WorldWideScience

Sample records for mendelevium 247

  1. Studies of neutron-deficient mendelevium isotopes at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)

    2010-01-15

    The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)

  2. ISA 247: trans-ISA 247, trans-R 1524, ISA(TX)247, ISAtx 247, ISATx247, LX 211, LX211, R 1524, R-1524.

    Science.gov (United States)

    2007-01-01

    Isotechnika is developing the immunosuppressive drug ISA 247, a calcineurin inhibitor that is undergoing clinical development for the treatment of psoriasis (phase III) and prevention of organ rejection after transplantation (phase II). Preclinical development for uveitis is also underway. Other autoimmune disease indications that could be explored include arthritis, type I diabetes and Crohn's disease. ISA 247 was being co-developed as R 1524 by Isotechnika and Roche. However, Roche is no longer involved in the development of this compound. Based on analysis of previously collected data, the trans-ISA 247 isomer was found to be more bioavailable and it is expected that this isomer can be administered at a lower dose compared with the previous formulation that consisted of an equivalent mixture of the two geometric isomers (cis and trans). Preclinical observations indicate that ISA 247 has the potential to be more potent and less toxic than other marketed immunosuppressants in its class used for the prevention of transplant rejection. Experiments to date suggest that ISA 247 is about three times as potent as ciclosporin, while genotoxicity studies in animals have shown that the compound has a significantly reduced tendency to cause renal toxicity. The combination of reduced toxicity and improved potency would give ISA 247 a therapeutic benefit over existing calcineurin-based treatments. Isotechnika and Roche entered into a co-development and commercialisation agreement in April 2002, with Roche gaining the exclusive worldwide marketing rights for ISA 247; Isotechnika received milestone payments of $US4 million and $CAN21.9 million in September 2002 and May 2003, respectively. The agreement was restructured in April 2004, under which Isotechnika will now solely manage and fund the clinical development of trans-ISA 247. Upon successful completion of these trials, Isotechnika will conduct at its own expense a phase IIb study in renal transplantation and phase III

  3. Dicty_cDB: SLH247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH247 (Link to dictyBase) - - - Contig-U16280-1 SLH247Z (Link... to Original site) - - SLH247Z 632 - - - - Show SLH247 Library SL (Link to library) Clone ID SLH247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH247Q.Seq.d/ Representative seq. ID SLH24...7Z (Link to Original site) Representative DNA sequence >SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ XXXXX...ant alignments: (bits) Value SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ 1253 0.0 SLA487 (SLA487Q) /CSM/S

  4. 43 CFR 24.7 - Exemptions.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Exemptions. 24.7 Section 24.7 Public Lands...-FEDERAL RELATIONSHIPS § 24.7 Exemptions. (a) Exempted from this policy are the following: (1) The control and regulation by the United States, in the area in which an international convention or treaty...

  5. 7 CFR 247.18 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 247.18 Section 247.18 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.18 Nutrition education. (a) What are the State agency's responsibilities in ensuring that nutrition education is provided? The State agency...

  6. 7 CFR 247.27 - Financial management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management. 247.27 Section 247.27... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.27 Financial management. (a) What are the Federal requirements for State and local agencies with regard to financial management...

  7. 40 CFR 247.13 - Transportation products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Transportation products. 247.13 Section 247.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Transportation products. (a) Traffic barricades and traffic cones used in controlling or restricting vehicular...

  8. 48 CFR 52.247-60 - Guaranteed Shipping Characteristics.

    Science.gov (United States)

    2010-10-01

    ... Characteristics. 52.247-60 Section 52.247-60 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-60 Guaranteed Shipping Characteristics. As prescribed in 47.305-16(b)(1), insert the following clause: Guaranteed Shipping Characteristics (DEC 1989) (a) The offeror is requested to complete...

  9. Dicty_cDB: SHH247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHH247 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - SHH247Z 601 - - - - Show SHH247 Library SH (Link to library) Clone ID SHH247 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b...pdate 2002.12. 6 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...ogaster SD01519 fu... 56 6e-07 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatu

  10. 48 CFR 52.247-2 - Permits, Authorities, or Franchises.

    Science.gov (United States)

    2010-10-01

    ... Franchises. 52.247-2 Section 52.247-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-2 Permits, Authorities, or Franchises. As prescribed in 47.207-1(a), insert the following clause: Permits, Authorities, or Franchises (JAN 1997) (a) The offeror does □, does not □, hold authorization from...

  11. 48 CFR 3452.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel. 3452.247-70 Section 3452.247-70 Federal Acquisition Regulations System DEPARTMENT OF EDUCATION ACQUISITION... travel” means travel outside the fifty States comprising the United States, the District of Columbia, and...

  12. 48 CFR 452.247-70 - Delivery Location.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Delivery Location. 452.247-70 Section 452.247-70 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE CLAUSES AND... Location. As prescribed in 447.302, insert a clause substantially as follows: Delivery Location (FEB 1988...

  13. 25 CFR 247.18 - What are the sanitation prohibitions?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What are the sanitation prohibitions? 247.18 Section 247.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER TREATY FISHING ACCESS SITES § 247.18 What are the sanitation prohibitions? (a) You cannot deposit...

  14. 48 CFR 952.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Foreign travel. 952.247-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.247-70 Foreign travel. As prescribed in 947.7002, insert the following clause: Foreign Travel (JUN 2010) Contractor foreign travel...

  15. 48 CFR 52.247-7 - Freight Excluded.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Freight Excluded. 52.247-7... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.247-7 Freight... contracts for transportation or for transportation-related services when any commodities or types of...

  16. 43 CFR 2.47 - Records subject to Privacy Act.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Records subject to Privacy Act. 2.47 Section 2.47 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.47 Records subject to Privacy Act. The Privacy Act applies to all...

  17. 47 CFR 24.247 - Triggering a reimbursement obligation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Triggering a reimbursement obligation. 24.247... Mhz Band § 24.247 Triggering a reimbursement obligation. (a) Licensed PCS. The clearinghouse will... the Proximity Threshold test indicates that a reimbursement obligation exists, the clearinghouse will...

  18. 40 CFR 247.10 - Paper and paper products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Paper and paper products. 247.10... COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.10 Paper and paper products. Paper and paper products, excluding building and construction paper grades. ...

  19. 48 CFR 52.247-67 - Submission of Transportation Documents for Audit.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Submission of Transportation Documents for Audit. 52.247-67 Section 52.247-67 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.247-67 Submission...

  20. Formation and characterization of Y : 247 film through spray ...

    Indian Academy of Sciences (India)

    Unknown

    gions (< 50 Å) of minority Y : 124 phase and stacking faults capable of ... critical current density (Jc) for Y : 247 films is ~ 103 A/cm2, and with silver ..... biphasic. As a result of decomposition, Y : 247 may be partially converted into Y : 124.

  1. 48 CFR 247.370 - DD Form 1384, Transportation Control and Movement Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1384, Transportation Control and Movement Document. 247.370 Section 247.370 Federal Acquisition Regulations System... Transportation in Supply Contracts 247.370 DD Form 1384, Transportation Control and Movement Document. The...

  2. 32 CFR 247.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.1 Purpose. This part implements DoD Directive 5122.10 1 and implements policy, assigns responsibilities, and prescribes procedures concerning authorized DoD Appropriated Funded (APF) newspapers and magazines, and Civilian Enterprise (CE...

  3. Radiology 24/7 In-House Attending Coverage: Do Benefits Outweigh Cost?

    Science.gov (United States)

    Coleman, Stephanie; Holalkere, Nagaraj Setty; O׳Malley, Julie; Doherty, Gemma; Norbash, Alexander; Kadom, Nadja

    2016-01-01

    Many radiology practices, including academic centers, are moving to in-house 24/7 attending coverage. This could be costly and may not be easily accepted by radiology trainees and attending radiologists. In this article, we evaluated the effects of 24/7 in-house attending coverage on patient care, costs, and qualitative aspects such as trainee education. We retrospectively collected report turnaround times (TAT) and work relative value units (wRVU). We compared these parameters between the years before and after the implementation of 24/7 in-house attending coverage. The cost to provide additional attending coverage was estimated from departmental financial reports. A qualitative survey of radiology residents and faculty was performed to study perceived effects on trainee education. There were decreases in report TAT following 24/7 attending implementation: 69% reduction in computed tomography, 43% reduction in diagnostic radiography, 7% reduction in magnetic resonance imaging, and 43% reduction in ultrasound. There was an average daytime wRVU decrease of 9%, although this was compounded by a decrease in total RVUs of the 2013 calendar year. The financial investment by the institution was estimated at $850,000. Qualitative data demonstrated overall positive feedback from trainees and faculty in radiology, although loss of independence was reported as a negative effect. TAT and wRVU metrics changed with implementation of 24/7 attending coverage, although these metrics do not directly relate to patient outcomes. Additional clinical benefits may include fewer discrepancies between preliminary and final reports that may improve emergency and inpatient department workflows and liability exposure. Radiologists reported the impression that clinicians appreciated 24/7 in-house attending coverage, particularly surgical specialists. Loss of trainee independence on call was a perceived disadvantage of 24/7 attending coverage and raised a concern that residency education

  4. 78 FR 73824 - Subzones 247A and 247B, Authorization of Production Activity, GE Transportation, (Locomotives...

    Science.gov (United States)

    2013-12-09

    ... of Production Activity, GE Transportation, (Locomotives, Off-Highway Vehicles and Motors/Engines), Lawrence Park and Grove City, Pennsylvania On July 18, 2013, GE Transportation submitted a notification of proposed production activity to the Foreign-Trade Zones (FTZ) Board for its facilities within Subzones 247A...

  5. 7 CFR 247.6 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... serving women, infants, and children, program outreach, and nutrition education. (Collaboration with the... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.6 State Plan. (a) What is the State... women, infants, and children, and the options to be used relating to income or other eligibility...

  6. CDC 24/7: Saving Lives, Protecting People

    Centers for Disease Control (CDC) Podcasts

    2012-06-04

    24/7, CDC provides health information, responds to public health emergencies and natural disasters, and monitors disease.  Created: 6/4/2012 by Office of the Associate Director of Communciation (OADC).   Date Released: 6/4/2012.

  7. 48 CFR 52.247-6 - Financial Statement.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Financial Statement. 52....247-6 Financial Statement. As prescribed in 47.207-1(e), insert the following provision in... furnish financial statements: Financial Statement (APR 1984) The offeror shall, upon request, promptly...

  8. Is the chain of galaxies near NGC 247 anomalous

    International Nuclear Information System (INIS)

    Balkowski, C.; Chamaraux, P.

    1975-01-01

    Neutral hydrogen 21-cm observations of the chain of galaxies near NGC 247 are reported on. From HI and optical data, the chain's distance is found to be 62sub(-25)+- 41 Mpc, in agreement with the redshift. This result rules out Arp's assumption of a physical association between NGC 247 and the chain at a confidence level of better than 3.9 times the r.m.s. dispersion. The HI content of the chain is quite normal, and it is likely to be dynamically stable: these results would argue against the proposal made by Burbridge et al. that the chain was formed recently. (orig.) [de

  9. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  10. 48 CFR 52.247-28 - Contractor's Invoices.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Invoices. 52....247-28 Contractor's Invoices. As prescribed in 47.207-9(c), insert the following clause in... services: Contractor's Invoices (APR 1984) The Contractor shall submit itemized invoices as instructed by...

  11. 40 CFR 247.16 - Non-paper office products.

    Science.gov (United States)

    2010-07-01

    ... pressboard binders containing recovered paper; and solid plastic binders containing recovered plastic. (e... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Non-paper office products. 247.16...-paper office products. (a) Office recycling containers and office waste receptacles. (b) Plastic desktop...

  12. 14 CFR 135.247 - Pilot qualifications: Recent experience.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot qualifications: Recent experience... Flight Crewmember Requirements § 135.247 Pilot qualifications: Recent experience. (a) No certificate holder may use any person, nor may any person serve, as pilot in command of an aircraft carrying...

  13. Towards 24/7 continuous heart rate monitoring.

    Science.gov (United States)

    Tarniceriu, Adrian; Parak, Jakub; Renevey, Philippe; Nurmi, Marko; Bertschi, Mattia; Delgado-Gonzalo, Ricard; Korhonen, Ilkka

    2016-08-01

    Heart rate (HR) and HR variability (HRV) carry rich information about physical activity, mental and physical load, physiological status, and health of an individual. When combined with activity monitoring and personalized physiological modelling, HR/HRV monitoring may be used for monitoring of complex behaviors and impact of behaviors and external factors on the current physiological status of an individual. Optical HR monitoring (OHR) from wrist provides a comfortable and unobtrusive method for HR/HRV monitoring and is better adhered by users than traditional ECG electrodes or chest straps. However, OHR power consumption is significantly higher than that for ECG based methods due to the measurement principle based on optical illumination of the tissue. We developed an algorithmic approach to reduce power consumption of the OHR in 24/7 HR trending. We use continuous activity monitoring and a fast converging frequency domain algorithm to derive a reliable HR estimate in 7.1s (during outdoor sports, in average) to 10.0s (during daily life). The method allows >80% reduction in power consumption in 24/7 OHR monitoring when average HR monitoring is targeted, without significant reduction in tracking accuracy.

  14. Switching Investigations on a SiC MOSFET in a TO-247 Package

    DEFF Research Database (Denmark)

    Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe

    2014-01-01

    This paper deals with the switching behavior of a SiC MOSFET in a TO-247 package. Based on simulations, critical parasitic inductances in the circuit layout are analyzed and their effect on the switching losses highlighted. Especially the common source inductance, a critical parameter in a TO-247...... package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching behavior. Switching energies of a SiC MOSFET in a TO-247 package is measured depending on varying gate...... resistance and loop inductances. With total switching energy of 340.24 μJ, the SiC MOSFET has more than six times lower switching losses than a regular Si IGBT. Implementing the SiC switches in a 3 kW T-Type inverter topology, efficiency improvements of 0.8 % are achieved and maximum efficiency of 97...

  15. Genetic Association of CD247 (CD3ζ) with SLE in a Large-Scale Multiethnic Study

    OpenAIRE

    Martins, Madalena; Williams, Adrienne H.; Comeau, Mary; Marion, Miranda; Ziegler, Julie T.; Freedman, Barry I.; Merrill, Joan T.; Glenn, Stuart B.; Kelly, Jennifer A.; Sivils, Kathy M.; James, Judith A.; Guthridge, Joel M.; Alarcón-Riquelme, Marta E.; Bae, Sang-Cheol; Kim, Jae-Hoon

    2015-01-01

    A classic T-cell phenotype in systemic lupus erythematosus (SLE) is the downregulation and replacement of the CD3ζ chain that alters T-cell receptor signaling. However, genetic associations with SLE in the human CD247 locus that encodes CD3ζ are not well established and require replication in independent cohorts. Our aim was therefore to examine, localize and validate CD247-SLE association in a large multiethnic population. We typed 44 contiguous CD247 single-nucleotide polymorphisms (SNPs) i...

  16. Rotational emission-line spectrum of Orion A between 247 and 263 GHZ

    International Nuclear Information System (INIS)

    Blake, G.A.; Sutton, E.C.; Masson, C.R.; Phillips, T.G.

    1986-01-01

    Results are presented from a molecular line survey of the core of the Orion molecular cloud between 247 and 263 GHz. The spectrum contains a total of 243 resolvable lines from 23 different chemical species. When combined with the earlier survey of Orion from 215 to 247 GHz by Sutton et al (1985), the complete data set includes over 780 emission features from 29 distinct molecules. Of the 23 molecules detected in this survey, only NO, CCH, and HCO + were identified not in the lower frequency data

  17. 32 CFR Appendix E to Part 247 - DoD Command Newspaper and Magazine Review System

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false DoD Command Newspaper and Magazine Review System... OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. E Appendix E to Part 247—DoD Command Newspaper and Magazine Review...

  18. Microstructural studies of carbides in MAR-M247 nickel-based superalloy

    Science.gov (United States)

    Szczotok, A.; Rodak, K.

    2012-05-01

    Carbides play an important role in the strengthening of microstructures of nickel-based superalloys. Grain boundary carbides prevent or retard grain-boundary sliding and make the grain boundary stronger. Carbides can also tie up certain elements that would otherwise promote phase instability during service. Various types of carbides are possible in the microstructure of nickel-based superalloys, depending on the superalloy composition and processing. In this paper, scanning electron and scanning transmission electron microscopy studies of carbides occurring in the microstructure of polycrystalline MAR-M247 nickel-based superalloy were carried out. In the present work, MC and M23C6 carbides in the MAR-M247 microstructure were examined.

  19. Investigation of neutron resonances of 247Cm in the 0.5-20 eV energy range

    International Nuclear Information System (INIS)

    Belanova, T.S.; Kolesov, A.G.; Klinov, A.V.; Nikol'skij, S.N.; Poruchikov, V.A.; Nefedov, V.N.; Artamonov, V.S.; Ivanov, R.N.; Kalebin, S.M.

    1979-01-01

    The neutron resonance parameters of 247 Cm were calculated from the transmission of a curium sample measured by the time-of-flight method. The neutron resonance parameters were calculated by the shape method using the single-level Breit-Wigner formula. Since the neutron resonance parameters of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu are well known, it was possible to identify the neutron resonances of 247 Cm from the measured transmission and calculate their parameters. We identified only five neutron resonances of 247 Cm with high values of 2gGAMMAsub(n). This is due to the fact that the 247 Cm content of the sample is low (1.7mg) and the resonances of this isotope are identified against the background of a large number of resonances of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu situated in the energy range in question

  20. 48 CFR 52.247-51 - Evaluation of Export Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Export....247-51 Evaluation of Export Offers. As prescribed in 47.305-6(e), insert the following provision: Evaluation of Export Offers (JAN 2001) (a) Port handling and ocean charges—other than DOD water terminals...

  1. The energy and monetary implications of the '24/7 'always on' society

    International Nuclear Information System (INIS)

    Loveday, Dennis L.; Bhamra, T.; Tang, T.; Haines, V.J.A.; Holmes, M.J.; Green, R.J.

    2008-01-01

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand - and generally receive - what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves. (author)

  2. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  3. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  4. Serving culturally diverse learners in the 24/7 management classroom

    NARCIS (Netherlands)

    van de Bunt-Kokhuis, S.G.M.; Weir, D.

    2013-01-01

    Purpose: The purpose of this paper is to highlight how future teaching in business schools will probably take place in an online (here called 24/7) classroom, where culturally diverse e-learners around the globe meet. Technologies such as iPhone, iPad and a variety of social media, to mention but a

  5. 48 CFR 252.247-7026 - Evaluation Preference for Use of Domestic Shipyards-Applicable to Acquisition of Carriage by...

    Science.gov (United States)

    2010-10-01

    ... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.247-7026 Evaluation Preference for Use of... Noncontiguous Trade. As prescribed in 247.574(e), use the following provision: Evaluation Preference For Use of... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation Preference for...

  6. 17 CFR 247.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... the average of the minimum and maximum hourly wage established by the bank for the current or prior... networking exception from the definition of âbroker.â 247.700 Section 247.700 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATION R-EXEMPTIONS AND DEFINITIONS RELATED TO...

  7. 48 CFR 247.371 - DD Form 1653, Transportation Data for Solicitations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1653... Supply Contracts 247.371 DD Form 1653, Transportation Data for Solicitations. The transportation specialist prepares the DD Form 1653 to accompany requirements for the acquisition of supplies. The completed...

  8. Creep Behaviour of Modified Mar-247 Superalloy

    Directory of Open Access Journals (Sweden)

    Cieśla M.

    2016-06-01

    Full Text Available The paper presents the results of analysis of creep behaviour in short term creep tests of cast MAR-247 nickel-based superalloy samples made using various modification techniques and heat treatment. The accelerated creep tests were performed under temperature of 982 °C and the axial stresses of σ = 150 MPa (variant I and 200 MPa (variant II. The creep behaviour was analysed based on: creep durability (creep rupture life, steady-state creep rate and morphological parameters of macro- and microstructure. It was observed that the grain size determines the creep durability in case of test conditions used in variant I, durability of coarse-grained samples was significantly higher.

  9. 7 CFR 247.24 - Recovery and redistribution of caseload and administrative funds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Recovery and redistribution of caseload and...) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.24 Recovery and redistribution of caseload and administrative funds. (a) May FNS...

  10. 17 CFR 247.781 - Exemption from the definition of “broker” for banks for a limited period of time.

    Science.gov (United States)

    2010-04-01

    ... “broker” for banks for a limited period of time. A bank is exempt from the definition of the term “broker... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks for a limited period of time. 247.781 Section 247.781 Commodity and Securities...

  11. 24/7 SM slavery.

    Science.gov (United States)

    Dancer, Peter L; Kleinplatz, Peggy J; Moser, Charles

    2006-01-01

    This study describes the nature of 24/7 SM slavery as practiced within the SM (sadomasochistic) community. These SM participants, who attempt to live full-time in owner-slave roles, represent a small proportion of those with SM interests. SM slaves have not been studied systematically to determine if and how they differ from other SM practitioners. An online questionnaire was used to obtain responses from individuals who self-identified as slaves. A total of 146 respondents participated, 53% female and 47% male, ranging in age from 18 to 72. We explored the depth of their relationships, how well they approximated "slavery," and how their relationships were structured to maintain distinct roles. Data showed that in long-term SM slave relationships, a power differential exists which extends beyond time-limited SM or sexual interactions. Owners and slaves often use common, daily life experiences or situations, such as the completion of household chores, money management, and morning or evening routines, to distinguish and maintain their respective roles. In addition, contrary to the perception of total submission, results revealed that slaves exercise free will when it is in their best interests to do so. These relationships were long-lasting and satisfying to the respondents.

  12. 48 CFR 247.372 - DD Form 1654, Evaluation of Transportation Cost Factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1654, Evaluation... Transportation in Supply Contracts 247.372 DD Form 1654, Evaluation of Transportation Cost Factors. Contracting personnel may use the DD Form 1654 to furnish information to the transportation office for development of...

  13. 7 CFR 247.23 - State provision of administrative funds to local agencies.

    Science.gov (United States)

    2010-01-01

    ... funds will be used to achieve program objectives. (Approved by the Office of Management and Budget under... 7 Agriculture 4 2010-01-01 2010-01-01 false State provision of administrative funds to local... PROGRAM § 247.23 State provision of administrative funds to local agencies. (a) How much of the...

  14. 7 CFR 247.13 - Provisions for non-English or limited-English speakers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Provisions for non-English or limited-English speakers... § 247.13 Provisions for non-English or limited-English speakers. (a) What must State and local agencies do to ensure that non-English or limited-English speaking persons are aware of their rights and...

  15. Selective Cathepsin S Inhibition with MIV-247 Attenuates Mechanical Allodynia and Enhances the Antiallodynic Effects of Gabapentin and Pregabalin in a Mouse Model of Neuropathic Pain.

    Science.gov (United States)

    Hewitt, Ellen; Pitcher, Thomas; Rizoska, Biljana; Tunblad, Karin; Henderson, Ian; Sahlberg, Britt-Louise; Grabowska, Urszula; Classon, Björn; Edenius, Charlotte; Malcangio, Marzia; Lindström, Erik

    2016-09-01

    Cathepsin S inhibitors attenuate mechanical allodynia in preclinical neuropathic pain models. The current study evaluated the effects when combining the selective cathepsin S inhibitor MIV-247 with gabapentin or pregabalin in a mouse model of neuropathic pain. Mice were rendered neuropathic by partial sciatic nerve ligation. MIV-247, gabapentin, or pregabalin were administered alone or in combination via oral gavage. Mechanical allodynia was assessed using von Frey hairs. Neurobehavioral side effects were evaluated by assessing beam walking. MIV-247, gabapentin, and pregabalin concentrations in various tissues were measured. Oral administration of MIV-247 (100-200 µmol/kg) dose-dependently attenuated mechanical allodynia by up to approximately 50% reversal when given as a single dose or when given twice daily for 5 days. No behavioral deficits were observed at any dose of MIV-247 tested. Gabapentin (58-350 µmol/kg) and pregabalin (63-377 µmol/kg) also inhibited mechanical allodynia with virtually complete reversal at the highest doses tested. The minimum effective dose of MIV-247 (100 µmol/kg) in combination with the minimum effective dose of pregabalin (75 µmol/kg) or gabapentin (146 µmol/kg) resulted in enhanced antiallodynic efficacy without augmenting side effects. A subeffective dose of MIV-247 (50 µmol/kg) in combination with a subeffective dose of pregabalin (38 µmol/kg) or gabapentin (73 µmol/kg) also resulted in substantial efficacy. Plasma levels of MIV-247, gabapentin, and pregabalin were similar when given in combination as to when given alone. Cathepsin S inhibition with MIV-247 exerts significant antiallodynic efficacy alone, and also enhances the effect of gabapentin and pregabalin without increasing side effects or inducing pharmacokinetic interactions. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.

  16. 75 FR 62333 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers

    Science.gov (United States)

    2010-10-08

    ...., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory... that the 247F propeller blades, P/N 817370-1, S/Ns FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, manufactured since January 1999, might also have...

  17. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  18. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Vasconcellos Cidia

    1995-01-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  19. Extending Pickering Fuel Channel Life to 247,000 EFPH (2020)

    International Nuclear Information System (INIS)

    Malek, I.

    2013-01-01

    This presentation is about extending the life of PNGS Pressure tubes from 210,000 EFPH (Effective Full Power Hours) to 247,000 EFPH. The l license renewal is in 2013 (R & D defined in 2009). The unknowns are the extent of degradation in some key areas. There are regulatory requirements for fuel channel extended life. It is necessary to integrate inspection capability and do-ability in outages. This would result in safe operation and demonstrated margin to extend life with operation to 2020.

