WorldWideScience

Sample records for mendelevium 249

  1. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  2. 7 CFR 249.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 249.3 Section 249.3 Agriculture... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.3 Administration. (a) Delegation to FNS. Within FNS, FNS shall act on behalf of the Department in the administration of...

  3. Dicty_cDB: SLH249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH249 (Link to dictyBase) - G24226 DDB0215670 Contig-U04170-1 SLH2...49E (Link to Original site) - - - - - - SLH249E 689 Show SLH249 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH249Q.Seq.d/ ...Representative seq. ID SLH249E (Link to Original site) Representative DNA sequence >SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2...re E Sequences producing significant alignments: (bits) Value SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2

  4. 47 CFR 25.227-25.249 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false [Reserved] 25.227-25.249 Section 25.227-25.249 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards §§ 25.227-25.249 [Reserved] ...

  5. 14 CFR 249.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Definitions. 249.2 Section 249.2 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... other acquisition. Supporting papers (records) means any group of documentary papers, such as memoranda...

  6. 48 CFR 249.110 - Settlement negotiation memorandum.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation memorandum. 249.110 Section 249.110 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 249.110 Settlement negotiation memorandum. Follow...

  7. 7 CFR 249.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 249.11 Section 249.11... § 249.11 Financial management system. (a) Disclosure of expenditures. The State agency must maintain a financial management system that provides accurate, current and complete disclosure of the financial status...

  8. 46 CFR 249.10 - Non-discrimination policy.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Non-discrimination policy. 249.10 Section 249.10... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.10 Non-discrimination policy. To administer effectively the policy regarding non-discrimination against U.S. insurers in other countries, as...

  9. 46 CFR 249.8 - Limitation on risk.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Limitation on risk. 249.8 Section 249.8 Shipping... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.8 Limitation on risk. (a) Underwriters may take a line on any single risk in excess of five percent of its Policyholders' Surplus only with...

  10. 7 CFR 249.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 249.9 Section 249.9 Agriculture... Nutrition education. (a) Goal. Nutrition education shall emphasize the relationship of proper nutrition to... agency shall integrate nutrition education into SFMNP operations and may satisfy nutrition education...

  11. 47 CFR 24.249 - Payment issues.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Payment issues. 24.249 Section 24.249 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PERSONAL COMMUNICATIONS... issues. (a) Timing. On the day that a PCS entity files its prior coordination notice (PCN) in accordance...

  12. 48 CFR 52.249-6 - Termination (Cost-Reimbursement).

    Science.gov (United States)

    2010-10-01

    ...-Reimbursement). 52.249-6 Section 52.249-6 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....249-6 Termination (Cost-Reimbursement). As prescribed in 49.503(a)(1), insert the following clause: Termination (Cost-Reimbursement) (MAY 2004) (a) The Government may terminate performance of work under this...

  13. 7 CFR 58.249 - Instant nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Instant nonfat dry milk. 58.249 Section 58.249... Products Bearing Usda Official Identification § 58.249 Instant nonfat dry milk. (a) Only instant nonfat dry milk manufactured and packaged in accordance with the requirements of this part and with the applicable...

  14. 7 CFR 249.13 - Program income.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program income. 249.13 Section 249.13 Agriculture....13 Program income. Program income means gross income the State agency earns from grant supported... property. The State agency must retain Program income earned during the agreement period and use it for...

  15. 7 CFR 249.12 - SFMNP costs.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false SFMNP costs. 249.12 Section 249.12 Agriculture....12 SFMNP costs. (a) General. (1) Composition of allowable costs. In general, a cost item will be... administration and operation of the SFMNP. Allowable SFMNP costs may be classified as follows: (i) Food costs and...

  16. 7 CFR 249.25 - Other provisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Other provisions. 249.25 Section 249.25 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... (7 U.S.C. 2011, et seq.) and to any other Federal or State food or nutrition assistance program. (b...

  17. Neutron total cross section measurements on 249Cf

    International Nuclear Information System (INIS)

    Carlton, R.F.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Benjamin, R.W.

    1979-01-01

    Neutron total cross section measurements were performed on a sample of 249 Cf (5.65 mg total weight) with the ORELA as a source of pulsed neutrons. The sample, the inverse thickness of which was 1542 barns/atom, consisted of 85.3% 249 Cf and 14.4% 249 Bk, and was cooled to liquid nitrogen temperature. Analyses were also made of data from a thin sample (l/n = 17430) of 65% 249 Cf in the region of the large fission resonance at 0.7 eV. Fifty-five resonances in 249 Cf were observed and analyzed over the energy range 0.1 eV to 90 eV by use of an R-matrix multilevel formalism. The resonance parameters obtained were used to determine the level spacing and the s-wave neutron and fission strength functions. Thermal total cross section measurements were also performed. 5 figures, 3 tables

  18. Absorption of 249Bk from the gastrointestinal tract

    International Nuclear Information System (INIS)

    Zalikin, G.A.; Nisimov, P.G.

    1988-01-01

    In experimets with albino mongrel female rats a study was made of the absorption of 249 Bk from the gastrointestinal tract after a single per os administration. The bulk of 249 Bk (96 per cent) administered either intravenously or per os was mainly deposited in the skeleton and liver. The value of 249 Bk absorption from the gastrointestinal trat by days 4 and 8 following administration was 0.05 per cent

  19. 48 CFR 249.7000 - Terminated contracts with Canadian Commercial Corporation.

    Science.gov (United States)

    2010-10-01

    ... Canadian Commercial Corporation. 249.7000 Section 249.7000 Federal Acquisition Regulations System DEFENSE... Termination Requirements 249.7000 Terminated contracts with Canadian Commercial Corporation. (a) Terminate contracts with the Canadian Commercial Corporation in accordance with— (1) The Letter of Agreement (LOA...

  20. 48 CFR 52.249-7 - Termination (Fixed-Price Architect-Engineer).

    Science.gov (United States)

    2010-10-01

    ... Architect-Engineer). 52.249-7 Section 52.249-7 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.249-7 Termination (Fixed-Price Architect-Engineer). As prescribed in 49.503(b), insert the following clause in solicitations and contracts for architect-engineer services when a fixed-price contract...

  1. 17 CFR 249.0-1 - Availability of forms.

    Science.gov (United States)

    2010-04-01

    ..., 100 F Street, NE, Washington, DC 20549. Any person may inspect the forms at this address and at the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 249.0-1 Section 249.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS...

  2. 48 CFR 52.249-9 - Default (Fixed-Price Research and Development).

    Science.gov (United States)

    2010-10-01

    ... Research and Development). 52.249-9 Section 52.249-9 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.249-9 Default (Fixed-Price Research and Development). As prescribed in 49.504(b), insert the following clause: Default (Fixed-Price Research and Development) (APR 1984) (a)(1) The...

  3. 32 CFR 249.6 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... PRESENTATION OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.6 Responsibilities. (a) The Under... scientific and engineering societies and professional associations. (c) The Under Secretary of Defense for...

  4. 32 CFR 249.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.1 Purpose. This part amplifies... scientific and technical papers; provides guidance for reviewing and presenting papers containing export... scientific and technical papers; and provides criteria for identifying fundamental research activities...

  5. 48 CFR 52.249-2 - Termination for Convenience of the Government (Fixed-Price).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Fixed-Price). 52.249-2 Section 52.249-2 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.249-2 Termination for Convenience of the Government (Fixed-Price). As prescribed in 49.502(b)(1)(i), insert the following clause: Termination for Convenience of the Government...

  6. 7 CFR 249.8 - Level of benefits and eligible foods.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Level of benefits and eligible foods. 249.8 Section...) Participant Benefits § 249.8 Level of benefits and eligible foods. (a) General. State agencies must identify..., such as prunes (dried plums), raisins (dried grapes), sun-dried tomatoes, or dried chili peppers are...

  7. 48 CFR 52.249-4 - Termination for Convenience of the Government (Services) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Services) (Short Form). 52.249-4 Section 52.249-4 Federal Acquisition... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-4 Termination for Convenience of the Government... convenience of the Government, limit termination settlement charges to services rendered before the date of...

  8. Yields of fission products produced by thermal-neutron fission of 249Cf

    International Nuclear Information System (INIS)

    Dickens, J.K.; McConnell, J.W.

    1981-01-01

    Absolute yields have been determined for 107 gamma rays emitted in the decay of 97 fission products representing 54 mass chains created during thermal-neutron fission of 249 Cf. These results include 14 mass chains for which no prior yield data exist. Using a Ge(Li) detector, spectra were obtained of gamma rays emanating from a 0.4 μg sample of 249 Cf between 45 s and 0.4 yr after very short irradiations of the 249 Cf by thermal neutrons. On the basis of measured gamma-ray yields and known nuclear data, total chain mass yields and relative uncertainties were obtained for 51 masses between 89 and 156. The absolute overall normalization uncertainty is approx.8%. The measured A-chain cumulative yields make up 77% of the total light mass (A 249 Cf

  9. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  10. 48 CFR 52.249-1 - Termination for Convenience of the Government (Fixed-Price) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Fixed-Price) (Short Form). 52.249-1 Section 52.249-1 Federal Acquisition... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-1 Termination for Convenience of the Government... Convenience of the Government (Fixed-Price) (Short Form) (APR 1984) The Contracting Officer, by written notice...

  11. 17 CFR 249.10 - Form 1-N for notice registration as a national securities exchange.

    Science.gov (United States)

    2010-04-01

    ... registration as a national securities exchange. 249.10 Section 249.10 Commodity and Securities Exchanges... or Exemption of, and Notification of Action Taken by, National Securities Exchanges § 249.10 Form 1-N for notice registration as a national securities exchange. This form shall be used for notice, and...

  12. 14 CFR 249.7 - Restrictions on record destruction.

    Science.gov (United States)

    2010-01-01

    ... PROCEEDINGS) ECONOMIC REGULATIONS PRESERVATION OF AIR CARRIER RECORDS General Instructions § 249.7... of a DOT order fixing the final mail compensation payable for services rendered during an “open mail...

  13. Bk and Cf chromatographic separation and 249Bk/248Cm and 249Cf/248Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry

    International Nuclear Information System (INIS)

    Gourgiotis, A.; Isnard, H.; Nonell, A.; Aubert, M.; Stadelmann, G.; Dupont, E.; AlMahamid, I.; Tiang, G.; Rao, L.; Lukens, W.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.

    2013-01-01

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248 Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios in the 248 Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)

  14. Alpha-gamma decay studies of 253No and its daughter products 253Md, 249Fm

    International Nuclear Information System (INIS)

    Hessberger, F.P.; Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Streicher, B.; Leino, M.; Nishio, K.

    2012-01-01

    Nuclear structure and decay of the isotope 253 No and its decay products 249 Fm and 253 Md were investigated by means of α - γ spectroscopy. Besides the established strong γ transitions from the 9/2 - [734] Nilsson level in 249 Fm, populated predominantly by the α decay of 253 No, into the ground-state (gs) rotational band, a couple of weaker γ lines (58.3, 129.2, 209.3 and 669.5keV) were observed and placed into the 249 Fm level scheme. The transition from the 7/2 - level in 249 Es, populated by the α decay of 253 Md, into the 9/2 + member of the gs rotational band, so far established for other odd-mass Es isotopes, was observed clearly. GEANT4 simulations were performed to investigate the influence of energy summing between α particles and conversion electrons (CE) on the shape of the α spectra at different implantation energies, leading to evidence for a weak α decay branch of 253 No into the gs of 249 Fm or the ground-state rotational band, respectively. (orig.)

  15. Current situation of International Organization for Standardization/Technical Committee 249 international standards of traditional Chinese medicine.

    Science.gov (United States)

    Liu, Yu-Qi; Wang, Yue-Xi; Shi, Nan-Nan; Han, Xue-Jie; Lu, Ai-Ping

    2017-05-01

    To review the current situation and progress of traditional Chinese medicine (TCM) international standards, standard projects and proposals in International Organization for Standardization (ISO)/ technical committee (TC) 249. ISO/TC 249 standards and standard projects on the ISO website were searched and new standard proposals information were collected from ISO/TC 249 National Mirror Committee in China. Then all the available data were summarized in 5 closely related items, including proposed time, proposed country, assigned working group (WG), current stage and classifification. In ISO/TC 249, there were 2 international standards, 18 standard projects and 24 new standard proposals proposed in 2014. These 44 standard subjects increased year by year since 2011. Twenty-nine of them were proposed by China, 15 were assigned to WG 4, 36 were in preliminary and preparatory stage and 8 were categorized into 4 fifields, 7 groups and sub-groups based on International Classifification Standards. A rapid and steady development of international standardization in TCM can be observed in ISO/TC 249.

  16. 7 CFR 249.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.1 General.... 2011, et seq.), and to any other Federal or State food or nutrition assistance program under which...

  17. Study of the 249-251Cf + 48Ca reactions: recent results and outlook

    Science.gov (United States)

    Voinov, A. A.; Oganessian, Yu Ts; Abdullin, F. Sh; Brewer, N. T.; Dmitriev, S. N.; Grzywacz, R. K.; Hamilton, J. H.; Itkis, M. G.; Miernik, K.; Polyakov, A. N.; Roberto, J. B.; Rykaczewski, K. P.; Sabelnikov, A. V.; Sagaidak, R. N.; Shirokovsky, I. V.; Shumeiko, M. V.; Stoyer, M. A.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu S.; Utyonkov, V. K.; Vostokin, G. K.

    2018-02-01

    Experiment aiming at the synthesis of heavy isotopes of Z=118 (Og) using beam of 48Ca and a target of 249-251Cf was undertaken in October 2015 - April 2016 employing the Dubna Gas-Filled Recoil Separator (FLNR JINR). The target of mixed isotopes of 249-251Cf (50.7% of 249Cf, 12.9% of 250Cf, and 36.4% of 251Cf) was irradiated by 48Ca ions at two beam energies of 252 and 258 MeV with the corresponding accumulated beam doses of 1.6×1019 and 1.1×1019. A single event observed at lower beam energy was assigned to the isotope 294Og, the product of the reaction 249Cf(48Ca, 3n); its decay pattern and the observed radioactive properties of the nuclides in the decay chain reproduce in full those observed for 294Og in our earlier experiments of 2002-2005 and 2012. At higher beam energy we observed no decay chains that could be attributed to the isotopes of Og. The possibility of renewal of this experiment in the future is discussed.

  18. 7 CFR 249.21 - Procurement and property management.

    Science.gov (United States)

    2010-01-01

    ... to such local, State or Federal authority as may have proper jurisdiction. (c) State regulations. The... applicable State and local regulations; and (2) Any procurements made with SFMNP funds adhere to the... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement and property management. 249.21 Section...

  19. Preparation and study of elemental californium-249

    International Nuclear Information System (INIS)

    Noe, M.; Peterson, J.R.

    1975-01-01

    Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)

  20. 17 CFR 249.507 - Form 7-M, consent to service of process by an individual nonresident broker-dealer.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 7-M, consent to service of process by an individual nonresident broker-dealer. 249.507 Section 249.507 Commodity and... Forms for Statements Made in Connection With Exempt Tender Offers § 249.507 Form 7-M, consent to service...

  1. 17 CFR 249.509 - Form 9-M, consent to service of process by a partnership nonresident broker-dealer.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 9-M, consent to service of process by a partnership nonresident broker-dealer. 249.509 Section 249.509 Commodity and... Forms for Statements Made in Connection With Exempt Tender Offers § 249.509 Form 9-M, consent to service...

  2. 48 CFR 1652.249-71 - FEHBP termination for convenience of the government-negotiated benefits contracts.

    Science.gov (United States)

    2010-10-01

    ... convenience of the government-negotiated benefits contracts. 1652.249-71 Section 1652.249-71 Federal... convenience of the government—negotiated benefits contracts. As prescribed in section 1649.101-71, the following clause shall be inserted in all FEHBP contracts. FEHBP Termination for Convenience of the...

  3. 48 CFR 52.249-5 - Termination for Convenience of the Government (Educational and Other Nonprofit Institutions).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Educational and Other Nonprofit Institutions). 52.249-5 Section 52.249-5... Convenience of the Government (Educational and Other Nonprofit Institutions). As prescribed in 49.502(d), insert the following clause: Termination for Convenience of the Government (Educational and Other...

  4. 7 CFR 249.14 - Distribution of funds to State agencies.

    Science.gov (United States)

    2010-01-01

    ... Section 249.14 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM... funds it receives. (h) Recovery of unused funds. State agencies must return to FNS any unexpended funds...

  5. Maternal and perinatal mortality figures in 249 South African ...

    African Journals Online (AJOL)

    the PMR for the black population is considerably hi9her than for the other ethnic groups. That said, perinatal mortality levels in South African blacks still compare favourably with figures from other African cQuntries.12. In conclusion, the MMRs and PMRs found in our survey of. 249 South African hospitals - though not truly.

  6. 48 CFR 52.249-3 - Termination for Convenience of the Government (Dismantling, Demolition, or Removal of Improvements).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Dismantling, Demolition, or Removal of Improvements). 52.249-3 Section 52.249-3... Convenience of the Government (Dismantling, Demolition, or Removal of Improvements). As prescribed in 49.502(b)(2), insert the following clause: Termination for Convenience of the Government (Dismantling...

  7. Physical and dynamical properties of the anomalous comet 249P/LINEAR

    Science.gov (United States)

    Fernández, Julio A.; Licandro, Javier; Moreno, Fernando; Sosa, Andrea; Cabrera-Lavers, Antonio; de León, Julia; Birtwhistle, Peter

    2017-10-01

    Images and low-resolution spectra of the near-Earth Jupiter family comet (JFC) 249P/LINEAR in the visible range obtained with the instrument OSIRIS in the 10.4 m Gran Telescopio Canarias (GTC) (La Palma, Spain) on January 3, 4, 6 and February 6, 2016 are presented, together with a series of images obtained with the 0.4m telescope of the Great Shefford Observatory obtained on Oct. 22 and 27, and Nov. 1 and 24, 2006. The reflectance spectrum of 249P is similar to that of a B-type asteroid. The comet has an absolute (visual) nuclear magnitude HV = 17.0 ± 0.4 , which corresponds to a radius of about 1-1.3 km for a geometric albedo ∼ 0.04 - 0.07 . From the analysis of GTC images using a Monte Carlo dust tail code we find that the time of maximum dust ejection rate was around 1.6 days before perihelion. The analysis of the dust tails during the 2006 and 2016 perihelion approaches reveals that, during both epochs, the comet repeated the same dust ejection pattern, with a similar short-lived activity period of about 20 days (FWHM) around perihelion and a dust loss rate peaking at 145 ± 50 kg/s. The total dust mass ejected during its last perihelion passage was (2.5 ± 0.9) × 108 kg, almost all this mass being emitted before the first observation of January 3, 2016. The activity onset, duration, and total ejected mass were very similar during the 2006 perihelion passage. This amount of dust mass is very low as compared with that from other active JFCs. The past orbital evolution of 249P and 100 clones were also followed over a time scale of ∼ 5 × 104 yr. The object and more than 60% of the clones remained bound to the near-Earth region for the whole computed period, keeping its perihelion distance within the range q ≃ 0.4 - 1.1 au. The combination of photometric and spectroscopic observations and dynamical studies show that the near-Earth comet 249P/LINEAR has several peculiar features that clearly differentiate it from typical JFCs. We may be in front of a new

  8. Study of the properties of the superheavy nuclei Z=117 produced in the 249Bk + 48Ca reaction

    International Nuclear Information System (INIS)

    Oganessian, Y.T.; Abdullin, F.S.; Dmitriev, S.N.; Itkis, M.G.; Polyakov, A.N.; Sagaidak, R.N.; Shirokovsky, I.V.; Shumeiko, M.V.; Subbotin, V.G.; Sukhov, A.M.; Tsyganov, Y.S.; Utyonkov, V.K.; Voinov, A.A.; Vostokin, G.K.; Alexander, C.; Binder, J.; Boll, R.A.; Ezold, J.; Felker, K.; Miernik, K.; Roberto, J.B.; Rykaczewski, K.P.; Gostic, J.M.; Henderson, R.A.; Moody, K.J.; Shaughnessy, D.H.; Stoyer, M.A.; Stoyer, N.J.; Grzywacz, R.K.; Miller, D.; Hamilton, J.H.; Ramayya, A.V.; Ryabinin, M.A.

    2014-01-01

    The reaction of 249 Bk with 48 Ca have been reinvestigated to provide new evidence for the discovery of element 117 on a larger number of events. The experiments were performed at five projectile energies and with a total beam dose of 48 Ca of about 4.6*10 19 . Two isotopes 293,294 117 were synthesized in the 249 Bk+ 48 Ca reaction, providing excitation functions and α-decay spectra of the produced isotopes that establishes these nuclei to be the products of the 4n- and 3n-evaporation channels, respectively. Decay properties of 293,294 117 and of all the daughter products agree with the data of the experiment in which these nuclei were synthesized for the first time in 2010. The new 289 115 events, populated by a decay of 293 117, demonstrate the same decay properties as those observed for 289 115 produced in the 243 Am( 48 Ca,2n) reaction thus providing cross-bombardment evidence. In addition, a single decay of 294 118 was observed from the reaction with 249 Cf - a result of the in-growth of 249 Cf in the 249 Bk target. (authors)

  9. 17 CFR 249.332 - Form N-Q, quarterly schedule of portfolio holdings of registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... of portfolio holdings of registered management investment company. 249.332 Section 249.332 Commodity... management investment company. This form shall be used by registered management investment companies, other than small business investment companies registered on Form N-5 (§§ 239.24 and 274.5 of this chapter...

  10. 17 CFR 249.331 - Form N-CSR, certified shareholder report.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified... Required Under Sections 13 and 15(d) of the Securities Exchange Act of 1934 § 249.331 Form N-CSR, certified shareholder report. This form shall be used by registered management investment companies to file reports...

  11. Ternary particle yields in 249Cf(nth,f)

    Science.gov (United States)

    Tsekhanovich, I.; Büyükmumcu, Z.; Davi, M.; Denschlag, H. O.; Gönnenwein, F.; Boulyga, S. F.

    2003-03-01

    An experiment measuring ternary particle yields in 249Cf(nth,f) was carried out at the high flux reactor of the Institut Laue-Langevin using the Lohengrin recoil mass separator. Parameters of energy distributions were determined for 27 ternary particles up to 30Mg and their yields were calculated. The yields of 17 further ternary particles were estimated on the basis of the systematics developed. The heaviest particles observed in the experiment are 37Si and 37S; their possible origin is discussed.

  12. Production and decay of the heaviest odd-Z nuclei in the 249Bk + 48Ca reaction

    International Nuclear Information System (INIS)

    Oganessian, Yu Ts; Abdullin, F Sh; Dmitriev, S N; Itkis, M G; Polyakov, A N; Alexander, C; Binder, J; Boll, R A; Ezold, J; Felker, K; Grzywacz, R K; Miernik, K; Roberto, J B; Gostic, J M; Henderson, R A; Moody, K J; Hamilton, J H; Ramayya, A V; Miller, D; Ryabinin, M A

    2015-01-01

    The reaction of 249 Bk with 48 Ca has been investigated with an aim of synthesizing and studying the decay properties of isotopes of the new element 117. The experiments were performed at five projectile energies (in two runs, in 2009-2010 and 2012) and with a total beam dose of 48 Ca ions of about 9x10 19 The experiments yielded data on a-decay characteristics and excitation functions of the produced nuclei that establish these to be 293 117 and 294 117 – the products of the 4n- and 3n-evaporation channels, respectively. In total, we have observed 20 decay chains of Z=117 nuclides. The cross sections were measured to be 1.1 pb for the 3n and 2.4 pb for the 4n-reaction channel. The new 289 115 events, populated by α decay of 117, demonstrate the same decay properties as those observed for 115 produced in the 243 Am( 48 Ca,2n) reaction thus providing cross-bombardment evidence. In addition, a single decay of 294 118 was observed from the reaction with 249 Cf – a result of the in-growth of 249 Cf in the 249 Bk target. The observed decay chain of 294 118 is in good agreement with decay properties obtained in 2002-2005 in the experiments with the reaction 249 Cf( 48 Ca,3n) 294 118. The energies and half-lives of the odd-Z isotopes observed in the 117 decay chains together with the results obtained for lower-Z superheavy nuclei demonstrate enhancement of nuclear stability with increasing neutron number towards the predicted new magic number N=184

  13. 17 CFR 249.801 - Form X-15AA-1, for application for registration as a national securities association or...

    Science.gov (United States)

    2010-04-01

    ... for registration as a national securities association or affiliated securities association. 249.801... Registration of and Reporting by National Securities Associations and Affiliated Securities Associations § 249.801 Form X-15AA-1, for application for registration as a national securities association or affiliated...

  14. Ternary particle yields in 249Cf(nth,f)

    International Nuclear Information System (INIS)

    Tsekhanovich, I.; Bueyuekmumcu, Z.; Davi, M.; Denschlag, H.O.; Goennenwein, F.; Boulyga, S.F.

    2003-01-01

    An experiment measuring ternary particle yields in 249 Cf(n th ,f) was carried out at the high flux reactor of the Institut Laue-Langevin using the Lohengrin recoil mass separator. Parameters of energy distributions were determined for 27 ternary particles up to 30 Mg and their yields were calculated. The yields of 17 further ternary particles were estimated on the basis of the systematics developed. The heaviest particles observed in the experiment are 37 Si and 37 S; their possible origin is discussed

  15. Evaluation of neutron nuclear data for 249Cf

    International Nuclear Information System (INIS)

    Zhou Delin; Yu Baosheng; Yuan Hanrong; Liu Tong; Zhang Jin; Su Zongdi; Yan Shiwei; Wang Cuilan; Zhang Jingshang

    1992-01-01

    A complete set of neutron nuclear data from 10 -5 eV to 20 MeV in ENDF/B-6 format has been evaluated for 249 Cf based on measured data, systematics predications and model theory calculations. The evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) reaction cross sections, the resolved and unresolved resonance parameters, the angular and energy distributions of emitted neutrons and the average number of neutrons emitted per fission. The numerical data are available in ENDF/B-6 format

  16. 17 CFR 249.803 - Form X-15AJ-2, for annual consolidated supplement of a national securities association or an...

    Science.gov (United States)

    2010-04-01

    ... consolidated supplement of a national securities association or an affiliated securities association. 249.803... Registration of and Reporting by National Securities Associations and Affiliated Securities Associations § 249.803 Form X-15AJ-2, for annual consolidated supplement of a national securities association or an...

  17. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  18. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  19. Magnetic susceptibility of 244Cm metal and 249Cf metal

    International Nuclear Information System (INIS)

    Fujita, D.K.; Parsons, T.C.; Edelstein, N.; Noe, M.; Peterson, J.R.

    1975-07-01

    The first magnetic susceptibility measurements made on the expanded fcc phase of 249 Cf metal are reported. Further measurements are needed on other Cf metal phases. Another measurement of the magnetic susceptibility of 244 Cm metal in a limited temperature range has been reported. The result does not agree with previously reported values. Further work is continuing on the synthesis of 244 Cm metal and 248 Cm metal and magnetic measurements on these samples. (auth)

  20. 17 CFR 249.819 - Form 19b-4, for electronic filing with respect to proposed rule changes by all self-regulatory...

    Science.gov (United States)

    2010-04-01

    ... filing with respect to proposed rule changes by all self-regulatory organizations. 249.819 Section 249..., SECURITIES EXCHANGE ACT OF 1934 Forms for Self-Regulatory Organization Rule Changes and Forms for....819 Form 19b-4, for electronic filing with respect to proposed rule changes by all self-regulatory...

  1. 75 FR 69870 - Delegation of Authority Under 18 U.S.C. 249

    Science.gov (United States)

    2010-11-16

    ... DEPARTMENT OF JUSTICE 28 CFR Part 0 [Docket No. OAG 136; A.G. Order No. 3227-2010] Delegation of Authority Under 18 U.S.C. 249 AGENCY: Department of Justice. ACTION: Final rule. SUMMARY: This rule amends....S.C. 801 does not apply. List of Subjects in 28 CFR Part 0 Authority delegations (Government...

  2. 17 CFR 249.508 - Form 8-M, consent to service of process by a corporation which is a nonresident broker-dealer.

    Science.gov (United States)

    2010-04-01

    ... to service of process by a corporation which is a nonresident broker-dealer. This form shall be filed... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 8-M, consent to service of process by a corporation which is a nonresident broker-dealer. 249.508 Section 249.508 Commodity...

  3. 17 CFR 249.1100 - Form MSD, application for registration as a municipal securities dealer pursuant to rule 15Ba2-1...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form MSD, application for registration as a municipal securities dealer pursuant to rule 15Ba2-1 under the Securities Exchange Act of 1934 or amendment to such application. 249.1100 Section 249.1100 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED...

  4. Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249 ...

    African Journals Online (AJOL)

    cadewumi

    Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249-256 ..... In recent years the popularity of complementary medicine has increased. Much interest has been focused on exploring ... delayed the induction of glucose intolerance and euglycemia in high fructose diet fed rats. Diabegon treatment inhibits the ...

  5. 17 CFR 249.447 - Form TH-Notification of reliance on temporary hardship exemption.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... § 249.447 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by... Note: For Federal Register citations affecting Form TH, see the List of CFR Sections Affected, which...

  6. 17 CFR 249.510 - Form 10-M, consent to service of process by a nonresident general partner of a broker-dealer firm.

    Science.gov (United States)

    2010-04-01

    ..., consent to service of process by a nonresident general partner of a broker-dealer firm. This form shall be... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 10-M, consent to service of process by a nonresident general partner of a broker-dealer firm. 249.510 Section 249.510...

  7. 50 CFR 665.249 - Lobster size and condition restrictions in Permit Area 2.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Lobster size and condition restrictions in... WESTERN PACIFIC Hawaii Fisheries § 665.249 Lobster size and condition restrictions in Permit Area 2. (a) Only spiny lobsters with a carapace length of 8.26 cm or greater may be retained (see Figure 1 to this...

  8. Actinide production in 136Xe bombardments of 249Cf

    International Nuclear Information System (INIS)

    Gregorich, K.E.

    1985-08-01

    The production cross sections for the actinide products from 136 Xe bombardments of 249 Cf at energies 1.02, 1.09, and 1.16 times the Coulomb barrier were determined. Fractions of the individual actinide elements were chemically separated from recoil catcher foils. The production cross sections of the actinide products were determined by measuring the radiations emitted from the nuclides within the chemical fractions. The chemical separation techniques used in this work are described in detail, and a description of the data analysis procedure is included. The actinide production cross section distributions from these 136 Xe + 249 Cf bombardments are compared with the production cross section distributions from other heavy ion bombardments of actinide targets, with emphasis on the comparison with the 136 Xe + 248 Cm reaction. A technique for modeling the final actinide cross section distributions has been developed and is presented. In this model, the initial (before deexcitation) cross section distribution with respect to the separation energy of a dinuclear complex and with respect to the Z of the target-like fragment is given by an empirical procedure. It is then assumed that the N/Z equilibration in the dinuclear complex occurs by the transfer of neutrons between the two participants in the dinuclear complex. The neutrons and the excitation energy are statistically distributed between the two fragments using a simple Fermi gas level density formalism. The resulting target-like fragment initial cross section distribution with respect to Z, N, and excitation energy is then allowed to deexcite by emission of neutrons in competition with fission. The result is a final cross section distribution with respect to Z and N for the actinide products. 68 refs., 33 figs., 6 tabs

  9. Association of the PPP3CA c.249G>A variant with clinical outcomes of tacrolimus-based therapy in kidney transplant recipients

    Directory of Open Access Journals (Sweden)

    Salgado PC

    2017-03-01

    Full Text Available Patricia C Salgado,1 Fabiana DV Genvigir,1 Claudia R Felipe,2 Helio Tedesco-Silva Jr,2 Jose O Medina-Pestana,2 Sonia Q Doi,3 Mario H Hirata,1 Rosario DC Hirata1 1Department of Clinical and Toxicological Analysis, School of Pharmaceutical Sciences, University of Sao Paulo, 2Division of Nephrology, Hospital do Rim, Federal University of Sao Paulo, Sao Paulo, Brazil; 3School of Medicine, Uniformed Services University of the Health Sciences, Bethesda, MD, USA Background: The effects of genetic variants related to the pharmacodynamic mechanisms of immunosuppressive drugs on their therapeutic efficacy and safety have been poorly explored. This study was performed to investigate the influence of the PPP3CA c.249G>A variant on the clinical outcomes of kidney transplant recipients. Patients and methods: A total of 148 Brazilian patients received tacrolimus (TAC-based immunosuppressive therapy for 90 days post-kidney transplantation. The PPP3CA rs3730251 (c.249G>A polymorphism was determined by real-time polymerase chain reaction. Single-nucleotide polymorphism (SNP data for CYP3A5 rs776746 (CYP3A5*3C; g.6986A>G were used to eliminate the confounding effects of this variant. Results: The PPP3CA c.249G>A SNP did not influence early TAC exposure, renal function, or other laboratory parameters, including levels of urea, creatinine, glucose, and lipids, and blood counts. This variant also did not account for the cumulative incidence of biopsy-confirmed acute rejection or delayed graft function. Regarding adverse events, PPP3CA c.249A allele carriers initially had a 3.05-fold increased probability of treatment-induced blood and lymphatic system disorders compared with c.249GG genotype individuals (95% confidence interval: 1.10–8.48, p=0.032. However, this result was not maintained after adjusting for body weight and CYP3A5*3C SNP status (p=0.086. Conclusion: The PPP3CA c.249G>A variant does not influence the clinical outcomes of Brazilian patients in the

  10. 17 CFR 249.821 - Form PILOT, information required of self-regulatory organizations operating pilot trading systems...

    Science.gov (United States)

    2010-04-01

    ... required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this... Associations § 249.821 Form PILOT, information required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this chapter. This form shall be used by all self-regulatory...

  11. Evaluation of anticancer properties of a new α-methylene-δ-lactone DL-249 on two cancer cell lines

    Directory of Open Access Journals (Sweden)

    Pomorska Dorota K.

    2017-06-01

    Full Text Available The anticancer activity of a new synthetic α-methylene-δ-lactone DL-249 was reported in leukemia HL-60 and breast cancer MCF-7 cells and compared with the activity of a natural α-methylene-γ-lactone from Tanacetum parthenium, parthenolide.

  12. 17 CFR 249.635 - Form X-17A-19, report by national securities exchanges and registered national securities...

    Science.gov (United States)

    2010-04-01

    ... national securities exchanges and registered national securities associations of changes in the membership... Certain Exchange Members, Brokers, and Dealers § 249.635 Form X-17A-19, report by national securities exchanges and registered national securities associations of changes in the membership status of any of...

  13. Nuclear data sheets for (odd-A) A = 249 through A = 263

    International Nuclear Information System (INIS)

    Schmorak, M.R.

