2010), s. 293-306 ISSN 0269-249X Institutional research plan: CEZ:AV0Z60050516 Keywords : centric diatoms * valve morphology * taxonomy Subject RIV: EF - Botanics Impact factor: 1.030, year: 2010

  17. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Irma G. Enriquez-Maldonado. Articles written in Journal of Genetics. Volume 88 Issue 2 August 2009 pp 249-252 Research Note. Association of matrix metalloproteinase-2 gene promoter polymorphism with myocardial infarction susceptibility in a Mexican population.

  18. Laser Bioeffects Resulting from Non-Linear Interactions of Ultrashort Pulses with Biological Systems

    Science.gov (United States)

    2004-07-01

    antioxidants to p’rev~iii activation’ of!q-KB6as led to the, general hypothesis that reactive oxygen species (ROS) are somehow involved in triggering... phototherapy for retinal and choroidal tumors: A rational approach", Graeffe’s Arch Exp Ophthalmol, 238, 249-272, (2000). 7. J.A. Oosterhuis, H.G. Journee-de

  19. Chemical characteristics of soil and pore waters of three wetland sites dominated by Phragmites australis: relation to vegetation composition and reed performance

    Czech Academy of Sciences Publication Activity Database

    Čížková, Hana; Pechar, Libor; Husák, Štěpán; Květ, Jan; Bauer, Václav; Radová, Jana; Edwards, K.

    2001-01-01

    Roč. 69, - (2001), s. 235-249 ISSN 0304-3770 R&D Projects: GA AV ČR KSK6005114; GA MŠk VS96072 Institutional research plan: CEZ:AV0Z6005908 Keywords : Eutrophication * nitrogen * organic matter * phosphorus Subject RIV: EF - Botanics Impact factor: 1.361, year: 2001

  20. Patterns of bryophyte and vascular plant richness in European subalpine springs

    Czech Academy of Sciences Publication Activity Database

    Sekulová, L.; Hájek, Michal; Hájková, Petra; Mikulášková, E.; Buttler, A.; Syrovátka, V.; Rozbrojová, Zuzana

    2012-01-01

    Roč. 213, č. 2 (2012), s. 237-249 ISSN 1385-0237 Institutional research plan: CEZ:AV0Z60050516 Keywords : springs * spesies richness * environmental factors Subject RIV: EF - Botanics Impact factor: 1.534, year: 2012 http://www.springerlink.com/content/m6gq67w137746672/