  20. Perceptions of 24/7 In-house Attending Coverage on Fellow Education and Autonomy in a Pediatric Cardiothoracic Intensive Care Unit.

    Science.gov (United States)

    Owens, Sonal T; Owens, Gabe E; Rajput, Shaili H; Charpie, John R; Kidwell, Kelley M; Mullan, Patricia B

    2015-01-01

    The 24/7 in-house attending coverage is emerging as the standard of care in intensive care units. Implementation costs, workforce feasibility, and patient outcomes resulting from changes in physician staffing are widely debated topics. Understanding the impact of staffing models on the learning environment for medical trainees and faculty is equally warranted, particularly with respect to trainee education and autonomy. This study aims to elicit the perceptions of pediatric cardiology fellows and attendings toward 24/7 in-house attending coverage and its effect on fellow education and autonomy. We surveyed pediatric cardiology fellows and attendings practicing in the pediatric cardiothoracic intensive care unit (PCTU) of a large, university-affiliated medical center, using structured Likert response items and open-ended questions, prior to and following the transition to 24/7 in-house attending coverage. All (100%) trainees and faculty completed all surveys. Both prior to and following transition to 24/7 in-house attending coverage, all fellows, and the majority of attendings agreed that the overnight call experience benefited fellow education. At baseline, trainees identified limited circumstances in which on-site attending coverage would be critical. Preimplementation concerns that 24/7 in-house attending coverage would negatively affect the education of fellows were not reflected following actual implementation of the new staffing policy. However, based upon open-ended questions, fellow autonomy was affected by the new paradigm, with fellows and attendings reporting decreased "appropriateness" of autonomy after implementation. Our prospective study, showing initial concerns about limiting the learning environment in transitioning to 24/7 in-house attending coverage did not result in diminished perceptions of the educational experience for our fellows but revealed an expected decrease in fellow autonomy. The study indirectly facilitated open discussions about

  1. 24/7 pediatric radiology attending coverage: times are changing

    Energy Technology Data Exchange (ETDEWEB)

    Donaldson, James S. [Feinberg School of Medicine at Northwestern University, Department of Medical Imaging, Ann and Robert H. Lurie Children' s Hospital of Chicago, IL (United States); Thakrar, Kiran H. [University of Chicago Pritzker School of Medicine, Body Imaging, NorthShore University HealthSystem, Chicago, IL (United States)

    2017-06-15

    The job of the pediatric radiologist long ago ceased to be an 8-to-5 role. Many practices have adopted evening shifts of in-house attending radiologists to cover the busy evening activity. With the ever-increasing role of imaging in clinical decisions and patient management, there is a need - if not a demand - to further extend attending pediatric radiology coverage. In this article, we discuss the needs and justification for extending pediatric radiology coverage at a tertiary-care children's hospital. We also describe the approach we took toward implementing 24/7 attending in-house coverage of pediatric radiology. (orig.)

  2. The energy and monetary implications of the '24/7 'always on' society

    Energy Technology Data Exchange (ETDEWEB)

    Loveday, Dennis L. [Department of Civil and Building Engineering, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Bhamra, T.; Tang, T. [Department of Design and Technology, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Haines, V.J.A. [Ergonomics and Safety Research Institute (ESRI), Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Holmes, M.J. [ARUP, 13, Fitzroy Street, London W1T 4BR (United Kingdom); Green, R.J. [Institute for Energy Research and Policy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)

    2008-12-15

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand - and generally receive - what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves. (author)

  3. 32 CFR Appendix C to Part 247 - Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and Distribution of...

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Mailing of DoD Newspapers, Magazines, CE Guides...) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. C Appendix C to Part 247—Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and...

  4. 24/7 in-house intensivist coverage and fellowship education: a cross-sectional survey of academic medical centers in the United States.

    Science.gov (United States)

    Diaz-Guzman, Enrique; Colbert, Colleen Y; Mannino, David M; Davenport, Daniel L; Arroliga, Alejandro C

    2012-04-01

    The objectives of this study were to determine the current staffing models of practice and the frequency of 24/7 coverage in academic medical centers in the United States and to assess the perceptions of critical care trainees and program directors toward these models. A cross-sectional national survey was conducted using an Internet-based survey platform. The survey was distributed to fellows and program directors of 374 critical care training programs in US academic medical centers. We received 518 responses: 138 from program directors (PDs) (37% of 374 programs) and 380 fellow responses. Coverage by a board-certified or board-eligible intensivist physician 24/7 was reported by 33% of PD respondents and was more common among pediatric and surgical critical care programs. Mandatory in-house call for critical care trainees was reported by 48% of the PDs. Mandatory call was also more common among pediatric-critical care programs compared with the rest (P 24/7 coverage would be associated with better patient care in the ICU and improved education for the fellows, although 65% of them believed this model would have a negative impact on trainees' autonomy. Intensivist coverage 24/7 was not commonly used in US academic centers responding to our survey. Significant differences in coverage models among critical care medicine specialties appear to exist. Program director and trainee respondents believed that 24/7 coverage was associated with better outcomes and education but also expressed concerns about the impact of this model on fellows' autonomy.

  5. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  6. Evaluation of Cm-247 neutron cross sections in the resonance region

    International Nuclear Information System (INIS)

    Martinelli, T.; Menapace, E.; Motta, M.; Vaccari, M.

    1980-01-01

    The neutron cross sections of Cm-247 are evaluated in the resonance (resolved and unresolved) region up to 10 keV. Average resonance parameters (i.e. spacing D, fission and radiative widths, neutron strength functions) are determined for unresolved region calculations. Moreover for a better comparison with the experimental data, fission cross section is calculated up to 10 MeV. In addition, the average number of neutrons emitted per fission as a function of energy is estimated

  7. The energy and monetary implications of the '24/7' 'always on' society

    Energy Technology Data Exchange (ETDEWEB)

    Loveday, Dennis L. [Department of Civil and Building Engineering, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom)], E-mail: d.l.loveday@lboro.ac.uk; Bhamra, T.; Tang, T. [Department of Design and Technology, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Haines, V.J.A. [Ergonomics and Safety Research Institute (ESRI), Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Holmes, M.J. [ARUP, 13, Fitzroy Street, London W1T 4BR (United Kingdom); Green, R.J. [Institute for Energy Research and Policy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)

    2008-12-15

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand-and generally receive-what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves.

  8. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.Foi analisado o perfil de 247 doentes com eritrodermia em um período de 23 anos, de Janeiro de 1962 a março de 1985, com o período de seguimento variando de 1 a 26 anos. Os doentes se apresentavam com eritema universal, descamação e prurido com mais de 2 meses de duração e a idade variava de 16 a 60 anos. A psoríase foi a doença associada mais freqüente, com uma proporção estimada de 44,9%, as reações cutâneas ao uso de drogas contribuíram com 7,3% do total de casos e a associação com reticuloses mostrou uma proporção de 4,1%. A eritrodermia permaneceu como de causa desconhecida em 29,2% dos casos. Não foram observadas diferenças entre os sexos no que diz respeito à doença associada. Um ou mais resultados anátomo patológicos das biópsias de pele, em conjunto com o quadro clínico, foi diagnóstico ou sugestivo do

  9. High cycle fatigue behavior of the IN718/M247 hybrid element fabricated by friction welding at elevated temperatures

    Directory of Open Access Journals (Sweden)

    Tran Hung Tra

    2016-12-01

    Full Text Available A hybrid element has been fabricated by friction welding, joining two superalloys Inconel 718 and Mar-M247. The high cycle fatigue behavior of this welded element was investigated at 500 °C and 700 °C. The fabrication could obtain excellent fatigue strength in which the fracture is located in the base metal Mar-M247 side and takes place outside the welded zone. The behavior of the joint under loadings is discussed through a simulation by the numerical finite element method.

  10. Development and Pilot Testing of 24/7 In-Ambulance Telemedicine for Acute Stroke: Prehospital Stroke Study at the Universitair Ziekenhuis Brussel-Project.

    Science.gov (United States)

    Valenzuela Espinoza, Alexis; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Fernandez Tellez, Helio; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Successful execution of the project involved the development and validation of a novel stroke scale, design and creation of specific hardware and software solutions, execution of field tests for mobile internet connectivity, design of new care processes and information flows, recurrent training of all professional caregivers involved in acute stroke management, extensive testing on healthy volunteers, organisation of a 24/7 teleconsultation service by trained stroke experts and 24/7 technical support, and resolution of several legal issues. In all, it took 41 months of research and development to confirm the safety, technical feasibility, reliability, and user acceptance of the PreSSUB approach. Stroke-specific key information can be collected safely and reliably before and during ambulance transportation and can adequately be communicated with the inhospital team awaiting the patient. This paper portrays the key steps required and the lessons learned for successful implementation of a 24/7 expert telemedicine service supporting patients with acute stroke during ambulance transportation to the hospital. © 2016 S. Karger AG, Basel.

  11. 24/7 security system: 60-FPS color EMCCD camera with integral human recognition

    Science.gov (United States)

    Vogelsong, T. L.; Boult, T. E.; Gardner, D. W.; Woodworth, R.; Johnson, R. C.; Heflin, B.

    2007-04-01

    An advanced surveillance/security system is being developed for unattended 24/7 image acquisition and automated detection, discrimination, and tracking of humans and vehicles. The low-light video camera incorporates an electron multiplying CCD sensor with a programmable on-chip gain of up to 1000:1, providing effective noise levels of less than 1 electron. The EMCCD camera operates in full color mode under sunlit and moonlit conditions, and monochrome under quarter-moonlight to overcast starlight illumination. Sixty frame per second operation and progressive scanning minimizes motion artifacts. The acquired image sequences are processed with FPGA-compatible real-time algorithms, to detect/localize/track targets and reject non-targets due to clutter under a broad range of illumination conditions and viewing angles. The object detectors that are used are trained from actual image data. Detectors have been developed and demonstrated for faces, upright humans, crawling humans, large animals, cars and trucks. Detection and tracking of targets too small for template-based detection is achieved. For face and vehicle targets the results of the detection are passed to secondary processing to extract recognition templates, which are then compared with a database for identification. When combined with pan-tilt-zoom (PTZ) optics, the resulting system provides a reliable wide-area 24/7 surveillance system that avoids the high life-cycle cost of infrared cameras and image intensifiers.

  12. Synthesis of the enantiomers of [3-3H]-2-[[4-[(7-chloro-4-quinolinyl)-amino]pentyl]ethylamino]eth anol, [3-3H]-hydroxychloroquine

    International Nuclear Information System (INIS)

    Ellames, G.J.; Herbert, J.M.; Peace, J.E.; Smith, D.J.; Wedge, K.J.

    1995-01-01

    The enantiomers of [3- 3 H]-2-[[4-[(7-chloro-4-quinolinyl)amino] pentyl]ethylamino]ethanol, [3- 3 H]-hydroxychloroquine, (R)-8 and (S)-8, have been prepared in two steps from the known precursors 4,7-dichloro-3-iodoquinoline, and the enantiomers of 2-[(4-aminopentyl) ethyl-amino]ethanol, (R)-2 and (S)-2, by formation of the enantiomers of 2-[[4-[(7-chloro-3-iodo-4-quinolinyl)amino]pentyl]ethylamino] ethanol, (R)-3 and (S)-3, and subsequent reductive deiodination with tritium gas over 10% palladium on charcoal. (Author)

  13. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  14. Prediction of maximum casting defect size in MAR-M-247 alloy processed by hot isostatic pressing

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Fintová, Stanislava; Kunz, Ludvík; Hutař, Pavel; Hrbáček, K.

    2015-01-01

    Roč. 22, č. 1 (2015), s. 25-32 ISSN 1335-0803 R&D Projects: GA MPO FR-TI4/030; GA MŠk(CZ) EE2.3.20.0214 Institutional support: RVO:68081723 Keywords : MAR-M 247 * Superalloys * Fatigue * Casting defects * Elevated temperatures Subject RIV: JL - Materials Fatigue, Friction Mechanics http://ojs.mateng.sk/index.php/Mateng/article/view/160/249

  15. Nursing staffs self-perceived outcome from a rehabilitation 24/7 educational programme - a mixed-methods study in stroke care.

    Science.gov (United States)

    Loft, M I; Esbensen, B A; Kirk, K; Pedersen, L; Martinsen, B; Iversen, H; Mathiesen, L L; Poulsen, I

    2018-01-01

    During the past two decades, attempts have been made to describe nurses' contributions to the rehabilitation of inpatients following stroke. There is currently a lack of interventions that integrate the diversity of nurses' role and functions in stroke rehabilitation and explore their effect on patient outcomes. Using a systematic evidence- and theory-based design, we developed an educational programme, Rehabilitation 24/7, for nursing staff working in stroke rehabilitation aiming at two target behaviours; working systematically with a rehabilitative approach in all aspects of patient care and working deliberately and systematically with patients' goals. The aim of this study was to assess nursing staff members' self-perceived outcome related to their capability, opportunity and motivation to work with a rehabilitative approach after participating in the stroke Rehabilitation 24/7 educational programme. A convergent mixed-method design was applied consisting of a survey and semi-structured interviews. Data collection was undertaken between February and June 2016. Data from the questionnaires ( N  = 33) distributed before and after the intervention were analysed using descriptive statistics and Wilcoxon sign rank test. The interviews ( N  = 10) were analysed using deductive content analysis. After analysing questionnaires and interviews separately, the results were merged in a side by side comparison presented in the discussion. The results from both the quantitative and qualitative analyses indicate that the educational programme shaped the target behaviours that we aimed to change by addressing the nursing staff's capability, opportunity and motivation and hence could strengthen the nursing staff's contribution to inpatient stroke rehabilitation. A number of behaviours changed significantly, and the qualitative results indicated that the staff experienced increased focus on their role and functions in rehabilitation practice. Our study provides an

  16. Help at 3:00 AM! Providing 24/7 Timely Support to Online Students via a Virtual Assistant

    Science.gov (United States)

    Vu, Phu; Fredrickson, Scott; Meyer, Richard

    2016-01-01

    With a dearth of research on human-robot interaction in education and relatively high non-completion rates of online students, this study was conducted to determine the feasibility of using a virtual assistant (VA) to respond to questions and concerns of students and provide 24/7 online course content support. During a 16 week-long academic…

  17. Synthesis of the enantiomers of [3-{sup 3}H]-2-[[4-[(7-chloro-4-quinolinyl)-amino]pentyl]ethylamino]eth anol, [3-{sup 3}H]-hydroxychloroquine

    Energy Technology Data Exchange (ETDEWEB)

    Ellames, G.J.; Herbert, J.M.; Peace, J.E.; Smith, D.J.; Wedge, K.J. [Sterling Winthrop Research Centre, Alnwick (United Kingdom). Pharmaceuticals Research Div.

    1995-01-01

    The enantiomers of [3-{sup 3}H]-2-[[4-[(7-chloro-4-quinolinyl)amino] pentyl]ethylamino]ethanol, [3-{sup 3}H]-hydroxychloroquine, (R)-8 and (S)-8, have been prepared in two steps from the known precursors 4,7-dichloro-3-iodoquinoline, and the enantiomers of 2-[(4-aminopentyl) ethyl-amino]ethanol, (R)-2 and (S)-2, by formation of the enantiomers of 2-[[4-[(7-chloro-3-iodo-4-quinolinyl)amino]pentyl]ethylamino] ethanol, (R)-3 and (S)-3, and subsequent reductive deiodination with tritium gas over 10% palladium on charcoal. (Author).

  18. 40 CFR 174.524 - Glyphosate Oxidoreductase GOX or GOXv247 in all plants; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate... Glyphosate Oxidoreductase GOX or GOXv247 enzyme in all plants are exempt from the requirement of a tolerance...

  19. A Gene Encoding a DUF247 Domain Protein Cosegregates with the S Self-Incompatibility Locus in Perennial Ryegrass

    DEFF Research Database (Denmark)

    Manzanares, Chloe; Barth, Susanne; Thorogood, Daniel

    2016-01-01

    genes cosegregating with the S-locus, a highly polymorphic gene encoding for a protein containing a DUF247 was fully predictive of known S-locus genotypes at the amino acid level in the seven mapping populations. Strikingly, this gene showed a frameshift mutation in self-compatible darnel (Lolium...

  20. Spatially conserved regulatory elements identified within human and mouse Cd247 gene using high-throughput sequencing data from the ENCODE project

    DEFF Research Database (Denmark)

    Pundhir, Sachin; Hannibal, Tine Dahlbæk; Bang-Berthelsen, Claus Heiner

    2014-01-01

    . In this study, we have utilized the wealth of high-throughput sequencing data produced during the Encyclopedia of DNA Elements (ENCODE) project to identify spatially conserved regulatory elements within the Cd247 gene from human and mouse. We show the presence of two transcription factor binding sites...

  1. Development and Pilot Testing of 24/7 In-Ambulance Telemedicine for Acute Stroke : Prehospital Stroke Study at the Universitair Ziekenhuis Brussel-Project

    NARCIS (Netherlands)

    Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study

  2. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  3. PHL 6625: A Minor Merger-associated QSO Behind NGC 247

    Energy Technology Data Exchange (ETDEWEB)

    Tao, Lian; Feng, Hua [Department of Engineering Physics, Tsinghua University, Beijing 100084 (China); Shen, Yue; Liu, Xin [Department of Astronomy, University of Illinois at Urbana-Champaign, Urbana, IL 61801 (United States); Ho, Luis C. [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100087 (China); Ge, Junqiang [National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Chaoyang District, Beijing 100012 (China); Kaaret, Philip [Department of Physics and Astronomy, University of Iowa, Iowa City, IA 52242 (United States); Mao, Shude [Center for Astrophysics, Tsinghua University, Beijing 100084 (China)

    2017-06-01

    PHL 6625 is a luminous quasi-stellar object (QSO) at z = 0.3954 located behind the nearby galaxy NGC 247 ( z = 0.0005). Hubble Space Telescope observations revealed an arc structure associated with it. We report on spectroscopic observations with the Very Large Telescope and multiwavelength observations from the radio to the X-ray band for the system, suggesting that PHL 6625 and the arc are a close pair of merging galaxies, instead of a strong gravitational lens system. The QSO host galaxy is estimated to be (4–28) × 10{sup 10} M {sub ☉} and the mass of the companion galaxy is estimated to be M {sub *} = (6.8 ± 2.4) × 10{sup 9} M {sub ☉}, suggesting that this is a minor merger system. The QSO displays typical broad emission lines, from which a black hole mass of about (2–5) × 10{sup 8} M {sub ☉} and an Eddington ratio of about 0.01–0.05 can be inferred. The system represents an interesting and rare case where a QSO is associated with an ongoing minor merger, analogous to Arp 142.

  4. 24/7 Connectedness and its Potential Impact on Today’s Physics Students: Technology Use, Multitasking, and GenMe

    OpenAIRE

    Teresa L. Larkin; Benjamin R. Hein

    2018-01-01

    There is no question that the digital age is upon us. For many of us, the trans-formation to the digital age has been gradual; and, most often, welcomed. In the classroom, we have developed many useful and innovative applications technolo-gy-based pedagogies. Outside of the classroom, we use routinely rely on tech-nology to communicate with our students. However, not all of us grew up with 24/7 access to information that the internet and today’s technologies provide. Perhaps the impact o...

  5. Safe2Tell® : an anonymous, 24/7 reporting system for preventing school violence.

    Science.gov (United States)

    Payne, Susan R T; Elliott, Delbert S

    2011-01-01

    There is widespread agreement that many school shootings could be prevented if authorities were informed that a student was planning or preparing to carry out an attack. A universal problem is that young people are highly reluctant to report on their peers. This code of silence represents a major barrier to prevention efforts. In response to the Columbine shooting, the state of Colorado established the Safe2Tell® anonymous, 24/7 reporting system for receiving and forwarding threats of violence, bullying, and other concerns. This article describes how the program has grown to the point that it now receives more than 100 calls per month. A series of case examples illustrates its success in responding to threatening situations, including twenty-eight potential school attacks. Copyright © 2011 Wiley Periodicals, Inc., A Wiley Company.

  6. High temperature creep properties of directionally solidified CM-247LC Ni-based superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Chiou, Mau-Sheng [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Jian, Sheng-Rui, E-mail: srjian@gmail.com [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Yeh, An-Chou [Department of Materials Science and Engineering, National Tsing Hua University, Hsinchu 300, Taiwan (China); Kuo, Chen-Ming [Department of Mechanical and Automation Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Juang, Jenh-Yih [Department of Electrophysics, National Chiao Tung University, Hsinchu 300, Taiwan (China)

    2016-02-08

    This study explores the effects of cooling rate after solution heat treatment on the high temperature/low stress (982 °C/200 MPa) creep properties of CM-247LC Nickel base superalloy. Cooling rate was controlled by blowing argon gas, air cooling, and furnace cooling, which, in turn, gave rise to corresponding cooling rates (from 1260 °C to 800 °C) of 18.7, 7.4, and 0.19 °C/s, respectively. The results indicated that higher cooling rate from the solution heat treatment temperature led to finer γ′ precipitates and much improved tertiary creep as well as rupture life time in high-temperature creep test. The microstructural analyses using both scanning electron microscopy (SEM) and transmission electron microscopy (TEM) revealed that finer γ′ precipitates and narrower γ channel width could result in denser rafting structure which might have hindered the climb of dislocations across the precipitates rafts.

  7. LA SENTENCIA DEL TRIBUNAL CONSTITUCIONAL 247/2007 Y EL SISTEMA CONSTITUCIONAL DE DISTRIBUCIÓN DE COMPETENCIAS ENTRE EL ESTADO Y LAS COMUNIDADES AUTÓNOMAS

    Directory of Open Access Journals (Sweden)

    Joaquín Tornos Mas

    2008-10-01

    Full Text Available The aim of this study is to examine articles 7 to 10 of ruling 247/2007 of theConstitutional Court, in which the role of the Statutes of Autonomy in thedivision of jurisdictions between the Central Government and the AutonomousCommunities is analysed, and the impact that the ruling in this case may haveon the future ruling on the Catalan Statute. To link ruling 247/2007 withthe future ruling on the Catalan Statute, on one side the appellant parties –the Partido Popular and the ombudsman, and the Parliement of Catalonia,on the other, the Constitutional Court makes its arguments regarding theextent to which the Statutes of Autonomy limit its jurisdiction. Public knowledgeof the appellants’ arguments and the Constitutional Court’s decisionregarding this case, which are included in a ruling from previous appealsthat pronounces on many of the issues covered in the mentioned appeals,allows the study to close with a series of considerations about the future rulingof the Constitutional Court on the part of the Catalan Statute relatingto the new model for distribution of jurisdictions.

  8. Development and pilot testing of 24/7 in-ambulance telemedicine for acute stroke : prehospital stroke study at the Universitair Ziekenhuis Brussel-project

    OpenAIRE

    Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    Abstract: Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Methods: Successful execution of the project involved the develop...

  9. Development and Pilot Testing of 24/7 In-Ambulance Telemedicine for Acute Stroke: Prehospital Stroke Study at the Universitair Ziekenhuis Brussel-Project

    OpenAIRE

    Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Methods: Successful execution of the project involved the development and v...

  10. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-08-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  11. 24/7 Connectedness and its Potential Impact on Today’s Physics Students: Technology Use, Multitasking, and GenMe

    Directory of Open Access Journals (Sweden)

    Teresa L. Larkin

    2018-05-01

    Full Text Available There is no question that the digital age is upon us. For many of us, the trans-formation to the digital age has been gradual; and, most often, welcomed. In the classroom, we have developed many useful and innovative applications technolo-gy-based pedagogies. Outside of the classroom, we use routinely rely on tech-nology to communicate with our students. However, not all of us grew up with 24/7 access to information that the internet and today’s technologies provide. Perhaps the impact of technology on those of us that teach is a bit different from the impact on our students. Many of our students today are members of the mil-lennial generation, which is sometimes referred to as Generation Me (GenMe. Members of GenMe have literally grown up with technology and the instantane-ous availability of information right at their fingertips. Computers, smart phones, iPads, and other technologies offer their users immediate access to information. Might these technologies be seen as a significant distraction to whatever the task at hand might be? Could these distractions be to blame for the perception of many in GenMe that they must multitask in order to get everything done? Might instant access to information be casting a cloud on student learning? If so, does this cloud have a silver lining? This paper addresses these and other questions through the use of a survey given to students in a second-level physics course in spring 2016. Results reveal that nearly all students feel the need to maintain this 24/7 connection using their smart phones. The impact that this level of connect-edness may have on our students will be discussed.

  12. Effects of MAR-M247 substrate (modified) composition on coating oxidation coating/substrate interdiffusion. M.S. Thesis. Final Report; [protective coatings for hot section components of gas turbine engines

    Science.gov (United States)

    Pilsner, B. H.

    1985-01-01

    The effects of gamma+gamma' Mar-M247 substrate composition on gamma+beta Ni-Cr-Al-Zr coating oxidation and coating/substrate interdiffusion were evaluated. These results were also compared to a prior study for a Ni-Cr-Al-Zr coated gamma Ni-Cr-Al substrate with equivalent Al and Cr atomic percentages. Cyclic oxidation behavior at 1130 C was investigated using change in weight curves. Concentration/distance profiles were measured for Al, Cr, Co, W, and Ta. The surface oxides were examined by X-ray diffraction and scanning electron microscopy. The results indicate that variations of Ta and C concentrations in the substrate do not affect oxidation resistance, while additions of grain boundary strengthening elements (Zr, Hf, B) increase oxidation resistance. In addition, the results indicate that oxidation phenomena in gamma+beta/gamma+gamma' Mar-M247 systems have similar characteristics to the l gamma+beta/gamma Ni-Cr-Al system.