    1976-01-01

    The available experimental data pertaining to the nuclear structure of nuclei with odd mass numbers A = 249 through 263 are compiled (the even-A mass chains were published in March 1976). The results from various decay and reaction measurements, as available through February 1976, are compared and evaluated and alpha-hindrance factors are calculated (see Table 2); syst refers to systematics values: in the case of SF a rough order of magnitude estimate of T/sub 1/2/(SF) was made in a manner similar to that of 73Ra38, T/sub 1/2/(α) syst were obtained as in 72E1Sc, and Q-values from systematics were obtained in a manner similar to that of 71WaGo

  14. Comparative Studies on microstructure, mechanical and corrosion behaviour of DMR 249A Steel and its welds

    Science.gov (United States)

    Mohammed, Raffi; Dilkush; Madhusudhan Reddy, G.; Srinivasa Rao, K.

    2018-03-01

    DMR249A Medium strength (low carbon) Low-alloy steels are used as structural components in naval applications due to its low cost and high availability. An attempt has been made to weld the DMR 249A steel plates of 8mm thickness using shielded metal arc welding (SMAW) and gas tungsten arc welding (GTAW). Welds were characterized for metallography to carry out the microstructural changes, mechanical properties were evaluated using vickers hardness tester and universal testing machine. Potentio-dynamic polarization tests were carried out to determine the pitting corrosion behaviour. Constant load type Stress corrosion cracking (SCC) testing was done to observe the cracking tendency of the joints in a 3.5%NaCl solution. Results of the present study established that SMA welds resulted in formation of relatively higher amount of martensite in ferrite matrix when compared to gas tungsten arc welding (GTAW). It is attributed to faster cooling rates achieved due to high thermal efficiency. Improved mechanical properties were observed for the SMA welds and are due to higher amount of martensite. Pitting corrosion and stress corrosion cracking resistance of SMA welds were poor when compared to GTA welds.

  15. 75 FR 19880 - Safety Zone; BW PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico

    Science.gov (United States)

    2010-04-16

    ... BW PIONEER, a Floating Production, Storage and Offloading (FPSO) system, at Walker Ridge 249 in the Outer Continental Shelf. The purpose of the safety zone is to protect the FPSO from vessels operating... reduces the threat of allisions, oil spills, and releases of natural gas, and thereby protects the safety...

  16. Dynamics of Db isotopes formed in reactions induced by 238U, 248Cm, and 249Bk across the Coulomb barrier

    Science.gov (United States)

    Kaur, Gurjit; Sandhu, Kirandeep; Kaur, Amandeep; Sharma, Manoj K.

    2018-05-01

    The dynamical cluster decay model is employed to investigate the decay of *265Db and *267Db nuclei, formed in the 27Al+238U , 18O+249Bk , and 19F+248Cm hot fusion reactions at energies around the Coulomb barrier. First, the fission dynamics of the 27Al+238U reaction is explored by investigating the fragmentation and preformation yield of the reaction. The symmetric mass distribution of the fission fragments is observed for *265Db nucleus, when static β2 i deformations are used within hot optimum orientation approach. However, the mass split gets broaden for the use of β2 i-dynamical hot configuration of the fragments and becomes clearly asymmetric for the cold-static-deformed approach. Within the application of cold orientations of fragments, a new fission channel is observed at mass asymmetry η =0.29 . In addition to 238U-induced reaction, the work is carried out to address the fission and neutron evaporation cross sections of *267Db nucleus formed via 19F+248Cm and 18O+249Bk reactions, besides a comprehensive analysis of fusion and capture processes. Higher fusion cross sections and compound nucleus formation probabilities (PCN) are obtained for the 18O+249Bk reaction, as larger mass asymmetry in the entrance channel leads to reduced Coulomb factor. Finally, the role of sticking (IS) and nonsticking (INS) moments of inertia is analyzed for the 4 n and 5 n channels of *267Db nuclear system.

  17. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  18. 17 CFR 249.325 - Form 13F, report of institutional investment manager pursuant to section 13(f) of the Securities...

    Science.gov (United States)

    2010-04-01

    ... institutional investment manager pursuant to section 13(f) of the Securities Exchange Act of 1934. 249.325... manager pursuant to section 13(f) of the Securities Exchange Act of 1934. This form shall be used by institutional investment managers which are required to furnish reports pursuant to section 13(f) of the...

  19. Fibroblast Growth Factor Receptor 3 (FGFR3–Analyses of the S249C Mutation and Protein Expression in Primary Cervical Carcinomas

    Directory of Open Access Journals (Sweden)

    Haiyan Dai

    2001-01-01

    Full Text Available Fibroblast growth factor receptor 3 (FGFR3 seems to play an inhibitory role in bone development, as activating mutations in the gene underlie disorders such as achondroplasia and thanatophoric dysplasia. Findings from multiple myeloma (MM indicate that FGFR3 also can act as an oncogene, and mutation of codon 249 in the fibroblast growth factor receptor 3 (FGFR3 gene was recently detected in 3/12 primary cervical carcinomas. We have analysed 91 cervical carcinomas for this specific S249C mutation using amplification created restriction site methodology (ACRS, and detected no mutations. Immunohistochemistry was performed on 73 of the tumours. Reduced protein staining was seen in 43 (58.8% samples. Six of the tumours (8.2% revealed increased protein staining compared with normal cervical tissue. These patients had a better prognosis than those with reduced or normal levels, although not statistically significant. This report weakens the hypothesis of FGFR3 as an oncogene of importance in cervical carcinomas.

  20. GAO's Estimate of the Costs of the "Parental and Medical Leave Act of 1987" (S. 249). Testimony before the Subcommittee on Children, Families, Drugs, and Alcoholism, Committee on Labor and Human Resources, United States Senate.

    Science.gov (United States)

    Gainer, William J.

    The General Accounting Office (GAO) estimates that the cost of S.249, the Parental and Medical Leave Act of 1987, will be, at most, 500 million dollars annually, a figure which reflects the cost of continuing health insurance coverage for employees on unpaid leave. S.249 is legislation which aims to provide to workers at firms with 15 or more…

  1. 17 CFR 249.618 - Form BD-Y2K, information required of broker-dealers pursuant to section 17 of the Securities...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form BD-Y2K, information... Exchange Members, Brokers, and Dealers § 249.618 Form BD-Y2K, information required of broker-dealers... FR 37674, July 13, 1998] Editorial Note: For Federal Register citations affecting Form BD-Y2K, see...

  2. 17 CFR 249.619 - Form TA-Y2K, information required of transfer agents pursuant to section 17 of the Securities...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TA-Y2K, information... Certain Exchange Members, Brokers, and Dealers § 249.619 Form TA-Y2K, information required of transfer... affecting Form TA-Y2K, see the List of CFR Sections Affected, which appears in the Finding Aids section of...

  3. Synthesis of the isotopes of elements 118 and 116 in the 249Cf and 245Cm+48Ca fusion reactions

    International Nuclear Information System (INIS)

    Oganessian, Y T; Utyonkov, V K; Lobanov, Y V; Abdullin, F S; Polyakov, A N; Sagaidak, R N; Shirokovsky, I V; Tsyganov, Y S; Voinov, A A; Gulbekian, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Subotic, K; Zagrebaev, V I; Vostokin, G K; Itkis, M G; Moody, K J; . Patin, J B; Shaughnessy, D A; Stoyer, M A; Stoyer, N J; Wilk, P A; Kenneally, J M; Landrum, J H; Wild, J F; Lougheed, R W

    2006-01-01

    The decay properties of 290 116 and 291 116, and the dependence of their production cross sections on the excitation energies of the compound nucleus, 293 116, have been measured in the 245 Cm( 48 Ca,xn) 293-x 116 reaction. These isotopes of element 116 are the decay daughters of element 118 isotopes, which are produced via the 249 Cf+ 48 Ca reaction. They performed the element 118 experiment at two projectile energies, corresponding to 297 118 compound nucleus excitation energies of E* = 29.2 ± 2.5 and 34.4 ± 2.3 MeV. During an irradiation with a total beam dose of 4.1 x 10 19 48 Ca projectiles, three similar decay chains consisting of two or three consecutive α decays and terminated by a spontaneous fission (SF) with high total kinetic energy of about 230 MeV were observed. The three decay chains originated from the even-even isotope 294 118 (E α = 11.65 ± 0.06 MeV, T α = 0.89 -0.31 +1.07 ms) produced in the 3n-evaporation channel of the 249 Cf+ 48 Ca reaction with a maximum cross section of 0.5 -0.3 +1.6 pb

  4. Photo-induced effects of the virgin Ge_2_4_._9Sb_1_1_._6S_6_3_._5 film

    International Nuclear Information System (INIS)

    Knotek, P.; Tichy, L.; Kutalek, P.

    2015-01-01

    Amorphous Ge_2_4_._9Sb_1_1_._6S_6_3_._5 film was prepared through thermal evaporation. A blue shift of the optical band gap by approximately 100 meV was observed as a result of self-bleaching process of protected film aged for two years. The magnitude of the light induced blue shift of the optical band of the virgin film is primarily dependent on the light penetration depth and on the light intensity. The kinetics of photo-bleaching follows the stretch exponential function with a formal rate of bleaching depending on the light intensity while the saturated state is independent from the light intensity. The far infrared spectra indicate that ageing, illumination by over-band gap-photons and annealing of the virgin film are mainly accompanied by the film network ordering. Illumination by UV light photons led to a blue shift accompanied by the significant oxidation as evidenced by the results of the far infrared spectra and the energy dispersive analysis. - Highlights: • “Giant” photo-induced effects in virgin Ge_2_4_._9Sb_1_1_._6S_6_3_._5 film • The role of the film thickness, the wavelengths and intensity of excitation photons • The changes of the photo-sensitivity due to the self-ageing process • The high-intensity illumination (> 10 W/cm"2) led to the different processes

  5. Photo-induced effects of the virgin Ge{sub 24.9}Sb{sub 11.6}S{sub 63.5} film

    Energy Technology Data Exchange (ETDEWEB)

    Knotek, P., E-mail: petr.knotek@upce.cz [University of Pardubice, Faculty of Chemical Technology, Department of General and Inorganic Chemistry, Studentska 573, 532 10 Pardubice (Czech Republic); Tichy, L. [Institute of Macromolecular Chemistry, AS CR, Heyrovskeho sq. 2, 162 06 Prague (Czech Republic); Kutalek, P. [University of Pardubice, Faculty of Chemical Technology, Joint Laboratory of Solid State Chemistry of Institute of Macromolecular Chemistry of Academy of Sciences of the Czech Republic, v.v.i., and University of Pardubice, Studentska 573, 532 10 Pardubice (Czech Republic)

    2015-11-02

    Amorphous Ge{sub 24.9}Sb{sub 11.6}S{sub 63.5} film was prepared through thermal evaporation. A blue shift of the optical band gap by approximately 100 meV was observed as a result of self-bleaching process of protected film aged for two years. The magnitude of the light induced blue shift of the optical band of the virgin film is primarily dependent on the light penetration depth and on the light intensity. The kinetics of photo-bleaching follows the stretch exponential function with a formal rate of bleaching depending on the light intensity while the saturated state is independent from the light intensity. The far infrared spectra indicate that ageing, illumination by over-band gap-photons and annealing of the virgin film are mainly accompanied by the film network ordering. Illumination by UV light photons led to a blue shift accompanied by the significant oxidation as evidenced by the results of the far infrared spectra and the energy dispersive analysis. - Highlights: • “Giant” photo-induced effects in virgin Ge{sub 24.9}Sb{sub 11.6}S{sub 63.5} film • The role of the film thickness, the wavelengths and intensity of excitation photons • The changes of the photo-sensitivity due to the self-ageing process • The high-intensity illumination (> 10 W/cm{sup 2}) led to the different processes.

  6. Studies of neutron-deficient mendelevium isotopes at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)

    2010-01-15

    The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)

  7. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  8. 17 CFR 249.501a - Form BDW, notice of withdrawal from registration as broker-dealer pursuant to § 240.15b6-1, § 240...

    Science.gov (United States)

    2010-04-01

    ... withdrawal, except for social security account numbers, disclosure of which is voluntary. The information... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form BDW, notice of withdrawal... Offers § 249.501a Form BDW, notice of withdrawal from registration as broker-dealer pursuant to § 240...

  9. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  10. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015 : a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, Ryan M.; Bhutta, Zulfiqar A.; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Zian; Coates, Matthew M.; Coggeshall, Megan; Dandona, Lalit; Dicker, Daniel J.; Erskine, Holly E.; Ferrari, Alize J.; Fitzmaurice, Christina; Foreman, Kyle; Forouzanfar, Mohammad H.; Fraser, Maya S.; Pullman, Nancy; Gething, Peter W.; Goldberg, Ellen M.; Graetz, Nicholas; Haagsma, Juanita A.; Hay, Simon I.; Huynh, Chantal; Johnson, Catherine; Kassebaum, Nicholas J.; Kinfu, Yohannes; Kulikoff, Xie Rachel; Kutz, Michael; Kyu, Hmwe H.; Larson, Heidi J.; Leung, Janni; Liang, Xiaofeng; Lim, Stephen S.; Lind, Margaret; Lozano, Rafael; Marquez, Neal; Mensah, George A.; Mikesell, Joe; Mokdad, Ali H.; Mooney, Meghan D.; Nguyen, Grant; Nsoesie, Elaine; Pigott, David M.; Amare, Azmeraw T.; Hoek, Hans W.; Singh, Abhishek; Tura, Abera Kenay

    2016-01-01

    Background Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249 causes

  11. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980–2015: a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, R.M.; Bhutta, Zulfiqar; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Z.; Coates, M.; Geleijnse, J.M.

    2016-01-01

    Background
    Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249

  12. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  13. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  14. Eleven new heaviest isotopes of elements Z=105 to Z=117 identified among the products of 249Bk+48Ca reactions

    International Nuclear Information System (INIS)

    Oganessian, Yu. Ts.; Abdullin, F. Sh.; Dmitriev, S. N.; Itkis, M. G.; Lobanov, Yu. V.; Mezentsev, A. N.; Polyakov, A. N.; Sagaidak, R. N.; Shirokovsky, I. V.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu. S.; Utyonkov, V. K.; Voinov, A. A.; Vostokin, G. K.; Bailey, P. D.; Benker, D. E.; Ezold, J. G.; Porter, C. E.; Riley, F. D.

    2011-01-01

    The heaviest isotopes of elements Z=117 to Z=105, 294 117, 293 117, 290 115, 289 115, 286 113, 285 113, 282 Rg, 281 Rg, 278 Mt, 274 Bh, and 270 Db, were identified by means of the Dubna gas-filled recoil separator among the products of the 249 Bk + 48 Ca reaction. The details of the observed six decay chains, indicating the production and decay of isotopes 293 117 and 294 117, are presented and discussed. The decay energies and resulting half-lives of these new nuclei show a strong rise of stability with increasing neutron number, validating the concept of the island of enhanced stability for superheavy nuclei [Oganessian et al., Phys. Rev. Lett. 104, 142502 (2010)].

  15. Radiosensibility curve with 60 Co in guinea grass (Panicum maximum Jacq.) cv. 'K-249'

    International Nuclear Information System (INIS)

    Lajonchere, G.; Mesa, A.R.; Prieto, M.; Sánchez-Quiroz, E.

    1995-01-01

    In order to select the adequate radiosensibility criterion and useful dosis were studied the effects of gamma radiation on the embryogenic callus of guinea cv. K-249. The application dosages were 0, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300 and 400 Gy and the measures evaluated were: increase of fresh mass of the callus in fresh medium, number of shoots, plantlets and total by callus and by gram of callus in regeneration medium. It was determined that the curves shaped with the number of shoots, plantlets and total by callus and by gram of callus were more radiosensible than that shoped with increase of fresh mass of the callus; as criterion of radiosensibility in this cultivar the total number of shoots and plantlets from gram of callus was selected for it's simplicity and veracity as much as in the evaluation and in the results. The useful dosis that determined one GR 10, 20, 50 and 70 percent were 16, 20, 29 and 160 Gy respectively. Albino shoots were also observed whose values were randomizely showed and it was observed albinism in 0 dosis. (author) [es

  16. Modified model of neutron resonances widths distributions. Results of reduced neutron widths approximation for mass region 35 ≤ A ≤ 249

    International Nuclear Information System (INIS)

    Sukhovoj, A.M.; Khitrov, V.A.

    2011-01-01

    The distributions of the reduced neutron widths of s-, p- and d-resonances of nuclei of any type from nuclear mass region 35 ≤ A ≤ 249 were approximated with maximal precision by the model which presents experimental data set as a superposition of a maximum of four independent neutron amplitudes. Under the assumption that each of these amplitudes has the Gauss distribution with the unique maximum there were determined the most probable values of contribution of each amplitude in summary width distribution, their most probable mean values and dispersions. Comparison of the obtained χ 2 values with value χ 2 at description of the experimental data by one distribution of neutron amplitudes with best fitted parameters shows that all widths from more than 157 analyzed data sets can have different types of wave functions

  17. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families

    DEFF Research Database (Denmark)

    Hansen, Thomas van Overeem; Jønson, Lars; Albrechtsen, Anders

    2010-01-01

    Germ-line mutations in the tumour suppressor proteins BRCA1 and BRCA2 predispose to breast and ovarian cancer. We have recently identified a Greenlandic Inuit BRCA1 nucleotide 234T>G/c.115T>G (p.Cys39Gly) founder mutation, which at that time was the only disease-causing BRCA1/BRCA2 mutation...... identified in this population. Here, we describe the identification of a novel disease-causing BRCA1 nucleotide 4803delCC/c.4684delCC mutation in a Greenlandic Inuit with ovarian cancer. The mutation introduces a frameshift and a premature stop at codon 1572. We have also identified a BRCA1 nucleotide 249T......>A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  18. Splenic masses in dogs. Part 1: Epidemiologic, clinical characteristics as well as histopathologic diagnosis in 249 cases (2000-2011).

    Science.gov (United States)

    Eberle, N; von Babo, V; Nolte, I; Baumgärtner, W; Betz, D

    2012-01-01

    Splenic masses have a high prevalence and are more common than diffuse splenic enlargement in dogs. It was the aim of the present study to retrospectively describe clinical aspects and histopathologic characteristics of dogs with splenic masses. Records of patients with a histologically diagnosed splenic mass between January 2000 and March 2011 were reviewed. 249 dogs met the inclusion criteria and could be included in the study. Splenic masses were diagnosed histologically as non-malignant disease (n=117; 47%) and malignant splenic disease (n=132; 53%). Hemangiosarcoma was the most common histological diagnosis (n=97; 73.5%). Other malignant tumors included sarcoma (n=14), fibrohistiocytic nodules (n=9) as well as lymphoma, blastoma and adenocarcinoma. The non-malignant masses consisted of nodular hyperplasia (n=60), splenic hematoma (n=41), and splenitis (n=6). Dogs with hemoperitoneum had a higher frequency of splenic neoplasia. The results corroborate previous findings that hemangiosarcoma is the most frequent neoplasm of the canine spleen. However, in approximately half of the cases benign lesions were histologically diagnosed. It is essential that a frank discussion is held with owners regarding the prognosis associated with the treatment of dogs with a splenic mass associated with hemoperitoneum.

  19. 48Ca+249Bk fusion reaction leading to element Z = 117: long-lived α-decaying 270Db and discovery of 266Lr.

    Science.gov (United States)

    Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Asai, M; Block, M; Boll, R A; Brand, H; Cox, D M; Dasgupta, M; Derkx, X; Di Nitto, A; Eberhardt, K; Even, J; Evers, M; Fahlander, C; Forsberg, U; Gates, J M; Gharibyan, N; Golubev, P; Gregorich, K E; Hamilton, J H; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hinde, D J; Hoffmann, J; Hollinger, R; Hübner, A; Jäger, E; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Laatiaoui, M; Lahiri, S; Lang, R; Lommel, B; Maiti, M; Miernik, K; Minami, S; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Pang, G K; Papadakis, P; Renisch, D; Roberto, J; Rudolph, D; Runke, J; Rykaczewski, K P; Sarmiento, L G; Schädel, M; Schausten, B; Semchenkov, A; Shaughnessy, D A; Steinegger, P; Steiner, J; Tereshatov, E E; Thörle-Pospiech, P; Tinschert, K; Torres De Heidenreich, T; Trautmann, N; Türler, A; Uusitalo, J; Ward, D E; Wegrzecki, M; Wiehl, N; Van Cleve, S M; Yakusheva, V

    2014-05-02

    The superheavy element with atomic number Z=117 was produced as an evaporation residue in the (48)Ca+(249)Bk fusion reaction at the gas-filled recoil separator TASCA at GSI Darmstadt, Germany. The radioactive decay of evaporation residues and their α-decay products was studied using a detection setup that allowed measuring decays of single atomic nuclei with half-lives between sub-μs and a few days. Two decay chains comprising seven α decays and a spontaneous fission each were identified and are assigned to the isotope (294)117 and its decay products. A hitherto unknown α-decay branch in (270)Db (Z = 105) was observed, which populated the new isotope (266)Lr (Z = 103). The identification of the long-lived (T(1/2) = 1.0(-0.4)(+1.9) h) α-emitter (270)Db marks an important step towards the observation of even more long-lived nuclei of superheavy elements located on an "island of stability."

  20. Characteristic of metallic state preperties of mendelevium and other actinoids by thermochcomatography

    International Nuclear Information System (INIS)

    Hubener, S.; Zvara, I.

    1982-01-01

    The adsorption of the heavy actinoids Cf, Es, Fm, and Md on polycrystalline titanium and molybdenum has been studied by thermochromatography in comparison with several well-known metallic elements, in trace amounts. The data lead us to suggest that Es, Fm, and Md are divalent in the metallic state and, moreover, that the position of their f energy levels relativg to the Fermi-energy is lower than in the cases of Cf and Yb. A correlation was found between the experimental enthalpies of adsorption of the heavy actinoids and their predicted enthalpies of sublimation

  1. Low-threshold stimulated emission at 249 nm and 256 nm from AlGaN-based multiple-quantum-well lasers grown on sapphire substrates

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiao-Hang; Detchprohm, Theeradetch; Kao, Tsung-Ting; Satter, Md. Mahbub; Shen, Shyh-Chiang; Douglas Yoder, P.; Dupuis, Russell D., E-mail: dupuis@gatech.edu [Center for Compound Semiconductors and School of Electrical and Computer Engineering, Georgia Institute of Technology, Atlanta, Georgia 30332-0250 (United States); Wang, Shuo; Wei, Yong O.; Xie, Hongen; Fischer, Alec M.; Ponce, Fernando A. [Department of Physics, Arizona State University, Tempe, Arizona 85287-1504 (United States); Wernicke, Tim; Reich, Christoph; Martens, Martin; Kneissl, Michael [Technical University of Berlin, Institute for Solid State Physics, Berlin D-10623 (Germany)

    2014-10-06

    Optically pumped deep-ultraviolet (DUV) lasing with low threshold was demonstrated from AlGaN-based multiple-quantum-well (MQW) heterostructures grown on sapphire substrates. The epitaxial layers were grown pseudomorphically by metalorganic chemical vapor deposition on (0001) sapphire substrates. Stimulated emission was observed at wavelengths of 256 nm and 249 nm with thresholds of 61 kW/cm{sup 2} and 95 kW/cm{sup 2} at room temperature, respectively. The thresholds are comparable to the reported state-of-the-art AlGaN-based MQW DUV lasers grown on bulk AlN substrates emitting at 266 nm. These low thresholds are attributed to the optimization of active region and waveguide layer as well as the use of high-quality AlN/sapphire templates. The stimulated emission above threshold was dominated by transverse-electric polarization. This work demonstrates the potential candidacy of sapphire substrates for DUV diode lasers.

  2. Low-threshold stimulated emission at 249 nm and 256 nm from AlGaN-based multiple-quantum-well lasers grown on sapphire substrates

    International Nuclear Information System (INIS)

    Li, Xiao-Hang; Detchprohm, Theeradetch; Kao, Tsung-Ting; Satter, Md. Mahbub; Shen, Shyh-Chiang; Douglas Yoder, P.; Dupuis, Russell D.; Wang, Shuo; Wei, Yong O.; Xie, Hongen; Fischer, Alec M.; Ponce, Fernando A.; Wernicke, Tim; Reich, Christoph; Martens, Martin; Kneissl, Michael

    2014-01-01

    Optically pumped deep-ultraviolet (DUV) lasing with low threshold was demonstrated from AlGaN-based multiple-quantum-well (MQW) heterostructures grown on sapphire substrates. The epitaxial layers were grown pseudomorphically by metalorganic chemical vapor deposition on (0001) sapphire substrates. Stimulated emission was observed at wavelengths of 256 nm and 249 nm with thresholds of 61 kW/cm 2 and 95 kW/cm 2 at room temperature, respectively. The thresholds are comparable to the reported state-of-the-art AlGaN-based MQW DUV lasers grown on bulk AlN substrates emitting at 266 nm. These low thresholds are attributed to the optimization of active region and waveguide layer as well as the use of high-quality AlN/sapphire templates. The stimulated emission above threshold was dominated by transverse-electric polarization. This work demonstrates the potential candidacy of sapphire substrates for DUV diode lasers.

  3. A worked example using the SP249 advanced assessment route: the carregado unit 6 final superheater outlet header

    Energy Technology Data Exchange (ETDEWEB)

    Brear, J.M.; Jarvis, P.; Jones, G.T. [ERA Technology (United Kingdom); Jovanovic, A.S.; Friemann, M.; Kluttig, B.; Ober, M. [Stuttgart Univ. (Germany). Staatliche Materialpruefungsanstalt; Batista, A. [EDP-PROET (Portugal); Araujo, C.L. de; Pires, A. [ISQ (Portugal)

    1995-12-31

    As a key part of its information resource, the SP249 Project contains a number of case studies, drawn from the collective experience of the partners and from the literature. The user of the system may search this data-base by component type and material or by assessment method, to find a practical example close to his own current problem. He can thus draw upon past experience as well as state-of-the-art knowledge to obtain advice. To facilitate this, a set of key-words has been defined to create links between the case studies and the overall assessment methodology. These relate to damage and failure types and causes as well as to techniques of investigation and assessment. For demonstration, validation and didactic purposes, certain of these case studies - one per end-user utility in the project - have been chosen for full elaboration as `worked-examples`. These real component evaluations are worked through by an expert group from the project team so as to provide the utility staff with `hands-on` training in both the practical techniques of component life. The assessment and the use of the knowledge based system. The exercise also provides valuable opportunity for feedback, allowing refinement of the technology package and the software. Amongst these worked examples, an assessment of EDP`s Carregado Unit 6 Final Superheater Outlet Header has been chosen for special attention - as the operators have kindly allowed direct CSS to the component during two outages. This article summarises the Carregado Case Study. It is intended to serve as a demonstration and as to how the Advanced Assessment Route (AAR) is used in practice. The actions performed and results obtained are summarised

  4. Health Disparities in the Relationship of Neighborhood Greenness to Mental Health Outcomes in 249,405 U.S. Medicare Beneficiaries

    Directory of Open Access Journals (Sweden)

    Scott C. Brown

    2018-03-01

    Full Text Available Prior studies suggest that exposure to the natural environment may be important for optimal mental health. The present study examines the association between block-level greenness (vegetative presence and mental health outcomes, in a population-based sample of 249,405 U.S. Medicare beneficiaries aged ≥65 years living in Miami-Dade County, Florida, USA, whose location did not change from 2010 to 2011. Multilevel analyses examined relationships between greenness, as measured by mean Normalized Difference Vegetation Index from satellite imagery at the Census block level, and each of two mental health outcomes; Alzheimer’s disease and depression, respectively, after statistically adjusting for age, gender, race/ethnicity, and neighborhood income level of the individuals. Higher block-level greenness was linked to better mental health outcomes: There was a reduced risk of Alzheimer’s disease (by 18% and depression (by 28% for beneficiaries living in blocks that were 1 SD above the mean for greenness, as compared to blocks that were 1 SD below the mean. Planned post-hoc analyses revealed that higher levels of greenness were associated with even greater mental health benefits in low-income neighborhoods: An increase in greenness from 1 SD below to 1 SD above the mean was associated with 37% lower odds of depression in low-income neighborhoods, compared to 27% and 21% lower odds of depression in medium- and high-income neighborhoods, respectively. Greenness may be effective in promoting mental health in older adults, particularly in low-income neighborhoods, possibly as a result of the increased opportunities for physical activity, social interaction, or stress mitigation.

  5. The Modified Bentall Procedure: A Single-Institution Experience in 249 Patients with a Maximum Follow Up of 21.5 Years.

    Science.gov (United States)

    Celiento, Michele; Ravenni, Giacomo; Margaryan, Rafik; Ferrari, Gabriele; Blasi, Stefania; Pratali, Stefano; Bortolotti, Uberto

    2016-07-01

    The study aim was to evaluate the long-term clinical outcomes of the modified Bentall procedure (MBP) with a mechanical conduit. Between 1993 and 2014, a total of 249 patients (mean age 62 ± 12 years; range: 25-87 years) underwent a MBP at the authors' institution. The main indication was annuloaortic ectasia in 102 patients (41%), followed by acute aortic dissection in 82 patients (33%); moderate to severe aortic regurgitation was present in 79% of cases. A bicuspid aortic valve was found in 17% of patients, and Marfan syndrome in 7%. The mean NYHA functional class was 2.5 ± 1.1. Concomitant procedures were performed in 36 patients (14%). The mean follow up was 8.7 ± 5.0 years (range: 0.3-21.5 years) and was 99% complete. The total follow up was 6.475 patient-years (pt-yr). Operative mortality was 3% in elective cases. Age, prolonged cardiopulmonary bypass times and mechanical ventilation >96 h were independent risk factors for early mortality. Actuarial survival at 15 and 20 years was 62% and 60%, respectively. Risk factors for late mortality were age and emergency operation. Actuarial freedom from thromboembolism (linearized incidence 0.93%/pt-yr) was 82% at 15 years, and 74% at 20 years. Seven patients required reoperation (0.38%/pt-yr), with an actuarial freedom from reoperation of 91% at 15 years and 87% at 20 years. The incidence of overall valve-related complications was 0.32%/pt-yr, with actuarial freedoms of 94% at 15 and 20 years. The MBP has shown excellent long-term results with a low incidence of procedure-related complications up to 20 years postoperatively. For this reason, it is considered to be a valid option for the treatment of aortic root disease, whenever valvesparing procedures are not indicated.

  6. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1995-01-01

    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  7. ¿Serían la Guardia, Tutela y Curatela Bienes Jurídicos Penales? Un Análisis Crítico de los Arts. 248 y 249 del CP a la Luz de la Exclusiva Protección de Bienes Jurídicos

    Directory of Open Access Journals (Sweden)

    Gerson Faustino Rosa

    2015-12-01

    Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.

  8. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VII) HFODD (v2.49t): A new version of the program

    International Nuclear Information System (INIS)

    Schunck, Nicolas F.; McDonnell, J.; Sheikh, J.A.; Staszczak, A.; Stoitsov, Mario; Dobaczewski, J.; Toivanen, P.

    2012-01-01

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme Hartree-Fock (HF) or Skyrme Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite temperature formalism for the HFB and HF+BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected.

  9. 7 CFR 249.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... financial instrument by which benefits under the program are transferred to program participants. Days means... as prunes (dried plums), raisins (dried grapes), sun-dried tomatoes, or dried chili peppers are not... eligibility requirements of the SFMNP and to whom coupons or equivalent benefits have been issued. Program or...

  10. 32 CFR 249.5 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... the requirements of national security. Interaction among concerned parties should commence at least... meeting organization include, but are not limited to, proprietary data, export-controlled data, Privacy... information, privacy data, and foreign government-provided data requires approval of the party controlling...

  11. 32 CFR 249.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... engineering performed under contract or grant at colleges, universities, and non-government laboratories is... government have established an understanding or agreement in that specific scientific or technical area. (h...-controlled, proprietary, privacy, and foreign government provided information. (e) Provide timely review of...

  12. Publications | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...

  13. 7 CFR 249.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... State Plan or amendment within 30 days of receipt. Portions of the State Plan that do not change... organizations for services such as certification of eligible participants, issuance of SFMNP coupons or benefits... provided. (14) A detailed description of the State agency's system for managing its coupon, market, and CSA...

  14. 7 CFR 249.6 - Participant eligibility.

    Science.gov (United States)

    2010-01-01

    ... participation in the SFMNP in a language other than English, reasonable steps must be taken to provide this... have provided for my eligibility determination is correct, to the best of my knowledge. This... solely because of lack of sufficient funding to provide SFMNP benefits to all eligible applicants. (5...

  15. 249-IJBCS-Article-Dr Adomou Aristide

    African Journals Online (AJOL)

    Dr Gatsing

    MPE and Traoré D (eds). CAB. International: UK and Cambridge; 19-39. INSAE 2002. Troisième recensement général de la population et de l'habitat. Résultats définitifs: Tableaux statistiques Cotonou,. Bénin, 4p. Lebrun J, Gilbert G. 1954. Une classification écologique des forêts du Congo. Publ. I.N.E.A.C., sér. Sc., 63: 89.

  16. 25 CFR 249.3 - Identification cards.

    Science.gov (United States)

    2010-04-01

    ... the issuance of an appropriate identification card to any Indian entitled thereto as prima facie... any Federal, State, or tribal enforcement officer shall be prima facie evidence that the person is not...

  17. 7 CFR 249.26 - SFMNP information.

    Science.gov (United States)

    2010-01-01

    ..., Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee: U.S. Department of.... (b) Inquiries pertaining to the SFMNP administered by a federally recognized Indian tribal...

  18. Nuclear spectroscopic study of the 117In and 77Se using angular correlation technique

    International Nuclear Information System (INIS)

    Zamboni, C.B.

    1981-01-01

    The integral pertubed angular correlation technique has been used to measure the g-factor of the 587 KeV(3/2 - ) state in 117 In. The measurements were made in an external magnetic field of 26 Kg. The 1303-273 KeV gamma cascade in 117 In populated from the beta decay of 117 Cd was utilized for the measurement. The result is g(587 KeV) = -0.233+-0.057. The present result shows the 587 KeV state may not be a simple P 3/2 proton hole state but rather a complex admixture of different configurations. The g-factor of the 249 KeV state in 77 Se has also been measured by the time differential pertubed angular correlation (TDPAC) method in an external magnetic field of 25 Kg. The 755-249 KeV gamma cascade in 77 Se populated from the electron capture decay of 57h 77 Br utilized for the measurement. The g-factor is determined to be g(249 KeV) = 0.486 +- 0.009. In addition the half life of the 249 KeV state in 77 Se has also been measured by the delayed gamma-gamma coincidence method utilizing the gamma cascades 572-249 KeV and 750-249 KeV in 77 Se. The resulting value of the half life is T 1/2 (249 KeV) = (9.56 +- 0.10)ns. The experimental results are discussed in terms of nuclear models applicable for nuclei in this mass region. (author) [pt

  19. Gclust Server: 76570 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 76570 HSA_8923040 Cluster Sequences Related Sequences(249) 580 NP_060102.1 collabor...elated sequences Related Sequences(249) Sequence length 580 Representative annotation NP_060102.1 collabor

  20. Gclust Server: 91733 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 91733 Vvy_VV2382 Cluster Sequences Related Sequences(249) 452 cadaverine/lysine ant...er sequences Cluster Sequences Link to related sequences Related Sequences(249) Sequence length 452 Representative annotation cadaver

  1. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis.. (VII) HFODD (v2.49t): A new version of the program

    Science.gov (United States)

    Schunck, N.; Dobaczewski, J.; McDonnell, J.; Satuła, W.; Sheikh, J. A.; Staszczak, A.; Stoitsov, M.; Toivanen, P.