  13. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  14. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  15. LCF- and LCF/HCF-behaviour of the superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inst. fuer Werkstoffkunde I

    2010-07-01

    The fatigue behaviour of the Nickel-base superalloy Mar-M247LC was investigated at 650 C in air environment under total strain control. Pure low cycle fatigue (LCF) loading, pure high cycle fatigue (HCF) loading and superimposed LCF/HCF loading were realised. In LCF tests with a strain ratio of zero and a hold time of 60 seconds the cyclic deformation and the lifetime behaviour was investigated. The dependence of the fatigue limit on the mean strain was estimated in HCF tests at a frequency of 60 Hz using an ultimate number of cycles of ten million. Finally the influence of superimposed HCF and LCF loadings was examined. At high total strain ranges of the HCF loading the lifetime of the superalloy as reduced about more than one magnitude compared to the lifetime under pure LCF loading. With decreasing HCF loadings the reduction of the lifetime decreases. This life time reduction can be explained by the interaction of the LCF and the superimposed HCF loading. Crack initiation and first crack propagation is predominantly induced by the LCF loading. After reaching an adequate long fatigue crack length the superimposed HCF loading contributes considerably to the crack growth. This contribution can be determined evaluating the distance between the LCF marking lines which form on the fracture surface. The higher the superimposed HCF loading was the longer the distance between the LCF marking lines and the lower the crack length were when first LCF marking lines could be recognized. On the basis of this cognition the life time under superimposed LCF/HCF loading was modelled using a model basing on fracture mechanics. (orig.)

  16. THE DEVELOPMENT OF BIOCHEMICAL OXYGEN DEMAND SENSOR USING LOCAL YEAST: Candida fukuyamaensis, UICC Y-247

    Directory of Open Access Journals (Sweden)

    Endang Saepudin

    2011-04-01

    Full Text Available In order to shorten the measurement time of biochemical oxygen demand (BOD, a BOD sensor based on yeastmetabolism was developed. Local yeast, Indonesian Origin, Candida fukuyamaensis UICC Y-247, was used as atransducer. The yeast was immobilized as a thin film in agarose matrix with the auxiliary of Nafion® acting as themembrane for ion exchange process. The film was then attached to gold-modified glassy carbons and used as transduceron the working electrodes. The measurements were conducted by observing the depletion of glucose concentrationusing multipulse amperometric method and then converted to BOD values. Optimum condition was observed in awaiting measurement time of 30 min at an applied potential of 450 mV (vs. Ag/AgCl. Linearity was shown in glucoseconcentration range of 0.1–0.5 mM, which was equivalent to BOD concentration range of 10–50 mg/L. A detectionlimit of 1.13 mg/L BOD could be achieved. Good repeatability was shown by a relative standard deviation (RSD of2.7% (n = 15. However, decreasing current response of ~50% was found after 3 days. Comparing to the conventionalBOD measurement, this BOD sensor can be used as an alternative method for BOD measurements.

  17. Characteristic of metallic state preperties of mendelevium and other actinoids by thermochcomatography

    International Nuclear Information System (INIS)

    Hubener, S.; Zvara, I.

    1982-01-01

    The adsorption of the heavy actinoids Cf, Es, Fm, and Md on polycrystalline titanium and molybdenum has been studied by thermochromatography in comparison with several well-known metallic elements, in trace amounts. The data lead us to suggest that Es, Fm, and Md are divalent in the metallic state and, moreover, that the position of their f energy levels relativg to the Fermi-energy is lower than in the cases of Cf and Yb. A correlation was found between the experimental enthalpies of adsorption of the heavy actinoids and their predicted enthalpies of sublimation

  18. The multifaceted effects of agmatine on functional recovery after spinal cord injury through Modulations of BMP-2/4/7 expressions in neurons and glial cells.

    Directory of Open Access Journals (Sweden)

    Yu Mi Park

    Full Text Available Presently, few treatments for spinal cord injury (SCI are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm, a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm(2 weight for 1 min at thoracic vertebra (Th 9 segment. Mice that received an intraperitoneal (i.p. injection of Agm (100 mg/kg/day within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following

  19. The Multifaceted Effects of Agmatine on Functional Recovery after Spinal Cord Injury through Modulations of BMP-2/4/7 Expressions in Neurons and Glial Cells

    Science.gov (United States)

    Park, Yu Mi; Lee, Won Taek; Bokara, Kiran Kumar; Seo, Su Kyoung; Park, Seung Hwa; Kim, Jae Hwan; Yenari, Midori A.; Park, Kyung Ah; Lee, Jong Eun

    2013-01-01

    Presently, few treatments for spinal cord injury (SCI) are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm), a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm2 weight for 1 min at thoracic vertebra (Th) 9 segment. Mice that received an intraperitoneal (i.p.) injection of Agm (100 mg/kg/day) within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs) are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST) demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following SCI. PMID

  20. Microstructure of selective laser melted CM247LC nickel-based superalloy and its evolution through heat treatment

    International Nuclear Information System (INIS)

    Divya, V.D.; Muñoz-Moreno, R.; Messé, O.M.D.M.; Barnard, J.S.; Baker, S.; Illston, T.; Stone, H.J.

    2016-01-01

    The selective laser melting of high temperature alloys is of great interest to the aerospace industry as it offers the prospect of producing more complex geometries than can be achieved with other manufacturing methods. In this study, the microstructure of the nickel-based superalloy, CM247LC, has been characterised following selective laser melting and after a post deposition heat treatment below the γ′ solvus temperature. In the as-deposited state, scanning electron microscopy with electron backscatter diffraction revealed a fine, cellular microstructure with preferential alignment of 〈001〉 along the build direction. A high dislocation density was seen at the periphery of the cells, indicating substantial localised deformation of the material. Fine primary MC carbides were also observed in the inter-cellular regions. High-resolution transmission electron microscopy identified the occurrence of very fine γ′ precipitates, approximately 5 nm in diameter, dispersed within the gamma phase. After heat treatment, the elongated cell colonies were observed to partially coalesce, accompanied by a decrease in dislocation density, producing columnar grains along the build direction. Cuboidal γ′ precipitates approximately 500 nm in diameter were observed to form in the recrystallised grains, accompanied by larger γ′ precipitates on the grain boundaries.

  1. Microstructure of selective laser melted CM247LC nickel-based superalloy and its evolution through heat treatment

    Energy Technology Data Exchange (ETDEWEB)

    Divya, V.D., E-mail: dv272@cam.ac.uk [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Muñoz-Moreno, R.; Messé, O.M.D.M.; Barnard, J.S. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Baker, S.; Illston, T. [Materials Solutions, Unit 8, Great Western Business Park, McKenzie Way, Worcester WR4 9GN (United Kingdom); Stone, H.J. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom)

    2016-04-15

    The selective laser melting of high temperature alloys is of great interest to the aerospace industry as it offers the prospect of producing more complex geometries than can be achieved with other manufacturing methods. In this study, the microstructure of the nickel-based superalloy, CM247LC, has been characterised following selective laser melting and after a post deposition heat treatment below the γ′ solvus temperature. In the as-deposited state, scanning electron microscopy with electron backscatter diffraction revealed a fine, cellular microstructure with preferential alignment of 〈001〉 along the build direction. A high dislocation density was seen at the periphery of the cells, indicating substantial localised deformation of the material. Fine primary MC carbides were also observed in the inter-cellular regions. High-resolution transmission electron microscopy identified the occurrence of very fine γ′ precipitates, approximately 5 nm in diameter, dispersed within the gamma phase. After heat treatment, the elongated cell colonies were observed to partially coalesce, accompanied by a decrease in dislocation density, producing columnar grains along the build direction. Cuboidal γ′ precipitates approximately 500 nm in diameter were observed to form in the recrystallised grains, accompanied by larger γ′ precipitates on the grain boundaries.

  2. Structural Benchmark Creep Testing for Microcast MarM-247 Advanced Stirling Convertor E2 Heater Head Test Article SN18

    Science.gov (United States)

    Krause, David L.; Brewer, Ethan J.; Pawlik, Ralph

    2013-01-01

    This report provides test methodology details and qualitative results for the first structural benchmark creep test of an Advanced Stirling Convertor (ASC) heater head of ASC-E2 design heritage. The test article was recovered from a flight-like Microcast MarM-247 heater head specimen previously used in helium permeability testing. The test article was utilized for benchmark creep test rig preparation, wall thickness and diametral laser scan hardware metrological developments, and induction heater custom coil experiments. In addition, a benchmark creep test was performed, terminated after one week when through-thickness cracks propagated at thermocouple weld locations. Following this, it was used to develop a unique temperature measurement methodology using contact thermocouples, thereby enabling future benchmark testing to be performed without the use of conventional welded thermocouples, proven problematic for the alloy. This report includes an overview of heater head structural benchmark creep testing, the origin of this particular test article, test configuration developments accomplished using the test article, creep predictions for its benchmark creep test, qualitative structural benchmark creep test results, and a short summary.

  3. MOLECULAR CLUMPS AND INFRARED CLUSTERS IN THE S247, S252, AND BFS52 REGIONS

    Energy Technology Data Exchange (ETDEWEB)

    Shimoikura, Tomomi; Dobashi, Kazuhito [Department of Astronomy and Earth Sciences, Tokyo Gakugei University, Koganei, Tokyo 184-8501 (Japan); Saito, Hiro; Nakamura, Fumitaka [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Matsumoto, Tomoaki [Hosei University, Fujimi, Chiyoda-ku, Tokyo 102-8160 (Japan); Nishimura, Atsushi; Kimura, Kimihiro; Onishi, Toshikazu; Ogawa, Hideo, E-mail: ikura@u-gakugei.ac.jp [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan)

    2013-05-01

    We present results of the observations carried out toward the S247, S252, and BFS52 H II regions with various molecular lines using the 1.85 m radio telescope and the 45 m telescope at Nobeyama Radio Observatory. There are at least 11 young infrared clusters (IR clusters) within the observed region. We found that there are two velocity components in {sup 12}CO (J = 2-1), and also that their spatial distributions show an anti-correlation. The IR clusters are located at their interfaces, suggesting that two distinct clouds with different velocities are colliding with each other, which may have induced the cluster formation. Based on {sup 13}CO (J = 1-0) and C{sup 18}O (J = 1-0) observations, we identified 16 clumps in and around the three H II regions. Eleven of the clumps are associated with the IR clusters and the other five clumps are not associated with any known young stellar objects. We investigated variations in the velocity dispersions of the 16 clumps as a function of the distance from the center of the clusters or the clumps. Clumps with clusters tend to have velocity dispersions that increase with distance from the cluster center, while clumps without clusters show a flat velocity dispersion over the clump extents. A {sup 12}CO outflow has been found in some of the clumps with IR clusters but not in the other clumps, supporting a strong relation of these clumps to the broader velocity dispersion region. We also estimated a mean star formation efficiency of {approx}30% for the clumps with IR clusters in the three H II regions.

  4. HPLC MS/MS method for quantification of meprobamate in human plasma: application to 24/7 clinical toxicology.

    Science.gov (United States)

    Delavenne, Xavier; Gay-Montchamp, Jean Pierre; Basset, Thierry

    2011-01-15

    We described the development and full validation of rapid and accurate liquid chromatography method, coupled with tandem mass spectrometry detection, for quantification of meprobamate in human plasma with [(13)C-(2)H(3)]-meprobamate as internal standard. Plasma pretreatment involved a one-step protein precipitation with acetonitrile. Separation was performed by reversed-phase chromatography on a Luna MercuryMS C18 (20 mm×4 mm×3 μm) column using a gradient elution mode. The mobile phase was a mix of distilled water containing 0.1% formic acid and acetonitrile containing 0.1% formic acid. The selected reaction monitoring transitions, in electrospray positive ionization, used for quantification were 219.2→158.2 m/z and 223.1→161.1m/z for meprobamate and internal standard, respectively. Qualification transitions were 219.2→97.0 and 223.1→101.1 m/z for meprobamate and internal standard, respectively. The method was linear over the concentration range of 1-300 mg/L. The intra- and inter-day precision values were below 6.4% and accuracy was within 95.3% and 103.6% for all QC levels (5, 75 and 200 mg/L). The lower limit of quantification was 1 mg/L. Total analysis time was reduced to 6 min including sample preparation. The present method is successfully applied to 24/7 clinical toxicology and demonstrated its usefulness to detect meprobamate poisoning. Copyright © 2010 Elsevier B.V. All rights reserved.

  5. Importance of the (n,gamma) Cm-247 Evaluation on Neutron Emission in Fast Reactor Fuel Cycle Analysis

    International Nuclear Information System (INIS)

    Benoit Forget; Mehdi Asgari; Rodolfo M. Ferrer

    2007-01-01

    As part of the GNEP program, it is envisioned to build a fast reactor for the transmutation of minor actinides. The spent nuclear fuel from the current fleet of light water reactors would be recycled, the current baseline is the UREX+1a process, and would act as a feed for the fast reactor. As the fuel is irradiated in a fast reactor a certain quantity of minor actinides would thus build up in the fuel stream creating possible concerns with the neutron emission of these minor actinides for fuel transportation, handling and fabrication. Past neutronic analyses had not tracked minor actinides above Cm-246 in the transmutation chain, because of the small influence on the overall reactor performance and cycle parameters. However, when trying to quantify the neutron emission from the recycled fuel with high minor actinide content, these higher isotopes play an essential role and should be included in the analysis. In this paper, the influence of tracking these minor actinides on the calculated neutron emission is presented. Also presented is the particular influence of choosing a different evaluated cross section data set to represent the minor actinides above Cm-246. The first representation uses the cross-sections provided by MC2-2 for all isotopes, while the second representation uses infinitely diluted ENDF/BVII.0 cross-sections for Cm-247 to Cf-252 and MC2-2 for all other isotopes

  6. Missed surgical intensive care unit billing: potential financial impact of 24/7 faculty presence.

    Science.gov (United States)

    Hendershot, Kimberly M; Bollins, John P; Armen, Scott B; Thomas, Yalaunda M; Steinberg, Steven M; Cook, Charles H

    2009-07-01

    To efficiently capture evaluation and management (E&M) and procedural billing in our surgical intensive care unit (SICU), we have developed an electronic billing system that links to the electronic medical record (EMR). In this system, only notes electronically signed and coded by an attending generate billing charges. We hypothesized that capture of missed billing during nighttime and weekends might be sufficient to subsidize 24/7 in-house attending coverage. A retrospective chart EMR review was performed of the EMRs for all SICU patients during a 2-month period. Note type, date, time, attending signature, and coding were analyzed. Notes without attending signature, diagnosis, or current procedural terminology (CPT) code were considered incomplete and identified as "missed billing." Four hundred and forty-three patients had 465 admissions generating 2,896 notes. Overall, 76% of notes were signed and coded by an attending and billed. Incomplete (not billed) notes represented an overall missed billing opportunity of $159,138 for the 2-month time period (approximately $954,000 annually). Unbilled E&M encounters during weekdays totaled $54,758, whereas unbilled E&M and procedures from weeknights and weekends totaled $88,408 ($44,566 and $43,842, respectively). Missed billing after-hours thus represents approximately $530K annually, extrapolating to approximately $220K in collections from our payer mix. Surprisingly, missed E&M and procedural billing during weekdays totaled $70,730 (approximately $425K billing, approximately $170K collections annually), and typically represented patients seen, but transferred from the SICU before attending documentation was completed. Capture of nighttime and weekend ICU collections alone may be insufficient to add faculty or incentivize in-house coverage, but could certainly complement other in-house derived revenues to such ends. In addition, missed daytime billing in busy modern ICUs can be substantial, and use of an EMR to identify

  7. Live birth sex ratio after in vitro fertilization and embryo transfer in China--an analysis of 121,247 babies from 18 centers.

    Science.gov (United States)

    Bu, Zhiqin; Chen, Zi-Jiang; Huang, Guoning; Zhang, Hanwang; Wu, Qiongfang; Ma, Yanping; Shi, Juanzi; Xu, Yanwen; Zhang, Songying; Zhang, Cuilian; Zhao, Xiaoming; Zhang, Bo; Huang, Yuanhua; Sun, Zhengyi; Kang, Yuefan; Wu, Riran; Wu, Xueqing; Sun, Haixiang; Sun, Yingpu

    2014-01-01

    In order to study the impact of procedures of IVF/ICSI technology on sex ratio in China, we conducted this multi-center retrospective study including 121,247 babies born to 93,895 women in China. There were 62,700 male babies and 58,477 female babies, making the sex ratio being 51.8% (Male: Female  = 107:100). In univariate logistic regression analysis, sex ratio was imbalance toward females of 50.3% when ICSI was preformed compared to 47.7% when IVF was used (Pratio in IVF/ICSI babies was significantly higher toward males in transfers of blastocyst (54.9%) and thawed embryo (52.4%) when compared with transfers of cleavage stage embryo (51.4%) and fresh embryo (51.5%), respectively. Multiple delivery was not associated with sex ratio. However, in multivariable logistic regression analysis after controlling for related factors, only ICSI (adjusted OR =  .90, 95%CI: 0.88-0.93; Pratio in IVF/ICSI babies. In conclusion, the live birth sex ratio in IVF/ICSI babies was influenced by the use of ICSI, which may decrease the percentage of male offspring, or the use of blastocyst transfer, which may increase the percentage of male offspring.

  8. 24/7 Presence of Medical Staff in the Labor Ward; No Day-Night Differences in Perinatal and Maternal Outcomes.

    Science.gov (United States)

    Tavares, Sara; Cavaco-Gomes, João; Moucho, Marina; Severo, Milton; Mateus, Mário; Ramalho, Carla; Visser, Gerard H A; Montenegro, Nuno

    2017-05-01

    Objective  The objective of this study was to assess possible day-night differences in perinatal and maternal labor outcomes in a hospital setting with no day-night differences in the presence of experienced medical staff. Design  This was a retrospective study conducted over 5 years between 2008 and 2012. Setting  This study was set at the obstetric delivery unit in a tertiary hospital. Population  A total of 9,143 singleton deliveries were assessed after 34 weeks of gestation and after exclusion of major congenital malformations, inductions of labor, and elective cesarean sections. Materials and Methods  Data were collected using the hospital electronic medical records. Time periods of 8 hours were defined (daytime between 8 am and 4 pm, evening time between 4 pm and 12 pm, and nighttime between 12 pm and 8 am). Differences between the three time periods were assessed using software R Core Team (2013). Main outcome measures were neonatal birth asphyxia, neonatal intensive care unit admission, and neonatal death. Results  There were no differences in perinatal and maternal outcomes in the course of the day, apart from a higher incidence of third- and fourth-degree tears during the evening. Neonatal outcome after obstetric emergencies (uterine rupture, partial placental abruption, and cord prolapse) also showed no day-night differences. Conclusion  Adverse nighttime-related outcomes may be avoided by the 24/7 presence of experienced medical staff. Thieme Medical Publishers 333 Seventh Avenue, New York, NY 10001, USA.

  9. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    International Nuclear Information System (INIS)

    Okuno, Hiroshi

    2002-01-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  10. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)

    2002-10-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  11. The role of continuous monitoring in a 24/7 telecardiology consultation service--a feasibility study.

    Science.gov (United States)

    Nikus, Kjell; Lähteenmäki, Jaakko; Lehto, Pasi; Eskola, Markku

    2009-01-01

    for speeding up the diagnostic and therapeutic processes in the hospital, although the study was limited in that the telecardiologist played a passive role and did not acutely impact patient care. In the future, the system could be expanded to surveillance of smaller hospitals. Telemedicine has the potential to aid in solving the conflict between aging of population, rise in the demand for critical care services, and shortage of professional personnel. This might, however, require a more active remote surveillance than the one tested in this study. Privacy- and security-related aspects are major components of building trust and confidence in telemedicine systems. In telecardiology, the real-time interactive telemedicine model with 24/7 service has potential superior performance compared with a store-and-forward telemedicine model.

  12. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1995-01-01

    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  13. Effect of heat treatment on the microstructure, texture and elastic anisotropy of the nickel-based superalloy CM247LC processed by selective laser melting

    International Nuclear Information System (INIS)

    Muñoz-Moreno, R.; Divya, V.D.; Driver, S.L.; Messé, O.M.D.M.; Illston, T.; Baker, S.; Carpenter, M.A.; Stone, H.J.

    2016-01-01

    Selective laser melting (SLM) of nickel-based superalloys is of great interest for the aerospace industry due to its capability for producing components with complex geometries. However, an improved understanding of the effect of SLM and subsequent post deposition heat treatments on the microstructure and mechanical properties is required to ensure that components with good structural integrity are produced. In this study, the microstructure, texture and elastic anisotropy of the nickel-based superalloy, CM247LC, in the as-SLM and heat-treated states have been analysed. The as-SLM microstructure showed fine elongated cells with a preferential alignment of <001> along the build direction and a significant intercellular misorientation. Heat treatments at temperatures below 1230 °C resulted in a progressive recovery of the microstructure, whilst heat treatments above this temperature gave rise to a recrystallised microstructure. The extent to which nucleation and growth of the γ′ precipitates and secondary particles were affected by increasing the heat treatment temperature was also characterised. The bulk elastic anisotropy of all samples was measured by resonant ultrasound spectroscopy (RUS) and was found to be consistent with the local textures obtained by electron backscatter diffraction (EBSD). It was observed that the initially strong elastic anisotropy exhibited by the as-SLM material was significantly reduced in the recrystallised samples, although some anisotropy was retained as a result of their elongated grain microstructures.

  14. Effect of heat treatment on the microstructure, texture and elastic anisotropy of the nickel-based superalloy CM247LC processed by selective laser melting

    Energy Technology Data Exchange (ETDEWEB)

    Muñoz-Moreno, R., E-mail: rociomunozmoreno@gmail.com [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Divya, V.D. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Driver, S.L. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Department of Earth Sciences, University of Cambridge, Downing Street, Cambridge CB2 3EQ (United Kingdom); Messé, O.M.D.M. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Illston, T.; Baker, S. [Materials Solutions, Unit 8, Great Western Business Park, McKenzie Way, Worcester WR4 9GN (United Kingdom); Carpenter, M.A. [Department of Earth Sciences, University of Cambridge, Downing Street, Cambridge CB2 3EQ (United Kingdom); Stone, H.J. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom)

    2016-09-30

    Selective laser melting (SLM) of nickel-based superalloys is of great interest for the aerospace industry due to its capability for producing components with complex geometries. However, an improved understanding of the effect of SLM and subsequent post deposition heat treatments on the microstructure and mechanical properties is required to ensure that components with good structural integrity are produced. In this study, the microstructure, texture and elastic anisotropy of the nickel-based superalloy, CM247LC, in the as-SLM and heat-treated states have been analysed. The as-SLM microstructure showed fine elongated cells with a preferential alignment of <001> along the build direction and a significant intercellular misorientation. Heat treatments at temperatures below 1230 °C resulted in a progressive recovery of the microstructure, whilst heat treatments above this temperature gave rise to a recrystallised microstructure. The extent to which nucleation and growth of the γ′ precipitates and secondary particles were affected by increasing the heat treatment temperature was also characterised. The bulk elastic anisotropy of all samples was measured by resonant ultrasound spectroscopy (RUS) and was found to be consistent with the local textures obtained by electron backscatter diffraction (EBSD). It was observed that the initially strong elastic anisotropy exhibited by the as-SLM material was significantly reduced in the recrystallised samples, although some anisotropy was retained as a result of their elongated grain microstructures.

  15. Did CDM particles of mass 2.47 x 10(-3) eV interact with precursor biopolymers and nucleic acids to initiate and boost lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass ≅ 2.47 x 10(-3)eV with the associated Compton range m(-1) ≅8.02 x 10(-3) cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m (-1) scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks.

  16. A 1550-nm all-optical VCSEL-to-VCSEL wavelength conversion of a 8.5-Gb/s data signal and transmission over a 24.7-km fibre

    Science.gov (United States)

    Boiyo, D. Kiboi; Isoe, G. M.; Gamatham, R. R. G.; Leitch, A. W. R.; Gibbon, T. B.

    2016-02-01

    For the first time, we demonstrate, VCSEL-to-VCSEL wavelength conversion within the low attenuation 1550 nm window, including transmission over fibre and bit error rate (BER) performance characterization. We experimentally demonstrate a low injection power optical wavelength conversion by injecting an optical beam from a signal carrier master vertical cavity surface-emitting laser (VCSEL) into the side-mode of the slave VCSEL. This technique solves the challenge of wavelength collisions and also provides wavelength re-use in typical wavelength division multiplexed (WDM) systems. This paper, for the first time, uses two 1550 nm VCSELs with tunability range of 3 nm for a 5-9.8 mA bias current. The master VCSEL is modulated with a non-return-to-zero (NRZ) pseudo-random binary sequence (PRBS_27-1) 8.5 Gb/s data. A data conversion penalty of 1.1 dB is realized when a 15 dBm injection beam is used. The transmission performance of the converted wavelength from the slave VCSEL is evaluated using BER measurement at a 10-9 threshold. A 0.5 dB transmission penalty of the converted wavelength data is realized in an 8.5 Gb/s transmission over 24.7 km. This work is vital for optical fibre systems that may require wavelength switching for transmission of data signals.

  17. Achados Ultra-Sonográficos em Pacientes com Ameaça de Abortamento no Primeiro Trimestre da Gestação Ultrasound Findings in First-trimester Threatened Abortion

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Watanabe

    2000-06-01

    Full Text Available Objetivo: avaliar os achados ultra-sonográficos nas gestantes com ameaça de abortamento no primeiro trimestre da gestação. Métodos: exames de ultra-som obstétrico transabdominal e transvaginal foram realizados nas pacientes com sangramento vaginal e teste de gravidez positivo. Foram incluídas as gestantes entre 6 a 14 semanas de gestação pela data da última menstruação ou pelo exame ultra-sonográfico, que apresentavam colo do útero impérvio ao exame clínico. Foram excluídas as gestações múltiplas ou aquelas que realizaram tentativa de abortamento por meio de drogas ou manipulação. Resultados: em 132 dos 247 casos (53.4% foi diagnosticada gestação viável e em 46.6% (115/247, gestação inviável. Abortamento incompleto foi identificado em 19% (47/247, abortamento completo em 8,5% (21/247, abortamento retido em 7,7% (19/247, gestação anembrionada em 6,1% (15/247, gestação ectópica em 4,5% (11/247 e mola hidatiforme em 0,8% (2/247. Conclusão: aproximadamente metade (46,6% das gestações com ameaça de abortamento no primeiro trimestre apresentaram diagnóstico de inviabilidade da gestação. O exame ultra-sonográfico pode ajudar a definir esta condição e a conduta obstétrica.Objective: to evaluate ultrasound findings in pregnant women with threatened abortion in the first trimester of pregnancy. Methods: transabdominal and transvaginal ultrasound scans were performed in patients with vaginal bleeding with previous positive pregnancy test. Patients with 6-14-week gestation (by the last menstrual period or ultrasound scan, with closed cervix on clinical evaluation were included. Multiple pregnancies and those patients who have tried abortion by using abortive drugs or manipulation were excluded. Results: in 132 of 247 (53.4% the pregnancy was viable and in 46.6% (115/247 the pregnancy was nonviable. Incomplete miscarriage was found in 19% (47/247, complete miscarriage in 8.5% (21/247, missed abortion in 7.7% (19/247

  18. 40 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... thermophilic converted product with high humus content. Compost can be used as a soil amendment and can also be... be added to the water/seed mix for enhanced performance; Industrial drums are cylindrical containers... with applicable specifications, availability at a reasonable price, availability within a reasonable...

  19. 32 CFR 247.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... for purchase, use, or patronage without regard to race, color, religion, sex, national origin, age...) Alteration of official photographic and video imagery will comply with DoD Directive 5040.5. 7 7 See footnote...

  20. 48 CFR 247.572 - Policy.

    Science.gov (United States)

    2010-10-01

    ... a vessel for which the contractor submitted an offer in response to the solicitation for the contract; and (ii) Prior to the acceptance of the vessel by the Government. (2) The Secretary of Defense... Act for Fiscal Year 2007 (Public Law 109-364)— (1) When obtaining carriage requiring a covered vessel...

  1. 32 CFR 247.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... cohesiveness and effectiveness by providing a visual representation of the essence of the command itself. (G... defined purpose in support of the mission of the publishing DoD Component, and the purpose must justify...

  2. 40 CFR 247.2 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... apply to purchases made by private party recipients (e.g., individuals, non-profit organizations) of... competition, considering such guidelines. Procuring agencies may decide not to procure such items if they are...; or are only available at an unreasonable price. [60 FR 21381, May 1, 1995, as amended at 62 FR 60973...

  3. 32 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...; commanders' comments; letters to the editor; editorials; commentaries; features; sports; entertainment items; morale, welfare, and recreation news and announcements; photography; line art; and installation and local...

  4. 8 CFR 247.11 - Notice.

    Science.gov (United States)

    2010-01-01

    ... Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF CERTAIN RESIDENT... and upon his request have an opportunity to appear in person, in support or in lieu of his written answer, before an immigration officer designated for that purpose. The person shall further be advised...

  5. 25 CFR 700.247 - Appeals.

    Science.gov (United States)

    2010-04-01

    ... envelope containing the notice of appeal and the face of the notice shall bear the legend “FREEDOM OF INFORMATION APPEAL”. The failure of an appeal to bear such a legend will not disqualify an appeal from...

  6. Retinitis Pigmentosa Mutations in Bad Response to Refrigeration 2 (Brr2) Impair ATPase and Helicase Activity.

    Science.gov (United States)

    Ledoux, Sarah; Guthrie, Christine

    2016-06-03

    Brr2 is an RNA-dependent ATPase required to unwind the U4/U6 snRNA duplex during spliceosome assembly. Mutations within the ratchet helix of the Brr2 RNA binding channel result in a form of degenerative human blindness known as retinitis pigmentosa (RP). The biochemical consequences of these mutations on Brr2's RNA binding, helicase, and ATPase activity have not yet been characterized. Therefore, we identified the largest construct of Brr2 that is soluble in vitro, which truncates the first 247 amino acids of the N terminus (Δ247-Brr2), to characterize the effects of the RP mutations on Brr2 activity. The Δ247-Brr2 RP mutants exhibit a gradient of severity of weakened RNA binding, reduced helicase activity, and reduced ATPase activity compared with wild type Δ247-Brr2. The globular C-terminal Jab1/Mpn1-like domain of Prp8 increases the ability of Δ247-Brr2 to bind the U4/U6 snRNA duplex at high pH and increases Δ247-Brr2's RNA-dependent ATPase activity and the extent of RNA unwinding. However, this domain of Prp8 does not differentially affect the Δ247-Brr2 RP mutants compared with the wild type Δ247-Brr2. When stimulated by Prp8, wild type Δ247-Brr2 is able to unwind long stable duplexes in vitro, and even the RP mutants capable of binding RNA with tight affinity are incapable of fully unwinding short duplex RNAs. Our data suggest that the RP mutations within the ratchet helix impair Brr2 translocation through RNA helices. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  7. Alpha1a-Adrenoceptor Genetic Variant Triggers Vascular Smooth Muscle Cell Hyperproliferation and Agonist Induced Hypertrophy via EGFR Transactivation Pathway.

    Directory of Open Access Journals (Sweden)

    Irina Gradinaru

    Full Text Available α1a Adrenergic receptors (α1aARs are the predominant AR subtype in human vascular smooth muscle cells (SMCs. α1aARs in resistance vessels are crucial in the control of blood pressure, yet the impact of naturally occurring human α1aAR genetic variants in cardiovascular disorders remains poorly understood. To this end, we present novel findings demonstrating that 3D cultures of vascular SMCs expressing human α1aAR-247R (247R genetic variant demonstrate significantly increased SMC contractility compared with cells expressing the α1aAR-WT (WT receptor. Stable expression of 247R genetic variant also triggers MMP/EGFR-transactivation dependent serum- and agonist-independent (constitutive hyperproliferation and agonist-dependent hypertrophy of SMCs. Agonist stimulation reduces contractility Using pathway-specific inhibitors we determined that the observed hyperproliferation of 247R-expressing cells is triggered via β-arrestin1/Src/MMP-2/EGFR/ERK-dependent mechanism. MMP-2-specific siRNA inhibited 247R-triggered hyperproliferation indicating MMP-2 involvement in 247R-triggered hyperproliferation in SMCs. β-arrestin1-specific shRNA also inhibited 247R-triggered hyperproliferation but did not affect hypertrophy in 247R-expressing SMCs, indicating that agonist-dependent hypertrophy is independent of β-arrestin1. Our data reveal that in different cardiovascular cells the same human receptor genetic variant can activate alternative modulators of the same signaling pathway. Thus, our findings in SMCs demonstrate that depending on the type of cells expressing the same receptor (or receptor variant, different target-specific inhibitors could be used to modulate aberrant hyperproliferative or hypertrophic pathways in order to restore normal phenotype.

  8. Clinical study of p-aminobenzoic acid-N-xyloside Na in advanced cancer patients

    International Nuclear Information System (INIS)

    Fukushima, Masanori; Ota, Kazuo

    1982-01-01

    Therapeutic effect of p-aminobenzoic acid-N-xyloside Na (K-247) were studied. Eleven patients with a variety of solid tumors were treated with K-247 alone. K-247 was given orally 800 mg daily for 4 weeks. As for side effect of the drug, only mild gastritis was observed in a few patients. Partial response (over 25% reduction of tumor size) with a median duration of two months was observed in 3 patients. These cases were metastatic tumor of lung from the carcinoma of thyroid, metastatic tumors of lung from the carcinoma of kidney, and mediastinal tumor. In eight patients the response was classified as no change and in one patient there was progressive disease. Thus K-247 has some therapeutic activity in patients with solid tumor. Combination therapy of irradiation and administration of K-247 were also studied. In twelve patients received the conbination therapy, partial response was observed in 7 patients with complete response in 3 patients. In some patients it seems that the effect of irradiation was enhanced by K-247 administration. To confirm this observation, randomized controlled trial is required. (author)

  9. Clinical study of p-aminobenzoic acid-N-xyloside Na in advanced cancer patients

    Energy Technology Data Exchange (ETDEWEB)

    Fukushima, M.; Ota, K. (Aichi Cancer Center, Nagoya (Japan))

    1982-02-01

    Therapeutic effect of p-aminobenzoic acid-N-xyloside Na (K-247) were studied. Eleven patients with a variety of solid tumors were treated with K-247 alone. K-247 was given orally 800 mg daily for 4 weeks. As for side effect of the drug, only mild gastritis was observed in a few patients. Partial response (over 25% reduction of tumor size) with a median duration of two months was observed in 3 patients. These cases were metastatic tumor of lung from the carcinoma of thyroid, metastatic tumors of lung from the carcinoma of kidney, and mediastinal tumor. In eight patients the response was classified as no change and in one patient there was progressive disease. Thus K-247 has some therapeutic activity in patients with solid tumor. Combination therapy of irradiation and administration of K-247 were also studied. In the twelve patients receiving the combination therapy, partial response was observed in 7 patients with complete response in 3 patients. In some patients it seems that the effect of irradiation was enhanced by K-247 administration. To confirm this observation, randomized controlled trial is required.

  10. Effectiveness of accelerated perioperative care and rehabilitation intervention compared to current intervention after hip and knee arthroplasty. A before-after trial of 247 patients with a 3-month follow-up

    Directory of Open Access Journals (Sweden)

    Hansen Torben B

    2008-04-01

    Full Text Available Abstract Background In Denmark, approximately 12,000 hip and knee arthroplasties were performed in 2006, and the hospital costs were close to US$ 110,000,000. In a randomized clinical trial, we have recently demonstrated the efficacy of accelerated perioperative care and rehabilitation intervention after hip and knee arthroplasty compared to current intervention under ideal circumstances. We do not, however, know whether these results could be reached under usual circumstances of healthcare practice. We therefore investigated whether length of stay after implementation of accelerated perioperative care and rehabilitation after hip and knee arthroplasty could be reduced in a normal healthcare setting, and how the achieved results matched those observed during the randomized clinical trial. Methods An effectiveness study as a before-after trial was undertaken in which all elective primary total hip and total knee arthroplasty patients were divided into a before-implementation group receiving the current perioperative procedure, and an after-implementation group receiving the new accelerated perioperative care and rehabilitation procedures as provided by a new multi-disciplinary organization. We used the Breakthrough Series Collaborative Model for implementation. The primary outcome measure was in hospital length of stay (LOS, and the secondary outcome measure was adverse effects within 3 months postoperatively. Results We included a total of 247 patients. Mean LOS was significantly (P Conclusion Accelerated perioperative care and rehabilitation intervention after hip and knee arthroplasty was successfully and effectively implemented. Results obtained during usual hospital circumstances matched the results achieved under ideal circumstances in this group of patients.

  11. 40 CFR 247.15 - Landscaping products.

    Science.gov (United States)

    2010-07-01

    ... hydroseeding and as an over-spray for straw mulch in landscaping, erosion control, and soil reclamation. (b) Compost made from recovered organic materials. (c) Garden and soaker hoses containing recovered plastic or rubber. (d) Lawn and garden edging containing recovered plastic or rubber. (e) Plastic lumber landscaping...

  12. 48 CFR 247.301-70 - Definition.

    Science.gov (United States)

    2010-10-01

    ... Definition. “Integrated logistics managers” or “third-party logistics providers” means providers of multiple logistics services. Some examples of logistics services are the management of transportation, demand...

  13. Publications | Page 247 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  14. Toward a 24/7 Learning Community.

    Science.gov (United States)

    Revenaugh, Mickey

    2000-01-01

    Although nearly two-thirds of family households have computers and 46 percent have Internet connections, troubling income-related gaps persist. Parents want interactive connections with teachers, homework hotlines, and tutoring services more than school web sites. Web-quest models, laptops, and computer donation programs are promising…

  15. Alta disponibilidad 24/7 : el reto

    OpenAIRE

    López Grande, Carlos Edgardo; Guadrón Gutiérrez, Ricardo Salvador

    2015-01-01

    En la actualidad, las actividades diarias para los ne- gocios, instituciones, instituciones educativas o nivel de usuario común están directamente vinculadas a la red de redes, la Internet. Su desarrollo ha permitido a la mayoría de los servicios y aplicaciones, que hace años eran sólo para el modo cliente-servidor, ahora acceder desde cualquier lugar en cualquier dispositi- vo con conexión a Internet. Por lo tanto, ofrecer un ambiente que da conexiones y transacciones 7/24 es necesario para ...

  16. 40 CFR 61.247 - Reporting requirements.

    Science.gov (United States)

    2010-07-01

    ...) Method of compliance with the standard (for example, “monthly leak detection and repair” or “equipped...) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Equipment Leaks... identification. (ii) Type of equipment (for example, a pump or pipeline valve). (iii) Percent by weight VHAP in...

  17. 7 CFR 247.34 - Management reviews.

    Science.gov (United States)

    2010-01-01

    ... administration on an ongoing basis by reviewing financial reports, audit reports, food orders, inventory reports... the State agency do to ensure that local agencies meet program requirements and objectives? The State..., and other agencies conducting program activities meet program requirements and objectives. As part of...

  18. 40 CFR 247.12 - Construction products.

    Science.gov (United States)

    2010-07-01

    ..., polyisocyanurate, polystyrene, phenolics, and composites; and (4) Spray-in-place insulation, including but not limited to foam-in-place polyurethane and polyisocyanurate, and spray-on cellulose. (b) Structural...

  19. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  20. Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum L.)

    International Nuclear Information System (INIS)

    Shehzad, M.A.; Nadeem, M.A.; Sarwar, M.A.; Naseer-ud-Din, G.M.; Ilahi, F.

    2012-01-01

    A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and as post-emergence herbicides. Results revealed that Post-emergence application of bromoxynil + MCPA at 247+247 g a.i ha/sup -1/ isoproturon (1080 g a.i ha) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free -1 -1 control. Bromoxynil + MCPA (247+247 g a.i ha) and clodinafop propargyl (240 g a.i ha/sup -1/) also gave maximum spike bearing tillers, number of grains spike and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/ ) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)

  1. Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum l.)

    International Nuclear Information System (INIS)

    Shehzad, M.A.; Nadeem, M.A.; Sarwar, M.A.

    2012-01-01

    A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and bromoxynil+MCPA at 247+247 g a.i ha/sup -1/ as post-emergence herbicides. Results revealed that Post-emergence application of isoproturon (1080 g a.i ha-1) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free control. Bromoxynil+MCPA (247+247 g a.i ha/sup -1/) and clodinafop propargyl (240 g a.i ha-1) also gave maximum spike bearing tillers, number of grains spike-1 and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)

  2. Learning by bidding: evidence from a large-scale natural experiment

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen

    -, č. 247 (2005), s. 1-33 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : learning * natural experiment * auction Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp247.pdf

  3. Listeria monocytogenes in poultry and poultry products: Epidemiological investigations in seven Danish abattoirs

    DEFF Research Database (Denmark)

    Ojeniyi, B.; Wegener, Henrik Caspar; Jensen, N.E.

    1996-01-01

    Listeria monocytogenes was isolated from 11/236 (4 . 7%) caecal samples from parent flocks, providing broilers to the abattoirs investigated. Caecal samples from 2078 broilers representing 90 randomly selected broiler flocks were negative for L. monocytogenes. A total of 3080 samples from seven...... abattoirs including poultry processing line samples, and final products were also examined for L. monocytogenes. Listeria monocytogenes was isolated in 0 . 3% to 18 . 7% of the samples collected in the different abattoirs. Epidemiological typing of 247 L. monocytogenes isolates, including serotyping, phage...... isolates of L. monocytogenes since only 120/247 (48 . 6%) isolates were typable by phage typing and 230/247 (93 . 1%) L. monocytogenes belonged to serotype 01 while 6/247 (2 . 4%) belonged to 04. The discovery of a few dominating clones in each abattoir might indicate an endemic occurrence of L...

  4. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | ... us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation ...

  5. 78 FR 78067 - Focused Mitigation Strategies To Protect Food Against Intentional Adulteration; Public Meeting on...

    Science.gov (United States)

    2013-12-24

    ... summary of your oral presentation and send to: Juanita Yates, Center for Food Safety and Applied Nutrition... Vol. 78 Tuesday, No. 247 December 24, 2013 Part V Department of Health and Human Services Food and.... 247 / Tuesday, December 24, 2013 / Proposed Rules#0;#0; [[Page 78068

  6. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. M R Meshram1 Nawal K Agrawal1 Bharoti Sinha1 P S Misra2. Department of Electronics and Computer Engineering, Indian Institute of Technology, Roorkee 247 667, India; Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Roorkee 247 667, India ...

  7. 29 CFR 779.247 - “Goods” defined.

    Science.gov (United States)

    2010-07-01

    ... OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Interstate Inflow Test Under... Act is defined in section 3(i) of the Act. The statutory definition is quoted in § 779.14, and is...

  8. 48 CFR 52.247-66 - Returnable Cylinders.

    Science.gov (United States)

    2010-10-01

    ... Cylinders (MAY 1994) (a) Cylinder, referred to in this clause, is a pressure vessel designed for pressures... clause. (c) For each cylinder lost or damaged beyond repair while in the Government's possession, the... associated replacement values.] These cylinders shall become Government property. (d) If any lost cylinder is...

  9. Digital reference service : libraries online 24/7

    OpenAIRE

    Vijayakumar, Manju; Vijayakumar, J. K.

    2005-01-01

    The integration of the Internet Technology in to Libraries has not changed its mission of providing excellent information service to users but it has added several new dimensions and opened new avenues to their tasks. Reference librarians, while assisting users in the library, now have an additional set of remote users, who access the reference service online, who are more demanding, less patient users who have greater expectations. This paper discusses the methods in Online Reference service...

  10. 48 CFR 247.270-2 - Technical provisions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Contracts for Transportation or for Transportation... sometimes within the same port, it is not practical to develop standard technical provisions covering all...

  11. 7 CFR 247.29 - Reports and recordkeeping.

    Science.gov (United States)

    2010-01-01

    .... All records must be available during normal business hours for use in management reviews, audits... obligated, and the amount remaining unobligated. (3) FNS-191, Racial/Ethnic Group Participation. Local agencies must submit a report of racial/ethnic participation each year, using the FNS-191. (c) Is there any...

  12. Web Based Prognostics and 24/7 Monitoring

    Science.gov (United States)

    Strautkalns, Miryam; Robinson, Peter

    2013-01-01

    We created a general framework for analysts to store and view data in a way that removes the boundaries created by operating systems, programming languages, and proximity. With the advent of HTML5 and CSS3 with JavaScript the distribution of information is limited to only those who lack a browser. We created a framework based on the methodology: one server, one web based application. Additional benefits are increased opportunities for collaboration. Today the idea of a group in a single room is antiquated. Groups will communicate and collaborate with others from other universities, organizations, as well as other continents across times zones. There are many varieties of data gathering and condition-monitoring software available as well as companies who specialize in customizing software to individual applications. One single group will depend on multiple languages, environments, and computers to oversee recording and collaborating with one another in a single lab. The heterogeneous nature of the system creates challenges for seamless exchange of data and ideas between members. To address these limitations we designed a framework to allow users seamless accessibility to their data. Our framework was deployed using the data feed on the NASA Ames' planetary rover testbed. Our paper demonstrates the process and implementation we followed on the rover.

  13. 48 CFR 252.247-7017 - Erroneous shipments.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Erroneous shipments. 252... SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of..., articles of personal property inadvertently packed with goods of other than the rightful owner. (2) Ensure...

  14. 76 FR 61279 - Defense Federal Acquisition Regulation Supplement; Defense Cargo Riding Gang Member (DFARS Case...

    Science.gov (United States)

    2011-10-04

    ... that the language of the proposed clause be amended to read as follows to reinforce DoD's role in the... Military Sealift Command), and specific procedural guidance for DoD personnel obtaining the background... 247.5. B. Language Inconsistency Comment: DFARS 252.247-7027(a) defines ``riding gang member'' as it...

  15. 78 FR 15049 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2013-03-08

    ... market disruption or threat thereof under section 421(b)(1); or (C) An affirmative final determination of... Newsprint Company. 82,247 Kincaid Furniture Co., Hudson, NC July 20, 2012. Inc., Plant 9 Lumber Yard, Foothills Temporary Employment. 82,247A Kincaid Furniture Co., Hudson, NC July 22, 2012. Inc., Plant 1...

  16. Production of Aspergillus niger β-mannosidase in Pichia pastoris

    Czech Academy of Sciences Publication Activity Database

    Fliedrová, Barbora; Weignerová, Lenka; Křen, Vladimír

    2012-01-01

    Roč. 279, č. 1 (2012), s. 247-247 ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] R&D Projects: GA ČR GD305/09/H008; GA ČR GAP207/10/0321 Institutional support: RVO:61388971 Keywords : NAG-thiazoline

  17. Infusorial concentration in rumen fluid of red deer, fallow deer, roe deer and moufflon

    Czech Academy of Sciences Publication Activity Database

    Kamler, Jiří

    1999-01-01

    Roč. 68, č. 4 (1999), s. 247-252 ISSN 0001-7213 R&D Projects: GA ČR GA206/97/0172; GA AV ČR KSK2005601 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.227, year: 1999 http://vfu-www.vfu.cz/acta-vet/vol68/pdf/68_247.pdf

  18. Cultural Economy, Capitalism and the Logic of the Public Sphere

    DEFF Research Database (Denmark)

    Schwarzkopf, Stefan

    2015-01-01

    Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp.......Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp....

  19. Study of the effect of moisture content and bending rate on the fracture toughness of rocks

    Czech Academy of Sciences Publication Activity Database

    Vavro, Leona; Souček, Kamil

    2013-01-01

    Roč. 10, č. 2 (2013), s. 247-253 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf

  20. Military Smokes and Obscurants Fate and Effects: A Literature Review Relative to Threatened and Endangered Species

    Science.gov (United States)

    2004-12-01

    aqueous phases indicated that hexachloroethane (HC) is dechlorinated to the same metabolites by sterilized and axenically cultivated aquatic plants and...Secondary poisoning of kestrels by white phosphorus. Ecotoxicology . 6(4):239-247. Since 1982, extensive waterfowl mortality due to white...D.W. and N.E. Federoff. 1997. Secondary poisoning of kestrels by white . Ecotoxicology . 6(4):239-247. WP T N Toxicity studies in waterfowl

  1. Dicty_cDB: SSK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 34 9.7 AB049544_1( AB049544 |pid:none) Porcine enterovirus 10 gene for RN... 3...4 9.7 AF363453_1( AF363453 |pid:none) Porcine enterovirus 9 strain UKG/4... 34 9.7 protein update 2009. 6.14

  2. 24/7 Operational Effectiveness Toolset: Mishap Investigation Interface

    Science.gov (United States)

    2008-10-01

    pressures, equipment limitations, attitudes, etc.). A PTO may have background or credentials in: Applied aerospace physiology Hyperbaric ... hypobaric physiology training Disorientation and centrifuge training Aviation human factors Life-support course Parachutist and land or water survival

  3. Maintaining Mission Critical Systems in a 247 Environment

    CERN Document Server

    Curtis, Peter M

    2011-01-01

    "This book is meant to offer Architects, Property Mangers, Facility Managers, Building Engineers, Information Technology Professionals, Data Center Personnel, Electrical & Mechanical Technicians and students in undergraduate, graduate, or continuing education programs relevant insight into the Mission Critical Environment with an emphasis on business resiliency, data center efficiency, and green power technology. Industry improvements, standards, and techniques have been incorporated into the text and address the latest issues prevalent in the Mission Critical Industry. An emphasis on green technologies and certifications is presented throughout the book. In addition, a description of the United States energy infrastructure's dependency on oil, in relation to energy security in the mission critical industry, is discussed. In conjunction with this, either a new chapter will be created on updated policies and regulations specifically related to the mission critical industry or updates to policies and regula...

  4. 40 CFR 247.14 - Park and recreation products.

    Science.gov (United States)

    2010-07-01

    ... plastic. (b) Plastic fencing containing recovered plastic for use in controlling snow or sand drifting and... containing recovered steel, aluminum, plastic, or concrete. (d) Playground equipment containing recovered plastic, steel, or aluminum. [60 FR 21381, May 1, 1995, as amended at 62 FR 60974, Nov. 13, 1997; 65 FR...

  5. 48 CFR 252.247-7008 - Evaluation of bids.

    Science.gov (United States)

    2010-10-01

    ... other factors, the Contracting Officer will evaluate bids on the basis of advantages or disadvantages to... evaluation, the Contracting Officer will assume that the administrative cost to the Government for issuing... Government, including the administrative costs in paragraph (b)(1). (c) When drayage is necessary for the...