    2012-01-01

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme-Hartree-Fock (HF) or Skyrme-Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite-temperature formalism for the HFB and HF + BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex-breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected. New version program summaryProgram title:HFODD (v2.49t) Catalogue identifier: ADFL_v3_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADFL_v3_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GNU General Public Licence v3 No. of lines in distributed program, including test data, etc.: 190 614 No. of bytes in distributed program, including test data, etc.: 985 898 Distribution

  2. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  3. Medusae from the sea around Laccadive group of islands (7 degrees-18 degrees N/69 degrees-76 degrees E)

    Digital Repository Service at National Institute of Oceanography (India)

    Santhakumari, V.

    stream_size 7 stream_content_type text/plain stream_name 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_249.pdf.txt stream_source_info 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_249.pdf.txt Content-Encoding ISO-8859...

  4. Roman for unge - og deres voksne - fra Nick Hornby

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2007-01-01

    Nick Hornby: SLAM. Oversat fra engelsk. af Jan Hansen. 280 sider, 249 kr. Lindhardt og Ringhof. Fire stjerner Udgivelsesdato: 071207......Nick Hornby: SLAM. Oversat fra engelsk. af Jan Hansen. 280 sider, 249 kr. Lindhardt og Ringhof. Fire stjerner Udgivelsesdato: 071207...

  5. CX3CR1 is a modifying gene of survival and progression in amyotrophic lateral sclerosis.

    Directory of Open Access Journals (Sweden)

    Alan Lopez-Lopez

    Full Text Available The objective of this study was to investigate the association of functional variants of the human CX3CR1 gene (Fractalkine receptor with the risk of Amyotrophic Lateral Sclerosis (ALS, the survival and the progression rate of the disease symptoms in a Spanish ALS cohort. 187 ALS patients (142 sporadic [sALS] and 45 familial and 378 controls were recruited. We investigated CX3CR1 V249I (rs3732379 and T280M (rs3732378 genotypes and their haplotypes as predictors of survival, the progression rate of the symptoms (as measured by ALSFRS-R and FVC decline and the risk of suffering ALS disease. The results indicated that sALS patients with CX3CR1 249I/I or 249V/I genotypes presented a shorter survival time (42.27 ± 4.90 than patients with 249V/V genotype (67.65 ± 7.42; diff -25.49 months 95%CI [-42.79,-8.18]; p = 0.004; adj-p = 0.018. The survival time was shorter in sALS patients with spinal topography and CX3CR1 249I alleles (diff =  -29.78 months; 95%CI [-49.42,-10.14]; p = 0.003. The same effects were also observed in the spinal sALS patients with 249I-280M haplotype (diff =  -27.02 months; 95%CI [-49.57, -4.48]; p = 0.019. In the sALS group, the CX3CR1 249I variant was associated with a faster progression of the disease symptoms (OR = 2.58; 95IC% [1.32, 5.07]; p = 0.006; adj-p = 0.027. There was no evidence for association of these two CX3CR1 variants with ALS disease risk. The association evidenced herein is clinically relevant and indicates that CX3CR1 could be a disease-modifying gene in sALS. The progression rate of the disease's symptoms and the survival time is affected in patients with one or two copies of the CX3CR1 249I allele. The CX3CR1 is the most potent ALS survival genetic factor reported to date. These results reinforce the role of the immune system in ALS pathogenesis.

  6. Strategic tariff protection, market conduct, and government commitment levels in developing economies

    Czech Academy of Sciences Publication Activity Database

    Ionascu, D.; Žigić, Krešimir

    -, č. 249 (2005), s. 1-43 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : optimal tariff protection * government non-commitment regime * symmetric versus asymmetric information Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp249.pdf

  7. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  8. 249 Marriage Counselling in Multicultural Society, Nigerian ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... The researcher sees Multicultural Counselling as a helping relationship, which involves two or more ... pastors and elders in the counselling profession. Some recommendations were made as ... Multicultural counselling is a helping relationship which involves two or more persons with different culture, ...

  9. 48 CFR 53.249 - Termination of contracts.

    Science.gov (United States)

    2010-10-01

    ....6: (1) SF 1034 (GAO), Public Voucher for Purchases and Services Other Than Personal. (See 49.302(a... Proposal for Cost-Reimbursement Type Contracts. (See 49.602-1(c) and 49.302.) Standard Form 1437 is... for Partial Payment. (See 49.602-4.) Standard Form 1440 is authorized for local reproduction and a...

  10. 48 CFR 52.249-14 - Excusable Delays.

    Science.gov (United States)

    2010-10-01

    ... under its terms if the failure arises from causes beyond the control and without the fault or negligence... each instance, the failure to perform must be beyond the control and without the fault or negligence of... subcontractor, and without the fault or negligence of either, the Contractor shall not be deemed to be in...

  11. 7 CFR 249.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ... representatives of FNS of the Comptroller General of the United States to inspect, audit, and copy. Any reports... reports. State agencies must submit financial and SFMNP performance data on a yearly basis as specified by... programs. (c) Source documentation. To be acceptable for audit purposes, all financial and SFMNP...

  12. 7 CFR 249.20 - Claims and penalties.

    Science.gov (United States)

    2010-01-01

    ... assessed by FNS against the State agency. The State agency must pay promptly to FNS a sum equal to the... causes, the State agency must, on demand by FNS, pay to FNS a sum equal to the amount of the money or the... for payment of its debts or for offset of debts on its current Letter of Credit within 30 days from...

  13. 7 CFR 249.24 - Data safeguarding procedures.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... programs; and (2) Containing the receiving organization's assurance that it will not, in turn, disclose the information to a third party. (c) The Comptroller General of the United States for audit and examination...

  14. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.

    2008-01-01

    Roč. 275, podzim (2008), s. 249-249 ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  15. 77 FR 62273 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-10-12

    ... data requirement is to make financial information easier for investors to analyze and assist issuers in... Act of 1934 (15 U.S.C. 78a et seq.) to submit specified financial information to the Commission and... 249.240f and 17 CFR 249.306). In interactive data format, financial statement information could be...

  16. Evaluation of flooring produced from small diameters logs of Eucalyptus sp. clones

    Directory of Open Access Journals (Sweden)

    José Reinaldo Moreira da Silva

    2010-12-01

    Full Text Available This study evaluated two Eucalyptus clones, MN 249 and MN 89, for the flooring production using small diameters logs. It was considered the wood physical properties - NBR 7190/97 (ABNT, 1997 and simulation of the product in service (ASTM D 2394/83 with two thicknesses, 8 and 14 mm. The basic density of the clone 89 NM was the highest one (0,615 g/cm3. The contractions were more pronounced in clone NM 249, however, the anisotropy coefficient of this clone was small. In the simulation tests, the floor produced by clone MN 249 presented the lowest deformation rate. The floor of 8 mm, in addition to the differences between clones, there was significant interaction between the positions for the indentation test caused by loads applied in small areas. The deformations obtained for the floor with 14 mm thickness, produced with the MN clone 89, were higher than those found in the literature for the indentation load applied on a small area test. The clone MN 249 presented the best results in both thicknesses.

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 249 of 249 ... Vol 2, No 2 (1998), The place and recognition of socio-economic rights in ... Vol 20 (2016), The role of traditional leaders in Zimbabwe: are ... Vol 18 (2014), The SADC regional bloc: What challenges and prospects for regional integration? ... Vol 3, No 1 (1999), The TRIPS agreement and South African ...

  18. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249... to be disclosed by the investment company on Form N-CSR (§§ 249.331 and 274.128 of this chapter) and... include, without limitation, controls and procedures designed to ensure that information required to be...

  19. Pseudomonas cepacia adherence to respiratory epithelial cells is enhanced by Pseudomonas aeruginosa

    International Nuclear Information System (INIS)

    Saiman, L.; Cacalano, G.; Prince, A.

    1990-01-01

    Pseudomonas aeruginosa and Pseudomonas cepacia are both opportunistic pathogens of patients with cystic fibrosis. The binding characteristics of these two species were compared to determine if they use similar mechanisms to adhere to respiratory epithelial cells. P. cepacia 249 was shown to be piliated, but there was no detectable homology between P. aeruginosa pilin gene probes and P. cepacia genomic DNA. P. cepacia and P. aeruginosa did not appear to compete for epithelial receptors. In the presence of purified P. aeruginosa pili, the adherence of 35S-labeled strain 249 to respiratory epithelial monolayers was unaffected, while that of P. aeruginosa PAO1 was decreased by 55%. The binding of P. cepacia 249 and 715j was increased by 2.4-fold and 1.5-fold, respectively, in the presence of an equal inoculum of PAO1. Interbacterial agglutination contributed to the increased adherence of P. cepacia, as the binding of 249 was increased twofold in the presence of irradiated PAO1. PAO1 exoproducts had a marked effect in enhancing the ability of the P. cepacia strains to adhere to the epithelial monolayers. A PAO1 supernatant increased the binding of 249 by eightfold and that of 715j by fourfold. Thus, there appears to be a synergistic relationship between P. aeruginosa and P. cepacia in which PAO1 exoproducts modify the epithelial cell surface, exposing receptors and facilitating increased P. cepacia attachment

  20. Sphingomonas jatrophae sp. nov. and Sphingomonas carotinifaciens sp. nov., two yellow-pigmented endophytes isolated from stem tissues of Jatropha curcas L.

    Science.gov (United States)

    Madhaiyan, Munusamy; Alex, Tan Hian Hwee; Cho, Hayoung; Kim, Soo-Jin; Weon, Hang-Yeon; Kwon, Soon-Wo; Whitman, William B; Ji, Lianghui

    2017-12-01

    Two yellow-pigmented isolates, S5-249 T and L9-754 T , originating from surface-sterilized plant tissues of Jatropha curcas L. (Jatropha) cultivars were characterized using a polyphasic taxonomic approach. Strains S5-249 T and L9-754 T had 16S rRNA genes sharing 94.2 % sequence similarity with each other and 91.6-97.2 % sequence similarity with those of other species in the genus Sphingomonas, suggesting that they represent two potentially novel species. The 16S rRNA gene sequences of strains S5-249 T and L9-754 T shared the highest similarity to that of Sphingomonas sanguinis NBRC 13937 T (96.1 and 97.2 %, respectively). The genomic DNA G+C contents of strains S5-249 T and L9-754 T were 66.9 and 68.5 mol%, respectively. The respiratory quinone was determined to be Q-10, and the major polyamine was homospermidine. Strains S5-249 T and L9-754 T contained summed feature 7 (comprising C18 : 1ω7c, C18 : 1ω9t and/or C18 : 1ω12t), C16 : 1, C14 : 0 2-OH and summed feature 4 (C16 : 1ω7t, iso-C15 : 0 2-OH and C16 : 1ω7c) as the major cellular fatty acids. The predominant polar lipids were phosphatidylglycerol, diphosphatidylglycerol, phosphatidylethanolamine and sphingoglycolipid. The average nucleotide identity (ANI) values between S. sanguinis NBRC 13937 T and the two type strains (S5-249 T and L9-754 T ) were 72.31 and 77.73 %, respectively. Digital DNA-DNA hybridization (dDDH) studies between the novel strains (S5-249 T and L9-754 T ) and other species of the genus Sphingomonas were well below the thresholds used to discriminate between bacterial species. The results of dDDH and physiological tests allowed genotypic and phenotypic differentiation of the strains from each other as well as from the species of the genus Sphingomonas with validly published names. These data strongly support the classification of the strains as representatives of novel species, for which we propose the names Sphingomonas jatrophae sp. nov

  1. 17 CFR 270.30a-2 - Certification of Form N-CSR and Form N-Q.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certification of Form N-CSR... Form N-CSR and Form N-Q. (a) Each report filed on Form N-CSR (§§ 249.331 and 274.128 of this chapter) or Form N-Q (§§ 249.332 and 274.130 of this chapter) by a registered management investment company...

  2. 40 CFR 180.249 - Alachlor; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... seed 0.03 Cowpea, forage 5.0 Cowpea, hay 5.0 Egg 0.02 Goat, fat 0.02 Goat, meat byproducts 0.02 Goat, meat 0.02 Hog, fat 0.02 Hog meat byproducts 0.02 Hog, meat 0.02 Horse, fat 0.02 Horse, meat byproducts..., dry 0.1 Beans, succulent lima 0.1 Cattle, fat 0.02 Cattle, meat byproducts 0.02 Cattle, meat 0.02 Corn...

  3. 7 CFR 249.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ... address the deficiencies and prevent their future recurrence. (iii) If the corrective action plan is... needed. Compliance buys can be required if, during FNS management evaluations by regional offices, a...

  4. 7 CFR 2.49 - Administrator, Rural Housing Service.

    Science.gov (United States)

    2010-01-01

    ... housing disaster program under sections 232, 234, and 253 of the Disaster Relief Act of 1970 (Pub. L. No... title VI of the Robert T. Stafford Disaster Relief and Emergency Assistance Act (42 U.S.C. 5195 et seq... 116(a) of the Act (42 U.S.C. 9616(a)), with respect to preliminary assessment and site inspection of...

  5. The role of preoperative serum cancer antigen 125 in malignant ovarian germ cell tumors

    Directory of Open Access Journals (Sweden)

    Ju-Hyun Kim

    2018-04-01

    Full Text Available Objective: To determine the role of preoperative serum cancer antigen 125 (CA 125 in malignant ovarian germ cell tumors (MOGCTs. Materials and methods: Using information from medical databases of Asan Medical Center (Seoul, Korea, we investigated 161 patients with histologically diagnosed MOGCTs and whose preoperative serum CA 125 had been checked. We determined the optimal cutoff value of CA 125 as > 249.5 U/mL in MOGCTs using a receiver operating characteristic curve. Results: The median patient age was 24 years (range, 6–52 years. The most common histologic type was immature teratoma. Most patients had stage I disease. Thirty-two patients (19.9% had elevated preoperative serum CA 125 levels over 249.5 U/mL. On univariate analysis, tumor size, advanced stage, the presence of ascites, ovarian surface involvement, and tumor rupture were significantly associated with elevated preoperative CA 125 levels (>249.5 U/mL. In the median follow-up time of 87 months (range, 9–271 months, 14 patients had a recurrence, and 5 died of the disease. Patients with an elevated serum preoperative CA 125 level (>249.5 U/mL had poorer disease-free survival, but this was not statistically significant. However, elevated preoperative CA 125 (>249.5 U/mL was significantly associated with poorer overall survival. Conclusions: Elevated preoperative serum CA 125 may have prognostic value in patients with MOGCTs. Keywords: CA-125 antigen, Ovarian germ cell cancer, Prognosis

  6. Factors affecting haematological indices in free-living fish populations

    Czech Academy of Sciences Publication Activity Database

    Lusková, Věra

    1998-01-01

    Roč. 67, č. 4 (1998), s. 249-255 ISSN 0001-7213. [International ichthyohaematology conference /5./. Protivín, 30.11.1998-03.12.1998] R&D Projects: GA ČR GA514/95/0203; GA AV ČR IAA6087704 Subject RIV: EH - Ecology, Behaviour Impact factor: 0.288, year: 1998 http://vfu-www.vfu.cz/acta-vet/vol67/249-98.htm

  7. 17 CFR 405.2 - Reports to be made by registered government securities brokers and dealers.

    Science.gov (United States)

    2010-04-01

    ... government securities broker or dealer shall file Part I of Form BD-Y2K (§ 249.618 of this title) prepared as..., shall file Part II of Form BD-Y2K (§ 249.618 of this title). Part II of Form BD-Y2K shall address each... registered government securities broker or dealer that was not required to file Part II of Form BD-Y2K under...

  8. North Base Industrial Area Development Plan Environmental Assessment

    Science.gov (United States)

    2006-03-01

    100 to 29.1-570 (Department of Game and Inland Fisheries) State Tributyltin ( TBT ) Program. VAC 3.1-249.59 to 3.1-249.62 Stresses the conservation...be classified as hazardous because of its toxicity , reactivity, ignitibility, or corrosivity. In addition, certain types of waste are “listed” or...personal protective equipment, construction inspection, the disposal of lead-based paint-containing wastes, and lead toxicity investigations (Air

  9. Review: Personal Effects of Divorce in Relation to Children / Recension: Efectos personales del divorcio respecto de los hijos

    Directory of Open Access Journals (Sweden)

    Teresa Duplá Marín

    2013-05-01

    Full Text Available Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270. Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270.

  10. Tuberculosis management practices of private practitioners in Pune municipal corporation, India.

    Directory of Open Access Journals (Sweden)

    Sandeep Bharaswadkar

    Full Text Available BACKGROUND: Private Practitioners (PP are the primary source of health care for patients in India. Limited representative information is available on TB management practices of Indian PP or on the efficacy of India's Revised National Tuberculosis Control Programme (RNTCP to improve the quality of TB management through training of PP. METHODS: We conducted a cross-sectional survey of a systematic random sample of PP in one urban area in Western India (Pune, Maharashtra. We presented sample clinical vignettes and determined the proportions of PPs who reported practices consistent with International Standards of TB Care (ISTC. We examined the association between RNTCP training and adherence to ISTC by calculating odds ratios and 95% confidence intervals. RESULTS: Of 3,391 PP practicing allopathic medicine, 249 were interviewed. Of these, 55% had been exposed to RNTCP. For new pulmonary TB patients, 63% (158/249 of provider responses were consistent with ISTC diagnostic practices, and 34% (84/249 of responses were consistent with ISTC treatment practices. However, 48% (120/249 PP also reported use of serological tests for TB diagnosis. In the new TB case vignette, 38% (94/249 PP reported use of at least one second line anti-TB drug in the treatment regimen. RNTCP training was not associated with diagnostic or treatment practices. CONCLUSION: In Pune, India, despite a decade of training activities by the RNTCP, high proportions of providers resorted to TB serology for diagnosis and second-line anti-TB drug use in new TB patients. Efforts to achieve universal access to quality TB management must account for the low quality of care by PP and the lack of demonstrated effect of current training efforts.

  11. Tuberculosis management practices of private practitioners in Pune municipal corporation, India.

    Science.gov (United States)

    Bharaswadkar, Sandeep; Kanchar, Avinash; Thakur, Narendra; Shah, Shubhangi; Patnaik, Brinda; Click, Eleanor S; Kumar, Ajay M V; Dewan, Puneet Kumar

    2014-01-01

    Private Practitioners (PP) are the primary source of health care for patients in India. Limited representative information is available on TB management practices of Indian PP or on the efficacy of India's Revised National Tuberculosis Control Programme (RNTCP) to improve the quality of TB management through training of PP. We conducted a cross-sectional survey of a systematic random sample of PP in one urban area in Western India (Pune, Maharashtra). We presented sample clinical vignettes and determined the proportions of PPs who reported practices consistent with International Standards of TB Care (ISTC). We examined the association between RNTCP training and adherence to ISTC by calculating odds ratios and 95% confidence intervals. Of 3,391 PP practicing allopathic medicine, 249 were interviewed. Of these, 55% had been exposed to RNTCP. For new pulmonary TB patients, 63% (158/249) of provider responses were consistent with ISTC diagnostic practices, and 34% (84/249) of responses were consistent with ISTC treatment practices. However, 48% (120/249) PP also reported use of serological tests for TB diagnosis. In the new TB case vignette, 38% (94/249) PP reported use of at least one second line anti-TB drug in the treatment regimen. RNTCP training was not associated with diagnostic or treatment practices. In Pune, India, despite a decade of training activities by the RNTCP, high proportions of providers resorted to TB serology for diagnosis and second-line anti-TB drug use in new TB patients. Efforts to achieve universal access to quality TB management must account for the low quality of care by PP and the lack of demonstrated effect of current training efforts.

  12. Evaluation of anticonvulsant actions of dibromophenyl enaminones using in vitro and in vivo seizure models.

    Directory of Open Access Journals (Sweden)

    Mohamed G Qaddoumi

    Full Text Available Epilepsy and other seizure disorders are not adequately managed with currently available drugs. We recently synthesized a series of dibromophenyl enaminones and demonstrated that AK6 and E249 were equipotent to previous analogs but more efficacious in suppressing neuronal excitation. Here we examined the actions of these lead compounds on in vitro and in vivo seizure models. In vitro seizures were induced in the hippocampal slice chemically (zero Mg2+ buffer and picrotoxin and electrically using patterned high frequency stimulation (HFS of afferents. In vivo seizures were induced in rats using the 6 Hz and the maximal electroshock models. AK6 (10 µM and E249 (10 µM depressed the amplitude of population spikes recorded in area CA1 of the hippocampus by -50.5±4.3% and -40.1±3.1% respectively, with partial recovery after washout. In the zero Mg2+ model, AK6 (10 µM depressed multiple population spiking (mPS by -59.3±6.9% and spontaneous bursts (SBs by -65.9±7.2% and in the picrotoxin-model by -43.3±7.2% and -50.0±8.3%, respectively. Likewise, E249 (10 µM depressed the zero-Mg2+-induced mPS by -48.8±9.5% and SBs by -55.8±15.5%, and in the picrotoxin model by -37.1±5.5% and -56.5±11.4%, respectively. They both suppressed post-HFS induced afterdischarges and SBs. AK6 and E249 dose-dependently protected rats in maximal electroshock and 6 Hz models of in vivo seizures after 30 min pretreatment. Their level of protection in both models was similar to that obtained with phenytoin Finally, while AK6 had no effect on locomotion in rats, phenytoin significantly decreased locomotion. AK6 and E249, suppressed in vitro and in vivo seizures to a similar extent. Their in vivo activities are comparable with but not superior to phenytoin. The most efficacious, AK6 produced no locomotor suppression while phenytoin did. Thus, AK6 and E249 may be excellent candidates for further investigation as potential agents for the treatment of epilepsy syndromes

  13. Pæren er faldet langt fra stammen

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2013-01-01

    Roman: Hassan Preislers vellykkede debutroman udleverer ikke bare multikulti-industrien. Den er også en rablende diagnosticering af det moderne menneskes livsvilkår HASSAN PREISLER BRUN MANDS BYRDE 224 sider, 249,95 Lindhardt og Ringhof Er udkommet 4......Roman: Hassan Preislers vellykkede debutroman udleverer ikke bare multikulti-industrien. Den er også en rablende diagnosticering af det moderne menneskes livsvilkår HASSAN PREISLER BRUN MANDS BYRDE 224 sider, 249,95 Lindhardt og Ringhof Er udkommet 4...

  14. Actinide targets for the synthesis of super-heavy elements

    International Nuclear Information System (INIS)

    Roberto, J.B.; Alexander, C.W.; Boll, R.A.; Burns, J.D.; Ezold, J.G.; Felker, L.K.; Hogle, S.L.; Rykaczewski, K.P.

    2015-01-01

    Since 2000, six new super-heavy elements with atomic numbers 113 through 118 have been synthesized in hot fusion reactions of "4"8Ca beams on actinide targets. These target materials, including "2"4"2Pu, "2"4"4Pu, "2"4"3Am, "2"4"5Cm, "2"4"8Cm, "2"4"9Cf, and "2"4"9Bk, are available in very limited quantities and require specialized production and processing facilities resident in only a few research centers worldwide. This report describes the production and chemical processing of heavy actinide materials for super-heavy element research, current availabilities of these materials, and related target fabrication techniques. The impact of actinide materials in super-heavy element discovery is reviewed, and strategies for enhancing the production of rare actinides including "2"4"9Bk, "2"5"1Cf, and "2"5"4Es are described.

  15. Identification of a disulfide bridge important for transport function of SNAT4 neutral amino acid transporter.

    Directory of Open Access Journals (Sweden)

    Rugmani Padmanabhan Iyer

    Full Text Available SNAT4 is a member of system N/A amino acid transport family that primarily expresses in liver and muscles and mediates the transport of L-alanine. However, little is known about the structure and function of the SNAT family of transporters. In this study, we showed a dose-dependent inhibition in transporter activity of SNAT4 with the treatment of reducing agents, dithiothreitol (DTT and Tris(2-carboxyethylphosphine (TCEP, indicating the possible involvement of disulfide bridge(s. Mutation of residue Cys-232, and the two highly conserved residues Cys-249 and Cys-321, compromised the transport function of SNAT4. However, this reduction was not caused by the decrease of SNAT4 on the cell surface since the cysteine-null mutant generated by replacing all five cysteines with alanine was equally capable of being expressed on the cell surface as wild-type SNAT4. Interestingly, by retaining two cysteine residues, 249 and 321, a significant level of L-alanine uptake was restored, indicating the possible formation of disulfide bond between these two conserved residues. Biotinylation crosslinking of free thiol groups with MTSEA-biotin provided direct evidence for the existence of a disulfide bridge between Cys-249 and Cys-321. Moreover, in the presence of DTT or TCEP, transport activity of the mutant retaining Cys-249 and Cys-321 was reduced in a dose-dependent manner and this reduction is gradually recovered with increased concentration of H2O2. Disruption of the disulfide bridge also decreased the transport of L-arginine, but to a lesser degree than that of L-alanine. Together, these results suggest that cysteine residues 249 and 321 form a disulfide bridge, which plays an important role in substrate transport but has no effect on trafficking of SNAT4 to the cell surface.

  16. [Current situation of awareness and use of banned pesticides among vegetable greenhouse farmers in a town of Ledu County, China].

    Science.gov (United States)

    Guo, Ying-hua; Xing, Yong-hua; Ji, Wen-wu; Zhou, Jian; Sun, Jian; Niu, Zhao-di; Yang, Hui-fang

    2013-09-01

    To investigate the awareness and use of banned pesticides among vegetable greenhouse farmers in a town of Ledu County, Qinghai Province, China and to provide a basis for the management and control of banned pesticides. Local residents who lived in a town of Ledu County for more than 5 years were selected as subjects in August 2012. A questionnaire survey was conducted in 267 vegetable greenhouse farmers who were selected from five villages of the town by cluster random sampling. Of the 267 subjects, 249 (93.26%) completed and returned the questionnaires. Eighty-seven (34.9%) of the 249 subjects were aware of banned pesticides, and the banned pesticide awareness rate varied significantly among the subjects with different education levels (χ(2) = 11.061, P = 0.011). Only education level entered the regression equation in non-conditional logistic regression analysis. Only five (2.0%) of the 249 subjects knew the banned pesticides as well as the details. All the 249 subjects used banned pesticides to varying degrees in the past 5 years. Only 9.0% (17/189) of the vegetable greenhouse farmers knew the time pesticides were initially banned in China. The banned pesticide awareness rate is relatively low in the town of Ledu County, and this rate is influenced by education level. It is needed to spread the knowledge and hazards of banned pesticides.

  17. All projects related to | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: INSTITUTION BUILDING, EVALUATION TECHNIQUES, INSTITUTIONAL FRAMEWORK, LAW, POLICY MAKING, ADMINISTRATIVE REFORM. Region: North of Sahara, South of Sahara, North and Central America, South America, Central Asia, Far East Asia, South Asia, Bolivia, Brazil, Colombia, India, Kenya, Peru.

  18. 48 CFR 52.249-10 - Default (Fixed-Price Construction).

    Science.gov (United States)

    2010-10-01

    ... control and without the fault or negligence of the Contractor. Examples of such causes include (i) acts of... unforeseeable causes beyond the control and without the fault or negligence of both the Contractor and the... any other rights and remedies provided by law or under this contract. (End of clause) Alternate I (APR...

  19. Synthesis of the New Element with Z=117

    International Nuclear Information System (INIS)

    Hamilton, J H; Ramayya, A V; Oganessian, Yu Ts; Abdullin, F Sh; Dmitriev, S N; Itkis, M G; Lobanov, Yu V; Mezentsev, A N; Polyakov, A N; Bailey, P D; Benker, D; Ezold, J; Porter, C E; Riley, F; Roberto, J B; Bennett, M E; Henderson, R A; Moody, K J; Nelson, S L; Ryabinin, M A

    2011-01-01

    The synthesis of the new chemical element with atomic number Z=117 is presented. The isotopes 293 117 and 294 117were produced in fusion reactions between 48 Ca and 249 Bk. The 249 Bk was produced in the High Flux Isotope Reactor and chemically separated at Oak Ridge. Decay chains involving eleven new nuclei were identified by means of the Dubna Gas Filled Recoil Separator. The measured decay properties show a strong rise of stability for super-heavy nuclei toward N=184.

  20. A SUMOylation Motif in Aurora-A: Implications for Spindle Dynamics and Oncogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Pérez de Castro, Ignacio; Aguirre-Portolés, Cristina [Molecular Oncology Programme, Cell Division and Cancer Group, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain); Martin, Benedicte [CNRS-UMR 6061, Institut de Génétique et Développement de Rennes, IFR 140 GFAS, Faculté de Médecine, Université Rennes 1, Rennes (France); Fernández-Miranda, Gonzalo [Molecular Oncology Programme, Cell Division and Cancer Group, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain); Klotzbucher, Andrea; Kubbutat, Michael H. G. [ProQinase GmBH, Freiburg (Germany); Megías, Diego [Confocal Microscopy Core Unit, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain); Arlot-Bonnemains, Yannick [CNRS-UMR 6061, Institut de Génétique et Développement de Rennes, IFR 140 GFAS, Faculté de Médecine, Université Rennes 1, Rennes (France); Malumbres, Marcos, E-mail: mmm@cnio.es, E-mail: iperez@cnio.es [Molecular Oncology Programme, Cell Division and Cancer Group, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain)

    2011-12-14

    Aurora-A is a serine/threonine kinase that plays critical roles in centrosome maturation, spindle dynamics, and chromosome orientation and it is frequently over-expressed in human cancers. In this work, we show that Aurora-A interacts with the SUMO-conjugating enzyme UBC9 and co-localizes with SUMO1 in mitotic cells. Aurora-A can be SUMOylated in vitro and in vivo. Mutation of the highly conserved SUMOylation residue lysine 249 significantly disrupts Aurora-A SUMOylation and mitotic defects characterized by defective and multipolar spindles ensue. The Aurora-A{sup K249R} mutant has normal kinase activity but displays altered dynamics at the mitotic spindle. In addition, ectopic expression of the Aurora-A{sup K249R} mutant results in a significant increase in susceptibility to malignant transformation induced by the Ras oncogene. These data suggest that modification by SUMO residues may control Aurora-A function at the spindle and that deficiency of SUMOylation of this kinase may have important implications for tumor development.

  1. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  2. Communication of nuclear data progress: No.6 Supplement (1992)

    International Nuclear Information System (INIS)

    1992-10-01

    This is a supplement to No.6 of Communication of Nuclear Data Progress (CNDP), in which the second and final part of the papers of CENDL-2 (Chinese Evaluated Nuclear Data Library, Version 2.0) is published. It includes the evaluation reports of 17 elements and isotopes with incident neutron energy from 10 -5 eV to 20 MeV, they are 16 O, 23 Na, 31 P, Ca, Zn, Mn, 59 Co, Cd, In, Hf, 232 Th, 235 U, 239 Pu, 240 Pu, 241 Am, 249 Bk, 249 Cf

  3. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available CTGLTIYQETYDPDHYRELHRWGPKQDFLERLETPERAI 180 ... Query: 249 VSDRFLARMIFAFRIGMPDVDLVLSTRESS...NFRDGMA 285 ... VSDRFLARMIFAFRIGMPDVDLVLSTRESSNFRDGMA Sbjct: 241 VSDRFLARMIFAFRIGMPDVDLVLSTRESSNFRDGMA 277

  4. ORF Alignment: NC_003074 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LLIEKARIEKNHEVLEMGCGWGTFAIEVVKRTG 180 ... Query: 249 FMDKFFSCCEDALAENGIFVLQFTAIPEALY...DESRLTSGFITEYIFPGGCLPSLARVTSA 308 ... FMDKFFSCCEDALAENGIFVLQFTAIPEALYDESRLTSGFITEYIFPGGCLPSLARVTSA Sbjct: 241 FMDKFFSCCEDALAENGIFVLQFTAIPEALYDESRLTSGFITEYIFPGGCLPSLARVTSA 300 ...

  5. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LGGDGFLLQTLRDTMGTGKKVYGMNRGTIGFLMNEYRSGGLTERIAAAVAETIRPLEMLA 67 ... Query: 190 AHGPIXXXXXXXXXXTPVSPFRPRRWRGALLSNKATVRFDILEPEKRPVNAAADHT...EVKA 249 ... AHGPI ... TPVSPFRPRRWRGALLSNKATVRFDILEPEKRPVNAAADHTEVKA Sbjct: 128 AHGPILPLDAPLLALTPVSPFRPRRWRGALLSNKATVRFDILEPEKRPVNAAADHTEVKA 187 ...

  6. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  7. A functional polymorphism of the microRNA-146a gene is associated with susceptibility to drug-resistant epilepsy and seizures frequency.

    Science.gov (United States)

    Cui, Lili; Tao, Hua; Wang, Yan; Liu, Zhou; Xu, Zhien; Zhou, Haihong; Cai, Yujie; Yao, Lifen; Chen, Beichu; Liang, Wandong; Liu, Yu; Cheng, Wanwen; Liu, Tingting; Ma, Guoda; Li, You; Zhao, Bin; Li, Keshen

    2015-04-01

    Epilepsy is the third most common chronic brain disorder and is characterized by an enduring predisposition for seizures. Recently, a growing body of evidence has suggested that microRNA-146a (miR-146a) is upregulated in the brains of epilepsy patients and of mouse models; furthermore, miR-146a may be involved in the development and progression of seizures through the regulation of inflammation and immune responses. In this report, we performed a case-control study to analyze the relationship between the two potentially functional single nucleotide polymorphisms (SNPs) of the miR-146a gene (rs2910464 and rs57095329) and the risk of epilepsy in a Chinese population comprising 249 cases and 249 healthy controls. Our study comprised 249 epilepsy patients and 249 healthy controls in two regions of China. The DNA was genotyped using the ABI PRISM SNapShot method. The statistical analysis was estimated using the chi-square test or Fisher's exact test. Our results indicated a significant association between the rs57095329 SNP of the miR-146a gene and the risk of drug resistant epilepsy (DRE) (genotypes, p = 0.0258 and alleles, p = 0.0108). Moreover, the rs57095329 A allele was found to be associated with a reduced risk of seizures frequency in DRE patients (all p epilepsy. Our data indicate that the rs57095329 polymorphism in the promoter region of miR-146a is involved in the genetic susceptibility to DRE and the seizures frequency. Copyright © 2015 British Epilepsy Association. Published by Elsevier Ltd. All rights reserved.