  6. 24/7 Negotiation in couples' transition to parenthood

    NARCIS (Netherlands)

    Wiesmann, S.M.

    2010-01-01

    How do couples negotiate about their division of paid and unpaid work when they become parents? The division of work among couples has significantly changed in the past decades. This study focused on the underlying processes that lead couples to a certain division of paid and unpaid work. To unravel

  7. 48 CFR 252.247-7007 - Liability and insurance.

    Science.gov (United States)

    2010-10-01

    ... harmless from, bodily injury and death of persons, resulting either in whole or in part from the negligence..., contributed jointly with the fault or negligence of the Contractor in causing such damage, injury, or death...-insurer under applicable provision of law. (2) Bodily injury liability insurance in an amount of not less...

  8. 247 Educational Policy and Technological Development in Africa ...

    African Journals Online (AJOL)

    User

    Our modern world is sharply divided along two socio- economic poles of ... This article therefore, will look at how Nigeria's educational policy affects her level of .... the scientific and technological culture” (Umoren, 1996). vii. Lack of appropriate ...

  9. 48 CFR 252.247-7010 - Scope of contract.

    Science.gov (United States)

    2010-10-01

    ... containers (Federal Specification PPP-B-580), all equipment, plant and labor; and (2) Perform all work in accomplishing containerization of personal property for overseas or domestic movement or storage, including— (i... property (including servicing of appliances) for movement or storage, drayage and related services. Unless...

  10. 247 REVIEW ARTICLE BOOK TITLE: ORAL TRADITION AS ...

    African Journals Online (AJOL)

    Some of these messages, especially those that presents an “interpretation” of existing situations, are often ... the future. Such information comes from eyewitnesses, hearsay, or internal ... In practice, most false rumours ... well as about beliefs concerning situations. ... society, which is subject to recreation by historical change.

  11. Ruggedized Portable Instrumentation Package for Marine Mammal Evoked Potential Hearing Measurements (DURIP)

    Science.gov (United States)

    2011-09-30

    NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Hawaii Institute of Marine Biology,Marine Mammal...Program Hawaii Institute of Marine Biology P.O. Box 1106 Kailua, Hawaii 96734 phone: (808) 247-5297 fax: (808) 247-5831 email: nachtiga...portable equipment was used at the Hilo Stranding Center to obtain the audiograms. Ready and available for RIMPAC excercises. 2 IMPACT

  12. Whole-body MRI in neurofibromatosis: incidental findings and prevalence of scoliosis

    International Nuclear Information System (INIS)

    Jaremko, Jacob L.; MacMahon, Peter J.; Torriani, Martin; Bredella, Miriam A.; Merker, Vanessa L.; Plotkin, Scott R.; Mautner, Victor F.

    2012-01-01

    To demonstrate incidental findings and scoliosis on whole-body MRI (WBMRI) in patients with neurofibromatosis type 1 and 2 (NF1 and NF2, respectively), and schwannomatosis. Institutional review board approval and written informed consent were obtained for this prospective HIPAA-compliant study. A total of 247 subjects (141 with NF1, 55 with NF2, 51 with schwannomatosis; 132 women (53.5%); mean age, 41 years, range, 18-97 years) underwent WBMRI using coronal STIR (TR/TE: 4190/111 ms, TI: 150 ms) and T1-weighted images (TR/TE: 454/10 ms), 10-mm slice thickness, imaging time ∝40 min. Images were reviewed for the presence of incidental findings, outside of nerve sheath tumors. The presence of scoliosis was recorded and curve morphology was assessed and quantified. Incidental findings other than scoliosis were recorded in 104/247 (42%) patients, most often affecting the musculoskeletal system (65/247 patients, 26%). We found 16/247 (6.5%) significant incidental findings likely to affect clinical management, including avascular necrosis of bone in eight patients (five with NF2), eight insufficiency fractures, and four non-neurogenic neoplasms (Hodgkin's lymphoma, liposarcoma, dermoid cyst, large uterine myoma requiring excision). Scoliosis was seen in 50/247 patients (20%), including 8/55 with NF2 (15%) and 11/51 with schwannomatosis (22%). Incidental findings in the neurofibromatoses frequently involve the skeleton. Given the relatively high incidence of unsuspected osteonecrosis and stress fractures, close attention to the skeleton on WBMRI is advised. In addition, knowledge of common incidental findings can help clinicians prepare patients who undergo WBMRI for potential unexpected findings. (orig.)

  13. Whole-body MRI in neurofibromatosis: incidental findings and prevalence of scoliosis

    Energy Technology Data Exchange (ETDEWEB)

    Jaremko, Jacob L.; MacMahon, Peter J.; Torriani, Martin; Bredella, Miriam A. [Massachusetts General Hospital and Harvard Medical School, Musculoskeletal Imaging and Intervention, Department of Radiology, Boston, MA (United States); Merker, Vanessa L.; Plotkin, Scott R. [Massachusetts General Hospital, Department of Neurology and Cancer Center, Boston, MA (United States); Mautner, Victor F. [University Medical Center Hamburg-Eppendorf, Department of Neurology, Hamburg (Germany)

    2012-08-15

    To demonstrate incidental findings and scoliosis on whole-body MRI (WBMRI) in patients with neurofibromatosis type 1 and 2 (NF1 and NF2, respectively), and schwannomatosis. Institutional review board approval and written informed consent were obtained for this prospective HIPAA-compliant study. A total of 247 subjects (141 with NF1, 55 with NF2, 51 with schwannomatosis; 132 women (53.5%); mean age, 41 years, range, 18-97 years) underwent WBMRI using coronal STIR (TR/TE: 4190/111 ms, TI: 150 ms) and T1-weighted images (TR/TE: 454/10 ms), 10-mm slice thickness, imaging time {proportional_to}40 min. Images were reviewed for the presence of incidental findings, outside of nerve sheath tumors. The presence of scoliosis was recorded and curve morphology was assessed and quantified. Incidental findings other than scoliosis were recorded in 104/247 (42%) patients, most often affecting the musculoskeletal system (65/247 patients, 26%). We found 16/247 (6.5%) significant incidental findings likely to affect clinical management, including avascular necrosis of bone in eight patients (five with NF2), eight insufficiency fractures, and four non-neurogenic neoplasms (Hodgkin's lymphoma, liposarcoma, dermoid cyst, large uterine myoma requiring excision). Scoliosis was seen in 50/247 patients (20%), including 8/55 with NF2 (15%) and 11/51 with schwannomatosis (22%). Incidental findings in the neurofibromatoses frequently involve the skeleton. Given the relatively high incidence of unsuspected osteonecrosis and stress fractures, close attention to the skeleton on WBMRI is advised. In addition, knowledge of common incidental findings can help clinicians prepare patients who undergo WBMRI for potential unexpected findings. (orig.)

  14. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture.

  15. Final Remedial Investigation Sampling Plan Addendum. Milan Army Ammunition Plant Remedial Investigation Southern Study Area (Operable Unit No. 5)

    Science.gov (United States)

    1997-09-01

    91-D-0012 Task Order No. 0007 2.4.7 Milan Army Ammunition Plant, Phytoremediation Pilot Study, USAEC, 1996 .. .............................. 2-28 2.5...indicated that heavy metal contamination (lead, chromium, and mercury ) was present at relatively low levels, and explosive contamination was limited to...and MI172 where lead was found at 22.9 j.g/1 and 18.4 Ig/l, respectively. 2.4.7 Milan Army Ammunition Plant, Phytoremediation Pilot Study, USAEC, 1996

  16. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  17. Exon 3-deleted/full-length growth hormone receptor polymorphism genotype frequencies in Spanish short small-for-gestational-age (SGA) children and adolescents (n = 247) and in an adult control population (n = 289) show increased fl/fl in short SGA.

    Science.gov (United States)

    Audí, Laura; Esteban, Cristina; Carrascosa, Antonio; Espadero, Rosa; Pérez-Arroyo, Annalisa; Arjona, Rosa; Clemente, María; Wollmann, Hartmut; Fryklund, Linda; Parodi, Luis A

    2006-12-01

    A polymorphism in the human GH receptor gene (d3/fl-GHR) resulting in genomic deletion of exon 3 has been associated with the degree of height increase in response to GH therapy. The objective of the study was to evaluate the frequencies of d3/fl-GHR polymorphism genotypes in control and short small-for-gestational-age (SGA) populations. An adult control population with heights normally distributed (ACPNH) between -2 and +2 sd score (SDS) and a short non-GH-deficient SGA child population were selected. Thirty Spanish hospitals participated in the selection of the short non-GH-deficient SGA children in the setting of a controlled, randomized trial, and one of these hospitals selected the ACPNH. CONTROLS AND PATIENTS: Two hundred eighty-nine adult subjects of both sexes constituted the ACPNH and 247 children and adolescents of both sexes the short SGA patients. Heights and weights were recorded in the ACPNH, and auxologic and biochemical data were recorded at each hospital for the SGA patients; d3/fl-GHR genotypes were determined and data analyzed in a single hospital. In short SGA patients, d3/fl-GHR genotype frequencies were significantly different from those in ACPNH, with a higher frequency of fl/fl genotype (P or=-2 SDS, n = 60). Our data showed significant differences in the frequency distribution of the d3/fl-GHR genotypes between a normally distributed adult height population and short SGA children, with the biologically less active fl/fl genotype being almost twice as frequent in SGA patients. These data suggest that the d3/fl-GHR polymorphism might be considered among the factors that contribute to the phenotypic expression of growth.

  18. Microscopic studies on Y2Ba4Cu7O15-δ by use of TEM and NQR techniques

    International Nuclear Information System (INIS)

    Kato, Masaki; Nakanishi, Makoto; Yoshimura, Kazuyoshi; Kosuge, Koji; Miyano, Toshio; Kakihana, Masato

    1998-01-01

    Y 2 Ba 4 Cu 7 O 15-δ compounds were characterized by microscopic investigation using TEM and NQR techniques. The authors synthesized Y247 compounds by two kinds of preparation methods: the conventional solid-state reaction (sample A) and the polymerized-complex method (sample B). The value of T c for sample A was found o be 65 K and that for sample B as 93 K by ac-χ measurements. As a result of TEM experiments, stacking faults along the c axis were observed more frequently in sample B than in sample A. These stacking faults resulted in microdomains containing pure Y123 or Y124 thin blocks of several unit cells. NQR experiments revealed that the microscopic environment of Cu(2) sites in sample A differed from either of those in the Y123 and Y124 compounds. NQR frequency values (ν Q ) of Cu(2) sites agreed well with those calculated by the point charge model applied for the Y247 structure. The spectra of Cu(2) sites in sample B could be regarded, however, as a combination of those of pure Y123, Y124, and also Y247 compounds. This fact was coincident with the result of TEM experiments. The authors concluded that the superconductivity of Y247 with higher T c originates from the thin block of Y123

  19. Magnetic tri-axial orientation in (Y1-xErx)2Ba4Cu7O15-y superconductors

    International Nuclear Information System (INIS)

    Horii, S.; Okuhira, S.; Yamaki, M.; Haruta, M.; Maeda, T.; Shimoyama, J.

    2011-01-01

    (Y 1-x Er x ) 2 Ba 4 Cu 7 O 15-y [(Y,Er)247] was synthesized for clarifying a magnetic role of Er ion. The three magnetization axes of (Y,Er)247 were obtained from tri-axial orientation using a modulated rotation magnetic field. Magnetic anisotropy of Er ion is roughly ten times higher than that for Y247 at room temperature. Importance of rare-earth ions was shown for reduction of required magnetic fields in the tri-axial magnetic orientation. We report the tri-axial grain-orientation effects under a modulated rotation magnetic field for (Y 1-x Er x ) 2 Ba 4 Cu 7 O y [(Y, Er)247]. The magnetic easy axis at room temperature was drastically changed around x ∼ 0.1; however, the Er-doping levels for the conversion of magnetic easy axes from the c-axis to the ab-direction and from the a- to b-axes were quite different. Tri-axial single-ion magnetic anisotropy of Er 3+ was roughly 10 times greater than tri-axial magnetic anisotropy generated by both the superconducting CuO 2 plane and the blocking Cu-O chain layer. An appropriate choice of rare-earth (RE) ions in RE-based cuprate superconductors enables the reduction of the required magnetic field for the production of bulks and thick films based on the magnetic orientation technique.

  20. Creation of miniature pig model of human Waardenburg syndrome type 2A by ENU mutagenesis.

    Science.gov (United States)

    Hai, Tang; Guo, Weiwei; Yao, Jing; Cao, Chunwei; Luo, Ailing; Qi, Meng; Wang, Xianlong; Wang, Xiao; Huang, Jiaojiao; Zhang, Ying; Zhang, Hongyong; Wang, Dayu; Shang, Haitao; Hong, Qianlong; Zhang, Rui; Jia, Qitao; Zheng, Qiantao; Qin, Guosong; Li, Yongshun; Zhang, Tao; Jin, Weiwu; Chen, Zheng-Yi; Wang, Hongmei; Zhou, Qi; Meng, Anming; Wei, Hong; Yang, Shiming; Zhao, Jianguo

    2017-11-01

    Human Waardenburg syndrome 2A (WS2A) is a dominant hearing loss (HL) syndrome caused by mutations in the microphthalmia-associated transcription factor (MITF) gene. In mouse models with MITF mutations, WS2A is transmitted in a recessive pattern, which limits the study of hearing loss (HL) pathology. In the current study, we performed ENU (ethylnitrosourea) mutagenesis that resulted in substituting a conserved lysine with a serine (p. L247S) in the DNA-binding domain of the MITF gene to generate a novel miniature pig model of WS2A. The heterozygous mutant pig (MITF +/L247S ) exhibits a dominant form of profound HL and hypopigmentation in skin, hair, and iris, accompanied by degeneration of stria vascularis (SV), fused hair cells, and the absence of endocochlear potential, which indicate the pathology of human WS2A. Besides hypopigmentation and bilateral HL, the homozygous mutant pig (MITF L247S/L247S ) and CRISPR/Cas9-mediated MITF bi-allelic knockout pigs both exhibited anophthalmia. Three WS2 patients carrying MITF mutations adjacent to the corresponding region were also identified. The pig models resemble the clinical symptom and molecular pathology of human WS2A patients perfectly, which will provide new clues for better understanding the etiology and development of novel treatment strategies for human HL.

  1. Mothers’ non-standard working and childcare-related challenges : A comparison between lone and coupled mothers

    OpenAIRE

    Moilanen, Sanna; May, Vanessa; Räikkönen, Eija; Sevón, Eija; Laakso, Marja-Leena

    2016-01-01

    Purpose – The purpose of this paper is to particularly focus on lone-mother families, comparing the childcare-related challenges experienced by working lone mothers and coupled mothers in three European countries in the context of a 24/7 economy and non-standard working hours (e.g. evening, night and weekend work). Design/methodology/approach – This study utilises survey data from Finnish, Dutch and British working mothers (n=1,106) collected as part of the “Families 24/7” research ...

  2. Characterizations of a loss-of-function mutation in the Kir3.4 channel subunit

    DEFF Research Database (Denmark)

    Calloe, Kirstine; Ravn, Lasse Steen; Schmitt, Nicole

    2007-01-01

    and two-electrode voltage-clamp revealed that Kir3.4-G247R basal current was reduced compared to wild-type Kir3.4 and co-expression with the muscarinic acetylcholine receptor type 2 showed that also the acetylcholine induced current was severely reduced in Kir3.4-G247R, indicating that the mutation...... the lack of clear clinical manifestations and further studies are necessary to elucidate if mutations in Kir3.4 are predisposing AF. Udgivelsesdato: 2007-Dec-28...

  3. Evaluation of Heat Capacity and Resistance to Cyclic Oxidation of Nickel Superalloys

    Directory of Open Access Journals (Sweden)

    Przeliorz R.

    2014-08-01

    Full Text Available Paper presents the results of evaluation of heat resistance and specific heat capacity of MAR-M-200, MAR-M-247 and Rene 80 nickel superalloys. Heat resistance was evaluated using cyclic method. Every cycle included heating in 1100°C for 23 hours and cooling for 1 hour in air. Microstructure of the scale was observed using electron microscope. Specific heat capacity was measured using DSC calorimeter. It was found that under conditions of cyclically changing temperature alloy MAR-M-247 exhibits highest heat resistance. Formed oxide scale is heterophasic mixture of alloying elements, under which an internal oxidation zone was present. MAR-M-200 alloy has higher specific heat capacity compared to MAR-M-247. For tested alloys in the temperature range from 550°C to 800°C precipitation processes (γ′, γ″ are probably occurring, resulting in a sudden increase in the observed heat capacity.

  4. 48 CFR 252.247-7006 - Removal of contractor's employees.

    Science.gov (United States)

    2010-10-01

    ... use only experienced, responsible, and capable people to perform the work. The Contracting Officer may... continued employment under this contract is inconsistent with the interest of military security. (End of...

  5. All projects related to | Page 247 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-01

    A grant to improve a new generation of Latin American leaders' understanding of how to better manage natural resources will contribute to the region's economic and social development. Start Date: January 1, 2012 ... Region: South Asia, Central Asia, Far East Asia, Bangladesh, Sri Lanka, India, Nepal, Pakistan. Program: ...

  6. 48 CFR 52.247-68 - Report of Shipment (REPSHIP).

    Science.gov (United States)

    2010-10-01

    ..., or private) for transportation to a domestic destination (other than a port for export); (2..., MEMPHIS, TN. SHIPPED YOUR DEPOT 1981 JUN 1 540 CTNS MENS COTTON TROUSERS, 30,240 LB, 1782 CUBE, VIA XX-YY...

  7. 32 CFR Appendix B to Part 247 - CE Publications

    Science.gov (United States)

    2010-07-01

    ... dining at a restaurant or attending a musical performance) of a commercial organization whose primary... potentially become the CE contractor. Upon evaluation of the competing proposals by the Source Selection Advisory Committee (SSAC) and selection of a winner by the selecting official, the CE contract shall be...

  8. 48 CFR 52.247-57 - Transportation Transit Privilege Credits.

    Science.gov (United States)

    2010-10-01

    ... equipment and acceptance by the carrier, these shipments under paid commercial bills of lading will move for... the offered f.o.b. origin price unless a lower rate is applicable on the date of bid opening (or...

  9. 7 CFR 247.5 - State and local agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ....); (6) Establishing nutritional risk criteria and a residency requirement for participants, if such... received for program administration; (8) Developing a plan for the detection and prevention of dual... compliance with Federal audit requirements; (14) Providing guidance to local agencies, as needed; and (15...

  10. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 247 EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMALADAYDAMTSLRPY 298 ... EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMA...LADAYDAMTSLRPY Sbjct: 241 EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMALADAYDAMTSLRPY 292

  11. Statement of work for services provided by the Waste Sampling and Characterization Facility for Effluent Monitoring during Calendar Year 1996

    International Nuclear Information System (INIS)

    Gleckler, B.P.

    1996-01-01

    This report documents radionuclide air emissions from the Hanford Site and the resulting effective dose equivalent to any member of the public from those emissions. This report complies with the reporting requirements of the Code of Federal Regulations, Title 40, ''Protection of the Environment,'' Part 61, ''National Emissions Standards for Hazardous Air Pollutants,'' Subpart H, ''National Emission Standards for Emissions of Radionuclides Other Than Radon From Department of Energy Facilities'' (40 CFR 61 Subpart H) and Chapter 246-247 of the Washington Administrative Code (WAC 246-247)

  12. George Sand: últimas novelas, últimos ensueños...

    Directory of Open Access Journals (Sweden)

    Àngels Santa

    2014-04-01

    Full Text Available A propósito de la obra de George Sand, Œuvres complètes.Sous la direction de Béatrice Didier. 1870, I :Malgrétout. Édition critique par Dominique Laporte (París, Honoré Champion, 2013, 247 p. ISBN : 9782745322968 y de George Sand, Œuvres complètes.Sous la direction de Béatrice Didier. 1876 :La Tour de Percemont. Édition critique par Dominique Laporte (París, Honoré Champion, 2013, 247 p. ISBN : 9782745322951.

  13. Electronic structures of PrBa{sub 2}Cu{sub 3}O{sub 7}, Pr{sub 2}Ba{sub 4}Cu{sub 7}O{sub 15-y}(y=0,1), and PrBa{sub 2}Cu{sub 4}O{sub 8} based on LSDA+U method

    Energy Technology Data Exchange (ETDEWEB)

    Tavana, A. [Magnet Research Laboratory (MRL), Department of Physics, Sharif University of Technology, Tehran (Iran); Department of Physics, University of Mohaghegh Ardabili, Ardabil (Iran); Shirazi, M.; Akhavan, M. [Magnet Research Laboratory (MRL), Department of Physics, Sharif University of Technology, Tehran (Iran)

    2009-10-15

    The electronic structures of PrBa{sub 2}Cu{sub 3}O{sub 7} (Pr123), Pr{sub 2}Ba{sub 4}Cu{sub 7}O{sub 15-y} (Pr247), and PrBa{sub 2}Cu{sub 4}O{sub 8} (Pr124) cuprates have been obtained using density-functional theory in the local spin density approximation plus onsite Coulomb interaction (LSDA+U). Onsite Hubbard correlation, U, has been considered for Pr-f and Cu-d orbitals and the effects of considering these correlation corrections on the Pr-O hybridizations have been inspected. Results imply that the Pr ionization state in Pr123 system is constituted from two different configurations, and the energy of the f states in these two configurations has an important role in superconductivity properties of the system. Our calculations also show that in both Pr124 and Pr247 systems, suppression of superconductivity is weaker than that in the Pr123 system. This occurs due to the weaker Pr-O bond in both Pr124 and Pr247 systems. The role of the double chain and single chain on the conduction properties of these compounds has been investigated. We have also studied the effect of oxygen deficiency in Pr247 system, which seems to revive superconductivity in this system. Investigating the hole carriers in the CuO{sub 2} plane shows a correlation between superconductivity suppression and hole decrement in the planes. (Abstract Copyright [2009], Wiley Periodicals, Inc.)

  14. Electronic structures of PrBa2Cu3O7, Pr2Ba4Cu7O15-y(y=0,1), and PrBa2Cu4O8 based on LSDA+U method

    International Nuclear Information System (INIS)

    Tavana, A.; Shirazi, M.; Akhavan, M.

    2009-01-01

    The electronic structures of PrBa 2 Cu 3 O 7 (Pr123), Pr 2 Ba 4 Cu 7 O 15-y (Pr247), and PrBa 2 Cu 4 O 8 (Pr124) cuprates have been obtained using density-functional theory in the local spin density approximation plus onsite Coulomb interaction (LSDA+U). Onsite Hubbard correlation, U, has been considered for Pr-f and Cu-d orbitals and the effects of considering these correlation corrections on the Pr-O hybridizations have been inspected. Results imply that the Pr ionization state in Pr123 system is constituted from two different configurations, and the energy of the f states in these two configurations has an important role in superconductivity properties of the system. Our calculations also show that in both Pr124 and Pr247 systems, suppression of superconductivity is weaker than that in the Pr123 system. This occurs due to the weaker Pr-O bond in both Pr124 and Pr247 systems. The role of the double chain and single chain on the conduction properties of these compounds has been investigated. We have also studied the effect of oxygen deficiency in Pr247 system, which seems to revive superconductivity in this system. Investigating the hole carriers in the CuO 2 plane shows a correlation between superconductivity suppression and hole decrement in the planes. (Abstract Copyright [2009], Wiley Periodicals, Inc.)

  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIKE...IKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL

  16. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EAYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIK...EIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL

  17. Reversible optic neuropathy with OPA1 exon 5b mutation

    DEFF Research Database (Denmark)

    Cornille, K.; Milea, D.; Amati-Bonneau, P.

    2008-01-01

    A new c.740G>A (R247H) mutation in OPA1 alternate spliced exon 5b was found in a patient presenting with bilateral optic neuropathy followed by partial, spontaneous visual recovery. R247H fibroblasts from the patient and his unaffected father presented unusual highly tubular mitochondrial network......, significant increased susceptibility to apoptosis, oxidative phosphorylation uncoupling, and altered OPA1 protein profile, supporting the pathogenicity of this mutation. These results suggest that the clinical spectrum of the OPA1-associated optic neuropathies may be larger than previously described...

  18. A fluorescent optical fibre chemosensor for mercury detection

    Science.gov (United States)

    Wren, Stephen P.; Sun, Tong; Grattan, Kenneth T. V.

    2015-09-01

    A proof-of-concept mercury probe was developed based on covalent attachment of a chemical coating to optical fibre. The sensing element comprised a dansyl derivative and crown ether moiety, acting as fluorophore and metal ion chelator respectively. An ON-OFF type fluorescence (quench) occurred upon binding of mercury ions, via an intramolecular charge transfer mechanism, in aqueous solution in the 909nM-90.9μM (247 ppb -24.7 ppm) concentration range. A washing protocol was identified for sensor regeneration allowing the probe to be re-used.

  19. ORF Alignment: NC_002976 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TLE 180 ... Query: 247 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 304 ... ASVTIISDHGIDGEVWSTICS...FGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298

  20. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 121 ASVDCYERFLPPPFKLLTPLARIPGSLRPATELLRIRALHPLPIALGWVVKRPVPPEVVD 180 ... Query: 247 LAADLPNATLRFVDDSYTAIPE...DQPAALTELILDFTRQ 284 ... LAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQ Sbjct: 241 LAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQ 278

  1. Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute

    Energy Technology Data Exchange (ETDEWEB)

    MJ Lambert

    2005-11-18

    Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 {micro}m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a

  2. Summary of Dissimilar Metal Joining Trials Conducted by Edison Welding Institute

    International Nuclear Information System (INIS)

    MJ Lambert

    2005-01-01

    Under the direction of the NASA-Glenn Research Center, the Edison Welding Institute (EWI) in Columbus, OH performed a series of non-fusion joining experiments to determine the feasibility of joining refractory metals or refractory metal alloys to Ni-based superalloys. Results, as reported by EWI, can be found in the project report for EWI Project 48819GTH (Attachment A, at the end of this document), dated October 10, 2005. The three joining methods used in this investigation were inertia welding, magnetic pulse welding, and electro-spark deposition joining. Five materials were used in these experiments: Mo-47Re, T-111, Hastelloy X, Mar M-247 (coarse-grained, 0.5 mm to several millimeter average grain size), and Mar M-247 (fine-grained, approximately 50 (micro)m average grain size). Several iterative trials of each material combination with each joining method were performed to determine the best practice joining method. Mo-47Re was found to be joined easily to Hastelloy X via inertia welding, but inertia welding of the Mo-alloy to both Mar M-247 alloys resulted in inconsistent joint strength and large reaction layers between the two metals. T-111 was found to join well to Hastelloy X and coarse-grained Mar M-247 via inertia welding, but joining to fine-grained Mar M-247 resulted in low joint strength. Magnetic pulse welding (MPW) was only successful in joining T-111 tubing to Hastelloy X bar stock. The joint integrity and reaction layer between the metals were found to be acceptable. This single joining trial, however, caused damage to the electromagnetic concentrators used in this process. Subsequent design efforts to eliminate the problem resulted in a loss of power imparted to the accelerating work piece, and results could not be reproduced. Welding trials of Mar M-247 to T-111 resulted in catastrophic failure of the bar stock, even at lower power. Electro-spark deposition joining of Mo-47Re, in which the deposited material was Hastelloy X, did not have a

  3. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RFIKYVQFETTSNAMSSSVPSTPTQIEFEKYLQNELNEMGIKNELTQTGHLFAYLSN 60 ... Query: 127 DTLLGADDKCAVAILMTICE...MYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 186 ... DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIG...RSITHLDINKLKAKKAYSLD Sbjct: 121 DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 180 ... Query: 247

  4. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QFTKDEVQAIVAALDAAGVPVIEVTHGDGLGGSSFNY 60 ... Query: 127 IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVL...EGVRD 186 ... IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVLEGVRD... Sbjct: 121 IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVLEGVRD 180 ... Query: 247 IGVFDKIGVKTGIDFFDIX

  5. New Antioxidative Secondary Metabolites from the Fruits of a Beibu Gulf Mangrove, Avicennia marina

    Directory of Open Access Journals (Sweden)

    Cheng-Hai Gao

    2014-07-01

    Full Text Available Further chemical investigation of the fruits of the mangrove, Avicennia marina, afforded three new phenylethyl glycosides, marinoids J–L (1–3, and a new cinnamoyl glycoside, marinoid M (4. The structures of isolates were elucidated on the basis of extensive spectroscopic analysis and by comparison of the data with those of related secondary metabolites. The antioxidant activity of the isolates was evaluated using the cellular antioxidant assay (CAA, and compounds 1–4 showed antioxidant activities, with EC50 values ranging from 23.0 ± 0.71 μM to 247.8 ± 2.47 μM.

  6. SYNTHESIS AND STUDY OF COMPLEXES OF COPPER(II, ZINC, COBALT(II AND NICKEL(II WITH NITROFLUORENYLIDENE-9-AMINO(IMINO DERIVATIVES

    Directory of Open Access Journals (Sweden)

    S.B. Strashnova

    2009-12-01

    Full Text Available The complexes of general formula MCl2∙L1-4∙nH2O (where L1 - N-(2,4,7-trinitrofluorenilidene-9-p-dimethyl-aminoanilin, L2 - N-(2,4,5,7-tetranitrofluorenilidene-9-p-dimethylaminoaniline, L3 - N-(2,4,7-trinitrofluorenilidene-N-(p-dimethylaminophenylhydroxylamine, L4 - N-(2,4,5,7-tetranitrofluorenilidene-9-N-(p-dimethylaminophenyl-hydroxylamine; M=Cu, Co, Ni, Zn; n= 1-3 have been synthesized and investigated by different methods. Spectral criteria of co-ordination of the molecules L1 –L4 in electronic adsorption spectra were detected.

  7. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 242 ... Query: 188 GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPV...NCSALV 247 ... GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV Sbjct: 1 ... GSSRAWTTVLDS...IKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV 60 ... Query: 308 ERVGGEKPVSVDVRIIAATNVDLAEAVSMGRFREDLLYRLDVFP

  8. Operational Research: Evaluating Multimodel Implementations for 24/7 Runtime Environments

    Science.gov (United States)

    Burkhart, J. F.; Helset, S.; Abdella, Y. S.; Lappegard, G.

    2016-12-01

    We present a new open source framework for operational hydrologic rainfall-runoff modeling. The Statkraft Hydrologic Forecasting Toolbox (Shyft) is unique from existing frameworks in that two primary goals are to provide: i) modern, professionally developed source code, and ii) a platform that is robust and ready for operational deployment. Developed jointly between Statkraft AS and The University of Oslo, the framework is currently in operation in both private and academic environments. The hydrology presently available in the distribution is simple and proven. Shyft provides a platform for distributed hydrologic modeling in a highly efficient manner. In it's current operational deployment at Statkraft, Shyft is used to provide daily 10-day forecasts for critical reservoirs. In a research setting, we have developed a novel implementation of the SNICAR model to assess the impact of aerosol deposition on snow packs. Several well known rainfall-runoff algorithms are available for use, allowing for intercomparing different approaches based on available data and the geographical environment. The well known HBV model is a default option, and other routines with more localized methods handling snow and evapotranspiration, or simplifications of catchment scale processes are included. For the latter, we have implemented the Kirchner response routine. Being developed in Norway, a variety snow-melt routines, including simplified degree day models or more advanced energy balance models, may be selected. Ensemble forecasts, multi-model implementations, and statistical post-processing routines enable a robust toolbox for investigating optimal model configurations in an operational setting. The Shyft core is written in modern templated C++ and has Python wrappers developed for easy access to module sub-routines. The code is developed such that the modules that make up a "method stack" are easy to modify and customize, allowing one to create new methods and test them rapidly. Due to the simple architecture and ease of access to the module routines, we see Shyft as an optimal choice to evaluate new hydrologic routines in an environment requiring robust, professionally developed software and welcome further community participation.

  9. S. Aft. J. Anim. Sci., 4, 247-258 (1974) INTENSIFICATION

    African Journals Online (AJOL)

    production, the cmphasis must inevitably fall on irnpoving efficiency in the oow hcrd. This is particularly evi&nt from a partitioning of thc total nutrients into the various pluses ... Maintenance of cow and calf ... creascd productivity per unit aroa and land is therefore ..... terial on this aspect the potential increase in efficiency of.

  10. 7 CFR 247.2 - The purpose and scope of CSFP.

    Science.gov (United States)

    2010-01-01

    ... help State and local agencies meet the nutritional needs of low-income pregnant, postpartum, and..., canned fruits and vegetables, canned meat or poultry and other protein items, and grain products such as...

  11. The Lived Experiences of 24/7 Connectivity on Secondary Educators

    Science.gov (United States)

    Heiden, James P.

    2012-01-01

    Student access to the Internet has dramatically increased during the first decade of 2000. A recent study indicated that over 85% of US teens have regular access to a cell phone (Rideout et al., 2010). The cell phone coupled with an Internet plan has created the smart phone. This technology allows students to decide when and where they want to…

  12. 25 CFR 247.1 - What definitions apply to this part?

    Science.gov (United States)

    2010-04-01

    ... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER... processing fish. Abandoned property may include: (1) Vehicles; (2) Mobile trailers; (3) Campers; (4) Tents..., destroy, cut, chop, girdle, dig, excavate, kill or in any way harm or disturb. Secretary means the...

  13. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 181 ... PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIM...SGKSVLVS Sbjct: 121 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 180 ... Query: 242 VANQGK 247 ... VANQGK Sbjct: 241 VANQGK 246

  14. Important Late-Stage Symbiotic Role of the Sinorhizobium meliloti Exopolysaccharide Succinoglycan.

    Science.gov (United States)

    Arnold, Markus F F; Penterman, Jon; Shabab, Mohammed; Chen, Esther J; Walker, Graham C

    2018-07-01

    Sinorhizobium meliloti enters into beneficial symbiotic interactions with Medicago species of legumes. Bacterial exopolysaccharides play critical signaling roles in infection thread initiation and growth during the early stages of root nodule formation. After endocytosis of S. meliloti by plant cells in the developing nodule, plant-derived nodule-specific cysteine-rich (NCR) peptides mediate terminal differentiation of the bacteria into nitrogen-fixing bacteroids. Previous transcriptional studies showed that the intensively studied cationic peptide NCR247 induces expression of the exo genes that encode the proteins required for succinoglycan biosynthesis. In addition, genetic studies have shown that some exo mutants exhibit increased sensitivity to the antimicrobial action of NCR247. Therefore, we investigated whether the symbiotically active S. meliloti exopolysaccharide succinoglycan can protect S. meliloti against the antimicrobial activity of NCR247. We discovered that high-molecular-weight forms of succinoglycan have the ability to protect S. meliloti from the antimicrobial action of the NCR247 peptide but low-molecular-weight forms of wild-type succinoglycan do not. The protective function of high-molecular-weight succinoglycan occurs via direct molecular interactions between anionic succinoglycan and the cationic NCR247 peptide, but this interaction is not chiral. Taken together, our observations suggest that S. meliloti exopolysaccharides not only may be critical during early stages of nodule invasion but also are upregulated at a late stage of symbiosis to protect bacteria against the bactericidal action of cationic NCR peptides. Our findings represent an important step forward in fully understanding the complete set of exopolysaccharide functions during legume symbiosis. IMPORTANCE Symbiotic interactions between rhizobia and legumes are economically important for global food production. The legume symbiosis also is a major part of the global nitrogen

  15. Organizational Issues, Structure, and Processes of Care in 257 ICUs in Latin America: A Study From the Latin America Intensive Care Network.

    Science.gov (United States)

    Estenssoro, Elisa; Alegría, Leyla; Murias, Gastón; Friedman, Gilberto; Castro, Ricardo; Nin Vaeza, Nicolas; Loudet, Cecilia; Bruhn, Alejandro; Jibaja, Manuel; Ospina-Tascon, Gustavo; Ríos, Fernando; Machado, Flavia R; Biasi Cavalcanti, Alexandre; Dubin, Arnaldo; Hurtado, F Javier; Briva, Arturo; Romero, Carlos; Bugedo, Guillermo; Bakker, Jan; Cecconi, Maurizio; Azevedo, Luciano; Hernandez, Glenn

    2017-08-01

    Latin America bears an important burden of critical care disease, yet the information about it is scarce. Our objective was to describe structure, organization, processes of care, and research activities in Latin-American ICUs. Web-based survey submitted to ICU directors. ICUs located in nine Latin-American countries. Individual ICUs. None. Two hundred fifty-seven of 498 (52%) of submitted surveys responded: 51% from Brazil, 17% Chile, 13% Argentina, 6% Ecuador, 5% Uruguay, 3% Colombia, and 5% between Mexico, Peru, and Paraguay. Seventy-nine percent of participating hospitals had less than 500 beds; most were public (59%) and academic (66%). ICUs were mainly medical-surgical (75%); number of beds was evenly distributed in the entire cohort; 77% had 24/7 intensivists; 46% had a physician-to-patient ratio between 1:4 and 7; and 69% had a nurse-to-patient ratio of 1 ≥ 2.1. The 24/7 presence of other specialists was deficient. Protocols in use averaged 9 ± 3. Brazil (vs the rest) had larger hospitals and ICUs and more quality, surveillance, and prevention committees, but fewer 24/7 intensivists and poorer nurse-to-patient ratio. Although standard monitoring, laboratory, and imaging practices were almost universal, more complex measurements and treatments and portable equipment were scarce after standard working hours, and in public hospitals. Mortality was 17.8%, without differences between countries. This multinational study shows major concerns in the delivery of critical care across Latin America, particularly in human resources. Technology was suboptimal, especially in public hospitals. A 24/7 availability of supporting specialists and of key procedures was inadequate. Mortality was high in comparison to high-income countries.

  16. Occurrence of aminoglycoside-modifying enzymes among isolates of Escherichia coli exhibiting high levels of aminoglycoside resistance isolated from Korean cattle farms.

    Science.gov (United States)

    Belaynehe, Kuastros Mekonnen; Shin, Seung Won; Hong-Tae, Park; Yoo, Han Sang

    2017-08-01

    This study investigated 247 Escherichia coli isolates collected from four cattle farms to characterize aminoglycoside-modifying enzyme (AME) genes, their plasmid replicons and transferability. Out of 247 isolates a high number of isolates (total 202; 81.78%) were found to be resistant to various antibiotics by disc diffusion. Of the 247 strains, 139 (56.3%) were resistant to streptomycin, and other antibiotic resistances followed as tetracycline (12.15%), ampicillin (7%), chloramphenicol (5.7%) and trimethoprim-sulfamethoxazole (0.8%). Among 247 isolates B1 was the predominant phylogenetic group identified comprising 151 isolates (61.1%), followed by groups A (27.9%), D (7%) and B2 (4%). Out of 139 isolates investigated for AME, 130 (93.5%) isolates carried at least one AME gene. aph3″-1a and aph3″-1b (46%) were the principal genes detected, followed by aac3-IVa (34.5%). ant2″-1a was the least detected gene (2.2%). Nine (6.5%) strains carried no AME genes. Twelve (63.2%) among 19 isolates transferred an AME gene to a recipient and aph3΄-1a was the dominant transferred gene. Transferability mainly occurred via the IncFIB replicon type (52.6%). Pulsed-field gel electrophoresis typing demonstrated a higher degree of diversity with 14 distinct cluster types. This result suggests that commensal microflora from food-producing animals has a tremendous ability to harbor and transfer AME genes, and poses a potential risk by dissemination of resistance to humans through the food chain. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  17. Storage and Non-Payment: Persistent Informalities within the Formal Water Supply of Hubli-Dharwad, India

    Directory of Open Access Journals (Sweden)

    Zachary Burt

    2014-02-01

    Full Text Available Urban water systems in Asia and Africa mostly provide intermittent rather than continuous water supplies; such systems compromise water quality and inconvenience the user. Starting in 2008, an upgrade to continuous (24/7 water services was provided for 10% of the twin cities of Hubli-Dharwad, India, through a process of privatisation and formalisation. The goals were to improve water quality, free consumers from collecting and storing water, and reduce non-revenue (i.e. unpaid for water. Drawing on household surveys (n = 1986 conducted in 2010-2011 in the 24/7 zones, as well as on a range of interviews, we find that, even with 'formal' 24/7 water service, most consumers continue the supposedly 'informal' practices of in-home storage and water use without payment of bills. We argue that multiple unaccounted-for factors – including a history of distrust between the consumer and the utility, seemingly small infrastructural details, resistance to higher tariffs, and valuing convenience above water quality – have kept these informal practices embedded within the formalised delivery system. Our research contributes to understanding why formalisation may only partially supplant informal practices even when the formal system is functional and reliable.

  18. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available thomonas ... campestris pv. campestris str. ATCC 33913] ... Length = 247 ... Query: 49 ... LNPFVPVQF...PLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY 108 ... LNPFVPVQFPLKLV...DRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY Sbjct: 1 ... LNPFVPVQFPLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQY

  19. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available C58, Dupont) plasmid AT ... Length = 247 ... Query: 28 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMA...KDLNAELEIVPLTGASRIPS 87 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTG...ASRIPS Sbjct: 21 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 80 ... Query: 148 STLDTWLTDNAPEV

  20. A new variation in the promoter region, the -604 C>T, and the Leu72Met polymorphism of the ghrelin gene are associated with protection to insulin resistance.

    Science.gov (United States)

    Zavarella, S; Petrone, A; Zampetti, S; Gueorguiev, M; Spoletini, M; Mein, C A; Leto, G; Korbonits, M; Buzzetti, R

    2008-04-01

    Previous studies suggested that polymorphisms in the coding region of the preproghrelin were involved in the etiology of obesity and might modulate glucose-induced insulin secretion. We evaluated the association of a new variation, -604C>T, in the promoter region of the ghrelin gene, of Leu72Met (247C>A) and of Gln90Leu (265A>T), all haplotype-tagging single nucleotide polymorphisms (SNPs), with measures of insulin sensitivity in 1420 adult individuals. The three SNPs were genotyped using ABI PRISM 7900 HT Sequence Detection System. We used multiple linear regression analysis for quantitative traits and THESIAS software for haplotype analysis. We observed a protective effect exerted by Met72 variant of Leu72Met SNP on insulin resistance parameters; a significant decreasing trend from Leu/Leu to Leu/Met and to Met/Met homozygous subjects in triglycerides, fasting insulin levels and HOMA-IR index (P=0.02, 0.01 and 0.003, respectively), and, consistently, an increase in ghrelin levels (P=0.003) was found. A significant decrease from CC to TC and to TT genotypes in insulin levels and HOMA-IR index was also detected (P=0.00l for both), but only in subjects homozygous for Leu72, where the protective effect of Met72 was not present. The haplotype analysis results supported the data obtained by the evaluation of each single SNP, showing the highest value of insulin levels and HOMA-IR index in the -604(c)247(c) haplotype intermediate value in -604(T)247(C) and lowest value in -604(C)247(A). Our observations suggest a protective role of the Met72 variant and of -604 T allele in modulating insulin resistance. These SNPs or an unknown functional variant in linkage disequilibrium could increase ghrelin levels and probably insulin sensitivity.

  1. Modulation of Bacillus thuringiensis Phosphatidylinositol-Specific Phospholipase C Activity by Mutations in the Putative Dimerization Interface

    Energy Technology Data Exchange (ETDEWEB)

    Shi, X.; Shao, C; Zhang, X; Zambonelli, C; Redfield, A; Head, J; Seaton, B; Roberts, M

    2009-01-01

    Cleavage of phosphatidylinositol (PI) to inositol 1,2-(cyclic)-phosphate (cIP) and cIP hydrolysis to inositol 1-phosphate by Bacillus thuringiensis phosphatidylinositol-specific phospholipase C are activated by the enzyme binding to phosphatidylcholine (PC) surfaces. Part of this reflects improved binding of the protein to interfaces. However, crystallographic analysis of an interfacially impaired phosphatidylinositol-specific phospholipase (W47A/W242A) suggested protein dimerization might occur on the membrane. In the W47A/W242A dimer, four tyrosine residues from one monomer interact with the same tyrosine cluster of the other, forming a tight dimer interface close to the membrane binding regions. We have constructed mutant proteins in which two or more of these tyrosine residues have been replaced with serine. Phospholipid binding and enzymatic activity of these mutants have been examined to assess the importance of these residues to enzyme function. Replacing two tyrosines had small effects on enzyme activity. However, removal of three or four tyrosine residues weakened PC binding and reduced PI cleavage by the enzyme as well as PC activation of cIP hydrolysis. Crystal structures of Y247S/Y251S in the absence and presence of myo-inositol as well as Y246S/Y247S/Y248S/Y251S indicate that both mutant proteins crystallized as monomers, were very similar to one another, and had no change in the active site region. Kinetic assays, lipid binding, and structural results indicate that either (i) a specific PC binding site, critical for vesicle activities and cIP activation, has been impaired, or (ii) the reduced dimerization potential for Y246S/Y247S/Y248S and Y246S/Y247S/Y248S/Y251S is responsible for their reduced catalytic activity in all assay systems.

  2. Study of β2-Glycoprotein I Polymorphisms in Patients With Chronic Renal Failure as a Predisposing Factor for the Development of Anti-β2-Glycoprotein I Auto-Antibodies.

    Science.gov (United States)

    Serrano, M; Cabrera-Marante, O; Martínez-Flores, J A; Morales, P; Pérez, D; Mora, S; García, F; González, E; Paz-Artal, E; Morales, J M; Serrano, A

    2016-11-01

    Immunoglobulin (Ig)A anti-β 2 -glycoprotein I (aB2GP1) antibodies are associated with thrombotic events, cardiovascular morbidity, and death in dialysis patients. About 30% of patients with chronic renal disease are positive for IgA aB2GP1; however, the origin of these antibodies is unknown. It has been speculated that dialysis membranes, age, or etiology of renal base disease are possible precipitating factors, although these factors do not appear to be the source of antibodies. B2GP1 is a protein of 326 amino acids grouped into five domains. Eight polymorphisms have been described; the most important are Val/Leu 247 , which appears to predispose aB2GP1 antibody production in patients with anti-phospholipid syndrome, and Trp/Ser 316 , which appears to have protective antibody production of aB2GP1. DNA samples from 92 patients with renal failure on hemodialysis were randomly collected with a 1:1 ratio for the positivity for IgA aB2GP1. Forty-six samples were positive for IgA aB2GP1 (group 1) and 46 negative for IgA aB2GP1 (group 2). All samples were anonymized to study polymorphism Val/Leu 247 and polymorphism Trp/Ser 316 . No significant differences were observed between those who were positive or negative for IgA aB2GP1 in patients with renal failure treated with hemodialysis and the polymorphism located in codons 247 and 316. The two groups of patients have the same prevalence in polymorphisms 247 and 316, and therefore there appears not to be a genetic predisposition in our population. New trigger factors must be studied. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Comparison of Commercial Wrist-Based and Smartphone Accelerometers, Actigraphy, and PSG in a Clinical Cohort of Children and Adolescents.

    Science.gov (United States)

    Toon, Elicia; Davey, Margot J; Hollis, Samantha L; Nixon, Gillian M; Horne, Rosemary S C; Biggs, Sarah N

    2016-03-01

    To compare two commercial sleep devices, an accelerometer worn as a wristband (UP by Jawbone) and a smartphone application (MotionX 24/7), against polysomnography (PSG) and actigraphy (Actiwatch2) in a clinical pediatric sample. Children and adolescents (n = 78, 65% male, mean age 8.4 ± 4.0 y) with suspected sleep disordered breathing (SDB), simultaneously wore an actiwatch, a commercial wrist-based device and had a smartphone with a sleep application activated placed near their right shoulder, during their diagnostic PSG. Outcome variables were sleep onset latency (SOL), total sleep time (TST), wake after sleep onset (WASO), and sleep efficiency (SE). Paired comparisons were made between PSG, actigraphy, UP, and MotionX 24/7. Epoch-by-epoch comparisons determined sensitivity, specificity, and accuracy between PSG, actigraphy, and UP. Bland-Altman plots determined level of agreement. Differences in bias between SDB severity and developmental age were assessed. No differences in mean TST, WASO, or SE between PSG and actigraphy or PSG and UP were found. Actigraphy overestimated SOL (21 min). MotionX 24/7 underestimated SOL (12 min) and WASO (63 min), and overestimated TST (106 min) and SE (17%). UP showed good sensitivity (0.92) and accuracy (0.86) but poor specificity (0.66) when compared to PSG. Bland-Altman plots showed similar levels of bias in both actigraphy and UP. Bias did not differ by SDB severity, however was affected by age. When compared to PSG, UP was analogous to Actiwatch2 and may have some clinical utility in children with sleep disordered breathing. MotionX 24/7 did not accurately reflect sleep or wake and should be used with caution. © 2016 American Academy of Sleep Medicine.

  4. A High-Availability, Distributed Hardware Control System Using Java

    Science.gov (United States)

    Niessner, Albert F.

    2011-01-01

    Two independent coronagraph experiments that require 24/7 availability with different optical layouts and different motion control requirements are commanded and controlled with the same Java software system executing on many geographically scattered computer systems interconnected via TCP/IP. High availability of a distributed system requires that the computers have a robust communication messaging system making the mix of TCP/IP (a robust transport), and XML (a robust message) a natural choice. XML also adds the configuration flexibility. Java then adds object-oriented paradigms, exception handling, heavily tested libraries, and many third party tools for implementation robustness. The result is a software system that provides users 24/7 access to two diverse experiments with XML files defining the differences

  5. Differences in the second internal transcribed spacer of four species of Nematodirus (Nematoda: Molineidae).

    Science.gov (United States)

    Newton, L A; Chilton, N B; Beveridge, I; Gasser, R B

    1998-02-01

    Genetic differences among Nematodirus spathiger, Nematodirus filicollis, Nematodirus helvetianus and Nematodirus battus in the nucleotide sequence of the second internal transcribed spacer (ITS-2) of ribosomal DNA ranged from 3.9 to 24.7%. Pairwise comparisons of their ITS-2 sequences indicated that the most genetically similar species were N. spathiger and N. helvetianus. N. battus was the most genetically distinct species, with differences ranging from 22.8 to 24.7% with respect to the other three species. Some of the nucleotide differences among species provided different endonuclease restriction sites that could be used in restriction fragment length polymorphism studies. The ITS-2 sequence data may prove useful in studies of the systematics of molineid nematodes.

  6. 75 FR 5877 - Commodity Supplemental Food Program (CSFP): Amendment Removing Priority Given to Women, Infants...

    Science.gov (United States)

    2010-02-05

    ... Education, Food assistance programs, Grant programs--health, Grant programs--social programs, Indians... requirements, Surplus agricultural commodities, Women. 0 Accordingly, 7 CFR part 247 is amended as follows...

  7. Evaluation of dental implants as a risk factor for the development of bisphosphonate-related osteonecrosis of the jaw in breast cancer patients.