  8. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PQPVVDAAIQALQDPKNHG 60 ... Query: 129 PAYPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAP 188 ... ... ... PAYPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAP Sbjct: 121 PAYPAH...FRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAP 180 ... Query: 249 GWRVGFVVGNRHVIQGLRTLKTNLDYGIFXXXXXXXX

  9. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 249 ... Query: 2 ... RKTFLAGNWKMHYTSTEASIVAKKIATEVKTLKDDFVIMITPPFTALSKVSECIKGSNIL 61 ... ... ... RKTFLAGNWKMHYTSTEASIVAKKIATEVKTLKDDFVIMITPPFTALSKVSECIKGSNIL Sbjct: 1 ... RKTFLAG...NWKMHYTSTEASIVAKKIATEVKTLKDDFVIMITPPFTALSKVSECIKGSNIL 60 ... Query: 122 FKYLILCVGETLNERDSEKTLDVVLNQVKKGLDGVSESD

  10. Two-quasineutron states in 98248Cf and 98250Cf and the neutron-neutron residual interactions

    International Nuclear Information System (INIS)

    Katori, K.; Ahmad, I.; Friedman, A. M.

    2008-01-01

    Two-quasineutron states in 248 Cf and 250 Cf were investigated by single-neutron transfer reactions, 249 Cf(d,t) 248 Cf and 249 Cf(d,p) 250 Cf. The majority of levels observed were assigned to 12 bands in 248 Cf and six bands in 250 Cf, constructed from the single-particle states in neighboring Cf nuclei. The effective two-body interactions between two odd neutrons coupled outside a deformed core were deduced from the differences in the energies of the bandheads formed by the parallel and antiparallel coupling of the intrinsic spins of the two single-particle states

  11. ORF Alignment: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VNSNPATIMTDPEF 60 ... Query: 129 ... IGADFEAIQRGEDRQRFKDLVAKVGGESARSKVCFTMDEVRETVEDLGLPVVVRPSFTM...G 188 ... IGADFEAIQRGEDRQRFKDLVAKVGGESARSKVCFTMDEVRETVEDLGLPVVVRPSFTMG Sbjct: 121 ... IGADFEAI...QRGEDRQRFKDLVAKVGGESARSKVCFTMDEVRETVEDLGLPVVVRPSFTMG 180 ... Query: 249 ... NVDPMGVHTGDSVTVAPAMTLTDWEYQRMRDLGIAILR

  12. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Sinorhizobium meliloti 1021] ... Length = 118 ... Query: 249 ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRT...LPVLDENEKLQGTVGLRELAGKEPG 308 ... ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRTLP...VLDENEKLQGTVGLRELAGKEPG Sbjct: 1 ... ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRTLPVLDENEKLQGTVGLRELAGKEPG 60 ...

  13. 7 CFR 249.10 - Coupon, market, and CSA program management.

    Science.gov (United States)

    2010-01-01

    ..., annual training shall include instruction emphasizing: (1) Eligible food choices; (2) Proper SFMNP coupon..., including the availability of eligible foods to SFMNP participants that are of the same quality and cost as... are promptly paid for food costs. (h) Reconciliation of SFMNP coupons. The State agency shall identify...

  14. People and things. CERN Courier, Nov 1984, v. 24(9)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1984-11-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A landmark event took place at Stanford on 3-4 August in the form of a ' Pief-fest', a celebration tacked onto the end of the traditional annual Stanford Linear Accelerator Center (SLAC) Summer Institute to mark the retirement of Wolfgang 'Pief Panofsky as the Laboratory's Director.The University of California's Lawrence Berkeley Laboratory has been chosen as the host institution for the Central Design Group for the Superconducting Super Collider (SSC). The fifth Topical Workshop on Proton-Antiproton Collider Physics will be held in Saint-Vincent, Aosta Valley, Italy, from 25 February to 2 March 1985. The local users' organization at the Stanford Linear Accelerator Center is organizing a Workshop on Electron-Positron Physics at High Luminosities, to be held at SLAC from 30 November to 1 December. The Aspen (Colorado, USA) Center for Physics announces a Winter Physics Conference Series - Collider Physics at Ultrahigh Energies from 6-12 January 1985 and Electro weak Interactions from 13- 19 January. As this edition was going to press, the CERN SPS protonantiproton collider was back in action for physics for the first time since the historic run last year which produced the Z particle and the first evidence for the sixth ('top') quark.

  15. People and things. CERN Courier, Nov 1984, v. 24(9)

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A landmark event took place at Stanford on 3-4 August in the form of a ' Pief-fest', a celebration tacked onto the end of the traditional annual Stanford Linear Accelerator Center (SLAC) Summer Institute to mark the retirement of Wolfgang 'Pief Panofsky as the Laboratory's Director.The University of California's Lawrence Berkeley Laboratory has been chosen as the host institution for the Central Design Group for the Superconducting Super Collider (SSC). The fifth Topical Workshop on Proton-Antiproton Collider Physics will be held in Saint-Vincent, Aosta Valley, Italy, from 25 February to 2 March 1985. The local users' organization at the Stanford Linear Accelerator Center is organizing a Workshop on Electron-Positron Physics at High Luminosities, to be held at SLAC from 30 November to 1 December. The Aspen (Colorado, USA) Center for Physics announces a Winter Physics Conference Series - Collider Physics at Ultrahigh Energies from 6-12 January 1985 and Electro weak Interactions from 13- 19 January. As this edition was going to press, the CERN SPS protonantiproton collider was back in action for physics for the first time since the historic run last year which produced the Z particle and the first evidence for the sixth ('top') quark

  16. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 122 GLKIVLCIGESLSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATPE 181 ... GLKIVLCIGESLSERETGKTNDVIQKQ...LTEALKDVSDLSNLVIAYEPIWAIGTGVVATPE Sbjct: 121 GLKIVLCIGESLSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATPE 180 ... Query: 242 FAKIIESAQ 250 ... FAKIIESAQ Sbjct: 241 FAKIIESAQ 249

  17. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available la ... parapertussis] ... Length = 249 ... Query: 37 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGG...SNIATDYVARATPDGYT 96 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATD...YVARATPDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 157 PGKLAFASS

  18. The combination of maltose-binding protein and BCG-induced Th1 activation is involved in TLR2/9-mediated upregulation of MyD88-TRAF6 and TLR4-mediated downregulation of TRIF-TRAF3.

    Science.gov (United States)

    Liu, Guomu; Zhai, Xiaoyu; Zhou, Hongyue; Yang, Xiaoyu; Zhang, Nannan; Tai, Guixiang; Ni, Weihua

    2018-03-01

    Our previous study demonstrated that maltose-binding protein (MBP) activated Th1 through the TLR2-mediated MyD88-dependent pathway and the TLR4-mediated TRIF-dependent pathway. The combination of MBP and BCG synergistically induced Th1 activation, and the TLR2/9-mediated MyD88-dependent pathway is involved in this process. To further explore this mechanism, we stimulated purified mouse CD4 + T cells with MBP and BCG in vitro. The results demonstrated that MBP combined with BCG synergistically increased IFN-γ production and TLR2/4/9 expression, suggesting the involvement of TLR2/4/9 in the combination-induced Th1 activation. Next, TLRs 2/4/9 were blocked to analyze the effects of TLRs on Th1 activation. The results demonstrated that MBP induced a low level of Th1 activation by upregulating TLR2-mediated MyD88-TRAF6 and TLR4-mediated TRIF-TRAF3 expression, whereas MBP combined with BCG induced synergistic Th1 activation, which was not only triggered by strong upregulation of TLR2/9-mediated MyD88-TRAF6 expression but also by shifting TLR4-mediated TRIF-TRAF3 into the TRIF-TRAF6 pathway. Moreover, we observed that a TLR4 antibody upregulated MyD88 expression and a TLR9 inhibitor downregulated TRIF expression, indicating that there was cross-talk between TLRs 2/4/9 in MBP combined with BCG-induced Th1 activation. Our findings may expand the knowledge regarding TLR cross-talk involved in regulating the Th1 response. Copyright © 2018 Elsevier Inc. All rights reserved.

  19. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... pertussis Tohama I] ... Length = 249 ... Query: 37 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKP...GGGSNIATDYVARATPDGYT 96 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNI...ATDYVARATPDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 157 PGKLAF

  20. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 37 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVEN...KPGGGSNIATDYVARATPDGYT 96 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGS...NIATDYVARATPDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 157 PGKL

  1. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  2. Association of common ATM variants with familial breast cancer in a South American population

    International Nuclear Information System (INIS)

    González-Hormazábal, Patricio; Jara, Lilian; Bravo, Teresa; Blanco, Rafael; Valenzuela, Carlos Y; Gómez, Fernando; Waugh, Enrique; Peralta, Octavio; Ortuzar, Waldo; Reyes, Jose M

    2008-01-01

    The ATM gene has been frequently involved in hereditary breast cancer as a low-penetrance susceptibility gene but evidence regarding the role of ATM as a breast cancer susceptibility gene has been contradictory. In this study, a full mutation analysis of the ATM gene was carried out in patients from 137 Chilean breast cancer families, of which 126 were BRCA1/2 negatives and 11 BRCA1/2 positives. We further perform a case-control study between the subgroup of 126 cases BRCA1/2 negatives and 200 controls for the 5557G>A missense variant and the IVS38-8T>C and the IVS24-9delT polymorphisms. In the full mutation analysis we detected two missense variants and eight intronic polymorphisms. Carriers of the variant IVS24-9delT, or IVS38-8T>C, or 5557G>A showed an increase in breast cancer risk. The higher significance was observed in the carriers of IVS38-8T>C (OR = 3.09 [95%CI 1.11–8.59], p = 0.024). The IVS24-9 T/(-T), IVS38-8 T/C, 5557 G/A composite genotype confered a 3.19 fold increase in breast cancer risk (OR = 3.19 [95%CI 1.16–8.89], p = 0.021). The haplotype estimation suggested a strong linkage disequilibrium between the three markers (D' = 1). We detected only three haplotypes in the cases and control samples, some of these may be founder haplotypes in the Chilean population. The IVS24-9 T/(-T), IVS38-8 T/C, 5557 G/A composite genotype alone or in combination with certain genetic background and/or environmental factors, could modify the cancer risk by increasing genetic inestability or by altering the effect of the normal DNA damage response

  3. Associations of fractalkine receptor (CX3CR1) and CCR5 gene variants with hypertension, diabetes and atherosclerosis in chronic renal failure patients undergoing hemodialysis.

    Science.gov (United States)

    Bagci, Binnur; Bagci, Gokhan; Huzmeli, Can; Sezgin, Ilhan; Ozdemir, Ozturk

    2016-07-01

    We aimed to investigate the associations of fractalkine receptor (CX3CR1) V249I, T280M and CCR5-59029 A/G gene polymorphisms in chronic renal failure (CRF) subjects undergoing hemodialysis and to evaluate possible associations of these polymorphisms with hypertension (HT), diabetes mellitus (DM) and atherosclerosis (AS). A total of 225 CRF subjects undergoing hemodialysis and 201 healthy controls were enrolled in the study. CRF subjects were divided into three major subgroups according to comorbidities including HT (n = 127), DM (n = 65) and AS (n = 33). Genotyping was done using polymerase chain reaction-restriction fragment length polymorphism method. The II genotype and I allele frequencies of CX3CR1 V249I polymorphism were found significantly more frequent in CRF subjects, CRF subjects with DM and CRF subjects with AS compared with controls (p < 0.05 for all comparisons). G allele frequency of CCR5 polymorphism was found significantly more prevalent in CRF subjects with DM than that of controls. Further, GG genotype and G allele frequencies of CCR5 polymorphism were significantly more prevalent in CRF subjects with AS compared with controls (p < 0.05). We also explored these polymorphisms among CRF subjects with and without following comorbidities: HT, DM, AS. We found significant association between CRF subjects with HT and without HT in terms of genotype and allele frequencies of V249I polymorphism (p < 0.05). CX3CR1 T280M polymorphism was not found significantly different in none of the comparisons. These data demonstrate possible associations between CX3CR1 V249I and CCR5-59029 A/G polymorphisms and/or HT, DM and AS in CRF subjects.

  4. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM

  5. 249 The Effect of Inter-tribal Post Election Violence Conflict Trauma ...

    African Journals Online (AJOL)

    User

    Indexed African Journals Online: www.ajol.info. An International Multidisciplinary Journal, ... system. Key words: trauma, academic performance, gender and violence. Introduction. Inter-tribal conflict has ... During the 2008 post election violence, education was largely disrupted as insecurity intensified. Teachers and pupils ...

  6. 14 CFR 249.20 - Preservation of records by certificated air carriers.

    Science.gov (United States)

    2010-01-01

    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS PRESERVATION OF AIR CARRIER RECORDS Preservation of Records by...) Papers forming a part of, or necessary to explain, journal entries; entry numbers Do. 3. Voucher... receivable or payable, detailed journals and ledgers or their equivalents, together with supporting papers Do...

  7. : tous les projets | Page 249 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le nombre d'enfants aux prises avec des difficultés mentales est important et augmente à un rythme alarmant en Inde. Date de début : 23 septembre 2011. End Date: 29 octobre 2012. Sujet: MENTAL DISEASES, MENTALLY DISABLED, CHILDREN, INFORMATION TECHNOLOGY, COMPUTERS, COMPUTER PROGRAMS.

  8. An Enterprise-Wide Model for Redistributing Excess Material

    Science.gov (United States)

    2012-12-01

    107,207,236.82 BLANK $2,047,184.25 $2,108,998.49 $2,328,683.08 $2,328,683.08 $2,811,032.68 AVN $1,749,973.25 $1,875,310.61 $2,009,566.99...SOUTHWEST $10,332,842.03 $8,142,023.44 $8,790,981.90 $8,790,981.90 $9,537,152.92 AVN $1,134,389.58 $1,036,453.46 $1,133,249.27 $1,133,249.27 $125,192.90...1,638,635.04 $1,722,803.38 $2,172,371.60 $2,172,371.60 $1,921,743.69 AVN $8,993.33 $6,622.32 $97,857.13 $97,857.13 $7,798.45 MARINES $541.34 $5,597.11

  9. Review of chromosome races in blind mole rats (Spalax and Nannospalax)

    Czech Academy of Sciences Publication Activity Database

    Arslan, A.; Kryštufek, B.; Matur, F.; Zima, Jan

    2016-01-01

    Roč. 65, č. 4 (2016), s. 249-301 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : karyotype * evolution * cytotypes * speciation Subject RIV: EG - Zoology Impact factor: 0.739, year: 2016

  10. Temperature, salinity, oxygen, nutrients and productivity profile data from THOMAS G. THOMPSON Cruise 001, 19651014 to 19651207 in the Caribbean Sea and the northeastern tropical Pacific Ocean (NODC Accession 7100507)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains a copy of University of Washington Department of Oceanography Technical Report No. 249, Physical, chemical, and productivity data from a...

  11. Fúzní palivo a obnovitelné zdroje

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír

    2015-01-01

    Roč. 65, č. 5 (2015), s. 249-252 ISSN 0375-8842 Keywords : nuclear fusion * fusion fuel power plant * renewable source * fusion energy Subject RIV: JF - Nuclear Energetics http://www.casopisenergetika.cz

  12. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY

  13. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY

  14. EST Table: BB985913 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/08/28 30 %/249 aa FBpp0129766|DereGG112...EDICTED: similar to putative lysosomal glucocerebrosidase [Tribolium castaneum] BB985877 MSV3 ...

  15. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

    2016-01-01

    Roč. 10, č. 35 (2016), s. 242-249 ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  16. Aulacoseira kruegeriana (Bacillariophyta, Coscinodiscophyceae): a new centric diatom from high-elevation Andean streams of Bolivia

    Czech Academy of Sciences Publication Activity Database

    Morales, E. A.; Rivera, S. F.; Rubin, S. D. C.; Vis, M. L.; Houk, Václav

    2015-01-01

    Roč. 30, č. 3 (2015), s. 269-277 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : centric diatoms * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 1.868, year: 2015

  17. African Journal for the Psychological Study of Social Issues - Vol 9 ...

    African Journals Online (AJOL)

    Product's promotion patterns and their effects on consumers' purchase intentions, brand loyalty and attitude · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. NA Shenge, 249-256 ...

  18. Cyanobacterial water-bloom of Limnoraphis robusta in the Lago Mayor of the Lake Titicaca. Can it develop?

    Czech Academy of Sciences Publication Activity Database

    Komárková, Jaroslava; Montoya, H.; Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 249-258 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * water bloom * Titicaca Lake Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  19. 17 CFR 270.30d-1 - Filing of copies of reports to shareholders.

    Science.gov (United States)

    2010-04-01

    ... shareholders. A registered management investment company, other than a small business investment company... and procedures specified therefor, of reports on Form N-CSR (§§ 249.331 and 274.128 of this chapter...

  20. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g 243 Am, 59 g 244 Cm, 51 mg 249 Bk, 465 mg 252 Cf, 2.5 mg 253 Es, and 1.4 pg 257 Fm. In addition, 45 mg of high-purity 248 Cm was operated from 252 Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality 248 Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that 252 Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of 249 Bk, 520 mg of 252 Cf, 2.0 mg of 253 Es (in a mixture of isotopes), 220 μg of high-purity 253 Es, and 1.6 pg of 257 Fm. We also expect to obtain 125 mg of high-purity 248 Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any 244 Pu. Two neutron sources were fabricated, bringing the total fabricated to 77. Two sources that had been used previously in various projects were returned to the TRU inventory and are available for reassignment. In special projects, we (1) produced about 1 mg of 250 Cf by irradiation of 249 Bk in HFIR rabbits, and (2) processed some irradiated 248 Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of 249 Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  1. Improved catalytic properties of halohydrin dehalogenase by modification of the halide-binding site.

    Science.gov (United States)

    Tang, Lixia; Torres Pazmiño, Daniel E; Fraaije, Marco W; de Jong, René M; Dijkstra, Bauke W; Janssen, Dick B

    2005-05-03

    Halohydrin dehalogenase (HheC) from Agrobacterium radiobacter AD1 catalyzes the dehalogenation of vicinal haloalcohols by an intramolecular substitution reaction, resulting in the formation of the corresponding epoxide, a halide ion, and a proton. Halide release is rate-limiting during the catalytic cycle of the conversion of (R)-p-nitro-2-bromo-1-phenylethanol by the enzyme. The recent elucidation of the X-ray structure of HheC showed that hydrogen bonds between the OH group of Tyr187 and between the Odelta1 atom of Asn176 and Nepsilon1 atom of Trp249 could play a role in stabilizing the conformation of the halide-binding site. The possibility that these hydrogen bonds are important for halide binding and release was studied using site-directed mutagenesis. Steady-state kinetic studies revealed that mutant Y187F, which has lost both hydrogen bonds, has a higher catalytic activity (k(cat)) with two of the three tested substrates compared to the wild-type enzyme. Mutant W249F also shows an enhanced k(cat) value with these two substrates, as well as a remarkable increase in enantiopreference for (R)-p-nitro-2-bromo-1-phenylethanol. In case of a mutation at position 176 (N176A and N176D), a 1000-fold lower catalytic efficiency (k(cat)/K(m)) was obtained, which is mainly due to an increase of the K(m) value of the enzyme. Pre-steady-state kinetic studies showed that a burst of product formation precedes the steady state, indicating that halide release is still rate-limiting for mutants Y187F and W249F. Stopped-flow fluorescence experiments revealed that the rate of halide release is 5.6-fold higher for the Y187F mutant than for the wild-type enzyme and even higher for the W249F enzyme. Taken together, these results show that the disruption of two hydrogen bonds around the halide-binding site increases the rate of halide release and can enhance the overall catalytic activity of HheC.

  2. Magnetické pole Země a jeho možný vliv na živé organizmy

    Czech Academy of Sciences Publication Activity Database

    Střeštík, Jaroslav

    2004-01-01

    Roč. 54, č. 4 (2004), s. 249-251 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z3012916 Keywords : geomagnetic activity * geomagnetic storms * human beings Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  3. effect of a low-intensity resistance exercise programme with blood

    African Journals Online (AJOL)

    Body fat was measured by means of bioelectrical impedance analysis (InBody 720 ... coefficient variance percentage of 4.9 and 7.7, respectively (Daughaday & Rotwein, 1989). Exercise ..... Frontiers in Physiology, 4(September): 249 (online).

  4. 48 CFR 49.401 - General.

    Science.gov (United States)

    2010-10-01

    ... negligence of the contractor, the default clauses prescribed in 49.503 and located at 52.249 provide that a... appropriate cases, exercise termination or cancellation rights in addition to those in the contract clauses...

  5. Morphology and taxonomy of an almost forgotten fossil diatom Gaillonella sculpta EHRENBERG (Bacillariophyceae)

    Czech Academy of Sciences Publication Activity Database

    Usoltseva, M.; Houk, Václav

    2016-01-01

    Roč. 31, č. 1 (2016), s. 39-49 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : Miocene * Gaillonella * Pseudoaulacosira * taxonomy * valve ultrastructure. * Bacillariophyceae Subject RIV: EF - Botanics Impact factor: 1.677, year: 2016

  6. Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition

    Czech Academy of Sciences Publication Activity Database

    Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.

    2014-01-01

    Roč. 565, 28 August (2014), s. 249-260 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014

  7. Oviposition site selection and embryo mortality in perch

    Czech Academy of Sciences Publication Activity Database

    Smith, C.; Douglas, A.; Jurajda, Pavel

    2001-01-01

    Roč. 58, č. 3 (2001), s. 880-882 ISSN 0022-1112 Institutional research plan: CEZ:AV0Z6093917 Keywords : spawning * reproduction * Eurasian perch Subject RIV: EG - Zoology Impact factor: 1.249, year: 2001

  8. SUBJECT INDEX

    Indian Academy of Sciences (India)

    presence of different types of clouds. 249. Alkaline ... 19. Antarctica. Influence of climatic teleconnections on the temporal ... coastal Dronning Maud Land, East Antarctica. 41 ... On the modeling of electrical boundary layer (elec- trode layer) ...

  9. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  10. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 249 ... Appraisal of the Addis Ababa Peace and Security Cooperation Framework and the United Nations Security Council Resolution 2098 for .... intervention: Evaluation of the African Union's right of intervention, Abstract PDF.

  12. Devitrification kinetics of Sb2O3-PbI2 glasses

    Czech Academy of Sciences Publication Activity Database

    Legouera, M.; Rahal, F.; Kostka, Petr; Poulain, M.

    2009-01-01

    Roč. 34, č. 4 (2009), s. 249-266 ISSN 0151-9107 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystallization kinetics * nucleation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.250, year: 2009

  13. Particle Flow Modelling in Slurry-Fed Stirred Vessels

    Czech Academy of Sciences Publication Activity Database

    Scargiali, F.; Grisafi, F.; Čermáková, Jiřina; Machoň, V.; Brucato, A.

    2004-01-01

    Roč. 27, č. 3 (2004), s. 249-256 ISSN 0930-7516 Institutional research plan: CEZ:AV0Z4072921 Keywords : solids * dispersion Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.791, year: 2004

  14. Subject Index

    Indian Academy of Sciences (India)

    Seismic Study of Magnetic Field in the Solar Interior (H. M. Antia), 85 ... Hα Intensity Oscillations in Large Flares (Ram Ajor Maurya & Ashok Ambastha), 249 .... Utilization of GPS Satellites for Precise Irradiation Measurement and Monitoring.

  15. Possibilities of RCH-microscopy in the reptilian research

    Czech Academy of Sciences Publication Activity Database

    Žižka, Zdeněk

    2002-01-01

    Roč. 51, č. 3 (2002), s. 249-252 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z5020903 Keywords : reptilia * integument * replica Subject RIV: EE - Microbiology, Virology Impact factor: 0.234, year: 2002

  16. Hepatitis infections, aflatoxin and hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    Pierre Hainaut

    2007-02-01

    Full Text Available

    The incidence rates of hepatocellular carcinoma (HCC show large geographic variations, globally reflecting the prevalence of two main aetiologic factors, hepatitis B (HBV and/or C (HCV virus infection and exposure to high levels of aflatoxin in the diet (Chen et al. 1997. The highest incidence rates are observed in regions where most of the population is exposed to both factors, such as in parts of eastern Asia and in sub-Saharan Africa (Parkin et al. 2001. These high incidences are consistent with the fact that HBV chronicity and exposure to aflatoxin have a multiplicative effect of risk for HCC. Depending on aetiology and geographic area, mutations in TP53 show striking differences in prevalence and pattern. In Europe and the US, where alcohol is a major risk factor in addition to viral infections, mutations occur in about 25% of HCC and show as much diversity in their type and codon position as in most other epithelial cancers. However, in high incidence areas such as Mozambique, Senegal, The Gambia (Africa and Qidong county (China, TP53 is mutated in over 50% of the cases and the vast majority of these mutations are a single missense, hotspot mutation at codon 249, AGG to AGT, resulting in the substitution of arginine into serine (249ser. This mutation is uncommon in regions where aflatoxin is not present at significant levels in the diet. In areas of intermediate exposure to aflatoxin, as for example in Thailand, the prevalence of the 249ser mutation is intermediate between high- and low-incidence areas. Thus, there is a dose-dependent relationship between exposure to aflatoxin, incidence of HCC and prevalence of 249ser mutation. Aflatoxins are toxic and carcinogenic metabolites produced by several varieties of molds, mainly Aspergillus flavus and Aspergillus parasiticum. These molds contaminate a wide range of traditional agricultural products in countries

  17. Modeling population dynamics of two cockroach species: Effects of the circadian clock, interspecific competition and pest control

    Czech Academy of Sciences Publication Activity Database

    Wu, H. H.; Lee, H. J.; Horng, S. B.; Berec, Luděk

    2007-01-01

    Roč. 249, - (2007), s. 473-486 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : German cockroach * Blattella germanica * Blatella bisignata Subject RIV: EH - Ecology, Behaviour Impact factor: 2.323, year: 2007

  18. Prevalence, dynamics, and biochemical predictors of optic nerve remyelination after methanol-induced acute optic neuropathy: a 2-year prospective study in 54 patients

    Czech Academy of Sciences Publication Activity Database

    Nurieva, O.; Kotíková, K.; Urban, P.; Pelclová, D.; Petřík, V.; Navrátil, Tomáš; Zakharov, S.

    2016-01-01

    Roč. 147, č. 1 (2016), s. 239-249 ISSN 0026-9247 Institutional support: RVO:61388955 Keywords : methanol optic neuropathy * visual evoked potentials * remyelination Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.282, year: 2016

  19. AcEST: DK946532 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FV Structural polyprotein OS=Barmah forest virus... 29 6.3 >sp|Q12594|DMAW_CLAFS ...+ + + C++ PPS S L HF Sbjct: 218 HCAVSTTHQTPDWFPLLCVQSPPSTSPFLGHF 249 >sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest

  20. SHORT COMMUNICATION GOSSIPIUM HIRSUTUM L. EXTRACT ...

    African Journals Online (AJOL)

    Preferred Customer

    inhibit acid corrosion of aluminum in acid solutions, using chemical and electrochemical techniques. ... nitric acid at room temperature, scrubbed with a bristle brush under running water, dried and .... Desalination 2009, 249, 922. 9. Raja, P.B. ...

  1. Intervence rizikových faktorů aterosklerózy a kardiovaskulární úmrtnost. 20letá primárně preventivní studie z pohledu statistika

    Czech Academy of Sciences Publication Activity Database

    Reissigová, Jindra; Tomečková, Marie

    2003-01-01

    Roč. 45, - (2003), s. 249-255 ISSN 0010-8650 R&D Projects: GA MŠk LN00B107 Keywords : primary prevention study * longitudinal study * risk factors * atherosclerosis * mortality * cardiovascular disease Subject RIV: BA - General Mathematics

  2. Retrospektivní sledování stavu smrkových ekosystémů v Národním parku Šumava

    Czech Academy of Sciences Publication Activity Database

    Cudlín, Pavel; Moravec, Ivo; Chmelíková, Ewa

    2001-01-01

    Roč. 6, - (2001), s. 249-258 ISSN 1211-7420 R&D Projects: GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : stress response * crown transformation * secondary structure Subject RIV: GK - Forestry

  3. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

  4. The effect of exopolysaccharide biosynthesis and related enzyme ...

    African Journals Online (AJOL)

    AJB2

    2012-02-21

    Feb 21, 2012 ... hypoglycemic, hypocholesterolemic, anti-HIV and .... Enhanced EPS production. Figure 1 shows the kinetics of EPS production of G .... Enzymatic determination of L-latic acid. Chn J. Anal. Lab. 24(9): 75-77. Chienyan H ...

  5. The how of WOW: a guide to giving a speech that will positively blow 'em away

    National Research Council Canada - National Science Library

    Carlson, Tony

    2005-01-01

    ... Your Speech 249 Appendix D- How About the ROI? 265 Index 269 ... 11182$ CNTS 01-19-05 10:15:57 PS PAGE vi AcknowledgmentsAcknowledgments In the general chatter after a major speech given by a client ...

  6. Saksa Raudtee läheb täna uuele katsele / Katri Soe

    Index Scriptorium Estoniae

    Soe, Katri

    2008-01-01

    Saksa valitsuskoalitsioon hakkab arutama Saksa Raudtee börsilemineku kompromissplaani, mille järgi läheb sügisel börsile 24,9% Deutsche Bahn AG transpordi ja logistikaosast, infrastruktuur jääb riigile

  7. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

  8. 249 The study examined the effect of climate change on the health ...

    African Journals Online (AJOL)

    Osondu

    cloud cover and precipitation (Ebong, 2010). In Nigeria just as in ... Ethiopian Journal of Environmental Studies and Management Vol. 6 No.3 2013 ... Technology, Federal University of Technology Minna, Nigeria. .... There is need for green.

  9. 48 CFR 1652.249-72 - FEHBP termination for default-negotiated benefits contracts.

    Science.gov (United States)

    2010-10-01

    ... negligence of the Carrier. Examples of such causes include (1) acts of God or of the public enemy, (2) acts... negligence of the Carrier. (d) If the failure to perform is caused by the default of a subcontractor at any... without the fault or negligence of either, the Carrier shall not be liable for any excess costs for...

  10. 239,249Pu and 137Cs in the air in Kurchatov, Kazakhstan

    International Nuclear Information System (INIS)

    Lehto, J.; Salminen, S.; Jaakkola, T.

    2005-01-01

    The Semipalatinsk nuclear test site is heavily contaminated from the 465 nuclear weapons tests conducted between 1948 and 1989. Approximately 120 of these tests were surface and air explosions that resulted in the most serious contamination of the soil. Most of these surface and air explosions were carried out on the Experimental Field, on the northern part of the site, about 70 southwest of town Kurchatov. In this area the Pu fallout is even higher than 100.000 Bq/m 2 whereas in the Kurchatov area it is round 1000 Bq/m 2 . In Finland, affected only by the global fallout, a typical value is 30-40 Bq/m 2 . A Finnish team carried out air sampler testing in Kurchatov in 2000-2001. Weekly air samples of 25.000 m 3 volume were taken in a one-year period in Kurchatov. After removal from the samplers the filters were brought to Finland and the gamma nuclides were determined by gamma spectrometry in the laboratories of the Finnish Authority for Radiation and Nuclear Safety (STUK). Then in the Laboratory of Radiochemistry they were leached with concentrated nitric acid and plutonium and uranium isotopes were separated by extraction chromatography using UTEVA and TRU. Plutonium isotopes were measured by alpha spectrometry and the uranium fraction was sent to the Technical Research Centre of Finland for uranium analysis with ICP-MS. Plutonium concentrations in the air in Kurchatov varied in a 100-fold range. The median value for 239,240 Pu was 100 nBq/m 3 and the range was from 14 to 2500 nBq/m 3 . There was no clear seasonal variation seen although somewhat elevated levels were found in February to April. The air concentrations of plutonium were clearly elevated compared to the values found in countries that were affected only by the global fallout. For example, in Munich, Germany, values between 2 and 6 nBq/m 3 have been reported in 1987-1991. However, considerably higher values than those observed in this study have been reported for village Dolon, 30 kilometers east of Kurchatov, where concentrations from 7.400 to 37.000 nBq/m 3 were measured by Dubasov et al. They also determined naturally occurring 210 Po in their air filters and found that its concentration was 1000-times higher than that of plutonium. Concentration of 137 Cs in the air was mainly below the detection limit but in those samples where it was detected the average value was 3.9±1.6 μBq/m 3 . Radiation doses to the population of Kurchatov due to inhalation of air, estimated by the ICRP methodology, were found to be rather low: 0.013 μSv/a for 239,240 Pu and 0.001 μSv/a for 137 Cs at maximum. The annual dose caused by the naturally occurring 210 Po is considerably higher: 13 μSv/a.

  11. Foreign Investment in the U.S.: Costs and Benefits. Headline Series 249.

    Science.gov (United States)

    Zupnick, Elliot

    The document discusses the implications and positive and negative aspects of foreign direct investment in the United States. The objective is to determine whether a restrictive U.S. policy as it relates to foreign direct investment in the United States is desirable. It is presented in five chapters. Chapter I defines foreign direct investment…

  12. the influence of aliphatic side chain of anacardic acid on molecular ...

    African Journals Online (AJOL)

    Mgina

    synthesized and used as a functional monomer to prepare imprinted polymers for comparison with ... precipitation polymerization method. MATERIALS ... HCl. O. OH. O. O. 2. Scheme 1: Synthesis of SaMcr. Salicylic acid (2.49 g, 18 mmol) was.

  13. Accumulation of Ag and Cu in.i. Amanita strobiliformis./i., and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.

    2016-01-01

    Roč. 29, č. 2 (2016), s. 249-264 ISSN 0966-0844 Institutional support: RVO:67985831 Keywords : heavy metals * metal uptake * metallothionein * Copper transporter protein family * ectomycorrhizal fungi Subject RIV: DD - Geochemistry Impact factor: 2.183, year: 2016

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 249 ... Vol 20 (2016), Revisiting the participation of traditional leaders in .... Vol 10, No 2 (2006), The horizontal application of constitutional rights in ... on the environment as part and parcel of integrated development planning?

  15. Aggarwal, Dr Rakesh

    Indian Academy of Sciences (India)

    Specialization: Immunisation, Public Health, Gastrointestinal & Liver Diseases, Viral Hepatitis, Epidemiology and Health Economics Address: Department of Gastroenterology, Sanjay Gandhi Postgraduate Institute of Medical Sciences, Raebareli Road, Lucknow 226 014, U.P.. Contact: Office: (0522) 249 4431. Residence: ...

  16. AUTHOR INDEX

    Indian Academy of Sciences (India)

    In vivo applications of X-ray fluorescence in human subjects. 249 ... varying oxide thickness. 165 ... liquid crystal at 9 GHz under the influence of external ... and CO by positron impact: Theoretical ... X-ray microanalysis for single-particle analy-.

  17. Theoretical Analysis and Preparation of Tapered Suspended Core Microstructure Fibers

    Czech Academy of Sciences Publication Activity Database

    Martan, Tomáš; Kaňka, Jiří; Kašík, Ivan; Matějec, Vlastimil

    2009-01-01

    Roč. 3, č. 3 (2009), s. 233-249 ISSN 1559-9612 Institutional research plan: CEZ:AV0Z20670512 Keywords : tapered fibers * optical sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.354, year: 2009

  18. 17 CFR 229.407 - (Item 407) Corporate governance.

    Science.gov (United States)

    2010-04-01

    ...-CSR (§§ 249.331 and 274.128 of this chapter)), unless the party relying on such report knows or has... expert for any purpose, including without limitation for purposes of section 11 of the Securities Act (15...