    Science.gov (United States)

    Matsuo, Akira; Hamada, Hayato; Takahashi, Hidetoshi; Okamoto, Ayako; Kaise, Hiroshi; Chikazu, Daichi

    2016-09-01

    It remains unclear whether dental implants are a risk factor for the development of bisphosphonate-related osteonecrosis of the jaw (BRONJ). We retrospectively evaluated the status of dental implants in patients given intravenous bisphosphonates (BPs) in a breast cancer cohort to elucidate the risk for BRONJ at the implant site. We established a BRONJ oral monitoring program for 247 breast cancer patients given intravenous BP in our institution. The 3-year cumulative incidence rate was determined. The systemic and local risk factors of 44 patients who completed comprehensive oral examinations were evaluated by logistic regression analysis. The 3-year cumulative incidence rate of the 247 patients was 0.074 % (8/247, 95 % CI 0.0081-0.014). In the 44 orally examined patients, 6 (13.6 %: 6/44) had dental implants. Of these 6 patients, 1 developed BRONJ at the implant site. There were no significant differences in the age, total BP treatment period, number of residual teeth, time of regular oral monitoring, oral hygiene level, or dental implant insertion. Although a case of ONJ was identified, dental implants which were inserted before intravenous BP administration were not a risk factor for the development of ONJ in breast cancer patients.

  8. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  9. Extraction optimization and characterization of polysaccharide ...

    African Journals Online (AJOL)

    Keywords: Pinellia rhizoma, Polysaccharides Optimization extraction, Monosaccharide composition,. Antioxidant ..... mean yield of PRP was 2.47 %. Therefore ... Table 3: Analysis of variance (ANOVA) for the fitted quadratic polynomial model.

  10. 49 CFR 173.247 - Bulk packaging for certain elevated temperature materials.

    Science.gov (United States)

    2010-10-01

    ... reference to the axes of the transport vehicle. Each accelerative or decelerative load may be considered... packagings used for transportation of molten metals and molten glass by rail when movement is restricted to...

  11. 32 CFR Appendix D to Part 247 - AFIS Print Media Directorate

    Science.gov (United States)

    2010-07-01

    ... for word processing or desktop publishing. All other PMD publications should be requisitioned through... Directorate (PMD), an element of AFIS, develops, publishes, and distributes a variety of print media products.../defenselink/afis/. B. Use of materials published by print media directorate. With the exception of copyrighted...

  12. 40 CFR 761.247 - Sample site selection for pipe segment removal.

    Science.gov (United States)

    2010-07-01

    ... end of the pipe segment. (3) If the pipe segment is cut with a saw or other mechanical device, take..., take samples from a total of seven segments. (A) Sample the first and last segments removed. (B) Select... total length for purposes of disposal, take samples of each segment that is 1/2 mile distant from the...

  13. 48 CFR 252.247-7016 - Contractor liability for loss or damage.

    Science.gov (United States)

    2010-10-01

    ... the Contractor's negligence, indemnification shall be at a rate not to exceed sixty cents per pound per article. (ii) Negligent damage. When loss or damage is caused by the negligence of the Contractor...

  14. 32 CFR Appendix A to Part 247 - Funded Newspapers and Magazines

    Science.gov (United States)

    2010-07-01

    .... Funded publications shall not carry commercial advertising. As a service, the Funded newspaper may carry... 32 National Defense 2 2010-07-01 2010-07-01 false Funded Newspapers and Magazines A Appendix A to... (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt...

  15. : tous les projets | Page 247 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Asie du Sud-Est connaît une intensification rapide de l'agriculture qui entraîne des répercussions sur les ... Région: China, Indonesia, Thailand, Viet Nam ... Région: North of Sahara, South of Sahara, Ethiopia, Kenya, Tanzania, Sudan.

  16. Technical Findings, Lessons Learned, and Recommendations Resulting from the Helios Prototype Vehicle Mishap

    National Research Council Canada - National Science Library

    Noll, Thomas E; Ishmael, Stephen D; Henwood, Bart; Perez-Davis, Marla E; Tiffany, Geary C; Madura, John; Gaier, Matthew; Brown, John M; Wierzbanowski, Ted

    2007-01-01

    .... One configuration, designated HP01, was designed to operate at extremely high altitudes using batteries and high-efficiency solar cells spread across the upper surface of its 247-foot wingspan...

  17. Fulltext PDF

    Indian Academy of Sciences (India)

    Unknown

    Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Roorkee 247 667, India .... nucleation, dispersoids can also increase the rate of crack ... compounds allows the possibility of precracking during.

  18. Download this PDF file

    African Journals Online (AJOL)

    cptldesign4

    asymptomatic pregnant women attending Bugando Medical centre (BMC) in Mwanza, Tanzania. A total of 247 ... In conclusion, asymptomatic bacteriuria among pregnant women is .... Symptomatic patients were given treatment empirically ...

  19. Statistical analysis of long term spatial and temporal trends of ...

    Indian Academy of Sciences (India)

    Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. ∗. Corresponding author. e-mail: ..... adopting established meteorological techniques like ...... a decision support tool for the assessment of regional.

  20. Historie a současný stav urychlovačů částic v českých zemích. II. Kruhové urychlovače

    Czech Academy of Sciences Publication Activity Database

    Janovský, I.; Šimáně, Čestmír

    2012-01-01

    Roč. 62, č. 4 (2012), s. 239-247 ISSN 0009-0700 Institutional support: RVO:61389005 Keywords : accelerator history * cyclic accelerator s Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  1. Právnický elektronický slovník (PES)

    Czech Academy of Sciences Publication Activity Database

    Cvrček, František

    2015-01-01

    Roč. 154, č. 3 (2015), s. 247-260 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences

  2. 76 FR 55407 - Announcement of Funding Awards; Public and Indian Housing Family Self-Sufficiency Program Under...

    Science.gov (United States)

    2011-09-07

    ... Bowling Green 247 Double Springs Bowling Green........ KY 42101 47,740 Road. Housing Authority of Glasgow... Norman Street... Saginaw MI 48605 48,675 Housing and Redevelopment 442 Pine Mill Court.. Virginia MN...

  3. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals

  • 77 FR 14540 - Announcement of Funding Awards for the Public and Indian Housing Family Self-Sufficiency Program...

    Science.gov (United States)

    2012-03-12

    ... Authority of Bowling Green.... 247 Double Springs Road....... Bowling Green 42101 KY 42101 47,470 Housing... MI 49507 65,500 Saginaw Housing Commission 1803 Norman Street Saginaw 48605 MI 48605 48,675 Housing...

  • Defense Infrastructure: General and Flag Officer Quarters at Pearl Harbor, Hawaii

    National Research Council Canada - National Science Library

    2002-01-01

    .... We reviewed 17 GFOQs at Pearl Harbor, Hawaii, with budgeted maintenance and repair costs of $1,247,300, to determine whether the Navy had properly classified interior shutter costs as maintenance and repair...

  • Iron Chelation

    Science.gov (United States)

    ... U.S.A. Share. Social media brings us together 24/7. Join our online community where you can report, reflect, reconnect. Twitter Facebook LinkedIn YouTube Instagram Pinterest Sign Up. Your First ...

  • delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.

    2014-01-01

    Roč. 57, č. 1 (2014), s. 243-247 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014

  • Progesterone for the prevention of preterm birth in twin pregnancy (STOPPIT): a randomised, double-blind, placebo-controlled study and meta-analysis.

    Science.gov (United States)

    Norman, Jane E; Mackenzie, Fiona; Owen, Philip; Mactier, Helen; Hanretty, Kevin; Cooper, Sarah; Calder, Andrew; Mires, Gary; Danielian, Peter; Sturgiss, Stephen; MacLennan, Graeme; Tydeman, Graham; Thornton, Steven; Martin, Bill; Thornton, James G; Neilson, James P; Norrie, John

    2009-06-13

    Women with twin pregnancy are at high risk for spontaneous preterm delivery. Progesterone seems to be effective in reducing preterm birth in selected high-risk singleton pregnancies, albeit with no significant reduction in perinatal mortality and little evidence of neonatal benefit. We investigated the use of progesterone for prevention of preterm birth in twin pregnancy. In this double-blind, placebo-controlled trial, 500 women with twin pregnancy were recruited from nine UK National Health Service clinics specialising in the management of twin pregnancy. Women were randomised, by permuted blocks of randomly mixed sizes, either to daily vaginal progesterone gel 90 mg (n=250) or to placebo gel (n=250) for 10 weeks from 24 weeks' gestation. All study personnel and participants were masked to treatment assignment for the duration of the study. The primary outcome was delivery or intrauterine death before 34 weeks' gestation. Analysis was by intention to treat. Additionally we undertook a meta-analysis of published and unpublished data to establish the efficacy of progesterone in prevention of early (<34 weeks' gestation) preterm birth or intrauterine death in women with twin pregnancy. This study is registered, number ISRCTN35782581. Three participants in each group were lost to follow-up, leaving 247 analysed per group. The combined proportion of intrauterine death or delivery before 34 weeks of pregnancy was 24.7% (61/247) in the progesterone group and 19.4% (48/247) in the placebo group (odds ratio [OR] 1.36, 95% CI 0.89-2.09; p=0.16). The rate of adverse events did not differ between the two groups. The meta-analysis confirmed that progesterone does not prevent early preterm birth in women with twin pregnancy (pooled OR 1.16, 95% CI 0.89-1.51). Progesterone, administered vaginally, does not prevent preterm birth in women with twin pregnancy. Chief Scientist Office of the Scottish Government Health Directorate.

  • Fine-mapping of immunodominant linear B-cell epitopes of the Staphylococcus aureus SEB antigen using short overlapping peptides.

    Directory of Open Access Journals (Sweden)

    Zhuo Zhao

    Full Text Available Staphylococcal enterotoxin B (SEB is one of the most potent Staphylococcus aureus exotoxins (SEs. Due to its conserved sequence and stable structure, SEB might be a good candidate antigen for MRSA vaccines. Although cellular immune responses to SEB are well-characterized, much less is known regarding SEB-specific humoral immune responses, particularly regarding detailed epitope mapping. In this study, we utilized a recombinant nontoxic mutant of SEB (rSEB and an AlPO4 adjuvant to immunize BALB/c mice and confirmed that rSEB can induce a high antibody level and effective immune protection against MRSA infection. Next, the antisera of immunized mice were collected, and linear B cell epitopes within SEB were finely mapped using a series of overlapping synthetic peptides. Three immunodominant B cell epitopes of SEB were screened by ELISA, including a novel epitope, SEB205-222, and two known epitopes, SEB97-114 and SEB247-261. Using truncated peptides, an ELISA was performed with peptide-KLH antisera, and the core sequence of the three immunodominant B cell epitopes were verified as SEB97-112, SEB207-222, and SEB247-257. In vitro, all of the immunodominant epitope-specific antisera (anti-SEB97-112, anti-SEB207-222 and anti-SEB247-257 were observed to inhibit SEB-induced T cell mitogenesis and cytokine production from splenic lymphocytes of BALB/c mice. The homology analysis indicated that SEB97-112 and SEB207-222 were well-conserved among different Staphylococcus aureus strains. The 3D crystal structure of SEB indicated that SEB97-112 was in the loop region inside SEB, whereas SEB207-222 and SEB247-257 were in the β-slice region outside SEB. In summary, the fine-mapping of linear B-cell epitopes of the SEB antigen in this study will be useful to understand anti-SEB immunity against MRSA infection further and will be helpful to optimize MRSA vaccine designs that are based on the SEB antigen.

  • Creutzfeldt-Jakob Disease

    Science.gov (United States)

    ... in the chromosome 20 gene coding the biological blueprint for prion protein. People who develop familial CJD ... other dementias, and help you find local support services. Call our 24/7 Helpline at 800.272. ...

  • Bezradnost metodologie kosmologie?

    Czech Academy of Sciences Publication Activity Database

    Havlík, Vladimír

    2015-01-01

    Roč. 63, č. 2 (2015), s. 247-266 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : methodology of science * anomalies * dark energy * dark matter * I. Lakatos * T. Kuhn Subject RIV: AA - Philosophy ; Religion

  • Ghana Journal of Geography: Submissions

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... The title page should include: The name(s) of the author(s); A concise and informative ... General Guide ... Journal of Database Marketing & Customer Strategy Management, 17, 247 – 256.

  • Statistical downscaling and projection of future temperature and ...

    Indian Academy of Sciences (India)

    2Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. 3Department of .... Generator (SWG) based downscaling methods .... It receives water ...... A decision support tool for the assessment of regional cli-.

  • TAX REFORMS AND INVESTMENT IN NIGERIA: AN EMPIRICAL ...

    African Journals Online (AJOL)

    GRACE

    Tax generated revenues are used to finance public utilities, perform social responsibilities and grease the ..... Capital Theory and Investment Behaviours, The American Review,. 53:247-257. ... ESUT Journal of Accounting, 5(2). December ...

  • Odraz vrcholně středověké urbanizace v archeologických pramenech na základě vybraných příkladů

    Czech Academy of Sciences Publication Activity Database

    Procházka, Rudolf

    2010-01-01

    Roč. 2010, č. 51 (2010), s. 209-247 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : medieval towns * pre-urban settlements * central Europe Subject RIV: AC - Archeology, Anthropology, Ethnology

  • Synthesis and characterization of electroless Ni–P coated graphite ...

    Indian Academy of Sciences (India)

    Wintec

    Metallurgical and Materials Engineering Department, Indian Institute of Technology Roorkee, Roorkee 247 667, India ... the chemical composition of the bath was also reported ..... viour of electroless Ni–P films, Ph.D. Thesis, University of.

  • Sputtering and emission intensity of cast irons with different metallurgical structures in a Grimm glow lamp

    International Nuclear Information System (INIS)

    Fujita, M.; Kashima, J.; Naganuma, K.

    1981-01-01

    The cathodic sputtering and emission intensities for the white, gray and malleable cast irons in the Grimm glow lamp are discussed. The intensities of the Fe 247.98-nm line for the samples of the three types depend linearly on the electrical power but the slopes of the plots differ. The intensity of the carbon line at 247.86 nm for malleable cast iron is weaker than those for the others. Sputtering is influenced by the form of the graphite, which can lead to distortion of the electrical field. Graphite on malleable cast iron is sputtered not only as atomic carbon but also as moieties containing several carbon atoms. The higher the supplied voltage, the shorter the time for the intensities of the Fe I and C I lines to reach constant values. (Auth.)

  • Antagonistic effects of three species of Trichoderma sp. on ...

    African Journals Online (AJOL)

    Francis

    This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.

  • Present and future water resources in India: Insights from satellite ...

    Indian Academy of Sciences (India)

    C climate change (although the range of model results, 247 mm/year, demonstrates high ... may subsequently influence the longevity of the local groundwater resource. However, at recent .... cloud cover fraction (all detrended prior to 1901),.

  • 2018-05-13T09:08:56Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    ... carbon footprint, green and blue water, human nutrition, production systems, ... is a major contributor to global warming resulted mainly from the FAO publication, ... animal production, from environment to human health; 247-254 2221-4062 ...

    1. 76 FR 56724 - Proposed Flood Elevation Determinations

      Science.gov (United States)

      2011-09-14

      ... Town of Clarkstown. Hackensack River confluence. At the upstream side of +248 +247 Little Tor Road... Emergency Management Agency. [FR Doc. 2011-23413 Filed 9-13-11; 8:45 am] BILLING CODE 9110-12-P ...

    2. A quantification of discharge readiness after outpatient anaesthesia ...

      African Journals Online (AJOL)

      Adele

      RESEARCH. Southern ... Nurses and patients were blinded to each other's assessments . ... and, 3) time to discharge readiness according to nursing assessments. .... Male/ Female. 69/125. 36/64. Ethnicity: Caucasian. 132. 68. Asian. 48. 24.7.

    3. Schizophrenia

      Science.gov (United States)

      ... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...

    4. Tardive Dyskinesia

      Science.gov (United States)

      ... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...

    5. Managing Diabetes: New Technologies Can Make It Easier

      Science.gov (United States)

      ... Epub ahead of print]. PMID: 28855239. 12-Week 24/7 Ambulatory Artificial Pancreas With Weekly Adaptation of Insulin ... nih.gov/wellnesstoolkits . Footer Subscribe Find us on Facebook RSS Home Past Issues About Us Privacy Accessibility ...

    6. Psychosis

      Science.gov (United States)

      ... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...

    7. Statistical analysis of long term spatial and temporal trends of ...

      Indian Academy of Sciences (India)

      Statistical analysis of long term spatial and temporal trends of temperature ... CGCM3; HadCM3; modified Mann–Kendall test; statistical analysis; Sutlej basin. ... Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 ...

    8. Trematodes of fishes of the Indo-west Pacific: told and untold richness

      Czech Academy of Sciences Publication Activity Database

      Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.

      2016-01-01

      Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016

    9. Communication, timing, and common learning

      Czech Academy of Sciences Publication Activity Database

      Steiner, Jakub; Stewart, C.

      2011-01-01

      Roč. 146, č. 1 (2011), s. 230-247 ISSN 0022-0531 Institutional research plan: CEZ:AV0Z70850503 Keywords : common knowledge * learning * communication Subject RIV: AH - Economics Impact factor: 1.235, year: 2011

    10. Journal of Earth System Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Author Affiliations. Pravin K Gupta1 Sri Niwas1 Neeta Chaudhary2. Department of Earth Sciences, Indian Institute of Technology Roorkee, Roorkee 247 667, India. Oil and Natural Gas Corporation, Priyadarshini Building, Sion, Mumbai, India.

    11. Bulletin of Materials Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Author Affiliations. Abdulhaqq A Hamid1 2 Rafi K Yahya1. Mechanical Engineering Department, College of Engineering, University of Mosul, Mosul, Iraq; Mechanical and Industrial Engineering Department, Indian Institute of Technology, Roorkee 247 667, India ...

    12. 78 FR 20324 - Proposed Information Collection Activity: Comment Request

      Science.gov (United States)

      2013-04-04

      ... leadership/ managers, instructional staff, case managers/advisors, partners and employers; (d) a brief survey... (including program leadership, case managers and instructional staff), and other local informants. Annual....083 247 82 Survey, Additional HPOG Questions [[Page 20325

    13. Older Adults and Mental Health

      Science.gov (United States)

      ... counselor at a crisis center in your area 24/7. Disaster Distress Helpline : People affected by natural or ... MSC 9663 Bethesda, MD 20892-9663 Follow Us Facebook Twitter YouTube Google Plus NIMH Newsletter NIMH RSS ...

    14. End of Life Care (Brain Tumors)

      Science.gov (United States)

      ... download a template for your state from the Internet. Words on the template can be inserted or ... for free and have access to the site 24/7. Visit Connections TrialConnect™ links patients with appropriate clinical ...

    15. Mechanisms of pH change in wood ant (.i.Formica polyctena./i.) nests

      Czech Academy of Sciences Publication Activity Database

      Jílková, Veronika; Šebek, O.; Frouz, J.

      2012-01-01

      Roč. 55, č. 5 (2012), s. 247-251 ISSN 0031-4056 Institutional research plan: CEZ:AV0Z60660521 Keywords : basic cations * glucose * honeydew Subject RIV: EH - Ecology, Behaviour Impact factor: 1.690, year: 2012

    16. Sampling for ants in different-aged spruce forests: A comparison of methods

      Czech Academy of Sciences Publication Activity Database

      Véle, A.; Holuša, J.; Frouz, Jan

      2009-01-01

      Roč. 45, č. 4 (2009), s. 301-305 ISSN 1164-5563 Institutional research plan: CEZ:AV0Z60660521 Keywords : ants * baits * methods comparison Subject RIV: EH - Ecology, Behaviour Impact factor: 1.247, year: 2009

    17. Enhancing parallelism of tile bidiagonal transformation on multicore architectures using tree reduction

      KAUST Repository

      Ltaief, Hatem; Luszczek, Piotr R.; Dongarra, Jack

      2012-01-01

      The objective of this paper is to enhance the parallelism of the tile bidiagonal transformation using tree reduction on multicore architectures. First introduced by Ltaief et. al [LAPACK Working Note #247, 2011], the bidiagonal transformation using

    18. Kunstiakadeemia uus õppehoone kõrgub õhuliselt vana maja kohale / Ants Juske, Mari Kodres

      Index Scriptorium Estoniae

      Juske, Ants, 1956-2016

      2008-01-01

      Eesti Kunstiakadeemia uue hoone arhitektuurivõistlusest ja võidutööst "Art Plaza"(Taani arhitektuuribüroo Effekt). Võistlustöödest "TLN247" (II koht), "Arts Factory" (III koht), "Public Section" (ergutuspreemia) ja "Sashimi" (ergutuspreemia)

    19. Isolation and characterization of twenty-five polymorphic ...

      Indian Academy of Sciences (India)

      markers in Siniperca scherzeri Steindachner and cross-species amplification. J. Genet. .... ACT. AGT. AGTGTGTGCAAGT. AGA. 188–247. 55. 8. 0.875. 0.8185. 0.7804. 0.2352. R: .... diversity and population structure of the endangered Spanish.

    20. ORF Alignment: NC_006677 [GENIUS II[Archive

      Lifescience Database Archive (English)

      Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

    1. Progressive rod-cone degeneration (PRCD) in selected dog breeds and variability in its phenotypic expression

      Czech Academy of Sciences Publication Activity Database

      Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel

      2011-01-01

      Roč. 56, č. 5 (2011), s. 243-247 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011

    2. Alzheimer's Disease Facts and Figures

      Medline Plus

      Full Text Available ... on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...

    3. Naegleria

      Science.gov (United States)

      ... Work: Naegleria fowleri CDC at Work: On Call 24/7 Healthy Water Sites Healthy Water Drinking Water Healthy ... Information Language: English (US) Español (Spanish) Recommend on Facebook Tweet Share Compartir Frequently Asked Questions What is ...

    4. Progress has Stalled in U.S. Stroke Death Rates after Decades of Decline

      Science.gov (United States)

      ... Resistance Cancer Cardiovascular Disease CDC Works for you 24/7 Child Development Disease & Conditions Food Safety Healthcare Associated ... outcomes Language: English (US) Español (Spanish) Recommend on Facebook Tweet Share Compartir Press Release Embargoed Until: Wednesday, ...

    5. AFRREV IJAH, Vol.2 (1) February, 2012

      African Journals Online (AJOL)

      user

      formidable force for governance and the people had great respect for it. Commendably, the rule ... not only revered but wielded unreserved influence on their subjects. .... in Asemah (2010, p.247) defines Public Relations as ―winning friends,.

    6. Alzheimer's Disease Facts and Figures

      Medline Plus

      Full Text Available ... is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find ... Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | About this Site | Privacy Policy | ...

    7. Decline in snowfall in response to temperature in Satluj basin ...

      Indian Academy of Sciences (India)

      The study also consists an analysis of average values of annual snowfall and temperature ... During the study, it was observed that the snowfall exhibited declining trends in the basin. ... National Institute of Hydrology, Roorkee 247 667, India.

    8. A Capacitance-Based Methodology for the Estimation of Piezoelectric Coefficients of Poled Piezoelectric Materials

      KAUST Repository

      Al Ahmad, Mahmoud; Alshareef, Husam N.

      2010-01-01

      A methodology is proposed to estimate the piezoelectric coefficients of bulk piezoelectric materials using simple capacitance measurements. The extracted values of d33 and d31 from the capacitance measurements were 506 pC/N and 247 p

    9. Comments on "Design of Entrained-Flow and Moving-, Packed-, and Fluidized-Bed Sorption Systems: Grain-Model Kinetics for Hot Coal-Gas Desulfurization with Limestone"

      Czech Academy of Sciences Publication Activity Database

      Hartman, Miloslav; Svoboda, Karel; Trnka, Otakar

      2002-01-01

      Roč. 41, - (2002), s. 1914-1915 ISSN 0888-5885 Institutional research plan: CEZ:AV0Z4072921 Keywords : hydrogen sulfide * calcium oxide * coal gas Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.247, year: 2002

    10. Microstructure and oxidation performance of a γ–γ′ Pt-aluminide ...

      Indian Academy of Sciences (India)

      Microstructure and oxidation performance of a –' Pt-aluminide bond coat on directionally solidified superalloy CM-247LC ... Keywords. Platinum aluminide bond coat; coating; cyclic oxidation; superalloy; microstructure. ... Defence Metallurgical Research Laboratory, Kanchanbagh, Hyderabad 500 058, India ...

    11. Banach spaces with projectional skeletons

      Czech Academy of Sciences Publication Activity Database

      Kubiś, Wieslaw

      2009-01-01

      Roč. 350, č. 2 (2009), s. 758-776 ISSN 0022-247X Institutional research plan: CEZ:AV0Z10190503 Keywords : projection * projectional skeleton * norming set Subject RIV: BA - General Mathematics Impact factor: 1.225, year: 2009

    12. Basal metabolic rate scaled to body mass between species by the ...

      African Journals Online (AJOL)

      Marlene Botha

      2017-03-19

      Mar 19, 2017 ... whole body fractal vascular dimension D is also applicable to all organs or ... slices, mitochondrial surface areas, and blood oxygen transport. ... Sci. vol. 47. 247. Results and Discussion. The principle of self-similarity implies ...

    13. Head Injury and Dizziness

      Science.gov (United States)

      ... was developed by subject matter experts from the Defense Department and Department of Veterans Affairs. (Revised January 2018) ... to Improve Your Memory Crisis Intervention (24/7) Department of ... Contact Us Terms and Conditions Privacy and Security Freedom of ...

    14. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1992

      International Nuclear Information System (INIS)

      1993-08-01

      The results of the joint researches by utilizing the facilities of JAERI in 1992 fiscal year were summarized. The number of research themes in 1992 was 247 cases. In this book, 166 reports are collected. (J.P.N.)