  19. Diabetes patients requiring glucose-lowering therapy and nondiabetics with a prior myocardial infarction carry the same cardiovascular risk: a population study of 3.3 million people

    DEFF Research Database (Denmark)

    Schramm, Tina Ken; Gislason, Gunnar H; Køber, Lars

    2008-01-01

    BACKGROUND: Previous studies reveal major differences in the estimated cardiovascular risk in diabetes mellitus, including uncertainty about the risk in young patients. Therefore, large studies of well-defined populations are needed. METHODS AND RESULTS: All residents in Denmark > or = 30 years...... of age were followed up for 5 years (1997 to 2002) by individual-level linkage of nationwide registers. Diabetes patients receiving glucose-lowering medications and nondiabetics with and without a prior myocardial infarction were compared. At baseline, 71 801 (2.2%) had diabetes mellitus and 79 575 (2.......4%) had a prior myocardial infarction. Regardless of age, age-adjusted Cox proportional-hazard ratios for cardiovascular death were 2.42 (95% confidence interval [CI], 2.35 to 2.49) in men with diabetes mellitus without a prior myocardial infarction and 2.44 (95% CI, 2.39 to 2.49) in nondiabetic men...

  20. Shell-model-based deformation analysis of light cadmium isotopes

    Science.gov (United States)

    Schmidt, T.; Heyde, K. L. G.; Blazhev, A.; Jolie, J.

    2017-07-01

    Large-scale shell-model calculations for the even-even cadmium isotopes 98Cd-108Cd have been performed with the antoine code in the π (2 p1 /2;1 g9 /2) ν (2 d5 /2;3 s1 /2;2 d3 /2;1 g7 /2;1 h11 /2) model space without further truncation. Known experimental energy levels and B (E 2 ) values could be well reproduced. Taking these calculations as a starting ground we analyze the deformation parameters predicted for the Cd isotopes as a function of neutron number N and spin J using the methods of model independent invariants introduced by Kumar [Phys. Rev. Lett. 28, 249 (1972), 10.1103/PhysRevLett.28.249] and Cline [Annu. Rev. Nucl. Part. Sci. 36, 683 (1986), 10.1146/annurev.ns.36.120186.003343].

  1. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.

    2008-07-01

    The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  2. Dynamical behaviour of fast electrons in a crystalline lamella; Comportement dynamique des electrons rapides dans une lamelle cristalline

    Energy Technology Data Exchange (ETDEWEB)

    Perio, Pierre; Tournarie, Max [Commissariat a l' energie atomique et aux energies alternatives - CEA (France)

    1960-07-01

    The substitution of the reciprocal space by a 'mixed space' simplifies the use of the dynamical equation. The Friedel law is preserved. The Ventzel-Kramers-Brillouin-Rayleigh approximation appears as a planar approximation and explains the evolution of some images in electron microscopy. Reprint of a paper published in Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 2218-2220, sitting of 23 November 1959 [French] La substitution d'un 'espace mixte' a l'espace reciproque facilite la manipulation de l'equation dynamique. La loi de Friedel est conservee. L'approximation Ventzel-Kramers-Brillouin-Rayleigh apparait comme une approximation plane et explique l'evolution de certaines images en microscopie electronique. Reproduction d'un article publie dans les Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 2218-2220, seance du 23 novembre 1959.

  3. Glutathione S-transferase P1 gene polymorphisms and susceptibility ...

    Indian Academy of Sciences (India)

    M. A. Bhat

    2017-11-28

    Nov 28, 2017 ... Binary logistic regression analysis showed significant association of A/G (odds ratio (OR): 1.6, 95% CI: 1.08–2.49, ... diet, advanced age, smoking, hypertension, diabetes mel- ..... risk of prostate cancer: A meta-analysis.

  4. Microwave Assisted Synthesis and Photoluminescence Properties of ...

    Indian Academy of Sciences (India)

    46

    earth doping of ZnS would not lead to sufficiently bright PL materials. As a result, several new ... photoluminescence characteristics of ZnS nanoparticles doped with Pb2+. New luminescent ..... Papers, San Francisco, CA, USA, 249. [6] Tanaka ...

  5. Maximum effort in the minimum-effort game

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Normann, H.-T.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  6. Kala töötlemine : [andmeid aastatest 1995-2004] / Maarja Purik

    Index Scriptorium Estoniae

    Purik, Maarja

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 49-52. Kalatöötlemise osatähtsus toiduainetööstuses moodustas 2004. a. 11,9% ja ekspordis 24,9%. Tabelid. Diagrammid

  7. Studying Canonical Analysis: A Reply to Thorndike's Comments

    Science.gov (United States)

    Barcikowski, Robert S.; Stevens, James P.

    1976-01-01

    This article is a rejoinder to TM 502 249. Each of Thorndike's comments are examined. A possible solution to the large number of subjects necessary for stable weights and variate-variable correlations using ridge regression procedures is suggested. (RC)

  8. DNA instability in low-risk myelodysplastic syndromes: refractory anemia with or without ring sideroblasts.

    Czech Academy of Sciences Publication Activity Database

    Novotná, Božena; Neuwirtová, R.; Šišková, M.; Bagryantseva, Yana

    2008-01-01

    Roč. 17, č. 14 (2008), s. 2144-2149 ISSN 0964-6906 R&D Projects: GA MZd NR8265 Institutional research plan: CEZ:AV0Z50390512 Keywords : Anemia * DNA Subject RIV: FD - Oncology ; Hematology Impact factor: 7.249, year: 2008

  9. The significance of the tail projections in female entomopathogenic nematodes within the family Steinernematidae

    Czech Academy of Sciences Publication Activity Database

    Mráček, Zdeněk; Půža, Vladimír; Nermuť, Jiří

    2016-01-01

    Roč. 90, č. 2 (2016), s. 249-251 ISSN 0022-149X R&D Projects: GA MŠk LH12105 Institutional support: RVO:60077344 Keywords : Steinernematidae * nematodes * Steinernema arenarium Subject RIV: EG - Zoology Impact factor: 1.420, year: 2016

  10. Cord Blood and Transplants

    Science.gov (United States)

    ... donate their baby’s umbilical cord blood to a public cord blood bank. We have more than 249,000 cord blood ... stored as a cord blood unit at a public cord blood bank for future use. It can then be listed ...

  11. Consumer response to packaging design: The role of packaging materials and graphics in sustainability perceptions and product evaluations

    NARCIS (Netherlands)

    Steenis, N.D.; Herpen, E. van; Lans, I.A. van der; Ligthart, T.N.; Trijp, H.C.M. van

    2017-01-01

    Building on theories of cue utilization, this paper investigates whether and how packaging sustainability influences consumer perceptions, inferences and attitudes towards packaged products. A framework is tested in an empirical study among 249 students using soup products varying in packaging

  12. Andromeda's Liberation in Monastery. Kosmas Damian Asam’s Fresco Painting at Břevnov (1726) Revisited

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan

    2010-01-01

    Roč. 46, č. 46 (2010), s. 234-249 ISSN 0046-1628 R&D Projects: GA AV ČR(CZ) IAA800090902 Institutional research plan: CEZ:AV0Z90090514 Keywords : frescoes * ancient mythology * monastery * Baroque Subject RIV: AA - Philosophy ; Religion

  13. Velocity of small-scale auroral ionospheric current systems over ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    a sub-auroral location during magnetically quiet conditions (ΣKp < 10), but attains an auroral position when the ..... ary 1995, the authors thank the expedition leader, .... 6 245–249. Tighe W G and Rostoker G 1981 Characteristics of west-.

  14. article_6_2012 Sept. edition

    African Journals Online (AJOL)

    AJRH Managing Editor

    249-6830 ... For all, education is positively associated with all four outcomes, and number of children is associated ... At a community level, proximity to a health center or school is positively .... in much of the eastern lakeshore region where this.

  15. Causes of Adult Blindness at Ecwa Eye Hospital, Kano

    African Journals Online (AJOL)

    user

    South America, disorders of the anterior segment of the eye ... associated causes. .... checks, particularly for persons at increased risk, such as ... Cases of refractive errors were not found in this study ... West Afr J Med 2004;23(3):249-52. 8.

  16. Consumer response to packaging design

    NARCIS (Netherlands)

    Steenis, Nigel D.; Herpen, van Erica; Lans, van der Ivo A.; Ligthart, Tom N.; Trijp, van Hans C.M.

    2017-01-01

    Building on theories of cue utilization, this paper investigates whether and how packaging sustainability influences consumer perceptions, inferences and attitudes towards packaged products. A framework is tested in an empirical study among 249 students using soup products varying in packaging

  17. Magnetic structure of molecular magnet Fe[Fe(CN)6]·4H2O

    Indian Academy of Sciences (India)

    perature disordered (paramagnetic) to an ordered magnetic phase transition at 22.6 K. ... three-dimensional network of straight Fe3+–C≡N–Fe3+ chains along the edges of the ... powder diffractometer (λ = 1.249 Å) at Dhruva reactor, Trombay.

  18. Dependence of the human skin protection against the UV solar carcinoma radiation on the sunscreens and cosmetics layer thickness

    Czech Academy of Sciences Publication Activity Database

    Stádník, Bohumil; Jirásková, M.

    2000-01-01

    Roč. 45, č. 3 (2000), s. 241-249 ISSN 0001-7043 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : cancer * fluorescence * patient diagnosis Subject RIV: JB - Sensors, Measurment, Regulation

  19. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g /sup 243/Am, 59 g /sup 244/Cm, 51 mg /sup 249/Bk, 465 mg /sup 252/Cf, 2.5 mg /sup 253/Es, and 1.4 pg /sup 257/Fm. In addition, 45 mg of high-purity /sup 248/Cm was operated from /sup 252/Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality /sup 248/Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that /sup 252/Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of /sup 249/Bk, 520 mg of /sup 252/Cf, 2.0 mg of /sup 253/Es (in a mixture of isotopes), 220 ..mu..g of high-purity /sup 253/Es, and 1.6 pg of /sup 257/Fm. We also expect to obtain 125 mg of high-purity /sup 248/Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any /sup 244/Pu. No changes were made in the chemical processing flowsheets normally used at TRU. Two neutron sources were fabricated, bringing the total fabricated to 77. In special projects, we (1) produced about 1 mg of /sup 250/Cf by irradiation of /sup 249/Bk in HFIR rabbits, and (2) processed some irradiated /sup 248/Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of /sup 249/Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix.

  20. Observation of new spontaneous fission activities from elements 100 to 105

    International Nuclear Information System (INIS)

    Somerville, L.P.

    1982-03-01

    Several new Spontaneous Fission (SF) activities have been found. No definite identification could be made for any of the new SF activities; however, half-lives and possible assignments to element-104 isotopes consistent with several cross bombardments include 257 Rf(3.8 s, 14% SF), 258 Rf(13 ms), 259 Rf(approx. 3 s, 8% SF), 260 Rf(approx. 20 ms), and 262 Rf(approx. 50 ms). The 80-ms SF activity claimed by the Dubna group for the discovery of element 104 ( 260 104) was not observed. A difficulty exists in the interpretation that 260 Rf is a approx. 20-ms SF activity: in order to be correct, for example, the SF activities with half-lives between 14 and 24 ms produced in the reactions 109- to 119-MeV 18 O + 248 Cm, 88- to 100-MeV 15 N + 249 Bk, and 96-MeV 18 O + 249 Cf must be other nuclides due to their large production cross sections, or the cross sections for production of 260 Rf must be enhanced by unknown mechanisms. Based on calculated total production cross sections a possible approx. 1% electron-capture branch in 258 Lr(4.5 s) to the SF emitter 258 No(1.2 ms) and an upper limit of 0.05% for SF branching in 254 No(55 s) were determined. Other measured half-lives from unknown nuclides produced in respective reactions include approx. 1.6 s ( 18 O + 248 CM), indications of a approx. 47-s SF activity (75-MeV 12 C + 249 Cf), and two or more SF activities with 3 s less than or equal to T/sub 1/2/ less than or equal to 60 s ( 18 O + 249 Bk). The most exciting conclusion of this work is that if the tentative assignments to even-even element 104 isotopes are correct, there would be a sudden change in the SF half-life systematics at element 104 which has been predicted theoretically and attributed to the disappearance of the second hump of the double-humped fission barrier

  1. Biobased Carbon Fibers and Thermosetting Resins for Use in DoD Composites Applications

    Science.gov (United States)

    2017-03-01

    modify these base structures can be used to modify simpler or more complex carbohydrates. Modification of monosaccharides , polysaccharides , or even...Am Oil Chem Soc. 2002;79:59–63. Approved for public release; distribution is unlimited. 249 49. Dumitriu S. Polysaccharides : structural

  2. The Role of Drosophila Merlin in the Control of Mitosis Exit and Development

    Science.gov (United States)

    2007-07-01

    axoneme, or with two axonemes, were found. Also, cytoplasmic fragmentation together with condensed cytoplasmic remnants and gigantic cytoplasmic... Endocrine - Related Cancer 2001; 8: 249-258. 33. Faivre S, Kroemer G and Raymond E. Current development of mTOR inhibitors as anticancer agents

  3. Assessment of anaemia and iron status of school age children (aged ...

    African Journals Online (AJOL)

    -12 years in some rural communities in Nigeria as well as identify factors associated with anemia in the children. A total of 249 school children, 120 males and 129 females aged between 7-12 years were used in the study. Haemomoglobin ...

  4. Unit Ministry Team Religious Support to Casualties on the Airland Battlefield

    Science.gov (United States)

    1987-10-28

    Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart

  5. Pleolipoviridae, a newly proposed family comprising archaeal pleomorphic viruses with single-stranded or double-stranded DNA genomes

    Czech Academy of Sciences Publication Activity Database

    Pietilä, M.K.; Roine, E.; Sencilo, Ana; Bamford, D.H.; Oksanen, H.M.

    2016-01-01

    Roč. 161, č. 1 (2016), s. 249-256 ISSN 0304-8608 R&D Projects: GA ČR(CZ) GAP302/11/1940 Institutional support: RVO:61388971 Keywords : VIRION ARCHITECTURE * HALOVIRUSES * SPINDLE Subject RIV: EE - Microbiology, Virology Impact factor: 2.058, year: 2016

  6. Distribution of iron, cobalt , zinc and selenium in macrofungi

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jan; Řanda, Zdeněk

    2007-01-01

    Roč. 6, č. 4 (2007), s. 249-259 ISSN 1617-416X Institutional research plan: CEZ:AV0Z10480505 Keywords : ectomycorrhizal fungi * instrumental neutron activation analysis * terrestrial saprobes Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.259, year: 2007

  7. Survey of Navy Funded Marine Mammal Research and Studies FY 00-01

    Science.gov (United States)

    2001-05-10

    A.L., Bergemann, A.D., Reidenberg, J.S., and Laitman, J.T. (2000) A molecular exploration of the branchial arches: Implications for understanding...insights into the development of the aerodigestive tract: Molecular relationships among branchial arches. Assoc. Res. Otolaryngol. Abstr. Vol. 23:249

  8. 76 FR 33419 - Nationally Recognized Statistical Rating Organizations

    Science.gov (United States)

    2011-06-08

    ... 232, 240, 249, et al. Nationally Recognized Statistical Rating Organizations; Proposed Rule #0;#0...-11] RIN 3235-AL15 Nationally Recognized Statistical Rating Organizations AGENCY: Securities and... rating organizations (``NRSROs''). In addition, in accordance with the Dodd-Frank Act, the Commission is...

  9. Sobre la historia de la traducción en España

    Directory of Open Access Journals (Sweden)

    Manuel Bruña Cuevas

    2011-01-01

    Full Text Available A propósito de la obra de Francisco Lafarga y Luis Pegenaute (eds., Diccionario histórico de la traducción en España (Madrid, Gredos, 2009; 1232 páginas. ISBN: 978-84-249-3626-6.

  10. Radiation hardness properties of full-3D active edge silicon sensors

    Czech Academy of Sciences Publication Activity Database

    Da Via, C.; Hasi, J.; Kenney, C.; Linhart, V.; Parker, S.; Slavíček, T.; Watts, S. J.; Bém, Pavel; Horažďovský, T.; Pospíšil, S.

    2008-01-01

    Roč. 587, 2-3 (2008), s. 243-249 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : silicon detectors * radiation hardness * 3D Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.019, year: 2008

  11. A study of physicians' interest in advising (recommending vasectomy in Egypt

    Directory of Open Access Journals (Sweden)

    Ahmed M. Hassanin

    2017-12-01

    Conclusion: However more than half of physicians had a positive perception of vasectomy, only 24.9% advised Egyptian men to undergo the procedure. Sociocultural factors and religious issues hindered physicians to recommend vasectomy in Egypt. Vasectomy was recommended when it was absolutely needed.

  12. Can war foster cooperation?

    Czech Academy of Sciences Publication Activity Database

    Bauer, Michal; Blattman, C.; Chytilová, Julie; Henrich, J.; Miguel, E.; Mitts, T.

    2016-01-01

    Roč. 30, č. 3 (2016), s. 249-274 ISSN 0895-3309 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : war * conflict * cooperation Subject RIV: AH - Economics Impact factor: 5.727, year: 2016

  13. Superconductivity in dense Mg1–xMxB2 (M= Zr, Nb, Mo; x= 0⋅ 05 ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 28; Issue 3. Superconductivity in dense Mg1–MB2 (M = Zr, Nb, Mo; = 0.05) materials sintered under pressure. S Kalavathi C Divakar. Superconductors Volume 28 Issue 3 June 2005 pp 249-252 ...

  14. The effect of adding a lactic acid bacterial inoculant to maize at ...

    African Journals Online (AJOL)

    Unknown

    Department of Economic affairs, Agriculture and Tourism, Western Cape, P.O. Box 249, George, 6530, South Africa ... Farm (30° 58' S, 22° 25' E, altitude 210m). ... Each period consisted of a 10 day adaption period and 21 day measurement ...

  15. How to hatch from an egg of great structural strength. A study of the common cuckoo

    Czech Academy of Sciences Publication Activity Database

    Honza, Marcel; Picman, J.; Grim, T.; Novák, V.; Čapek Jr., Miroslav; Mrlík, Vojtěch

    2001-01-01

    Roč. 32, č. 3 (2001), s. 249-255 ISSN 0908-8857 R&D Projects: GA AV ČR IAA6087801 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cuculus canorus * eggs Subject RIV: EG - Zoology Impact factor: 1.353, year: 2001

  16. "Sa oled mul teine" : teisesusest eesti kultuuri eneseanalüüsis / Aare Pilv

    Index Scriptorium Estoniae

    Pilv, Aare, 1976-

    2008-01-01

    Kolmest eesti kultuuri eneseanalüüsi kontseptsioonist: "katkestus" (Hasso Krull), "eksistentsialistlik absurdiprojekt" (Jaan Undusk), "enesekolonisatsioon" (Tiit Hennoste). Poleemikat T. Hennoste enesekolonisatsiooni teooriaga (olulisim tekst selle kohta on 2006. a. avaldatud artikkel "Noor-Eesti kui lõpetamata enesekoloniseerimisprojekt"). Sisaldab bibliograafiat. Autorist lk. 249

  17. Search for single production of a vector-like quark via a heavy gluon in the 4b final state with the ATLAS detector in pp collisions at √s = 8 TeV

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2016-01-01

    Roč. 758, Jul (2016), 249-268 ISSN 0370-2693 Institutional support: RVO:68378271 Keywords : CERN LHC Coll * background * composite * benchmark * gluon * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  18. Determination of boron by ICP-AES in normal and malignant cells incubated 'in vitro' with fructose {sup 10}BPA; Determinacion de boro por ICP-AES para el estudio de captacion por celulas malignas y normales incubadas 'in vitro' con fructosa-BPA

    Energy Technology Data Exchange (ETDEWEB)

    Garavaglia, Ricardo N; Farias, Silvia S; Rodriguez, Ruben E; Servant, Roberto E; Liberman, Sara; Pisarev, Mario A; Batistoni, Daniel A [Comision Nacional de Energia Atomica, General San Martin (Argentina). Dept. de Quimica

    1999-07-01

    This paper describes the development and optimization of methodology for total boron concentration in cell cultures coming from fixation and accumulation of this element by normal and malignant cells. On account of sample mass and low volume resulting from dilution, generally about 1 mL, a procedure for automatic injection of micro volumes was designed, developed and optimized. Iron interference was carefully studied. Linear calibration curves were obtained for 50 to 2500 ng B/mL range. Determination limits were 10 and 20 ng B/mL for B 249.772 nm and 249.677 nm, respectively. Repeatability, expressed as relative standard deviation was better than 5% for a 100 ng B/mL. Recovery of analyte added to real samples ranged between 95 and 103%. The method was applied to studies on F-98 cells (rat glioma) and normal glia in BNCT project frame. (author)

  19. Determination of boron by ICP-AES in normal and malignant cells incubated 'in vitro' with fructose 10BPA

    International Nuclear Information System (INIS)

    Garavaglia, Ricardo N.; Farias, Silvia S.; Rodriguez, Ruben E.; Servant, Roberto E.; Liberman, Sara; Pisarev, Mario A.; Batistoni, Daniel A.

    1999-01-01

    This paper describes the development and optimization of methodology for total boron concentration in cell cultures coming from fixation and accumulation of this element by normal and malignant cells. On account of sample mass and low volume resulting from dilution, generally about 1 mL, a procedure for automatic injection of micro volumes was designed, developed and optimized. Iron interference was carefully studied. Linear calibration curves were obtained for 50 to 2500 ng B/mL range. Determination limits were 10 and 20 ng B/mL for B 249.772 nm and 249.677 nm, respectively. Repeatability, expressed as relative standard deviation was better than 5% for a 100 ng B/mL. Recovery of analyte added to real samples ranged between 95 and 103%. The method was applied to studies on F-98 cells (rat glioma) and normal glia in BNCT project frame. (author)

  20. Major clinical outcomes in antiretroviral therapy (ART)-naive participants and in those not receiving ART at baseline in the SMART study

    DEFF Research Database (Denmark)

    Lundgren, Jens; Emery, Sean; Neuhaus, Jacqueline A

    2008-01-01

    BACKGROUND: The SMART study randomized 5,472 human immunodeficiency virus (HIV)-infected patients with CD4+ cell counts >350 cells/microL to intermittent antiretroviral therapy (ART; the drug conservation [DC] group) versus continuous ART (the viral suppression [VS] group). In the DC group......, participants started ART when the CD4+ cell count was ART at entry inform the early use of ART. METHODS: Patients who were either ART naive (n=249) or who had not been receiving ART for >or= 6 months (n=228) were analyzed. The following......). RESULTS: A total of 477 participants (228 in the DC group and 249 in the VS group) were followed (mean, 18 months). For outcome (iv), 21 and 6 events occurred in the DC (7 in ART-naive participants and 14 in those who had not received ART for >or= 6 months) and VS (2 in ART-naive participants and 4...

  1. Study on hydrogen assisted cracking susceptibility of HSLA steel by implant test

    Directory of Open Access Journals (Sweden)

    Gopa Chakraborty

    2016-12-01

    Full Text Available DMR-249A is an indigenously developed high strength low alloy steel for Indian ship building industry for making ship-hull and is extensively used in the construction of war ships and submarines. Welding electrodes conforming to SFA 5.5 AWS E8018 C1 has been indigenously developed for welding of this steel using shielded metal arc welding process. In the present study, susceptibility to hydrogen assisted cracking of DMR-249A steel welds made using this electrode has been assessed using implant test. Implant tests were conducted using this electrode at two different levels of diffusible hydrogen, measured using gas chromatography technique. It is observed that both the steel and the welding consumable are not susceptible to hydrogen assisted cracking even with a high diffusible hydrogen level of 9 mL/100g of weld metal. In implant tests, specimen did not fracture even after loading to stress levels higher than the yield strength of the base metal. The good resistance of this steel and the welding consumable, even with high levels of diffusible hydrogen, is attributed to absence of a susceptible microstructure in both the weld metal and heat affected zone. Hence, this study shows that, in the absence of a susceptible microstructure, hydrogen assisted cracking is unlikely to occur even if hydrogen level is high. It also confirms that in welding of DMR-249A with indigenously developed E8018 C1 electrode, hydrogen assisted cracking is not a concern and no preheating is required to avoid it during welding.

  2. An evaluation of selected Neidium species from the Antarctic Region

    Czech Academy of Sciences Publication Activity Database

    Hamilton, P. B.; De Haan, M.; Kopalová, Kateřina; Zidarova, R.; Van de Vijver, B.

    2014-01-01

    Roč. 29, č. 1 (2014), s. 27-40 ISSN 0269-249X R&D Projects: GA MŠk ME 934; GA MŠk ME 945 Institutional support: RVO:67985939 Keywords : Bacillariophyta * biogeography * Neidium Subject RIV: EF - Botanics Impact factor: 1.746, year: 2014

  3. Gclust Server: 39739 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 39739 PHRA_96515 Cluster Sequences Related Sequences(163) 249 C_scaffold_82000018; ...no annotation 2 1.00e-25 0.0 22.22 0.0 0.0 0.0 0.0 Show 39739 Cluster ID 39739 Sequence ID PHRA_96515 Link t

  4. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3. Volume 115, Issue 3. August 2005, pages 241-369. pp 241-249. Some Properties of ... with some properties which are mathematically and statistically interesting. pp 251-257. Homeomorphisms and the Homology of Non-Orientable Surfaces.

  5. Historiografie biologie a jejich grande dame Ilse Jahnová (1922-2010)

    Czech Academy of Sciences Publication Activity Database

    Hermann, Tomáš; Šimůnek, Michal V.

    2010-01-01

    Roč. 43, č. 4 (2010), s. 249-254 ISSN 0300-4414 R&D Projects: GA ČR GPP410/10/P550 Institutional research plan: CEZ:AV0Z80630520 Keywords : Ilse Jahn * historiography of biology * history of science Subject RIV: AB - History

  6. Carbon Dioxide Emissions Reduction Estimates: Potential Use of ...

    African Journals Online (AJOL)

    , substituting a fraction of the currently used petroleum fuels ... Out of the 1,249,170 tCO2e emitted in 2007, the emissions of CO2 from gasoline and diesel were 25 % and 39 %, respectively. 151,950 vehicles using gasoline were circulating on ...

  7. Determination of dissociation constants of cytokinins by capillary zone electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Barták, P.; Bednář, P.; Stránský, Z.; Boček, Petr; Vespalec, Radim

    2000-01-01

    Roč. 878, č. 2 (2000), s. 249-259 ISSN 0021-9673 R&D Projects: GA MŠk VS96021; GA AV ČR IAA4031703; GA ČR GA203/99/0044 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.551, year: 2000

  8. The list of cyanobacterial species of the Czech Republic to the end of 2009

    Czech Academy of Sciences Publication Activity Database

    Kaštovský, J.; Hauer, Tomáš; Komárek, Jiří; Skácelová, O.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 245-249 ISSN 1802-5439 R&D Projects: GA ČR GA206/08/0318 Institutional research plan: CEZ:AV0Z60050516 Keywords : checklist * cyanobacteria * Czech Republic Subject RIV: EF - Botanics Impact factor: 0.978, year: 2010

  9. Oxidation of LDL and extent of peripheral atherosclerosis

    NARCIS (Netherlands)

    Vijver, L.P.L. van de; Kardinaal, A.F.M.; Duyvenvoorde, W. van; Kruijssen, D.A.C.M.; Grobbee, D.E.; Poppel, G. van; Princen, H.M.G.

    1999-01-01

    Evidence has accumulated for oxidative modification of low-density lipoproteins (LDL) to play an important role in the atherogenic process. Therefore, we investigated the relation between susceptibility of LDL to oxidation and risk of peripheral atherosclerosis among 249 men between 45 and 80 years

  10. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    pp 235-241 Polymers. Synthesis, mechanical, thermal and chemical properties of ... pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene ... showed reduction in g value. pp 251-262 Polymers. Analysis of surface degradation of high density polyethylene (HDPE) insulation material due to tracking.

  11. Optical properties of erbium doped antimony based glasses: Promising visible and infrared amplifiers materials

    Czech Academy of Sciences Publication Activity Database

    Hamzaoui, M.; Soltani, M.; Baazouzi, M.; Tioua, B.; Ivanova, Z.G.; Lebullenger, R.; Poulain, M.; Zavadil, Jiří

    2012-01-01

    Roč. 249, č. 11 (2012), s. 2213-2221 ISSN 0370-1972 R&D Projects: GA ČR GAP106/12/2384 Institutional support: RVO:67985882 Keywords : Glasses * Rare earths * Photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2012

  12. Molecular characterization of phytoplasmas in lilies with fasciation in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Bertaccini, A.; Fránová, Jana; Botti, S.; Tabanelli, D.

    2005-01-01

    Roč. 249, - (2005), s. 79-85 ISSN 0378-1097 R&D Projects: GA AV ČR(CZ) IBS5051014 Institutional research plan: CEZ:AV0Z50510513 Keywords : phytoplasma * Lilium spp. * molecular characterization Subject RIV: EE - Microbiology, Virology Impact factor: 2.057, year: 2005

  13. Retrospektivní sledování stavu smrkových ekoosystémů v Národním parku Šumava

    Czech Academy of Sciences Publication Activity Database

    Cudlín, Pavel; Moravec, Ivo; Chmelíková, Ewa

    2001-01-01

    Roč. 6, - (2001), s. 249-258 ISSN 1211-7420 R&D Projects: GA MŽP SE/610/10/00; GA MŠk OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : norway spruce * multiple stress * crown structure Subject RIV: GK - Forestry

  14. Diel variations in the photosynthetic parameters of Prochlorococcus strain PCC 9511: Combined effects of light and cell cycle

    Czech Academy of Sciences Publication Activity Database

    Bruyant, F.; Babin, M.; Genty, B.; Prášil, Ondřej; Behrenfeld, M. J.; Claustre, H.; Bricaud, A.; Garczarek, L.; Holtzendorff, J.; Koblížek, Michal; Doušová, Helena; Partensky, F.

    2005-01-01

    Roč. 50, č. 3 (2005), s. 850-863 ISSN 0024-3590 R&D Projects: GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z50200510 Keywords : prochlorococcus * phytoplankton Subject RIV: EE - Microbiology, Virology Impact factor: 3.249, year: 2005

  15. Safety in Numbers

    Science.gov (United States)

    2010-11-27

    Bicocca. Dipartimento di Informatica , Sistemistica e Comunicazione. Laboratorio di Test e Analisi del Software, Milano. Technical Report LTA:2004:05...Communications of the ACM, 1981. 24(9): pp. 563-573. 76. Thomas Reps, On the sequential nature of interprocedural program-analysis problems. Acta Informatica

  16. Estrogenic activity of environmental polycyclic aromatic hydrocarbons in uterus of immature Wistar rats

    Czech Academy of Sciences Publication Activity Database

    Kummer, V.; Mašková, J.; Zralý, Z.; Neča, J.; Šimečková, P.; Vondráček, Jan; Machala, M.

    2008-01-01

    Roč. 180, č. 3 (2008), s. 212-221 ISSN 0378-4274 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : polycyclic aromatic hydrocarbons * rat immature uterothrophic assay * estrogen receptor Subject RIV: BO - Biophysics Impact factor: 3.249, year: 2008

  17. Interference of Bifidobacterium choerinum or Escherichia coli Nissle 1917 with Salmonella Typhimurium in gnotobiotic piglets correlates with cytokine patterns in blood and intestine

    Czech Academy of Sciences Publication Activity Database

    Šplíchalová, Alla; Trebichavský, Ilja; Rada, V.; Vlková, E.; Sonnenborn, U.; Šplíchal, Igor

    2011-01-01

    Roč. 163, č. 2 (2011), s. 242-249 ISSN 0009-9104 R&D Projects: GA ČR GA523/07/0572 Institutional research plan: CEZ:AV0Z50200510 Keywords : Bifidobacterium * gnotobiotic pig * cytokine Subject RIV: EC - Immunology Impact factor: 3.360, year: 2011

  18. 76 FR 8946 - Security Ratings

    Science.gov (United States)

    2011-02-16

    ... grade securities (such as foreign currency or other cash settled derivative securities). See... investment grade securities (such as foreign currency or other cash settled derivative securities). See... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 200, 229, 230, 232, 239, 240, and 249 [Release No...

  19. Refinement of the basis and impact of common 11q23.1 variation to the risk of developing colorectal cancer

    Czech Academy of Sciences Publication Activity Database

    Pittman, A.M.; Webb, E.; Carvajal-Carmona, L.; Howarth, K.; Di-Bernardo, M.; Broderick, P.; Spain, S.; Walther, A.; Price, A.; Sullivan, K.; Twiss, P.; Fielding, S.; Rowan, A.; Jaeger, E.; Vijayakrishnan, J.; Chandler, I.; Penegar, S.; Qureshi, M.; Lubbe, S.; Domingo, E.; Kemp, Z.; Barclay, E.; Wood, W.; Martin, L.; Gorman, M.; Thomas, H.; Peto, J.; Bishop, T.; Gray, R.; Maher, E.R.; Lucassen, A.; Kerr, D.; Evans, G.; van Wezel, T.; Morreau, H.; Wijnen, J.T.; Hopper, J.L.; Southey, M.C.; Giles, G.G.; Försti, A.; Hemminki, K.; Vodička, Pavel; Naccarati, Alessio; Lipton, L.; Ho, J.W.C.; Cheng, K.K.; Sham, P.C.; Luk, J.; Agúndez, J.A.G.; Ladero, J.M.; de la Hoya, M.; Caldés, T.; Niittymäki, I.; Tuupanene, S.; Karhu, A.; Aaltonen, L.; Cazier, J.B.; Tomlinson, I.P.M.; Houlston, R.S.

    2008-01-01

    Roč. 17, č. 23 (2008), s. 3720-3727 ISSN 0964-6906 R&D Projects: GA ČR GA310/07/1430 Institutional research plan: CEZ:AV0Z50390703 Keywords : Polymorphism * CRC Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.249, year: 2008

  20. Pregnancy Specific Glycoprotein 17 Binds to the Extracellular Loop 2 of its Receptor, CD9, and Induces the Secretion of IL-lO, IL-6, PGE2 and TGFbeta1 in Murine Macrophages

    Science.gov (United States)

    2004-07-09

    produced in CHO cells using standard methodology (Southern Biotec, Birmingham, AL). For immunoblot analysis, the following Abs were employed: anti-myc...Experimental Cell Reserach . 1999. p. 243- 249. 5. Rudert, F., W. Zimmermann, and J.A. Thompson, Intra- and interspecies analyses of the carcinoembryonic

  1. Charge distribution within hypercarbon-halogenated 1-Ph-2-X-1,2-dicarba-closo-dodecaboranes, (X = F, Cl, Br, I): A dipole moment and computational study

    Czech Academy of Sciences Publication Activity Database

    Hnyk, Drahomír; Všetečka, V.; Drož, L.

    2010-01-01

    Roč. 978, 1-3 (2010), s. 246-249 ISSN 0022-2860 R&D Projects: GA MŠk LC523 Institutional research plan: CEZ:AV0Z40320502 Keywords : halogens * carboranes * dipole moments Subject RIV: CA - Inorganic Chemistry Impact factor: 1.599, year: 2010

  2. Deformation effects in rock massifs and their long-term monitoring

    Czech Academy of Sciences Publication Activity Database

    Košťák, Blahoslav

    2006-01-01

    Roč. 39, č. 3 (2006), s. 249-258 ISSN 1470-9236 R&D Projects: GA MŠk(CZ) OC 625.10 Institutional research plan: CEZ:AV0Z30460519 Keywords : anchors * extensometers * monitoring Subject RIV: DO - Wilderness Conservation Impact factor: 0.778, year: 2006

  3. 64 original article optimization of rna extraction in mycobacterium

    African Journals Online (AJOL)

    Dr Oboro VO

    ... on thick 7H10 agar plates supplemented with 10% oleic acid- ... RNA lysis solution (0.15 M sucrose, 10 mM sodium acetate [pH 5.2] .... medium was discarded and the infected macrophage ..... Clin Invest 1995, 96(1):245-249. 18. Buchmeier ...

  4. Family Characteristics of Children with Dyslexia.

    Science.gov (United States)

    Melekian, Badrig A.

    1990-01-01

    A retrospective review of 249 French children (ages 8-15) with severe dyslexia found that families were characterized by low occupational status and educational level for parents and predominance of high-ranking children in large sibships. Parental age and matrimonial status seemed unimportant. (Author/JDD)

  5. Worldwide Report: Epidemiology. No. 326

    Science.gov (United States)

    1983-08-02

    for this disease. Chancroid accounted for 24,9 percent, non-gonnococcal urethritis for 11,3 percent, lymphogranuloma venereum for 8,2 percent and...second major change was the decrease in chancroid and the possibility that education programmes contributed should not be overlooked. [Text] [Harare

  6. Establishment of target and invasive plant species on a reclaimed coal mining dump in relation to their occurrence in the surroundings

    Czech Academy of Sciences Publication Activity Database

    Kabrna, M.; Hendrychová, M.; Prach, Karel

    2014-01-01

    Roč. 28, č. 4 (2014), s. 242-249 ISSN 1748-0930 R&D Projects: GA ČR(CZ) GAP505/11/0256 Institutional support: RVO:67985939 Keywords : mining * reclamation * vascular plant s Subject RIV: EH - Ecology, Behaviour Impact factor: 0.562, year: 2014

  7. The Mediterranean: high discovery rates for a well-studied trematode fauna

    Czech Academy of Sciences Publication Activity Database

    Pérez-del-Olmo, A.; Kostadinova, Aneta; Gibson, D. I.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 249-256 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Digenean species diversity * marine fishes * parasites Subject RIV: EG - Zoology Impact factor: 1.181, year: 2016

  8. Effects of the endemic earthworm .i.Allolobophora hrabei./i. (Černosvitov, 1935) on soil microbial communities of steppe grasslands

    Czech Academy of Sciences Publication Activity Database

    Jirout, Jiří; Pižl, Václav

    2014-01-01

    Roč. 76, September (2014), s. 249-256 ISSN 0038-0717 R&D Projects: GA ČR GAP504/12/0536 Institutional support: RVO:60077344 Keywords : bacteria * archaea * fungi * community composition * DGGE * earthworm Subject RIV: EH - Ecology, Behaviour Impact factor: 3.932, year: 2014

  9. optimization of crystal violet dye removal from aqueous solution

    African Journals Online (AJOL)

    maje malamiyo

    -Journal of Chemistry, 6(4):1109-1116. Malik P.K. (2003): Use of activated carbons prepared from sawdust and rice-husk for Adsorption of acid dyes: a case study of acid yellow 36,. Dyes Pigments 56:239-249. Malik, R., Ramteke, D.S., and ...

  10. Emotion regulation and disease adjustment in women and men with rheumatoid arthritis

    NARCIS (Netherlands)

    van Middendorp, Henriet; Geenen, Rinie; Sorbi, Marjolijn J.; Vingerhoets, Ad J. J. M.; van Doornen, Lorenz J. P.; Bijlsma, Johannes W. J.

    2008-01-01

    Strategies to regulate emotions (alexithymia, affect intensity, and emotional expression) were examined by questionnaires in 249 female and 96 male patients with rheumatoid arthritis (RA; age range: 19-87 years) and compared to the scores of 196 female control participants (age range: 19-82 years).

  11. A Method to Identify Best Available Technologies (BAT) for Hydrogenation Reactors in the Pharmaceutical Industry

    Czech Academy of Sciences Publication Activity Database

    Le Doan, T.V.; Stavárek, Petr; de Bellefon, C.

    2012-01-01

    Roč. 2, č. 3 (2012), s. 77-82 ISSN 2062-249X Grant - others:IMPULSE(XE) FP6-NMP2-CT-2005-011816 Institutional support: RVO:67985858 Keywords : hydrogenation * pharmaceuticals * methodology Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.091, year: 2012

  12. Data of evolutionary structure change: 1DFFA-3CPMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DFFA-3CPMA 1DFF 3CPM A A -----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDM...line> 3CPM A 3CPMA THR CA 218 GLY CA 249 ILE CA 245 3CPM... A 3CPMA IKKYSDKLVPFILE CA 305 ARG CA 316 GLN CA 241 3CPM

  13. Industrial Perspectives of Work Place Basics and Training Delivery Services.

    Science.gov (United States)

    Logan, Joyce; Byers, Charles

    1991-01-01

    Kentucky employers (249 of 800 surveyed) identified adaptability, teamwork, communication, and problem solving as entry-level and advancement skills. Over 50 percent did no preemployment testing. Responses indicated areas needing change: training focused on workplace basics, accessible training delivery, and preemployment assessment services. (SK)

  14. Několik textů z odpustkové aféry aneb co je nového v roce 1412

    Czech Academy of Sciences Publication Activity Database

    Soukup, Pavel

    2015-01-01

    Roč. 7, č. 2 (2015), s. 249-288 ISSN 1804-0977 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : indulgences * Hussitism * Wycliffism * religious polemics * medieval theology * John XXIII (antipope) * Jan Hus Subject RIV: AB - History

  15. Iodine deficiency in pregnancy and the effects of maternal iodine supplementation on the offspring: a review

    NARCIS (Netherlands)

    Zimmermann, M.B.

    2009-01-01

    The World Health Organization (WHO) recently increased their recommended iodine intake during pregnancy from 200 to 250 µg/d and suggested that a median urinary iodine (UI) concentration of 150-249 µg/L indicates adequate iodine intake in pregnant women. Thyrotropin concentrations in blood collected

  16. 40 CFR 51.121 - Findings and requirements for submission of State implementation plan revisions relating to...

    Science.gov (United States)

    2010-07-01

    ... Carolina, Ohio, Pennsylvania, Rhode Island, South Carolina, Tennessee, Virginia, West Virginia, and the...,406 New Jersey 96,876 New York 240,322 North Carolina 165,306 Ohio 249,541 Pennsylvania 257,928 Rhode..., Russell, St. Clair, Shelby, Sumter, Talladega, Tallapoosa, Tuscaloosa, Walker, and Winston. (C) [Reserved...

  17. Vliv vegetačního krytu na disipaci energie a vodní režim v krajině - dopady na interakce biotických a abiotických složek v povrchových vodách

    Czech Academy of Sciences Publication Activity Database

    Pechar, Libor; Pokorný, Jan; Procházka, J.; Wotavová, K.; Pecharová, E.; Švehla, J.

    2004-01-01

    Roč. 3, č. 21 (2004), s. 249-255 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] Institutional research plan: CEZ:AV0Z6087904 Keywords : Landscape function * water cycle * remote sensing Subject RIV: DO - Wilderness Conservation

  18. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  19. Zirconium determination in rocks by solid-phase spectrophotometry

    International Nuclear Information System (INIS)

    Brykina, G.D.; Lebedeva, G.G.; Agapova, G.F.; AN SSSR, Moscow

    1990-01-01

    A method was developed for determination of zirconium in rocks by solid-phase spectrophotometry using AV-17x8-Cl anion exchanger modified with xylenol orange. Relative standard deviation at the level of (2-4.9)x10 -3 % ZrO 2 was about 0.245

  20. Cyberbullying Behaviors among Female College Students: Witnessing, Perpetration, and Victimization

    Science.gov (United States)

    Selkie, Ellen M.; Kota, Rajitha; Moreno, Megan

    2016-01-01

    Problem: Cyberbullying is common among adolescents, and emerging studies also describe this phenomenon in college students. Less is known about specific cyberbullying behaviors and roles in cyberbullying incidents experienced by college females. Methods: 249 female students from 4 colleges completed online surveys assessing involvement in 11…

  1. Untitled

    Indian Academy of Sciences (India)

    The Source of Acetylcholine in the Frog's Heart on Direct Electrical Stimulation . . . . Inderjit Singh, Sunita Inderjit Singh and O. P. Bhatmagar 249. The Skull of Hemirhamphus xanthopterus Cuv. & Val. . . . . . . . . . . . P. N. Mathur, Narain Khattar and Kumari M. Zachariah 255. Studies on the Microbial Spoilage of Canned Food.

  2. 12 CFR 335.251 - Forms for notification of action taken by national securities exchanges.

    Science.gov (United States)

    2010-01-01

    ... national securities exchanges. 335.251 Section 335.251 Banks and Banking FEDERAL DEPOSIT INSURANCE... for notification of action taken by national securities exchanges. The applicable forms for notification of action taken by national securities exchanges are codified in subpart A of 17 CFR part 249. All...

  3. New methodology for capillary electrophoresis with ESI-MS detection: Electrophoretic focusing on inverse electromigration dispersion gradient. High-sensitivity analysis of sulfonamides in waters

    Czech Academy of Sciences Publication Activity Database

    Malá, Zdeňka; Gebauer, Petr; Boček, Petr

    2016-01-01

    Roč. 935, SEP (2016), s. 249-257 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GA16-09135S Institutional support: RVO:68081715 Keywords : electrophoretic focusing * CE-ESI-MS * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.950, year: 2016

  4. Research

    African Journals Online (AJOL)

    2012-10-30

    Oct 30, 2012 ... Prevalence of lipodystrophy and metabolic syndrome among HIV positive ... Use of highly active antiretroviral therapy has led to significant ..... Hypertriglyceridemia were detected in 39%, hypertension in 35.1%, impaired fasting plasma glucose in 24.9%, low HDL .... resistance due to altered fat distribution.

  5. Chloroguanide metabolism in relation to the efficacy in malaria prophylaxis and the S-mephenytoin oxidation in Tanzanians

    DEFF Research Database (Denmark)

    Skjelbo, E; Mutabingwa, T K; Bygbjerg, Ib Christian

    1996-01-01

    S-Mephenytoin and chloroguanide (proguanil) oxidation was studied in 216 tanzanians. The mephenytoin S/R ratio in urine ranged from 0.9, were arbitrarily defined as poor metabolizers of mephenytoin. The chloroguanide/cycloguanil ratio ranged from 0.82 to 249. There was a significant correlation b...

  6. Categorizing moving objects into film genres: The effect of animacy attribution, emotional response, and the deviation from non-fiction

    NARCIS (Netherlands)

    Visch, V.T.; Tan, E.S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. American Journal of Psychology, 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). The perception of causality (T.R. Miles & E. Miles, Trans.).

  7. On the Evolutionary Stage of the Unclassified B[e] Star CD-42°11721

    Czech Academy of Sciences Publication Activity Database

    Borges Fernandes, M.; Kraus, Michaela; Lorenz Martins, S.; de Araújo, F. X.

    2007-01-01

    Roč. 377, č. 3 (2007), s. 1343-1362 ISSN 0035-8711 R&D Projects: GA AV ČR KJB300030701 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * emission-line * identification Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.249, year: 2007

  8. African Journal of Psychiatry - Vol 9, No 4 (2006)

    African Journals Online (AJOL)

    The barriers preventing effective treatment of South African patients with mental health problems · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. L Trump, C Hugo, 249-260. http://dx.doi.org/10.4314/ajpsy.v9i4.30224 ...

  9. Improved detectability of barbiturates in high-performance liquid chromatography by pre-column labelling and ultraviolet detection

    NARCIS (Netherlands)

    Hulshoff, A.; Roseboom, H.; Renema, J.

    1979-01-01

    2-Naphthacyl derivatives of barbiturates are formed in acetone at 30° within 30 min, in an essentially quantitative manner, using caesium carbonate as a catalyst. These derivatives absorb UV radiation strongly at 254 nm. Using a variable-wavelength detector set at 249 nm, 1 ng of

  10. Antimicrobial activity of Mucuna pruriens on selected bacteria

    African Journals Online (AJOL)

    SERVER

    2007-09-19

    Sep 19, 2007 ... Manyam BV, Dhanasekaran M, Hare TA (1995). An Alternative. Medicine Treatment for Parkinson's diease: Results of a Multicenter. Clinical Trial, J. Altern. Complement Med., 1(3): 249-255. Russell AD, Furr JR (1977). Antibacterial activity of a new chloroxylenol preparation containing ethylenediamine ...

  11. Positive predictive value of diagnosis coding for hemolytic anemias in the Danish National Patient Register

    DEFF Research Database (Denmark)

    Hansen, Dennis Lund; Overgaard, Ulrik Malthe; Pedersen, Lars

    2016-01-01

    . Patients with mechanical reason for hemolysis such as an artificial heart valve, and patients with vitamin-B12 or folic acid deficiency were excluded. RESULTS: We identified 412 eligible patients: 249 with a congenital hemolytic anemia diagnosis and 163 with acquired hemolytic anemia diagnosis. In all...

  12. Subjektivní blahobyt v České republice a střední Evropě: makro- a mikro-determinanty

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří

    2014-01-01

    Roč. 62, č. 2 (2014), s. 249-270 ISSN 0032-3233 R&D Projects: GA ČR(CZ) GAP404/11/1521 Institutional support: RVO:68378025 Keywords : subjective well-being * life satisfaction * Central Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.650, year: 2014

  13. Using the Fish Larvae and Egg Exposure System (FLEES) to Generate Effects Data for Informing Environmental Windows

    Science.gov (United States)

    2017-03-01

    not stationary and continuously move as dredge materials are removed; and 3) the fanning behavior of fish, such as SMB, can disperse fine-grained...235–249. Gordon, A. K., and C. G. Palmer. 2015. Defining an exposure-response relationship for suspended kaolin clay particulates and aquatic

  14. Carboxyl-functionalized magnetic microparticle carrier for isolation and identification of DNA in dairy products

    Czech Academy of Sciences Publication Activity Database

    Horák, Daniel; Rittich, B.; Španová, A.

    2007-01-01

    Roč. 311, č. 1 (2007), s. 249-254 ISSN 0304-8853 R&D Projects: GA ČR GA525/05/0311 Institutional research plan: CEZ:AV0Z40500505 Keywords : magnetic particles * DNA * magnetite Subject RIV: GM - Food Processing Impact factor: 1.704, year: 2007

  15. Belongingness and Suicidal Ideation in College Students

    Science.gov (United States)

    Ploskonka, Rachel A.; Servaty-Seib, Heather L.

    2015-01-01

    Objective: In this study, the relationships between 3 specific domains of belongingness (ie, family, peers, and academic institution) were examined with respect to suicidal ideation. Participants: A sample (N = 249) of undergraduate students was recruited from a large, midwestern university during the Spring 2013 semester. Methods: Multiple…

  16. Review of prognostic and predictive aspects of mutated TP53 in Wilms’ tumor biology with morphological report and molecular analysis of 37-year-old man’s nephroblastoma

    Directory of Open Access Journals (Sweden)

    Andrzej Wincewicz

    2017-02-01

    Full Text Available Here we review prognostic and predictive aspects of mutated TP53 in Wilms’ tumor biology on the basis of the morphological report and molecular analysis of adult nephroblastoma (diffuse blastemal pattern of a 37-year-old man. Among quite different proteins, TP53 affects expression of several genes such as hypoxia inducible proteins GLUT1 and EPO as well as multidrug resistance (MDR mediated by P-glycoprotein (Pgp/MDR1 and multidrug-resistant related protein (MRP1, with certain clinical implications. TP53 mutation was found both in our primary tumor (c.746G>T p.R249M frequency 92% and in nodal metastasis (c.746G>T p.R249M frequency 90%, and the common polymorphism p.P72R in the same gene was revealed with frequency of about 97% in both primary tumor and metastatic disease with appliance of NGS technology (IonTorrent – LifeTechnology using Ion AmpliSeq Cancer Hotspot Panel v2.

  17. Lattice NRQCD study on in-medium bottomonium spectra using a novel Bayesian reconstruction approach

    International Nuclear Information System (INIS)

    Kim, Seyong; Petreczky, Peter; Rothkopf, Alexander

    2016-01-01

    We present recent results on the in-medium modification of S- and P-wave bottomonium states around the deconfinement transition. Our study uses lattice QCD with N f = 2 + 1 light quark flavors to describe the non-perturbative thermal QCD medium between 140MeV < T < 249MeV and deploys lattice regularized non-relativistic QCD (NRQCD) effective field theory to capture the physics of heavy quark bound states immersed therein. The spectral functions of the 3 S 1 (ϒ) and 3 P 1 (χ b1 ) bottomonium states are extracted from Euclidean time Monte Carlo simulations using a novel Bayesian prescription, which provides higher accuracy than the Maximum Entropy Method. Based on a systematic comparison of interacting and free spectral functions we conclude that the ground states of both the S-wave (ϒ) and P-wave (χ b1 ) channel survive up to T = 249MeV. Stringent upper limits on the size of the in-medium modification of bottomonium masses and widths are provided

  18. Rasgos epidemiológicos de ciegos y débiles visuales por retinosis pigmentaria en la provincia Las Tunas Epidemiologic traits of the blind and visually handicapped due to retinitis pigmantosa in the province of Las Tunas

    Directory of Open Access Journals (Sweden)

    Luisa González Hess

    2003-06-01

    Full Text Available Se estudiaron 325 pacientes con el diagnóstico retinosis pigmentaria en la provincia Las Tunas. De ellos, se encontró que el 24,9 y el 10 % eran ciegos y débiles visuales respectivamente, donde se obtuvo una tasa de ciegos por retinosis pigmentaria de 1,45 x 10 000 habitantes y de débiles visuales de 0,6 x 10 000 habitantes. El tipo de herencia que predominó en ambos grupos fue la autosómica recesiva.325 patients with the diagnosis of retinitis pigmentosa were studied in the province of Las Tunas. Of them, it was found that 24.9 % and 10 % were blind and visually handicapped, respectively. A rate of blind patients caused by retinitis pigmentosa of 1.45 x 10 000 inhabitants and of visually handicapped of 0.6 x 10 000 inhabitants was obtained. The type of inheritance predominating in both groups was the autosomal recessive inheritance.

  19. Asymmetries in four powerful radio sources

    International Nuclear Information System (INIS)

    Lonsdale, C.J.; Morison, I.

    1983-01-01

    The extragalactic radio sources 3C 153, 196, 249.1 and 268.4 have been observed at frequencies of 408 and 1666 MHz with the new MERLIN array operated by Jodrell Bank, giving resolutions of approx. 0.9 and 0.25 arcsec respectively. The sources show marked asymmetries about the central object in spectral index, flux and morphology, which we believe are most naturally accounted for by the effects of a time-dependent asymmetry in the central powerhouse. In the case of 3C 249.1 the observations suggest that energy is being supplied alternately to the two sides of the source. The 1666-MHz observations also show that each of the other three sources contains one extremely compact hotspot. The minimum internal energy densities in these hotspots are such that confinement by ram pressure of motion through the intergalactic medium may not be possible, indicating that such features are transient phenomena in free expansion, or that some other confinement mechanism is operating. (author)

  20. Influence of the anisotropy of expansion coefficients on the elastic properties of uranium of zirconium and of zinc; Influence de l'anisotropie des coefficients de dilatation sur les proprietes elastiques de l'uranium du zirconium et du zinc

    Energy Technology Data Exchange (ETDEWEB)

    Calais, Daniel; Saada, Georges; Simenel, Nicole [Commissariat a l' energie atomique et aux energies alternatives - CEA (France)

    1959-07-01

    The anisotropy of the expansion coefficients of uranium, zirconium and zinc provoke internal tensions in the course of cooling these metals. These tensions are eliminated in the case of zinc by restoration to room temperature, but persist in uranium and zirconium and are responsible for the absence of an elastic limit in these two metals. Reprint of a paper published in Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 1225-1227, sitting of 5 October 1959 [French] L'anisotropie des coefficients de dilatation de l'uranium, du zirconium et du zinc provoque au cours du refroidissement de ces metaux des tensions internes. Eliminees par restauration a la temperature ambiante dans le cas du zinc, ces tensions persistent pour l'uranium et le zirconium et sont responsable de l'absence de limite elastique dans ces deux metaux. Reproduction d'un article publie dans les Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 1225-1227, seance du 5 octobre 1959.

  1. Inhibition between 350 and 500 deg. C of the corrosion of magnesium by damp air; Inhibition entre 350 et 500 deg. C de la corrosion du magnesium par l'air humide

    Energy Technology Data Exchange (ETDEWEB)

    Darras, Raymond; Caillat, Roger [Commissariat a l' energie atomique et aux energies alternatives - CEA (France)

    1960-07-01

    It has been demonstrated that the formation of a fluoride layer on the surface of magnesium by either dry or wet methods raises the temperature to which it resists corrosion in damp air from 350 to 490 deg. C. This protection effect could lead to a revision of the Pilling and Bedworth rule. Reprint of a paper published in 'Comptes Rendus des Seances de l'Academie des Sciences', tome 249, p. 1517-1519, sitting of 19 October 1959 [French] Il a ete montre que la formation d'une couche fluoree a la surface du magnesium, soit par voie seche, soit par voie humide, permet d'elever de 350 a 490 deg. C la temperature jusqu'a laquelle il resiste a la corrosion dans l'air humide. Cet effet protecteur pourrait conduire a revoir la regle de Pilling et Bedworth. Reproduction d'un article publie dans les 'Comptes Rendus des Seances de l'Academie des Sciences', tome 249, p. 1517-1519, seance du 19 octobre 1959.

  2. About the existing linear relation between the material velocity and the shock wave velocity propagating inside a metal; Au sujet de la relation lineaire existant entre la vitesse materielle et la vitesse de l'onde de choc se propageant dans un metal

    Energy Technology Data Exchange (ETDEWEB)

    Berger, Jean; Joigneau, Suzanne [Commissariat a l' energie atomique et aux energies alternatives - CEA (France)

    1960-07-01

    It was found that, for solids and more particularly for metals, in huge fields of shock pressure, the wave velocity is a linear function of the material velocity. A theoretical calculation allows to demonstrate this linear law and to calculate its parameters which are compared to experimental data. Reprint of a paper published in Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 2506-2508, sitting of 9 December 1959 [French] Il a ete constate que, pour les solides et plus particulierement pour les metaux, dans de larges domaines de pression de choc, la vitesse de l'onde etait une fonction lineaire de la vitesse materielle. Un calcul theorique nous permet de retrouver cette loi lineaire et d'en calculer les parametres; ceux-ci sont alors compares aux donnees experimentales. Reproduction d'un article publie dans les Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 2506-2508, seance du 9 decembre 1959.

  3. Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

    Science.gov (United States)

    Cokorinos, Emily C; Delmore, Jake; Reyes, Allan R; Albuquerque, Bina; Kjøbsted, Rasmus; Jørgensen, Nicolas O; Tran, Jean-Luc; Jatkar, Aditi; Cialdea, Katherine; Esquejo, Ryan M; Meissen, John; Calabrese, Matthew F; Cordes, Jason; Moccia, Robert; Tess, David; Salatto, Christopher T; Coskran, Timothy M; Opsahl, Alan C; Flynn, Declan; Blatnik, Matthew; Li, Wenlin; Kindt, Erick; Foretz, Marc; Viollet, Benoit; Ward, Jessica; Kurumbail, Ravi G; Kalgutkar, Amit S; Wojtaszewski, Jørgen F P; Cameron, Kimberly O; Miller, Russell A

    2017-05-02

    The AMP-activated protein kinase (AMPK) is a potential therapeutic target for metabolic diseases based on its reported actions in the liver and skeletal muscle. We evaluated two distinct direct activators of AMPK: a non-selective activator of all AMPK complexes, PF-739, and an activator selective for AMPK β1-containing complexes, PF-249. In cells and animals, both compounds were effective at activating AMPK in hepatocytes, but only PF-739 was capable of activating AMPK in skeletal muscle. In diabetic mice, PF-739, but not PF-249, caused a rapid lowering of plasma glucose levels that was diminished in the absence of skeletal muscle, but not liver, AMPK heterotrimers and was the result of an increase in systemic glucose disposal with no impact on hepatic glucose production. Studies of PF-739 in cynomolgus monkeys confirmed translation of the glucose lowering and established activation of AMPK in skeletal muscle as a potential therapeutic approach to treat diabetic patients. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. 17 CFR 249.103 - Form 3, initial statement of beneficial ownership of securities.

    Science.gov (United States)

    2010-04-01

    ... information in investigations or litigation involving the federal securities laws or other civil, criminal, or... affecting Form 3, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  5. 17 CFR 249.105 - Form 5, annual statement of beneficial ownership of securities.

    Science.gov (United States)

    2010-04-01

    ... information in investigations or litigation involving the federal securities laws or other civil, criminal, or... affecting Form 5, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  6. 26 CFR 1.249-1 - Limitation on deduction of bond premium on repurchase.

    Science.gov (United States)

    2010-04-01

    ... A issues a callable 20-year convertible bond at face for $1,000 bearing interest at 10 percent per... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Limitation on deduction of bond premium on... deduction of bond premium on repurchase. (a) Limitation—(1) General rule. No deduction is allowed to the...

  7. A survey for piroplasmids in horses and Bactrian camels in North-Eastern Mongolia

    Czech Academy of Sciences Publication Activity Database

    Sloboda, M.; Jirků, Milan; Lukešová, D.; Qablan, M.; Batsukh, Z.; Fiala, Ivan; Horin, P.; Modrý, David; Lukeš, Julius

    2011-01-01

    Roč. 179, 1-3 (2011), 246-249 ISSN 0304-4017 R&D Projects: GA ČR GA523/09/1972 Institutional research plan: CEZ:AV0Z60220518 Keywords : Piroplasmosis * Babesia * Theileria * Horse * Bactrian camel * Dog Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.579, year: 2011

  8. Myths and Misconceptions in Popular Psychology: Comparing Psychology Students and the General Public

    Science.gov (United States)

    Furnham, Adrian; Hughes, David J.

    2014-01-01

    This study examined the prevalence of psychological myths and misconceptions among psychology students and within the general population. In total, 829 participants completed a 249-item questionnaire designed to measure a broad range of psychological myths. Results revealed that psychological myths and misconceptions are numerous and widely held.…

  9. Size-Resolved Penetration Through High-Efficiency Filter Media Typically Used for Aerosol Sampling

    Czech Academy of Sciences Publication Activity Database

    Zíková, Naděžda; Ondráček, Jakub; Ždímal, Vladimír

    2015-01-01

    Roč. 49, č. 4 (2015), s. 239-249 ISSN 0278-6826 R&D Projects: GA ČR(CZ) GBP503/12/G147 Institutional support: RVO:67985858 Keywords : filters * size-resolved penetration * atmospheric aerosol sampling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.953, year: 2015

  10. The Roles of Corporate Governance in Bank Failures during the Recent Financial Crisis

    NARCIS (Netherlands)

    Berger, A.N.; Imbierowicz, B.; Rauch, C.

    2012-01-01

    Abstract: This paper analyzes the roles of corporate governance in bank defaults during the recent financial crisis of 2007-2010. Using a data sample of 249 default and 4,021 no default US commercial banks, we investigate the impact of bank ownership and management structures on the probability of

  11. Pesticide residues in fruit and vegetables from Africa - a Nordic Project

    DEFF Research Database (Denmark)

    Petersen, Annette

    . Most of the samples came from South Africa (249), followed by Egypt (129), Morocco (92) and Kenya (88). In total 45 different commodities were analyzed, oranges (162) being the largest group, followed by beans with pods (80) and table grapes (71). In the analytical scope 220 to 345 pesticides...

  12. CONTRACTION CHARACTERISTICS AND MYOSIN HEAVY-CHAIN COMPOSITION OF RABBIT MASSETER MOTOR UNITS

    NARCIS (Netherlands)

    KWA, SHS; WEIJS, WA; JUCH, PJW

    1. We studied isometric twitch peak force (TPF) and twitch contraction time (TCT) of 249 motor units of the masseter muscle in 41 rabbits after extracellular electrical stimulation of single trigeminal motoneurons in the brain stem. In 41 of these units we determined the amount of tension decrease

  13. Factors associated with the referral of anxious children to mental health care: the influence of family functioning, parenting, parental anxiety and child impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  14. Factors Associated with the Referral of Anxious Children to Mental Health Care: the Influence of Family Functioning, Parenting, Parental Anxiety and Child Impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  15. Přírodní materiály bohaté montmorillonitem: simultánní měření dilatace a sorpce

    Czech Academy of Sciences Publication Activity Database

    Hanus, R.; Kolaříková, I.; Brabec, Libor; Kočiřík, Milan; Přikryl, R.; Jelínek, E.; Zikánová, Arlette

    2005-01-01

    Roč. 99, č. 4 (2005), s. 246-249 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GA104/02/1464 Institutional research plan: CEZ:AV0Z40400503 Keywords : bentonite * montmorrilonite * adsorption * Ca2+ Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.445, year: 2005

  16. Quasistatic normal-compliance contact problem of visco-elastic bodies with Coulomb friction implemented by QP and SGBEM

    Czech Academy of Sciences Publication Activity Database

    Vodička, R.; Mantič, V.; Roubíček, Tomáš

    2017-01-01

    Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.357, year: 2016 http://www.sciencedirect.com/science/article/pii/S037704271630499X

  17. Characterization of spirochetal isolates from arthropods collected in South Moravia, Czech Republic, using fatty acid methyl esters analysis

    Czech Academy of Sciences Publication Activity Database

    Čechová, L.; Durnová, E.; Šikutová, Silvie; Halouzka, Jiří; Němec, M.

    2004-01-01

    Roč. 808, č. 2 (2004), s. 249-254 ISSN 1570-0232 R&D Projects: GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : spirochetes * arthropods * fatty acid methyl esters Subject RIV: EE - Microbiology, Virology Impact factor: 2.176, year: 2004

  18. 77 FR 27082 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-05-08

    ... publicly identified by name by the International Trade Commission as a member of a domestic industry in an... date 81,249 Jump Clothing, Inc., Sweet Los Angeles, CA....... February 13, 2010. Rain Apparel. The... COM Corp Industries, ISATEC Garfield Heights, OH Technical Center. The investigation revealed that the...

  19. 76 FR 46603 - Security Ratings

    Science.gov (United States)

    2011-08-03

    ... settled derivative securities). See Simplification of Registration of Reporting Requirements for Foreign... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 200, 229, 230, 232, 239, 240, and 249 [Release No. 33-9245; 34-64975; File No. S7-18-08] RIN 3235-AK18 Security Ratings AGENCY: Securities and Exchange...

  20. Chakraborty, Prof. Ranajit

    Indian Academy of Sciences (India)

    Elected: 2006 Honorary. Chakraborty, Prof. Ranajit. Date of birth: 1946. Address: Director, Center for Computational Genomics, University of North Texas, HSC, 3500 Camp Bowie Blvd, CBH 249, Fort Worth, TX 76107, U.S.A.. Contact: Office: (+1-817) 735 2421. Fax: (+1-817) 735 5016. Email: ranajit.chakraborty@unthsc.

  1. Observations on the lambing interval of the cape bushbuck ...

    African Journals Online (AJOL)

    A record of births from three Cape bushbuck ewes at Queens Park Zoo, East London, from November 1971 to December 1974, indicated that the mean lambing interval of Tragelaphus scriptus sylvaticus in captivity is 249 days and that ewes reach sexual maturity at approximately one year of age.

  2. Safe Gene Therapy for Type 1 Diabetes

    Science.gov (United States)

    2012-10-01

    tiation (Cheng et al, 2007; Gillard et al, 2007). Nevertheless, our data show that the negative selection checkpoint is facilitated by insulin produced...1A diabetes: 2005. Immunol Rev 204: 232–249 Gillard GO, Dooley J, Erickson M, Peltonen L, Farr AG (2007) Aire- dependent alterations in medullary

  3. Correlation between morphological characters and estimated bunch ...

    African Journals Online (AJOL)

    The methodology of multiple linear regression (MLR) was used to estimate bunch weight. The most significant variables that were measured included number of leaves at harvest, number of fruits per bunch, FW, FL, rachis weight (RW) and stalk length (SL), generating the following prediction equation: BW= -5.249 + ...

  4. Foreign body impacted in the Jejunum

    African Journals Online (AJOL)

    xp

    28:298-305, 1999. 3. Jasperson D. Drug-induced oesophageal disorders: pathogenesis, incidence, prevention and management. Drug. Saf 22:237-249, 2000. 4. Jones A. Caustic ingestion and foreign bodies: damage to the upper gastrointestinal tract. In: Wyllie R,. Hyams JS(Ed).Pediatric Gastrointestinal and Liver Disease ...

  5. The Research Laboratory of Electronics Progress Report Number 136, 1 January-31 December 1993

    Science.gov (United States)

    1994-06-01

    the previous four years for of gravitational lensing-the distortion of radio the Office of Solar System Exploration of the signals from distant radio...355 Energia Nucleare e Energie Alternative (Italy) 249 Geophysics 325 Energy transfer 133 Geraci, James R. 35, 37 Entin, Ilya 209, 225 Gold, Bernard 317

  6. 76 FR 81665 - Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus...

    Science.gov (United States)

    2011-12-28

    ... Wolf (Canis lupus) in the Western Great Lakes; Final rule #0;#0;Federal Register / Vol. 76, No. 249... (Canis lupus) in the Western Great Lakes AGENCY: Fish and Wildlife Service, Interior. ACTION: Final rule... Minnesota population of gray wolves (Canis lupus) to conform to current statutory and policy requirements...

  7. O- centers in LuAG:Ce,Mg ceramics

    Czech Academy of Sciences Publication Activity Database

    Hu, C.; Liu, S.; Fasoli, M.; Vedda, A.; Nikl, Martin; Feng, X. Q.; Pan, Y.B.

    2015-01-01

    Roč. 9, č. 4 (2015), s. 245-249 ISSN 1862-6254 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : scintillator * hole center * EPR * LuAG * Ce 3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.578, year: 2015

  8. Dicty_cDB: Contig-U04058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 09 |pid:none) Gossypium thurberi ubiquitin-conju... 130 2e-29 CP000585_249( CP000585 |pid:none) Ostreococcus...83533.... 130 2e-29 (Q9SLE4) RecName: Full=Ubiquitin carrier protein E2 29; ... 130 2e-29 AY082009_1( AY0820

  9. Financial Information Source, Knowledge, and Practices of College Students from Diverse Backgrounds

    Science.gov (United States)

    Mimura, Yoko; Koonce, Joan; Plunkett, Scott W.; Pleskus, Lindsey

    2015-01-01

    Using cross-sectional data, we examined the financial information sources, financial knowledge, and financial practices of young adults, many of whom are first generation college students, ethnic minorities, and immigrants or children of immigrants. Participants (n = 1,249) were undergraduate students at a large regional comprehensive university.…

  10. C S Sanmathi

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C S Sanmathi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene and maleic anhydride: determination of the reactivity ratios · C S Sanmathi S Prasannakumar B S ...

  11. AcEST: DK945439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available whole genome... 137 3e-31 tr|Q6ZZK5|Q6ZZK5_ACTTI Short chain dehydrogenase OS=Actinoplanes... 134 3e-30 tr|A...ASVVGFLASDGGEWVNGQVVRVNGGY 249 >tr|Q6ZZK5|Q6ZZK5_ACTTI Short chain dehydrogenase OS=Actinoplanes teichomycet

  12. Evaluation of pulsatility index and diameter of the jugular vein and superficial body temperature as physiological indices of temperament in weaned beef calves: relationship with serum cortisol concentrations, rectal temp..

    Science.gov (United States)

    The relationship between temperament, pulsatility index and diameter of the jugular vein, and body temperature was assessed in Angus crossbred calves (262±24.9 days old). Temperament scores were used to classify calves as calm (n=31), intermediate (n=32), or temperamental (n=28). Blood samples were ...

  13. A DDC Bibliography on Computers in Information Sciences. Volume I. Information Sciences Series.

    Science.gov (United States)

    Defense Documentation Center, Alexandria, VA.

    The unclassified and unlimited bibliography compiles references dealing specifically with the role of computers in information sciences. The volume contains 249 annotated references grouped under two major headings: Time Shared, On-Line, and Real Time Systems, and Computer Components. The references are arranged in accesion number (AD-number)…

  14. On the Scientific Foundations of Level 2 Fusion

    Science.gov (United States)

    2004-03-01

    Development of Decision Aids”, CMIF Report 2-99, Feb 1999 KN2-49 Theories of Groups, Teams, Coalitions, etc -Adaptive Behaviors- • There is a huge literature...Investigations of Trust-related System Vulnerabilities in Aided, Adversarial Decision Making”, CMIF Report, Jan 2000 KN2-53 Summarizing Algorithm re Thing

  15. Ultrasound assisted synthesis of ZnO/reduced graphene oxide composites with enhanced photocatalytic activity and anti-photocorrosion

    International Nuclear Information System (INIS)

    Peng, Yonggang; Ji, Junling; Chen, Dajun

    2015-01-01

    Graphical abstract: - Highlights: • ZnO/reduced graphene oxide composites were prepared by in situ growth with ultrasound assisted method. • A plausible formation mechanism of ZnO/rGO composites was deduced. • After hybridization with rGO, the photocatalytic activity of ZnO was improved and its photocorrosion was inhibited obviously. - Abstract: A method to improve the photocatalytic activity and suppress the photocorrosion of ZnO was developed by depositing ZnO nanoparticles onto the surface of reduced graphene oxide (rGO) via in situ growth with ultrasound assisted synthesis. The optimum synergetic effect of ZnO/rGO composite was found at a weight ratio of 2% (rGO/ZnO). Compared with ZnO, the photocatalytic activities of ZnO/rGO composite for the degradation of methylene blue (MB) and C.I. acid red 249 (AR249) aqueous solutions under UV light irradiation were increased by 8.6% and 14.7%, respectively. The improved photocatalytic activity was originated from the rapid separation of photogenerated electrons and holes on the interface of rGO and ZnO. The photocorrosion of ZnO was inhibited obviously after hybridization with rGO. Even after six successive cycles under UV irradiation, the photocatalytic activities of ZnO/rGO composite for MB and AR249 still retained 92.9% and 94.8% of that for the first cycling run, while that of ZnO obviously decreased due to serious photocorrosion. The photocorrosion inhibition of ZnO by rGO was attributed to the reduced activation of surface oxygen atom on the surface of ZnO.

  16. Paralysis following stereotactic spinal irradiation in pigs suggests a tolerance constraint for single-session irradiation of the spinal nerve

    International Nuclear Information System (INIS)

    Medin, Paul M.; Foster, Ryan D.; Kogel, Albert J. van der; Meyer, Jeffrey; Sayre, James W.; Huang, Hao; Öz, Orhan K.

    2013-01-01

    Background and purpose: Paralysis observed during a study of vertebral bone tolerance to single-session irradiation led to further study of the dose-related incidence of motor peripheral neuropathy. Materials and methods: During a bone tolerance study, cervical spinal nerves of 15 minipigs received bilateral irradiation to levels C5–C8 distributed into three dose groups with mean maximum spinal nerve doses of 16.9 ± 0.3 Gy (n = 5), 18.7 ± 0.5 Gy (n = 5), and 24.3 ± 0.8 Gy (n = 5). Changes developing in the gait of the group of pigs receiving a mean maximum dose of 24.3 Gy after 10–15 weeks led to the irradiation of two additional animals. They received mean maximum dose of 24.9 ± 0.2 Gy (n = 2), targeted to the left spinal nerves of C5–C8. The followup period was one year. Histologic sections from spinal cords and available spinal nerves were evaluated. MR imaging was performed on pigs in the 24.9 Gy group. Results: No pig that received a maximum spinal nerve point dose ⩽19.0 Gy experienced a change in gait while all pigs that received ⩾24.1 Gy experienced paralysis. Extensive degeneration and fibrosis were observed in irradiated spinal nerves of the 24.9 Gy animals. All spinal cord sections were normal. Irradiated spinal nerve regions showed increased thickness and hypointensity on MR imaging. Conclusion: The single-session tolerance dose of the cervical spinal nerves lies between 19.0 and 24.1 Gy for this model

  17. Aspectos ergonômicos na transferência de pacientes: um estudo realizado com trabalhadores de uma central de transportes de um hospital universitário Aspectos ergonómicos en la transferencia de enfermos: un estudio hecho com trabajadores de una central de transportes de un hospital universitário The transfer of patients and its ergonomic aspects: a study conducted at a university hospital lifting center

    Directory of Open Access Journals (Sweden)

    Cristiane Gonzales Rossi

    2001-09-01

    Full Text Available Com o objetivo de avaliar aspectos ergonômicos na transferência de pacientes com a utilização de maca e cadeira de rodas, observou-se 249 transferências realizadas por trabalhadores da Seção de Escolta de um Hospital Universitário. Os resultados sugerem que a existência dessa equipe é uma iniciativa que deve ser estimulada mas que esses trabalhadores precisam de treinamento específico sobre movimentação e transporte de pacientes e de terem à disposição materiais auxiliares e equipamentos mecânicos.Com el objetivo de avaliar aspectos ergonómicos de transferencia de enfermos com utilización de maca y silla de ruedas, observarán se 249 transferencias realizadas por trabajadores de la Sección de Escolta (Acompañamiento de un Hospital Universitário. Los resultados sugerem que la existencia desse equipo es una iniciativa que debrá ser estimulada. Pero esos trabajadores necessitan entrenamiento especifico sobre mobilizacion y transporte de enfermos e necessitam tener a disposicion materiales auxiliares y equipamentos mecânicos.The purpose of this study was to evaluate ergonomic aspects involved in using a stretcher and a wheel chair to transfer patients. 249 transfers carried out by the workers of a university hospital lifting sector were observed. The observations showed that the idea of having a team to transfer patients has to be stimulated but the members of the team require specific training in handling and transferring patients. Mechanical equipment and other devices should also be available.

  18. Quantification of renal cortical blood flow using factor analysis of O-15 water dynamic PET images

    International Nuclear Information System (INIS)

    Seo, Kang Jun; Ahn, Ji Young; Lee, Jae Sung; Paeng, Jin Chul; Cheon, Gi Jeong; Lee, Dong Soo; Noh, Tae Won; Chung, June Key; Lee, Myung Chul

    2000-01-01

    To obtain spatial distribution of renal factor images, input function, and regional tissue time-activity curve (TAC) from O-15 water dynamic PET images non-invasively, factor analysis (FA) was used. O-15 water dynamic PET scans were performed on 3 normal dogs (22 ∼ 29 kg) with the bolus injection of O-15 water (555 ∼ 740 Mbq). We performed FA on the masked dynamic images and obtained the pure TACs and the corresponding factor images. Microsphere experiment also was performed. 37MBq of microsphere labeled with Sc-46 was injected into the left ventricle. Arterial input functions derived from the PET images using FA were compared with the invasively derived arterial blood samples. The renal cortical blood flow using the TACs by FA was within the normal range of 1.23 ∼ 2.46 ml/min/g. In microsphere study, the renal cortical blood flow of left kidney by FA was 2.49±0.47 ml/min/g (1.81∼2.90 ml/min/g) and by microsphere was 2.52 ±0.19 ml/min/g (2.34 ∼2.68 ml/min/g). In right kidney, flow by FA was 2.02 ±0.32 ml/min/g (1.82∼2.49 ml/min/g) and by microsphere was 2.49 ±0.27 ml/min/g (2.02∼2.7). FA is a useful and robust method to extract input functions and tissue TACs from O-15 dynamic renal PET. Renal cortical blood flow can be estimated non-invasively using FA and it will be helpful for the assessment of renal functional disease

  19. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  20. Hubungan Indeks Massa Tubuh dengan Cedera Ligamen Krusiat Anterior pada Atlet Cabang Olahraga Kontak

    Directory of Open Access Journals (Sweden)

    Rurin Ardiyanti

    2016-09-01

    Full Text Available AbstrakCedera Ligamen Krusiat Anterior (LKA adalah trauma pada atlet yang memerlukan tindakan bedah dan berrisiko menjadi osteoartritis. Berbagai macam faktor dapat menyebabkan cedera LKA, seperti Indeks Massa Tubuh (IMT yang merupakan salah satu faktor risiko cedera LKA. Tujuan penelitian ini adalah menentukan hubungan IMT dengan cedera LKA. Penelitian ini menggunakan metode analitik observasional. Sampel adalah 271 atlet diambil dari seluruh cabang olahraga kontak di KONI (Komite Olahraga Nasional Indonesia Jawa Timur. Data yang diperoleh berupa IMT dan kejadian cedera LKA pada atlet dalam 1 tahun, kemudian dianalisis dengan uji kemaknaan Fisher. Peneliti menemukan 7% (19 orang mengalami cedera LKA. Penelitian ini menemukan bahwa presentase cedera LKA pada IMT tinggi (>24,9 kg/m2 dua kali lebih banyak dibanding pada IMT tidak tinggi (≤24,9 kg/m2, yaitu 12,5% dan 6,5%. Pada uji Fisher tidak ditemukan hubungan antara IMT dan cedera LKA (p>0,05.  Penelitian ini menunjukkan bahwa terdapat risiko cedera LKA pada atlet dengan IMT tinggi, namun tidak signifikan secara statistik. Banyak faktor risiko cedera LKA lainnya yang tidak dapat dikontrol melalui metodologi penelitian ini.Kata kunci: indeks massa tubuh, cedera ligamen krusiat anterior, atlet AbstractAnterior Cruciate Ligament (ACL injuries are common on athletes that need surgical treatment and a risk to become osteoarthritis. There are many factors contributed to ACL injury. Body Mass Index (BMI is one of ACL injury risk factor. The objective of this study was to determine the relationship between BMI and ACL injury. This was an observasional analitic study. The sample was 271 contact sport athletes at KONI East Java. Data about BMI and ACL injury on the athlete for 1 year was collected. The data then was analysed by Fisher test. There were 7% (19 persons of athletes suffers from ACL injury. This study found that the proportion of ACL injury on athlete with high BMI (>24,9 kg/m2 was twice

  1. Verteerbaarheid en voederwaarde van diverse kwaliteiten graskuil en van CCM bij biologische zeugen = Digestibility and nutritive value of several qualities of grass silage and of CCM in organic housed gestating sows

    NARCIS (Netherlands)

    Peet-Schwering, van der C.M.C.; Binnendijk, G.P.; Diepen, van J.T.M.

    2010-01-01

    The chemical composition, digestibility and energy value of five qualities of grass silage and of CCM (Corn cob mix) were investigated in organic housed gestating sows. The dry matter content of the five grass silages varied between 21.3 and 24.9%. The energy value per kg dry matter varied between

  2. New record of the invasive ladybeetle Harmonia axyridis in Afrotropical Region: Tanzania, Zanzibar

    Czech Academy of Sciences Publication Activity Database

    Nedvěd, Oldřich; Háva, J.

    2016-01-01

    Roč. 24, č. 1 (2016), s. 247-249 ISSN 1021-3589 Grant - others:GA JU(CZ) 159/2013/P Institutional support: RVO:60077344 Keywords : ladybird beetle * South-Africa * Coccinellidae Subject RIV: EG - Zoology Impact factor: 0.813, year: 2016 http://www.bioone.org/doi/full/10.4001/003.024.0247

  3. Embracing the Institutional Mission: Influences of Identity Processing Styles

    Science.gov (United States)

    Milner, Lauren A.; Ferrari, Joseph R.

    2010-01-01

    Previous research suggests that different information processing styles influence how effectively students adapt to a college environment. During the college years, individuals shape and refine their values and principles while they also develop a life-long philosophy. The present study examined how student ego-identity development (n = 1,249) was…

  4. Afgivelse af formue til trusts

    DEFF Research Database (Denmark)

    Feldthusen, Rasmus Kristian

    2009-01-01

    Kravet om at en stifter skal have foretaget en "uigenkaldelig og effektiv udskillelse" for at dansk skatteret vil anerkende at der foreligger en trust vurderes. Kravet er senest lagt til grund i SKM 2009.249 SR. Forfatteren opfordrer til, at SKAT i stedet foretager en konkret vurdering af selve...

  5. Attention-Deficit, Fear and Aggression in Iranian Preschool Students with Regard to Gender Differences

    Science.gov (United States)

    Sheikhzade, Mostafa; Assemi, Arezoo

    2013-01-01

    The cause of most adult psychopathologies or behavioural disorders can be traced back to childhood. In this study, we examine the attention-deficit, fear and aggression in Iran's preschool students in Oshnaviye city. In this analytical-descriptive study, 50 students were selected through stratified sampling method from 249 students. Data were…

  6. Effects of Attractiveness and Status in Dating Desire in Homosexual and Heterosexual Men and Women

    NARCIS (Netherlands)

    Ha, P.T.; Berg, J.E.M. van den; Engels, R.C.M.E.; Lichtwarck-Aschoff, A.

    2012-01-01

    The present study examined partner preferences of homosexual and heterosexual men and woman, focusing on attractiveness and status. Homosexual (N = 591 men; M age = 28.87 years, SD = 10.21; N = 249 women; M age = 33.36 years, SD = 13.12) and heterosexual participants (N = 346 men; M age = 39.74

  7. Factors associated with the referral of anxious children to mental health care: The influence of family functioning, parenting, parental anxiety and child impairment.

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, Susan M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8–13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  8. Diskurzivní analýza v soudobé sociální psychologii: teorie, koncepty a aplikace

    Czech Academy of Sciences Publication Activity Database

    Zábrodská, Kateřina

    2010-01-01

    Roč. 54, č. 3 (2010), s. 249-262 ISSN 0009-062X R&D Projects: GA ČR GPP407/10/P146 Institutional research plan: CEZ:AV0Z70250504 Keywords : discourse analysis * conversation analysis * critical discursive psychology Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010

  9. Degradation of PET, PEEK and PI induced by irradiation with 150 keV Ar+ and 1.76 MeV He+ ions

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Havránek, Vladimír; Švorčík, V.; Suzuki, T.; Djourelov, N.

    2005-01-01

    Roč. 240, 1/2 (2005), s. 245-249 ISSN 0168-583X R&D Projects: GA MŠk(CZ) OC 527.100 Institutional research plan: CEZ:AV0Z10480505 Keywords : irradiated polymers * ion beam modification * ERDA Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.181, year: 2005

  10. 48 CFR 49.402-1 - The Government's right.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false The Government's right. 49... MANAGEMENT TERMINATION OF CONTRACTS Termination for Default 49.402-1 The Government's right. Under contracts containing the Default clause at 52.249-8, the Government has the right, subject to the notice requirements...

  11. Music during Lectures: Will Students Learn Better?

    Science.gov (United States)

    Dosseville, Fabrice; Laborde, Sylvain; Scelles, Nicolas

    2012-01-01

    We investigated the influence of music during learning on the academic performance of undergraduate students, and more particularly the influence of affects induced by music. Altogether 249 students were involved in the study, divided into a control group and an experimental group. Both groups attended the same videotaped lecture, with the…

  12. Information Activities and Appropriation in Teacher Trainees' Digital, Group-Based Learning

    Science.gov (United States)

    Hanell, Fredrik

    2016-01-01

    Introduction: This paper reports results from an ethnographic study of teacher trainees' information activities in digital, group-based learning and their relation to the interplay between use and appropriation of digital tools and the learning environment. Method: The participants in the present study are 249 pre-school teacher trainees in…

  13. Accumulative capabilities of essential nutrient elements in organs of ...

    African Journals Online (AJOL)

    use

    2011-11-23

    Nov 23, 2011 ... Cu > Mn > Zn > B. In conclusion, the ACs for essential nutrient elements differed, with the ... and Fe were quantified using Perkin Elmer Atomic Absorption .... vitamin C, protein and fat ranging from 249.6 to 266 .... Boron determination in plant tissues by ... Accumulation of cadmium and selected elements.

  14. On some singular limits in damped radiation hydrodynamics

    Czech Academy of Sciences Publication Activity Database

    Blanc, X.; Ducomet, B.; Nečasová, Šárka

    2016-01-01

    Roč. 13, č. 2 (2016), s. 249-271 ISSN 0219-8916 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible * Euler * damping Subject RIV: BA - General Mathematics Impact factor: 0.940, year: 2016 http://www.worldscientific.com/doi/10.1142/S0219891616500089

  15. Maloprim malaria prophylaxis in children living in a holoendemic village in north-eastern Tanzania

    DEFF Research Database (Denmark)

    Lemnge, M M; Msangeni, H A; Rønn, A M

    1997-01-01

    , splenomegaly, and packed cell volume (PCV) was investigated in a cohort of 249 children (126 receiving D-P and 123 receiving placebo) aged 1-9 years. The case definition of clinical malaria (malaria fever) was measured axillary temperature > or = 37.5 degrees C and/or reported fever, and P. falciparum asexual...

  16. Assessing ground compaction via time lapse surface wave analysis

    Czech Academy of Sciences Publication Activity Database

    Dal Moro, Giancarlo; Al-Arifi, N.; Moustafa, S.S.R.

    2016-01-01

    Roč. 13, č. 3 (2016), s. 249-256 ISSN 1214-9705 Institutional support: RVO:67985891 Keywords : Full velocity spectrum (FVS) analysis * ground compaction * ground compaction * phase velocities * Rayleigh waves * seismic data inversion * surface wave dispersion * surface waves Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.699, year: 2016

  17. Leukotriene-mediated neuroinflammation, toxic brain damage, and neurodegeneration in acute methanol poisoning

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Kotíková, K.; Nurieva, O.; Hlušička, J.; Kačer, P.; Urban, P.; Vaněčková, M.; Seidl, Z.; Diblík, P.; Kuthan, P.; Navrátil, Tomáš; Pelclová, D.

    2017-01-01

    Roč. 55, č. 4 (2017), s. 249-259 ISSN 1556-3650 Institutional support: RVO:61388955 Keywords : brain damage * leukotrienes * methanol poisoning * Neuroinflammation * nontraumatic brain injury * sequelae of poisoning Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 3.677, year: 2016

  18. Categorizing Moving Objects into Film Genres: The Effect of Animacy Attribution, Emotional Response, and the Deviation from Non-Fiction

    Science.gov (United States)

    Visch, Valentijn T.; Tan, Ed S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. "American Journal of Psychology," 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). "The perception of causality" (T.R. Miles & E. Miles, Trans.). London: Methuen (Original work published…

  19. 76 FR 30437 - Indian Child Welfare Act; Designated Tribal Agents for Service of Notice

    Science.gov (United States)

    2011-05-25

    ...-mail: [email protected] Agdaagux Tribe of King Cove, Arthur Newman, Tribal Administrator, P.O. Box 249, King Cove, AK 99612; Phone: (907) 497-2648; Fax: (907) 497- 2803; E-mail: [email protected] and Grace...: graces@apiai.org . Akhiok, Native Village of, Rachelle Joy, KANA Foster Parent Support Specialist, 3449...

  20. 76 FR 69306 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-11-08

    ... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget... ``Investment Company Act'') requires a registered management investment company (``fund'') to (1) file a report with the Commission on Form N-CSR (17 CFR 249.331 and 274.128) not later than 10 days after the...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 249 ... Mampaka L Mojapelo. Vol 31, No 2 (2011), Mother tongue education in the official minority languages in Zimbabwe, Abstract. Eventhough Ndlovu. Vol 28, No 2 (2008), Mother-tongue education in primary schools in Malawi: From policy to implementation, Abstract. Grace Chiuye, Themba Moyo. Vol 34 ...

  2. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 91; Issue 2. Physical mapping of 5S and 45S rDNA in Chrysanthemum and related genera of the Anthemideae by FISH, and species relationships. Magdy Hussein Abd El-Twab Katsuhiko Kondo. Research Note Volume 91 Issue 2 August 2012 pp 245-249 ...

  3. Intergenerational Relationships in Cross-Cultural Comparison: How Social Networks Frame Intergenerational Relations between Mothers and Grandmothers in Japan, Korea, China, Indonesia, Israel, Germany, and Turkey

    Science.gov (United States)

    Nauck, Bernhard; Suckow, Jana

    2006-01-01

    The article explores the relevance of intergenerational relationships within the overall network of young mothers and grandmothers in seven societies: Japan, Korea, China, Indonesia, Turkey, Israel, and Germany. The empirical base is 2,945 named network members in 249 pairs of interviews of grandmothers and their daughters from a cross-cultural…

  4. 76 FR 55084 - Announcement of Funding Awards for the Section 202 Supportive Housing for the Elderly Program...

    Science.gov (United States)

    2011-09-06

    ... Pembroke Pines, FL Miami Jewish Home & Hospital Capital Advance: $10,634,700 Three-year Rental Subsidy...: 42 Illinois Chicago, IL Cath Charities Hsg Devl Corp Capital Advance: $6,617,100 Three-year Rental... Charities of Louisville Capital Advance: $2,763,200 Three-year Rental Subsidy: $249,600 Number of Units: 24...

  5. Using Fun in the Statistics Classroom: An Exploratory Study of College Instructors' Hesitations and Motivations

    Science.gov (United States)

    Lesser, Lawrence M.; Wall, Amitra A.; Carver, Robert H.; Pearl, Dennis K.; Martin, Nadia; Kuiper, Shonda; Posner, Michael A.; Erickson, Patricia; Liao, Shu-Min; Albert, Jim; Weber, John J., III

    2013-01-01

    This study examines statistics instructors' use of fun as well as their motivations, hesitations, and awareness of resources. In 2011, a survey was administered to attendees at a national statistics education conference, and follow-up qualitative interviews were conducted with 16 of those ("N" = 249) surveyed to provide further…

  6. 17 CFR 230.175 - Liability for certain statements by issuers.

    Science.gov (United States)

    2010-04-01

    ... statement of future economic performance contained in management's discussion and analysis of financial... Discussion and Analysis of Financial Condition and Results of Operations,” Item 5 of Form 20-F (§ 249.220(f... paragraphs 30-34 of Statement of Financial Accounting Standards No. 69) presented voluntarily or pursuant to...

  7. Joint location and source mechanism inversion of microseismic events: benchmarking on seismicity induced by hydraulic fracturing

    Czech Academy of Sciences Publication Activity Database

    Anikiev, D.; Valenta, Jan; Staněk, František; Eisner, Leo

    2014-01-01

    Roč. 198, č. 1 (2014), s. 249-258 ISSN 0956-540X R&D Projects: GA ČR GAP210/12/2451 Institutional support: RVO:67985891 Keywords : inverse theory * probability distributions * wave scattering and diffraction * fractures and faults Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.724, year: 2013

  8. A general method for the calculation of absolute trace gas concentrations in air and breath from selected ion flow tube mass spectrometry data

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Dryahina, Kseniya; Smith, D.

    249-250, - (2006), s. 230-239 ISSN 1387-3806 R&D Projects: GA ČR GA202/03/0827 Institutional research plan: CEZ:AV0Z40400503 Keywords : selected ion flow tube * mass spectrometry * SIFT-MS * trace gas analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.337, year: 2006

  9. All projects related to | Page 2 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The 2014 Ebola outbreak in West Africa claimed the lives of tens of thousands of people, with Guinea, Liberia, and Sierra Leone severely hit by this crisis. Region: South of Sahara, Guinea, Liberia, Nigeria, Sierra Leone, Republic of Congo, Canada. Program: Food, Environment, and Health. Total Funding: CA$ 249,188.00.

  10. Scrotal abnormalities and infertility in west African men: A ...

    African Journals Online (AJOL)

    Objective: To determine and compare the spectrum of scrotal abnormalities in fertile and sub-fertile west African men using scrotal US. Subjects and methods: The study examined 249 subjects over a period of 13 months. The subjects comprised 149 patients with diagnosis of male infertility, as well as 100 healthy ...

  11. The Relationship between Experiences of Discrimination and Mental Health among Lesbians and Gay Men: An Examination of Internalized Homonegativity and Rejection Sensitivity as Potential Mechanisms

    Science.gov (United States)

    Feinstein, Brian A.; Goldfried, Marvin R.; Davila, Joanne

    2012-01-01

    Objective: The current study used path analysis to examine potential mechanisms through which experiences of discrimination influence depressive and social anxiety symptoms. Method: The sample included 218 lesbians and 249 gay men (total N = 467) who participated in an online survey about minority stress and mental health. The proposed model…

  12. 48 CFR 32.503-15 - Application of Government title terms.

    Science.gov (United States)

    2010-10-01

    ... Application of Government title terms. (a) Property to which the Government obtains title by operation of the... Property; and (2) The termination clauses at 52.249, for termination inventory. (c) The contractor may sell... the scrap disposition. (d) When the title to materials or other inventories is vested in the...

  13. A Study of Income and Test Anxiety among Turkish University Students

    Science.gov (United States)

    Önem, E. E.

    2014-01-01

    This study aimed to investigate the relationship between income level of Turkish university students studying at an English language teaching department and test anxiety levels as well as worry and emotionality components of test anxiety. 249 (60 male, 189 female) undergraduate students studying at an English Language Teaching Department of a…

  14. Recent natural hybridization between two allopolyploid wheatgrasses (Elytrigia, Poaceae): Ecological and evolutionary implications

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta

    2007-01-01

    Roč. 100, - (2007), s. 249-260 ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007

  15. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. M Komaraiah. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  16. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. John Bernet. Articles written in Journal of Biosciences. Volume 28 Issue 3 April 2003 pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati Mullick Akhilesh K Singh Arvind Sahu · More Details Abstract Fulltext PDF. The complement system is a potent ...

  17. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Vidyanand Nanjundiah, Stuart A. Newman and Scott F. Gilbert. pp 249-358 Volume 28 Issue 3 April 2003. Viral Evasion of Host Responses. Shahid Jameel. pp 1-134 Volume 28 Issue 1 February 2003. Oxygen/Nitrogen Radicals: Cell Injury and Disease. Val Vallyathan, Rajiv K. Saxena and Vince Castranova. pp 553-627 ...

  18. 17 CFR 240.6a-4 - Notice of registration under Section 6(g) of the Act, amendment to such notice, and supplemental...

    Science.gov (United States)

    2010-04-01

    ... accordance with the instructions contained therein, if: (i) The exchange is a board of trade, as that term in... new information and correct any information rendered inaccurate, on Form 1-N (§ 249.10 of this chapter... this section is available continuously on an Internet web site controlled by a Security Futures Product...

  19. Astronomical Observations by Speckle Interferometry.

    Science.gov (United States)

    1986-06-12

    commonly -been noted [Heintz (101)] that it was Karl *, Schwarzchild who iui 1895 [ Schwarzschild (190)] made the first measure- ments of binary stars...J. Lett 163. Michelson, A A, Pease. F. G. 1921. Ap. 280: L23 J. 53: 249 190. Schwarzschild . K. 1896. Astron. Nadir. 164. Morgan. B. L., lieddoes. 1

  20. Metabolic and hormonal responses of growing modern meat type chickens to fasting

    Science.gov (United States)

    The present study compared the effects of fasting on circulating concentrations of glucose, insulin and glucagon in male and female modern meat-type chickens (Ross 708) at three ages (19 d, 33 d and 47 d). Plasma concentrations of glucose were reduced by fasting with reductions of 24.9% (19-d-old),...

  1. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K Ankamma. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  2. G Chandramohan Reddy

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Chandramohan Reddy. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara ...

  3. Proceedings (Mathematical Sciences) SUBJECT INDEX

    Indian Academy of Sciences (India)

    299. Automorphism group. Semisymmetric cubic graphs of order 16p2. 19. Bernoulli polynomial. On the general Dedekind sums and its reciprocity formula. 1 ... and x = f(t,x,xσ ) on time scales 249. Density of states. Regularity of the interband light absorption coefficient. 351. Lifshitz tails for the interband light absorp-.

  4. Formulation and development of colon-targeted mucopenetrating ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research May 2017; 16 (5): 967-973 ... Sent for review: 24 December 2016 ... was significant difference in drug release between coated (8.46 ± 2.49 ... of easy durg delivery in the treatment of such diseases. Metronidazole is a drug of ..... the intestinal delivery of protein drugs: alginate and.

  5. degradation products predict outcotne in gestational proteinuric ...

    African Journals Online (AJOL)

    Scientific Publications, 1989: 249-305. 3. Rodgers GM, Taylor RN, Roberts J. Preeclampsia is associated witb a serum factor cytotoxic to human endotbelial cells. Am J. Obstel Gyneco11988; 159: 908-914. 4. Davey DA, MacGillivray 1. The classification and definition of tbe hypertensive disorders of pregnancy. Am J Obstel ...

  6. M R Sudarsana Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. M R Sudarsana Kumar. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar ...

  7. Awareness and desirability of the Nigerian antenatal women about ...

    African Journals Online (AJOL)

    Results:Of the 650 subjects, 249(38.3%)were aware of analgesia use in labour and their sources of information were through media (30.9%), antenatal counselling (22.9%), friends/relations (17.3%), internet (5.6%) and others – literature/lectures/ symposium (22.9%). The only factor that influence awareness on logistic ...

  8. Southwestern Division 2012 History Report

    Science.gov (United States)

    2013-05-01

    11,560,687 swimmers • 3,099,726 water skiers • 14,330,607 boaters • 24,071,146 sightseers • 20,097,446 fi shermen • 1,698,249 hunters...heavy involvement of counsel in all actions. Continue to refine procedures for processing border fence condemnations in Army Knowledge Online (AKO

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 249 ... Vol 19 (2015), Insufficient access to substance abuse treatment ... to transformative development in the African decade for women ... Vol 16 (2012), People want to work, yet most have to labour: Towards decent work in South African ... in Rwanda - the possible interim role of Gacaca community courts ...

  10. The labour ward analgesic service at King Edward VIII Hospital ...

    African Journals Online (AJOL)

    The labour ward analgesic service at King Edward VIII. Hospital, Durban. D. A. ROCKE, C. C. ROUT, H. D. RUSSELL, S. SINGH. Abstract The provision of analgesic services to the labour ward at King Edward VIII Hospital was studied during a I-week period. Of249 patients, 113 (45%) received no analgesia whatsoever.

  11. Character and dynamics of the floodplain of the Losenice River, Šumava Mts

    Czech Academy of Sciences Publication Activity Database

    Hartvich, Filip

    2008-01-01

    Roč. 13, č. 3 (2008), s. 237-249 ISSN 1211-7420 R&D Projects: GA AV ČR(CZ) KJB300460501 Grant - others:MŽP(CZ) SM/2/57/05 Institutional research plan: CEZ:AV0Z30460519 Keywords : floodplain * GIS delineation * flood consequences Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  12. MOOC & B-Learning: Students' Barriers and Satisfaction in Formal and Non-Formal Learning Environments

    Science.gov (United States)

    Gutiérrez-Santiuste, Elba; Gámiz-Sánchez, Vanesa-M.; Gutiérrez-Pérez, Jose

    2015-01-01

    The study presents a comparative analysis of two virtual learning formats: one non-formal through a Massive Open Online Course (MOOC) and the other formal through b-learning. We compare the communication barriers and the satisfaction perceived by the students (N = 249) by developing a qualitative analysis using semi-structured questionnaires and…

  13. Combination of micropreparative solution isoelectric focusing and high-performance liquid chromatography for differentiation of biofilm-positive and biofilm-negative Candida parapsilosis group from vascular catheter

    Czech Academy of Sciences Publication Activity Database

    Vykydalová, Marie; Horká, Marie; Růžička, F.; Duša, Filip; Moravcová, Dana; Kahle, Vladislav; Šlais, Karel

    2014-01-01

    Roč. 812, Feb (2014), s. 243-249 ISSN 0003-2670 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Candida parapsilosis group * biofilm * sonicate from vascular cathether * sIEF * HPLC Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.513, year: 2014 http://hdl.handle.net/11104/0230766

  14. Theta-paced flickering between place-cell maps in the hippocampus

    Czech Academy of Sciences Publication Activity Database

    Ježek, Karel; Henriksen, E. J.; Treves, A.; Moser, E. I.; Moser, M.B.

    2011-01-01

    Roč. 478, č. 7368 (2011), s. 246-249 ISSN 0028-0836 R&D Projects: GA MŠk(CZ) LC554; GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : memory * theta * hippocampus * place cells * teleportation Subject RIV: FH - Neurology Impact factor: 36.280, year: 2011

  15. Academic Expectations and Actual Achievements: The Roles of Hope and Effort

    Science.gov (United States)

    Levi, Uzi; Einav, Michal; Ziv, Orit; Raskind, Ilana; Margalit, Malka

    2014-01-01

    This study sought to extend the research on adolescents' hope, academic expectations, and average grades. The hope theory (Snyder, "Psychological Inquiry" 13(4):249-275, 2002), the salutogenic paradigm (with a focus on sense of coherence (SOC) (Antonovsky 1987)), and Bandura's ("Journal of Management" 38(1):9-44,…

  16. 40 CFR 52.720 - Identification of plan.

    Science.gov (United States)

    2010-07-01

    ... deletes Rule 204(c)(1)(D) and the reference to it in Rule 204(h) from the IPCB Air Pollution Control... 215); section 215.205 of subpart F (part 215); sections 215.240, 215.241, and 215.249 of subpart H... Pollution Control, Illinois Environmental Protection Agency (IEPA) to Stephen Rothblatt, Chief, Regulation...

  17. Some duality relations in the theory of tensor products

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Smith, R. J.

    2012-01-01

    Roč. 30, č. 3 (2012), s. 239-249 ISSN 0723-0869 R&D Projects: GA ČR(CZ) GAP201/11/0345 Institutional support: RVO:67985840 Keywords : tensor * projective * injective Subject RIV: BA - General Mathematics Impact factor: 0.780, year: 2012 http://www.sciencedirect.com/science/article/pii/S072308691200045X

  18. Powerhouse down: Complex II dissociation in the respiratory chain

    Czech Academy of Sciences Publication Activity Database

    Hwang, M.-S.; Rohlena, Jakub; Dong, L.-F.; Neužil, Jiří; Grimm, S.

    2014-01-01

    Roč. 19, Part A SI (2014), 20-28 ISSN 1567-7249 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA ČR GAP301/12/1851 Institutional support: RVO:86652036 Keywords : Mitochondria * Apoptosis * Complex II Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.249, year: 2014

  19. P K Das

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P K Das. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 249-253 Nitride Ceramics. Optimization of time–temperature schedule for nitridation of silicon compact on the basis of silicon and nitrogen reaction kinetics · J Rakshit P K Das.

  20. ER disruption and GFP degradation during non-regenerable transformation of flax with Agrobacterium tumefaciens

    Czech Academy of Sciences Publication Activity Database

    Bleho, J.; Obert, B.; Takáč, T.; Petrovská, Beáta; Heym, C.; Menzel, D.; Šamaj, J.

    2012-01-01

    Roč. 249, č. 1 (2012), s. 53-63 ISSN 0033-183X Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : Agrobacterium rhizogenes * Agrobacterium tumefaciens * Endoplasmic reticulum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.855, year: 2012

  1. AcEST: DK957364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N=CAT2... 249 5e-66 sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbagini... 248 1e-65 sp|O24339|CATA_SOLAP...KFYT 128 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 247 bits (631),

  2. uv laser induced molecular multiphoton ionization and fragmentation. [Intensity dependence, ion properties and yield

    Energy Technology Data Exchange (ETDEWEB)

    Rockwood, S; Reilly, J P; Hohla, K; Kompa, K L

    1979-02-01

    It has been demonstrated that the output from a discharge pumped KrF laser (249 nm) is capable of ionizing a variety of molecules. The nature and yield of ions generated in this process, which were identified by time-of-flight mass spectrometry, exhibit a striking intensity dependence. 12 references, 3 figures.

  3. 75 FR 79320 - Security-Based Swap Data Repository Registration, Duties, and Core Principles

    Science.gov (United States)

    2010-12-20

    ... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 240 and 249 [Release No. 34-63347; File No. S7-35-10] RIN 3235-AK79 Security-Based Swap Data Repository Registration, Duties, and Core Principles Correction In proposed rule document 2010-29719 beginning on page 77306 in the issue of December 10, 2010...

  4. Impact of work, health and health beliefs on new episodes of pain-related and general absence-taking

    DEFF Research Database (Denmark)

    Frost, P.; Haahr, J. P.; Andersen, JH

    2009-01-01

    to a central register of state-funded income loss compensation. RESULTS: Sickness absence of at least 14 days and pain-related absence of at least 7 days was experienced by 24.9% and 5.2%, respectively, while 14.2% received state-funded income loss compensation. Physical work demands, working in the public...

  5. Status Report of Nuclear Data Activities at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Smith, M.; Nesaraja, C. [Oak Ridge National Laboratory, US DOE, Oak Ridge, TN 37831 (United States)

    2013-08-15

    The Nuclear Data Group consists of Group Leader of Experimental Astrophysics and Nuclear Data Program, two ENSDF Evaluators a Software Developer. Activities: i) Nuclear Structure Data This activity consists of the mass chain evaluations, and our responsibility is in the actinide region A=241-249. Currently the literature cutoff dates for mass chain A=241- 249 are listed below: Mass Chain and Literature cut of dates from ENSDF database 241 M.J. Martin. NDS 106, 89 (2005) (Lit cut-off June, 2005) 242 Y. A. Akovali. NDS 96, 177 (2002) (Lit cut-off Sept., 2001) 243 Y. A. Akovali. NDS 103, 515 (2004) (Lit cut-off March, 2004) 244 Y. A. Akovali. NDS 99, 197 (2003) (Lit cut-off June, 2002) 245 E. Browne and J.K. Tuli . NDS 112,447 (2011) (Lit cut-off June, 2011) 246 E. Browne and J.K. Tuli. NDS 112,447 (2011)(Lit cut off Jan 2011) 247 Y. A. Akovali. NDS 102, 515 (2004) Lit cut-off August, 2003) 248 Y. A. Akovali. NDS 87, 249 (1998) (Lit cut-off July, 1998) 249 Khalifeh Abusalem. NDS 112, 2129 (2011) (Lit cut-off Dec, 1998) Since the last NSDD meeting in 2011, several mass chains are being evaluated and are in their various stages of evaluation. Mass chains are reviewed as requested by the National Nuclear Data Center. ii) Nuclear Astrophysics Data: The astrophysics data research is closely coupled with our program of measurements of reactions with unstable and stable nuclei. A guest visitor from Beihang Univ. in Beijing collaborated with the Group Leader and others to calculate the single-particle bound and resonant levels for {sup 131,133}Sn. The guest visitor used the analytical continuation of the coupling constant (ACCC) method based on a relativistic mean field (RMF) theory with BCS pairing approximation for these calculations. The RMF+ACCC+BCS model successfully reproduced observed single- particle bound levels in 131,133Sn and self-consistently predicts single-particle resonant levels with densities too low for widely used traditional statistical model treatments

  6. The chrondoprotective actions of a natural product are associated with the activation of IGF-1 production by human chondrocytes despite the presence of IL-1β

    Directory of Open Access Journals (Sweden)

    Bobrowski Paul

    2006-04-01

    Full Text Available Abstract Background Cartilage loss is a hallmark of arthritis and follows activation of catabolic processes concomitant with a disruption of anabolic pathways like insulin-like growth factor 1 (IGF-1. We hypothesized that two natural products of South American origin, would limit cartilage degradation by respectively suppressing catabolism and activating local IGF-1 anabolic pathways. One extract, derived from cat's claw (Uncaria guianensis, vincaria®, is a well-described inhibitor of NF-κB. The other extract, derived from the vegetable Lepidium meyenii (RNI 249, possessed an uncertain mechanism of action but with defined ethnomedical applications for fertility and vitality. Methods Human cartilage samples were procured from surgical specimens with consent, and were evaluated either as explants or as primary chondrocytes prepared after enzymatic digestion of cartilage matrix. Assessments included IGF-1 gene expression, IGF-1 production (ELISA, cartilage matrix degradation and nitric oxide (NO production, under basal conditions and in the presence of IL-1β. Results RNI 249 enhanced basal IGF-1 mRNA levels in human chondrocytes by 2.7 fold, an effect that was further enhanced to 3.8 fold by co-administration with vincaria. Enhanced basal IGF-1 production by RNI 249 alone and together with vincaria, was confirmed in both explants and in primary chondrocytes (P Conclusion The identification of agents that activate the autocrine production of IGF-1 in cartilage, even in the face of suppressive pro-inflammatory, catabolic cytokines like IL-1β, represents a novel therapeutic approach to cartilage biology. Chondroprotection associated with prevention of the catabolic events and the potential for sustained anabolic activity with this natural product suggests that it holds significant promise in the treatment of debilitating joint diseases.

  7. Survey on Mycoplasma hyopneumoniae gilt acclimation practices in Europe.

    Science.gov (United States)

    Garza-Moreno, Laura; Segalés, Joaquim; Pieters, Maria; Romagosa, Anna; Sibila, Marina

    2017-01-01

    Gilts are considered to play a key role in Mycoplasma hyopneumoniae (M. hyopneumoniae) transmission and control. An effective gilt acclimation program should ideally reduce M. hyopneumoniae shedding at first farrowing, decreasing pre-weaning colonization prevalence and potential respiratory problems in fatteners. However, information on gilt acclimation practices is scarce in Europe . The aim of this study was to identify current acclimation strategies for M. hyopneumoniae in Europe using a questionnaire designed to assess 15 questions focused on gilt replacement status, acclimation strategies and methods used to ascertain its effect. A total of 321 questionnaires (representing 321 farms) were voluntarily completed by 108 veterinarians (from 18 European countries). From these farms, 280 out of 321 (87.2%) were aware of the health status of gilts on arrival. From these 280 farms, 161 (57.5%) introduced M. hyopneumoniae positive replacements. In addition, 249 out of 321 (77.6%) farms applied an acclimation process using different strategies, being M. hyopneumoniae vaccination (145 out of 249, 58.2%) and the combination of vaccine and exposure to sows selected for slaughter (53 out of 249, 21.3%) the most commonly used. Notwithstanding, only 53 out of 224 (23.6%) farms, knowing the M. hyopneumoniae initial status and performing acclimation strategies against it, verified the effect of the acclimation by ELISA (22 out of 53, 41.5%), PCR (4 out of 53, 7.5%) or both (27 out of 53, 50.9%). This study showed that three fourths of the farms represented in this European survey have M. hyopneumoniae acclimation strategies for gilts, and one fifth of them verify to some extent the effect of the process. Taking into account that the assessment of acclimation efficacy could help in optimizing replacement gilt introduction into the breeding herd, it seems these practices for M. hyopneumoniae are still poorly developed in Europe.

  8. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 28; Issue 3. Issue front cover thumbnail. Volume 28, Issue 3. April 2003, pages 248-358. Viral Evasion of Host Responses. pp 248-248. Preface · Shahid Jameel · More Details Fulltext PDF. pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati ...

  9. Proceedings of the Workshop on Measurement and Analysis of Structural Response in Concrete Armor Units Held in Vicksburg, Mississippi on 23-24 January 1985

    Science.gov (United States)

    1988-02-01

    diques de abrigo de la ensenade de San Ciprian ( Lugo ), Report PN 249-10-17393, Santander MARKLE, D G AND DAVIDSON, D D (1983) Effects of dolos...like that must be gigantic . MR. MAGOON: I believe they investigated that in a different program. There were a number of programs. If I can remember, this

  10. Tracking the Environment in Australian Children's Literature: The Children's Book Council of Australia Picture Book of the Year Awards 1955-2014

    Science.gov (United States)

    Babb, Yeyoung May; McBurnie, Janine; Miller, Kelly K.

    2018-01-01

    Popular and accessible before television and the internet, picture books capture the context of the time they were created and influence the generations of children who consume them. Depictions of the natural world have changed across several generations of picture books as seen in illustrations of all 249 books of an influential collection, the…

  11. 75 FR 28078 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Order Approving and...

    Science.gov (United States)

    2010-05-19

    ... Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S. Rep. No. 94-75, 94th Cong., 1st... EDGA rules for any broker- dealer subsidiary of Direct Edge Holdings LLC.\\14\\ Apparent violations of any EDGA rules by any broker-dealer subsidiary of Direct Edge Holdings LLC. will be processed by, and...

  12. 75 FR 28080 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Order Approving and...

    Science.gov (United States)

    2010-05-19

    ... Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S. Rep. No. 94-75, 94th Cong., 1st... EDGX rules for any broker- dealer subsidiary of Direct Edge Holdings LLC.\\14\\ Apparent violations of any EDGX rules by any broker-dealer subsidiary of Direct Edge Holdings LLC. will be processed by, and...

  13. Buys-Ballot Modeling of Nigerian Domestic Crude Oil Production ...

    African Journals Online (AJOL)

    PROF. O. E. OSUAGWU

    2013-09-01

    Sep 1, 2013 ... fluctuations about the trend. (iv). The irregular, random .... Mean 2.309 2.317 2.227 2.186 2.249 2.251 2.296 2.307 2.343 2.381 2.247 2.244. Std. Dev .... In v. S q r. Fig. 3: Time Plot of the Inverse Square Root Transformed Data ...

  14. Play Therapy Behaviors of Sexually Abused Children.

    Science.gov (United States)

    Homeyer, Linda E.; Landreth, Garry L.

    The purpose of this study was to identify play therapy behaviors of sexually abused children. Surveys were sent to members of the Association for Play Therapy, of which 249 respondents, who worked with 16 or more sexually abused children, were used. Results indicate that there are identifiable and highly interrelated PTBs of sexually abused…

  15. Sociolinguistic Variation and Change in British Sign Language Number Signs: Evidence of Leveling?

    Science.gov (United States)

    Stamp, Rose; Schembri, Adam; Fenlon, Jordan; Rentelis, Ramas

    2015-01-01

    This article presents findings from the first major study to investigate lexical variation and change in British Sign Language (BSL) number signs. As part of the BSL Corpus Project, number sign variants were elicited from 249 deaf signers from eight sites throughout the UK. Age, school location, and language background were found to be significant…

  16. Fulltext PDF

    Indian Academy of Sciences (India)

    Asteroseismology ofγ Scuti Stars: Problems and Prospects (M.-J. Goupil, M. A. Dupret,. R. Samadi, T. Boehm, E. Alecian, J. C. Suarez, Y. Lebreton & C. Catala), 249. Pulsations in Subdwarf B Stars (C. Simon Jeffery), 261. Lessons for Asteroseismology from White Dwarf Stars (Travis S. Metcalfe), 273. On the Analysis of Light ...

  17. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K Rajendra Babu. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K ...

  18. Effect of long term cropping hybrid sorrel (Rumex patientia x Rumex tianshanicus) on soil biota

    Czech Academy of Sciences Publication Activity Database

    Heděnec, Petr; Novotný, D.; Usťak, S.; Honzík, R.; Váňa, V.; Petříková, V.; Frouz, Jan

    2015-01-01

    Roč. 78, July (2015), s. 92-98 ISSN 0961-9534 R&D Projects: GA MŠk(CZ) 7E08081 Institutional support: RVO:60077344 Keywords : basal soil respiration * composition of soil biota * hybrid sorrel * microbial biomass C * specific microbial respiration (qCO2) Subject RIV: DF - Soil Science Impact factor: 3.249, year: 2015

  19. 77 FR 38100 - Self-Regulatory Organizations; International Securities Exchange, LLC; Order Instituting...

    Science.gov (United States)

    2012-06-26

    ... motion to enforce the Injunction.\\30\\ ISE objects to the commenters' request that the Commission delay... relationship between settlement value and other values would be preserved in such a circumstance.\\97\\ \\97\\ See... Committee on Banking, Housing and Urban Affairs to Accompany S. 249, S. Rep. No. 75, 94th Cong., 1st Sess...

  20. Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe.

    Science.gov (United States)

    Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix

    2013-03-01

    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.

  1. Wang et al., Afr J Tradit Complement Altern Med. (2015) 12(3):183 ...

    African Journals Online (AJOL)

    USER

    Cooney ... There were more than 400,000 deaths caused by breast cancer per year in past few years .... the rates were 24.9±2.9% (P<0.01), 32.8±4.2% (P<0.01) and 44.9±7.7% (P<0.01) at 24 hours' time point. .... triple negative breast cancer.

  2. Outlook for Mississippi Alluvial Valley forests: a subregional report from the Southern Forest Futures Project

    Science.gov (United States)

    Emile S. Gardiner

    2015-01-01

    The Mississippi Alluvial Valley, which can be broadly subdivided into the Holocene Deposits section and the Deltaic Plain section, is a 24.9-million-acre area generally approximating the alluvial floodplain and delta of the lower Mississippi River. Its robust agricultural economy is maintained by a largely rural population, and recreational resources draw high...

  3. Diagnosis and Elimination of Thallium after an Intentional Intoxication

    Czech Academy of Sciences Publication Activity Database

    Pelclová, D.; Šenholdová, Z.; Lukáš, E.; Urban, P.; Ridzoň, P.; Vlček, K.; Navrátil, Tomáš

    2007-01-01

    Roč. 101, č. 14 (2007), s. 249-250 ISSN 0009-2770. [Mezioborová česko-slovenská toxikologická konference /12./. Praha, 11.06.2007-13.06.2007] Institutional research plan: CEZ:AV0Z40400503 Keywords : Prussian blue * excretion * neurological * alopecia Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.683, year: 2007

  4. Quasi-linear heating and acceleration in bi-Maxwellian plasmas

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Passot, T.; Sulem, P. L.; Trávníček, Pavel M.

    2013-01-01

    Roč. 20, č. 12 (2013), 122306/1-122306/6 ISSN 1070-664X Institutional support: RVO:68378289 Keywords : plasma electromagnetic waves * plasma nonlinear phenomena * diffusion Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013 http://scitation.aip.org/content/aip/journal/pop/20/12/10.1063/1.4846955

  5. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

    2009-01-01

    Roč. 237, č. 3 (2009), s. 249-257 ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  6. In some symmetric spaces monotonicity properties can be reduced to the cone of rearrangements

    Czech Academy of Sciences Publication Activity Database

    Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav

    2016-01-01

    Roč. 90, č. 1 (2016), s. 249-261 ISSN 0001-9054 Institutional support: RVO:67985840 Keywords : symmetric spaces * K-monotone symmetric Banach spaces * strict monotonicity * lower local uniform monotonicity Subject RIV: BA - General Mathematics Impact factor: 0.826, year: 2016 http://link.springer.com/article/10.1007%2Fs00010-015-0379-6

  7. 75 FR 64752 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-20

    .... Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by management investment..., Washington, DC 20549-0213. Extension: Form N-CSR, SEC File No. 270-512, OMB Control No. 3235-0570. Notice is... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...

  8. 78 FR 58351 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-09-23

    .... Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by registered management..., Washington, DC 20549-0213 Extension: Form N-CSR; OMB Control No. 3235-0570, SEC File No. 270-512 Notice is... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...

  9. 75 FR 50784 - Proposed Collection; Comment Request

    Science.gov (United States)

    2010-08-17

    ... Office of Management and Budget for extension and approval. Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by management investment companies to file certified shareholder reports under..., Washington, DC 20549-0213. Extension: Form N-CSR; SEC File No. 270-512; OMB Control No. 3235-0570. Notice is...

  10. 78 FR 43250 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-07-19

    ... Office of Management and Budget for extension and approval. Form N-CSR (17 CFR 249.331 and 274.128) is a combined reporting form used by registered management investment companies (``funds'') to file certified..., Washington, DC 20549-0213. Extension: Form N-CSR. SEC File No. 270-512, OMB Control No. 3235-0570 Notice is...

  11. Legacy System Improvements for the Objective Force

    Science.gov (United States)

    2001-08-14

    Less Than 11 lbs • M249 Short Barrel/ Buttstock •Reduced size/length • Com Remotely Op Wpn Sys •Fire Under Armor w/o Turret • IAV Program Spt •Primary...concepts being evaluated Common Remotely Operated Weapons Station(CROWS) Benefits: • Permits under armor operation of crew served weapons for suppression of

  12. 75 FR 53987 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-09-02

    ..., Washington, DC 20549-0213. Extension: Rule 15Ba2-1 and Form MSD; SEC File No. 270-0088; OMB Control No. 3235... by a bank municipal securities dealer must be filed on Form MSD (17 CFR 249.1100). The Commission uses the information contained in Form MSD to determine whether bank municipal securities dealers meet...

  13. The practice of continuous sedation until death in nursing homes in flanders, belgium: a nationwide study

    NARCIS (Netherlands)

    Rys, S.; Mortier, F.; Deliens, L.; Bilsen, J.

    2014-01-01

    Results The response rate was 65.5%, and 249 nurses reported a case of CSD (57.6%). Most individuals had cancer (33.6%) or dementia (32.8%); lacked competence (65.7%); and had severe pain (71.2%), fatigue (62.3%), loss of dignity (59%), anxiety (58.4%), and longing for death (58.4%). Intractable

  14. C P Vinod

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C P Vinod. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 247-249 Experimental Techniques. A method employing STM for the estimation of relative changes in the work function of modified metal tips · R B Sharma C P Vinod G U Kulkarni.

  15. Attitudes toward Physical Education and Class Preferences of Turkish Adolescents in Terms of School Gender Composition

    Science.gov (United States)

    Koca, Canan; Asci, F. Hulya; Demirhan, Giyasettin

    2005-01-01

    The purpose of this study was to examine attitudes toward physical education (PE and PE class preferences of high school Turkish students in terms of school gender composition; 213 girls and 249 boys from coeducational public schools, and 196 girls and 210 boys from single-sex vocational schools participated in the study. The Attitudes Toward…

  16. Imprints of climate forcings in global gridded temperature data

    Czech Academy of Sciences Publication Activity Database

    Mikšovský, Jiří; Holtanová, E.; Pišoft, P.

    2016-01-01

    Roč. 7, č. 1 (2016), s. 231-249 ISSN 2190-4979 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : atlantic multidecadal osciallation * pacific decadal oscillation * surface-temperature * 20th century reanalysis * southern-oscilation * internal variability * irradiance Subject RIV: EH - Ecology, Behaviour Impact factor: 3.635, year: 2016

  17. Results of a Multisite Survey of U.S. Psychiatry Residents on Education in Professionalism and Ethics

    Science.gov (United States)

    Jain, Shaili; Dunn, Laura B.; Warner, Christopher H.; Roberts, Laura Weiss

    2011-01-01

    Objective: The authors assess the perspectives of psychiatry residents about the goals of receiving education in professionalism and ethics, how topics should be taught, and on what ethical principles the curriculum should be based. Method: A written survey was sent to psychiatry residents (N = 249) at seven U.S. residency programs in Spring 2005.…

  18. Vertically Aligned Niobium Nanowire Arrays for Fast-Charging Micro-Supercapacitors.

    Science.gov (United States)

    Mirvakili, Seyed M; Hunter, Ian W

    2017-07-01

    Planar micro-supercapacitors are attractive for system on chip technologies and surface mount devices due to their large areal capacitance and energy/power density compared to the traditional oxide-based capacitors. In the present work, a novel material, niobium nanowires, in form of vertically aligned electrodes for application in high performance planar micro-supercapacitors is introduced. Specific capacitance of up to 1 kF m -2 (100 mF cm -2 ) with peak energy and power density of 2 kJ m -2 (6.2 MJ m -3 or 1.7 mWh cm -3 ) and 150 kW m -2 (480 MW m -3 or 480 W cm -3 ), respectively, is achieved. This remarkable power density, originating from the extremely low equivalent series resistance value of 0.27 Ω (2.49 µΩ m 2 or 24.9 mΩ cm 2 ) and large specific capacitance, is among the highest for planar micro-supercapacitors electrodes made of nanomaterials. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. In Vitro and in Vivo Evaluation of Mutations in the NS Region of Lineage 2 West Nile Virus Associated with Neuroinvasiveness in a Mammalian Model

    Directory of Open Access Journals (Sweden)

    Katalin Szentpáli-Gavallér

    2016-02-01

    Full Text Available West Nile virus (WNV strains may differ significantly in neuroinvasiveness in vertebrate hosts. In contrast to genetic lineage 1 WNVs, molecular determinants of pathogenic lineage 2 strains have not been experimentally confirmed so far. A full-length infectious clone of a neurovirulent WNV lineage 2 strain (578/10; Central Europe was generated and amino acid substitutions that have been shown to attenuate lineage 1 WNVs were introduced into the nonstructural proteins (NS1 (P250L, NS2A (A30P, NS3 (P249H NS4B (P38G, C102S, E249G. The mouse neuroinvasive phenotype of each mutant virus was examined following intraperitoneal inoculation of C57BL/6 mice. Only the NS1-P250L mutation was associated with a significant attenuation of virulence in mice compared to the wild-type. Multiplication kinetics in cell culture revealed significantly lower infectious virus titres for the NS1 mutant compared to the wild-type, as well as significantly lower amounts of positive and negative stranded RNA.

  20. How elements up to 118 were reached and how to go beyond

    Science.gov (United States)

    Düllmann, Christoph E.

    2017-11-01

    The new superheavy elements with Z=113, 115, 117, and 118 were recently accepted into the periodic table and have been named. Elements with Z≥112 are predominantly produced in 48Ca-induced fusion reactions on actinide targets. This pathway is exhausted at Z=118 due to the lack of target materials with sufficiently high proton number to reach elements with Z≥119. Search experiments for yet heavier elements were performed at GSI Darmstadt and FLNR Dubna. The reactions 50Ti + 249Bk, which leads to Z=119, as well as 64Ni + 238U, 58Fe + 244Pu, 54Cr + 248Cm, and 50Ti + 249Cf, leading to Z=120, have been studied. Despite a total duration of these experiments of more than one year, neither succeeded in the identification of a new element. To obtain improved guidance for better-informed search experiments, nuclear reaction studies appear necessary and have recently started. Also technical advances will be an important pillar to this end. At GSI, work towards a new continuous-wave linear accelerator is ongoing and is briefly described.

  1. Drilling and geophysical logs of the tophole at an oil-and-gas well site, Central Venango County, Pennsylvania

    Science.gov (United States)

    Williams, John H.; Bird, Philip H.; Conger, Randall W.; Anderson, J. Alton

    2014-01-01

    In a study conducted by the U.S. Geological Survey, in cooperation with the Pennsylvania Department of Conservation and Natural Resources, Bureau of Topographic and Geologic Survey, drilling and geophysical logs were used to characterize the geohydrologic framework and the freshwater and saline-water zones penetrated by the tophole at an oil-and-gas well site in central Venango County, Pennsylvania. The geohydrologic setting of the well site is typical of the dissected Appalachian Plateau underlain by Pennsylvanian and Mississippian sandstone and shale. The drilling, gamma, and acoustic-televiewer logs collected from the 575-foot deep tophole define the penetrated Pennsylvanian and Mississippian stratigraphic units and their lithology. The caliper, video, and acoustic-televiewer logs delineate multiple bedding-related and high-angle fractures in the lower Pottsville Group and Shenango Formation from 22 to 249 feet below land surface. The caliper and acoustic-televiewer logs indicate a sparsity of fractures below 249 feet below land surface in the lowermost Shenango Formation, Cuyahoga Group, Corry Sandstone, “Drake Well” formation, and upper Riceville Formation.

  2. Facile Synthesis of ZnO Nanoparticles and Their Photocatalytic Activity

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jun Young; Ko, Sung Hyun; Kim, Sang Wook [Dongguk Univ., Yongin (Korea, Republic of); Lee, Sookeun; Kim, A Young [Daegu Gyeongbuk Institute of Science and Technology, Daegu (Korea, Republic of)

    2014-07-15

    This paper reports the facile synthesis methods of zinc oxide (ZnO) nanoparticles, using diethylene glycol (DEG) and polyethylene glycol (PEG400). The particle size and morphology were correlated with the PEG concentration and reaction time. With 0.75 mL of PEG400 in 150 mL of DEG and a 20 h reaction time, the ZnO nanoparticles began to disperse from a collective spherical grain shape. The ZnO nanoparticles were characterized by X-ray diffraction, scanning electron microscopy, transmission electron microscopy and a N{sub 2} adsorption.desorption studies. The Brunauer-Emmett-Teller (BET) surface areas of and were 157.083, 141.559 and 233.249 m{sup 2}/g, respectively. The observed pore diameters of and were 63.4, 42.0 and 134.0 A, respectively. The pore volumes of and were 0.249, 0.148 and 0.781 cm{sup 3}/g, respectively. The photocatalytic activity of the synthesized ZnO nanoparticles was evaluated by methylene blue (MB) degradation, and the activity showed a good correlation with the N{sub 2} adsorption.desorption data.

  3. 17 CFR 249.104 - Form 4, statement of changes in beneficial ownership of securities.

    Science.gov (United States)

    2010-04-01

    ... can use the information in investigations or litigation involving the federal securities laws or other... citations affecting Form 4, see the List of CFR Sections Affected, which appears in the Finding Aids section...

  4. S.I. No 249 of 1972, Factories Ionising Radiations (Unsealed Radioactive Substances) Regulations, 1972

    International Nuclear Information System (INIS)

    1972-12-01

    The Regulations which entered into force on 1 December 1972 apply to factories in which a process involving the use of unsealed radioactive substances is carried on and where the total activity of the unsealed radioactive substances exceeds specified levels, or where there are objects contaminated in excess of certain levels. The Schedules specify the maximum radiation doses and the maximum permissible levels of contamination and provide for a classification of radionuclides [fr

  5. Beiträge zur Kenntnis der Pupillacea VII. Über zwei Wenig Bekannte Valloniidae

    NARCIS (Netherlands)

    Gittenberger, E.

    1977-01-01

    Spermodea spermatia (Da Silva e Castro) (Fig. 2) Helix spermatia J. da Silva e Castro, 1887: 249 (Locus typicus: "au bois de Bussaco", Bugaco, 40°22'N 8°21'W, etwa 15 km nnö. von Coimbra, Beira Litoral, Portugal — ? Syntypus: MHNG-Bgt2)). — A. Locard, 1899: 61. Helix (Acanthinula) spermatia — C. A.

  6. Buoyancy-Driven Instability of Bubbly Layers: Analogy with Thermal Convection

    Czech Academy of Sciences Publication Activity Database

    Růžička, Marek; Thomas, N. H.

    2003-01-01

    Roč. 29, č. 2 (2003), s. 249-270 ISSN 0301-9322 R&D Projects: GA ČR GA104/01/0547 Grant - others:ERB(XE) IC15-CT98-0904 Institutional research plan: CEZ:AV0Z4072921 Keywords : hydrodynamic diffusio * heterogeneous regime * concentration waves Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.289, year: 2003

  7. The Relationship between the Values of Primary School and Music Teacher Candidates and Their Cheating Attitudes

    Science.gov (United States)

    Saracaloglu, Asuman Seda; Gerçeker, Ceren Saygi; Aladag, Soner

    2018-01-01

    The aim of this research is to examine the relationship between the values of primary and music teacher candidates and their cheating attitudes in terms of different variables. The study group of the research is composed of 249 students who are studying at the Departments of Primary School Teaching and Music Education at Adnan Menderes University…

  8. Rho-associated protein kinase regulates subcellular localisation of Angiomotin and Hippo-signalling during preimplantation mouse embryo development

    Czech Academy of Sciences Publication Activity Database

    Mihajlović, A. I.; Bruce, Alexander

    2016-01-01

    Roč. 33, č. 3 (2016), s. 381-390 ISSN 1472-6483 Grant - others:GA ČR(CZ) GA13-03295S; GA JU(CZ) 004/2015/P Institutional support: RVO:60077344 Keywords : Angiomotin * Hippo-signalling * polarization Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.249, year: 2016 http://www.sciencedirect.com/science/article/pii/S1472648316304047

  9. Investigating Forest Inventory and Analysis-collected tree-ring data from Utah as a proxy for historical climate

    Science.gov (United States)

    R. Justin DeRose; W. Shih-Yu (Simon) Wang; John D. Shaw

    2012-01-01

    Increment cores collected as part of the periodic inventory in the Intermountain West were examined for their potential to represent growth and be a proxy for climate (precipitation) over a large region (Utah). Standardized and crossdated time-series created from pinyon pine (n=249) and Douglas-fir (n=274) increment cores displayed spatiotemporal patterns in growth...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 249 ... Issue, Title. Vol 10, No 1 (2010), Ye Shakoch Chilot (the court of the sheikhs): A traditional institution of conflict resolution in Oromiya zone of Amhara regional state, Ethiopia, Abstract PDF. M Zeleke. Vol 15, No 3 (2015), A comparative analysis of the Post- Arab Spring National Dialogues in Tunisia and ...

  11. Detection of Bioactive Surfactants in Aqueous Solutions on the Basis of H.sub.2./sub.O.sub.2./sub.-Voltammetry

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Novotný, Ladislav

    2000-01-01

    Roč. 366, č. 1 (2000), s. 249-253 ISSN 0937-0633 R&D Projects: GA ČR GA203/98/P239; GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 1.418, year: 2000

  12. Assessment of the Acute Psychiatric Patient in the Emergency Department: Legal Cases and Caveats

    Science.gov (United States)

    2014-05-01

    paranoid behavior. Notable in his evaluation were a blood alcohol level (BAL) of 0.203% and a positive urine screen for marijuana . The EP and social worker...1994; 24(4):672–677. 7. Dubin WR, Weiss KJ, Zeccardi JA. Organic brain syndrome: The psychiatric imposter. JAMA. 1993;249(1):60–62. 8. Tintinalli JE

  13. C M K Nair

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M K Nair. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K Nair.

  14. Locomotor diseases among male long-haul truck drivers and other professional drivers

    DEFF Research Database (Denmark)

    Jensen, Anker; Kaerlev, Linda; Tüchsen, Finn

    2007-01-01

    -249) and for other truck drivers (SHR: 130, 95% CI: 108-156) compared to bus drivers (SHR: 110, 95% CI: 79-149). All drivers had high SHR for lesions of the ulnar nerve (SHR: 159, 95% CI: 119-207), especially bus drivers (SHR: 197, 95% CI: 116-311). Long-haul truck drivers had high SHRs for synovitis and bursitis...

  15. Human Betacoronavirus 2c EMC/2012–related Viruses in Bats, Ghana and Europe

    Science.gov (United States)

    Annan, Augustina; Baldwin, Heather J.; Corman, Victor Max; Klose, Stefan M.; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K.V.; Lina, Peter H.C.; Godlevska, Elena V.; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian

    2013-01-01

    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats. PMID:23622767

  16. Projections of uncertainties in climate change scenarios into expected winter wheat yields

    Czech Academy of Sciences Publication Activity Database

    Trnka, M.; Dubrovský, Martin; Semerádová, Daniela; Žalud, Z.

    2004-01-01

    Roč. 77, - (2004), s. 229-249 ISSN 0177-798X R&D Projects: GA ČR GA521/02/0827 Grant - others:Mendel University of Agriculture and Forestry Brno(CZ) J 08/98:432100001 Institutional research plan: CEZ:AV0Z3042911 Keywords : climate change scenarios * wheat yields Subject RIV: GC - Agronomy Impact factor: 0.964, year: 2004

  17. JMBR APRIL.cdr

    African Journals Online (AJOL)

    FinePrint

    (n=132, 31.5%) were in their third decade of life and the mean age was 33 ±. 4.2 years. ... difference with respect to age (p=0.374). Majority (n=249, 59.5%) were in the lower socio-economic class. ... need to strengthen the continuing oral health education programme, and ..... oral health beliefs and attitudes of Chinese in.

  18. Impinging jets controlled by fluidic input signal

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav; Trávníček, Zdeněk; Peszyński, K.

    2016-01-01

    Roč. 249, October (2016), s. 85-92 ISSN 0924-4247 R&D Projects: GA ČR GA13-23046S; GA ČR GA14-08888S Institutional support: RVO:61388998 Keywords : fluidics * jets * impinging jets * coanda effect Subject RIV: BK - Fluid Dynamics Impact factor: 2.499, year: 2016 http://www.sciencedirect.com/science/article/pii/S0924424716303880

  19. The effectiveness of selected housing subsidies in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Sunega, Petr; Boelhouwer, P.

    2009-01-01

    Roč. 24, č. 3 (2009), s. 249-269 ISSN 1566-4910 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : Housing policy * Welfare economics * Subsidy effectiveness Subject RIV: AH - Economics http://www.springerlink.com/content/y8km555k622v8vu0/

  20. Neutron Field Measurement of p(35)+Be Source using the Multi-foil Activation Method

    Czech Academy of Sciences Publication Activity Database

    Štefánik, Milan; Bém, Pavel; Majerle, Mitja; Novák, Jan; Šimečková, Eva; Štursa, Jan

    2017-01-01

    Roč. 2017, č. 11 (2017), č. článku 249. E-ISSN 1742-3406 Institutional support: RVO:61389005 Keywords : p+Be * Be target * neutron spectrum Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Atomic, molecular and chemical physics (physics of atoms and molecules including collision, interaction with radiation, magnetic resonances, Mössbauer effect)