    15. Bulletin of Materials Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Author Affiliations. RAVI KANT1 UJJWAL PRAKASH1 VIJAYA AGARWALA1 V V SATYA PRASAD2. Department of Metallurgical and Materials Engineering, IIT Roorkee, Roorkee 247 667, India; Defence Metallurgical Research Laboratory, Kanchanbagh, Hyderabad 500 058, India ...

    16. a case study of Ede north local government workers.

      African Journals Online (AJOL)

      ABEOLUGBENGAS

      Risky behaviours and attitudes of healthy Nigerians towards kidney failure: a case ... attitudes of healthy populace of workers of Ede North Local Government Area of Osun State, Nigeria. .... exercise 247 (74.6%), use of alcohol 239 (72.2%).

    17. Proceedings of the Second Environmental Physics Conference (EPC-2006)

      International Nuclear Information System (INIS)

      Comsan, M.N.H.

      2007-01-01

      The publication has been set up as proceedings of the environmental physics conference. the conference consistes of atmospere and climate; the ecosystem; radiation and radioactivity; activity review; environmental issues. This conference consistes of 247p., figs., tabs., refs

    18. 0-6621 : developing a mixture-based specification for flexible base.

      Science.gov (United States)

      2012-08-01

      The Texas Department of Transportation : (TxDOT) currently utilizes Item 247, Flexible : Base, to specify a foundation course of flexible : base utilized in a pavement. Base materials are : not allowed to be used by the contractors until : the ...

    19. NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS (NESHAP) SUBPART H RADIONUCLIDES POTENTIAL TO EMIT CALCULATIONS

      Energy Technology Data Exchange (ETDEWEB)

      EARLEY JN

      2008-07-23

      This document provides an update of the status of stacks on the Hanford Site and the potential radionuclide emissions, i.e., emissions that could occur with no control devices in place. This review shows the calculations that determined whether the total effective dose equivalent (TEDE) received by the maximum public receptor as a result of potential emissions from any one of these stacks would exceed 0.1 millirem/year. Such stacks require continuous monitoring of the effluent, or other monitoring, to meet the requirements of Washington Administrative code (WAC) 246-247-035(1)(a)(ii) and WAC 246-247-075(1), -(2), and -(6). This revised update reviews the potential-to-emit (PTE) calculations of 31 stacks for Fluor Hanford, Inc. Of those 31 stacks, 11 have the potential to cause a TEDE greater than 0.1 mrem/year.

    20. NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS (NESHAP) SUBPART H; RADIONUCLIDES POTENTIAL-TO-EMIT CALCULATIONS

      International Nuclear Information System (INIS)

      EARLEY JN

      2008-01-01

      This document provides an update of the status of stacks on the Hanford Site and the potential radionuclide emissions, i.e., emissions that could occur with no control devices in place. This review shows the calculations that determined whether the total effective dose equivalent (TEDE) received by the maximum public receptor as a result of potential emissions from any one of these stacks would exceed 0.1 millirem/year. Such stacks require continuous monitoring of the effluent, or other monitoring, to meet the requirements of Washington Administrative code (WAC) 246-247-035(1)(a)(ii) and WAC 246-247-075(1), -(2), and -(6). This revised update reviews the potential-to-emit (PTE) calculations of 31 stacks for Fluor Hanford, Inc. Of those 31 stacks, 11 have the potential to cause a TEDE greater than 0.1 mrem/year

    1. Discussion of percutanous nephrostomy technique with prevention and treatment of complications

      International Nuclear Information System (INIS)

      Zhang Zefu; Liang Huiming; Zheng Chuansheng; Wu Hanpin; Zhou Guofeng

      2008-01-01

      Objective: To analyze the complications and treatment technique of percutaneous nephrostomy. Methods: 247 hydronephrosis eases treated with percutaneous nephrostomy guided by ultrosound and fluroseopy flora Januray 2007 to April 2008 were evaluated retrospectively and the causes of complications and suitable treatments were analyzed. Results: The successful rate of percutaneous nephrostomy in 247 hydronephrotic cases reached 100%. In all cases, 4 cases occurred with severe complications (1.6%) including 3 massive hemorrhage and 1 septic shock during the operation. The minor complications (25 cases, 10% ) were hematuria, urinary tract infection, local haematoma, perirenal haematoma, detachment of drainage tube with obstruction and exodus, internal double-J catheter displacement and obstruction, etc. Conclusion: The operative safety and treatment efficacy of percutaneous nephrostomy could be achieved through skillful management and comprehensive preoperative evaluation of the risk factors for the complications. (authors)

    2. Measuring seasonal variations of moisture in a landfill with the partitioning gas tracer test

      International Nuclear Information System (INIS)

      Han, Byunghyun; Jafarpour, Behnam; Gallagher, Victoria N.; Imhoff, Paul T.; Chiu, Pei C.; Fluman, Daniel A.

      2006-01-01

      Seven pilot-scale partitioning gas tracer tests (PGTTs) were conducted to assess the accuracy and reproducibility of this method for measuring water in municipal solid waste landfills. Tests were conducted in the same location over a 12-month period, and measured moisture conditions ranged from possible dry waste to refuse with a moisture content of 24.7%. The final moisture content of 24.7% was in reasonable agreement with gravimetric measurements of excavated refuse, where the moisture content was 26.5 ± 6.0CI%. Laboratory tests were used to assess the utility of the PGTT for measuring water in small pores, water sorbed to solid surfaces, and the influence of dry waste on PGTTs. These experiments indicated that when refuse surfaces are not completely solvated with water, PGTTs may produce misleading results (negative estimates) of water saturation and moisture content

    3. Helicopter emergency medical service patient transport safe at night?

      NARCIS (Netherlands)

      Peters, J.H.; Wageningen, B. van; Hoogerwerf, N.; Biert, J.

      2014-01-01

      OBJECTIVE: Dutch helicopter emergency medical services are available 24/7. Working without daylight brings additional challenges, both in patient care and in-flight operation. We retrospectively evaluated the safety of this nighttime helicopter transportation of patients. METHODS: Our helicopter

    4. Alzheimer's Disease Facts and Figures

      Medline Plus

      Full Text Available ... were diagnosed in the mild cognitive impairment (MCI) stage — before dementia — it would collectively save $7 trillion ... symptoms What is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: ...

    5. Huttonia spicata (Sternberg) emend. and its spores, the Radnice Basin (Bolsovian), Carboniferous continental basins of the Czech Republic

      Czech Academy of Sciences Publication Activity Database

      Libertín, M.; Bek, Jiří

      2004-01-01

      Roč. 128, 3/4 (2004), s. 247-261 ISSN 0034-6667 R&D Projects: GA AV ČR(CZ) IAA3013902 Keywords : Huttonia * in situ spores * sphenopsids Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.886, year: 2004

    6. Home range of Noack's round-leaf bat (Hipposideros aff. ruber) in an agricultural landscape of central Ghana

      Czech Academy of Sciences Publication Activity Database

      Nkrumah, E. E.; Vallo, Peter; Klose, S. M.; Ripperger, S.; Badu, E. K.; Drosten, C.; Kalko, E. K. V.; Tschapka, M.; Oppong, S. K.

      2016-01-01

      Roč. 18, č. 1 (2016), s. 239-247 ISSN 1508-1109 Institutional support: RVO:68081766 Keywords : core area * foraging area * local convex hull * maximum foraging distance * radio-tracking Subject RIV: EG - Zoology Impact factor: 1.040, year: 2016

    7. Muzejní zlomek s opisem Evangelia sv. Matouše s homiliemi

      Czech Academy of Sciences Publication Activity Database

      Voleková, Kateřina

      2017-01-01

      Roč. 140, 1/2 (2017), s. 247-257 ISSN 0024-4457 R&D Projects: GA ČR GA15-06405S Institutional support: RVO:68378092 Keywords : Old Czech * Bible * translation * manuscript Subject RIV: AI - Linguistics OBOR OECD: Linguistics

    8. Large-Scale Systems Control Design via LMI Optimization

      Czech Academy of Sciences Publication Activity Database

      Rehák, Branislav

      2015-01-01

      Roč. 44, č. 3 (2015), s. 247-253 ISSN 1392-124X Institutional support: RVO:67985556 Keywords : Combinatorial linear matrix inequalities * large-scale system * decentralized control Subject RIV: BC - Control Systems Theory Impact factor: 0.633, year: 2015

    9. Characterization and evaluation of stress and heavy metal tolerance ...

      African Journals Online (AJOL)

      STORAGESEVER

      2009-05-18

      May 18, 2009 ... mol purpurogallin formed/mg protein/min) using ε 2.47/mM/cm at. 230 nm for purpurogallin. The ascorbate .... Hydrogen sulphide test ..... stress tolerant Bacillus thuringiensis, in partially anaerobic rice field soils during post ...

    10. The rhetorical function of references to angels in the Main Letters of ...

      African Journals Online (AJOL)

      Test

      2011-06-07

      Jun 7, 2011 ... (1984:245–247), Morland (1995:148–149), Kremendahl (2000:83) and ..... gender-related roles that he links to creation (cf. dia; tou`to ..... Carr, W., 1981, Angels and principalities: The background, meaning and development.

    11. The use of the psychological contract to explain self-perceived employability

      NARCIS (Netherlands)

      Sok, J.; Blomme, R.J.; Tromp, D.M.

      2013-01-01

      This study examines the relationship between the psychological contract and self-perceived employability (intra-organizational mobility intentions, employee development and perceived labor market opportunities). A survey was completed by 247 alumni of the Hotelschool The Hague, a hotel management

    12. Effect of pollution control on corporate financial performance in a transition economy

      Czech Academy of Sciences Publication Activity Database

      Earnhart, D.; Lízal, Lubomír

      2007-01-01

      Roč. 17, č. 4 (2007), s. 247-266 ISSN 0961-0405 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : Czech Republic * environmental protection * financial performance Subject RIV: AH - Economics

    13. ORF Alignment: NC_003070 [GENIUS II[Archive

      Lifescience Database Archive (English)

      Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

    14. ORF Alignment: NC_003070 [GENIUS II[Archive

      Lifescience Database Archive (English)

      Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

    15. Neumann and Robin problems in a cracked domain with jump conditions on cracks

      Czech Academy of Sciences Publication Activity Database

      Medková, Dagmar; Krutitskii, P.

      2005-01-01

      Roč. 301, č. 1 (2005), s. 99-114 ISSN 0022-247X Institutional research plan: CEZ:AV0Z10190503 Keywords : Laplace equation * crack * single layer potential Subject RIV: BA - General Mathematics Impact factor: 0.579, year: 2005

    16. Nonlinear models of suspension bridges

      Czech Academy of Sciences Publication Activity Database

      Malík, Josef

      2006-01-01

      Roč. 321, č. 2 (2006), s. 828-850 ISSN 0022-247X Institutional research plan: CEZ:AV0Z30860518 Keywords : suspension bridges * principle of minimum energy Subject RIV: BA - General Mathematics Impact factor: 0.758, year: 2006

    17. 77 FR 76522 - Notice of Quarterly Report (July 1, 2012-September 30, 2012)

      Science.gov (United States)

      2012-12-28

      ... week. Restructure and rehabilitate primary and secondary pipelines (kilometers). Restructure and...). Screening for hypertension (percent). Awareness of working population related to noncommunicable disease... satisfactory or better. Secondary National Roads $213,412,526 Reduce $15,863,247 Motorized traffic time...

    18. Alzheimer's Disease Facts and Figures

      Medline Plus

      Full Text Available ... date on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...

    19. Development of a specification for flexible base construction.

      Science.gov (United States)

      2014-01-01

      The Texas Department of Transportation (TxDOT) currently uses Item 247 Flexible Base to specify a : pavement foundation course. The goal of this project was to evaluate the current method of base course : acceptance and investigate methods to r...

    20. 27 CFR 24.247 - Materials authorized for the treatment of distilling material.

      Science.gov (United States)

      2010-04-01

      ... fermentable carbohydrates The amylase enzyme activity shall be derived from Aspergillus niger, Aspergillus... starches to fermentable carbohydrates The amylase enzyme actvity shall be derived from Aspergillus niger or Aspergillus oryzae per FDA advisory opinion dated 8/18/83 or from Rhizopus oryzae per 21 CFR 173.130 or from...

    1. Nuclear engineering 24/7 via distance learning: Course development and management experiences

      International Nuclear Information System (INIS)

      Maldonado, G. I.; Christenson, J.; Spitz, H.; Rutz, E.; Todd, A.

      2006-01-01

      This article summarizes a few lessons learned in our early experiences in developing, delivering and implementing a series of distance learning classes for full-time undergraduate students enrolled in the combined-degree BS Mechanical + MS Nuclear Engineering 5-year and co-op based 'MNE- ACCEND' program at the Univ. of Cincinnati. This program is in its third year since inception and currently hosts approximately 35 undergraduate students enrolled in the graduating classes of 2008, 2009, and 2010, which is when these students are expected to complete their BS Mechanical and MS Nuclear Engineering degrees. In addition, 20+ newly confirmed students are expected to enter this program in the fall quarter of 2006 to become our Class of 2011. Therefore, the successful 'follow through' of the DL component of this program continues to be increasingly crucial as this student pipeline reaches a targeted steady-state of about 10 to 15 graduates per class. (authors)

    2. S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...

      African Journals Online (AJOL)

      In the case of sheep the treatment of OF-collected samples (total extrusa vs. solid frac- tion) had a significant ... of laboratory drying equipment, is discussed. Oesophageally ..... Chemistry of browning reactions in model system. J. Agric. Food ...

    3. 76 FR 25534 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers

      Science.gov (United States)

      2011-05-05

      ... 5 p.m., Monday through Friday, except Federal holidays. The AD docket contains this AD, the... through FR2279 inclusive, FR 2398, FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, installed. Propeller blades reworked to Hamilton Sundstrand Service...

    4. 76 FR 7101 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers

      Science.gov (United States)

      2011-02-09

      ..., except Federal holidays. The AD docket contains this AD, the regulatory evaluation, any comments received... blades part number (P/N) 817370-1, S/Ns FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, before December 31, 2010. We determined that those S/N...

    5. 7 CFR 247.25 - Allowable uses of administrative funds and other funds.

      Science.gov (United States)

      2010-01-01

      ... subgrantees must comply with part 3019 of this title. State and local agencies may use procurement procedures... authority regarding the settlement of all contractual and administrative issues arising out of procurements... administrative funds provided to State and local agencies? Administrative funds may be used for costs that are...

    6. 28 CFR 2.47 - Warrant placed as a detainer and dispositional review.

      Science.gov (United States)

      2010-07-01

      ... notified of his right to request counsel under the provisions of § 2.48(b) to assist him in completing this... original sentence is not interrupted by a new conviction (e.g., YCA; NARA; Mexican or Canadian treaty cases...

    7. Isolation and Characterization of Starches from eight Dioscorea ...

      African Journals Online (AJOL)

      AJB SERVER

      2006-09-04

      Sep 4, 2006 ... granules were predominantly ellipsoidal in shape with only Renta yam and ... of the different Dioscorea alata starches may prove useful in ... Vitamin C content ranging from 13.0 to 24.7 mg/100 g .... 1530 Afr. J. Biotechnol.

    8. 76 FR 64358 - National Institute of Diabetes and Digestive and Kidney Diseases; Notice of Closed Meeting

      Science.gov (United States)

      2011-10-18

      ... Diabetes and Digestive and Kidney Diseases Special Emphasis Panel, PAR09-247: Ancillary Studies in Liver... Diabetes and Digestive and Kidney Diseases; Notice of Closed Meeting Pursuant to section 10(d) of the... Assistance Program Nos. 93.847, Diabetes, [[Page 64359

    9. Animal Production Research Advances - Vol 6, No 4 (2010)

      African Journals Online (AJOL)

      Packed Cell Volume as an Indicator of Camel Trypanosomosis in the Sudan · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AM Ibrahim, AA Ismail, AA Majid, HS Sidig, ME Osman, AH Rahman, 247-251 ...

    10. Česká fyzikální chemie za Bohuslava Raýmana

      Czech Academy of Sciences Publication Activity Database

      Jindra, Jiří

      2011-01-01

      Roč. 3, č. 2 (2011), s. 232-247 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80630520 Keywords : B. Raýman 1852-1910 * education on physical chemistry in Prague * period 1882-1911 Subject RIV: AB - History

    11. Muscular disease

      Institute of Scientific and Technical Information of China (English)

      2009-01-01

      2009252 Investigation on survival motor neuron gene deletion in Chinese patients with sporadic amyotrophic lateral sclerosis.SU Zongquan(苏宗权),et al.Dept Neurol,1st Affili Hosp,Fujian Med,Fuzhou 350005.Chin J Neurol,2009;42(4):245-247.

    12. EST Table: BY918756 [KAIKOcDNA[Archive

      Lifescience Database Archive (English)

      Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] 10/08/29 54 %/247 aa FBpp0120238|DanaGF170... similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 F1mg ...

    13. The Integral Equation Method and the Neumann Problem for the Poisson Equation on NTA Domains

      Czech Academy of Sciences Publication Activity Database

      Medková, Dagmar

      2009-01-01

      Roč. 63, č. 21 (2009), s. 227-247 ISSN 0378-620X Institutional research plan: CEZ:AV0Z10190503 Keywords : Poisson equation * Neumann problem * integral equation method Subject RIV: BA - General Mathematics Impact factor: 0.477, year: 2009

    14. ORF Alignment: NC_005126 [GENIUS II[Archive

      Lifescience Database Archive (English)

      Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

    15. 37 CFR 1.52 - Language, paper, writing, margins, compact disc specifications.

      Science.gov (United States)

      2010-07-01

      ... style having capital letters which should be at least 0.3175 cm. (0.125 inch) high, but may be no...; 35 U.S.C. 6, Pub. L. 97-247; 15 U.S.C. 1113, 1123) Editorial Note: For Federal Register citations...

    16. A new species of Bothriocephalus Rudolphi, 1808 (Eucestoda: Bothriocephalidea) from the channel bull blenny Cottoperca gobio (Günther) (Perciformes: Bovichtidae) on the Patagonian shelf off Argentina

      Czech Academy of Sciences Publication Activity Database

      Gil de Pertierra, A.A.; Arredondo, N.J.; Kuchta, Roman; Incorvaia, I.S.

      2015-01-01

      Roč. 90, č. 3 (2015), s. 247-256 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Cestoda * fishes * parasites Subject RIV: EG - Zoology Impact factor: 1.316, year: 2015

    17. 1 Evaluation of the antioxidant activity of citrus flavedo extracts in ...

      African Journals Online (AJOL)

      2015-07-10

      Jul 10, 2015 ... mayonnaise prepared from unstripped soybean oil and in bulk unstripped soybean oil. .... soybean oil to obtain 0.02% (m/m) BHT or 0.2% (m/m) citrus flavedo extract in ..... Journal of Chromatography A 705, 247-256.

    18. Augener & Co., London - neznámý Dvořákův nakladatel

      Czech Academy of Sciences Publication Activity Database

      Matějčková, Helena

      2012-01-01

      Roč. 49, č. 3 (2012), s. 247-266 ISSN 0018-7003 R&D Projects: GA ČR GA408/08/1020 Institutional support: RVO:68378076 Keywords : Dvořák * publishers * London Subject RIV: AL - Art, Architecture, Cultural Heritage

    19. The National Network of Libraries of Medicine

      Science.gov (United States)

      ... journals and other resources. But thanks to the Internet, people around the country can access an amazing amount of reliable health information from home, work or school, free of charge, 24/7. And the National Network of Libraries of Medicine ( ...

    20. Associative Ionization of Excited Sodium Species with Various Ligands: Assessing Relative Bonding Strengths of Ion-ligand Interactions

      Czech Academy of Sciences Publication Activity Database

      Gilligan, J. J.; McCunn, L. R.; Leskiw, B. D.; Herman, Zdeněk; Castleman Jr., A. W.

      2001-01-01

      Roč. 204, 1/3 (2001), s. 247-253 ISSN 1387-3806 Institutional research plan: CEZ:AV0Z4040901 Keywords : associative ionization * cluster ions * sodium bonding energies Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.176, year: 2001

    1. The Prevalence of Enterhaemorrhagic Escherichia Coli in children ...

      African Journals Online (AJOL)

      EHEC), the pathogenicity of other strains of Escherichia coli and other organisms in children presenting with and without diarrhoea in the hospital. Subjects and Methods: A total of 247 stool samples collected from children aged 1 month to 7 ...

    2. Projected climate change impacts on skiing and snowmobiling: A case study of the United States

      Science.gov (United States)

      A physically-based water and energy balance model is used to simulate natural snow accumulation at 247 winter recreation locations across the continental United States. We combine this model with projections of snowmaking conditions to determine downhill skiing, cross-country ski...

    3. Clean Hands Count

      Medline Plus

      Full Text Available ... News 581,131 views 18:49 Just Good Music 24/7 ● Classic Live Radio classics. 1,406 ... 611,013 views 1:46 Hand hygiene FULL music video - Duration: 2:33. AlfredHealthTV 26,798 views ...

    4. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

      Directory of Open Access Journals (Sweden)

      Vaščić, V.

      2007-04-01

      Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

    5. African Journal of Biotechnology - Vol 14, No 3 (2015)

      African Journals Online (AJOL)

      Phytosynthesis of eco-friendly silver nanoparticles and biological applications –A novel concept in nanobiotechnology · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MC Reddy, KSR Murthy, A Srilakshmi, KRS Sambasiva Rao, T Pullaiah, 222-247.

    6. Dicty_cDB: CFG349 [Dicty_cDB

      Lifescience Database Archive (English)

      Full Text Available its) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, com...060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 247 4e-64 DQ985464_1( DQ985464 |pid:none) S

    7. File list: Pol.Epd.50.RNA_polymerase_II.AllCell [Chip-atlas[Archive

      Lifescience Database Archive (English)

      Full Text Available Pol.Epd.50.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...247,SRX080162,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.50.RNA_polymerase_II.AllCell.bed ...

    8. The accelerator facility of the Heidelberg Ion-Beam Therapy Centre (HIT)

      Science.gov (United States)

      Peters, Andreas

      The following sections are included: * Introduction * Beam parameters * General layout of the HIT facility * The accelerator chain in detail * Operational aspects of a particle therapy facility * 24/7 accelerator operation at 335 days per year * Safety and regulatory aspects * Status and perspectives * References

    9. Escherichia coli bacteraemia in patients with and without haematological malignancies

      DEFF Research Database (Denmark)

      Olesen, B; Kolmos, H J; Orskov, F

      1998-01-01

      We compared serotypes, virulence factors and susceptibility to antibiotics of Escherichia coli strains isolated from 282 patients with bacteraemia. Thirty-five of these were neutropenic patients with haematological malignancy and 247 were patients with a normal or raised total white blood cell co...

    10. 78 FR 77089 - Pacific Island Fisheries; 2014 Annual Catch Limits and Accountability Measures

      Science.gov (United States)

      2013-12-20

      ...--groupers 5,600 Holocentridae--squirrelfish......... 2,585 Mugilidae--mullets 2,857 Crustaceans--crabs 2,248...,726 Serranidae--groupers 17,958 Mugilidae--mullets 15,032 Kyphosidae--chubs/rudderfish........ 13,247...; 4,446 giant clams. Mugilidae--mullets 3,308 Siganidae--rabbitfish 2,537 Bolbometopon muricatum...

    11. Human Health Screening and Public Health Significance of Contaminants of Emerging Concern Detected in Public Water Supplies

      Science.gov (United States)

      The source water and treated drinking water from twenty five drinking water treatment plants (DWTPs) across the United States were sampled in 2010 – 2012. Samples were analyzed for 247 contaminants using 15 chemical and microbiological methods. Most of these contaminants are no...

    12. Stressful Life Events: Moderators of the Relationships of Gender and Gender Roles to Self-Reported Depression and Suicidality among College Students.

      Science.gov (United States)

      Waelde, Lynn C.; And Others

      1994-01-01

      Examines whether relationships of self-reported depression and suicidality to gender roles or gender are moderated by stressful life events. Results with 290 female and 247 male undergraduates support the androgyny model of adjustment and a self-schema model of depression. (SLD)

    13. The Strategic Reperfusion Early After Myocardial Infarction (STREAM) study

      NARCIS (Netherlands)

      Armstrong, Paul W.; Gershlick, Anthony; Goldstein, Patrick; Wilcox, Robert; Danays, Thierry; Bluhmki, Erich; van de Werf, Frans; van de Werf, Frans Van de; Armstrong, Paul; Aaberge, Lars; Adgey, Jennifer; Arntz, Hans-Richard; Aviles, Fransisco; Fresco, Claudio; Grajek, Stefan; Halvorsen, Sigrun; Huber, Kurt; Kendall, Jason; Lambert, Yves; Meert, Philippe; Nanas, John; Ostojic, Miodrag; Pesenti, Antonio; Piegas, Leopoldo; Quinn, Tom J.; Rosell, Fernando; Schreiber, Wolfgang; Sinnaeve, Peter; Steen-Hansen, Jon-Erik; Steg, P. Gabriel; Sulimov, Victor; Timerman, Sergio; Travers, Andrew; Welsh, Robert; Zeymer, Uwe; Fox, Keith A. A.; Montalescot, Gilles; Pollack, Charles; Tijssen, Jan; Weaver, Doug; Brower, Ron

      2010-01-01

      BACKGROUND: Primary percutaneous coronary intervention (PCI) has emerged as the preferred therapy for acute ST-elevation myocardial infarction (STEMI) provided it is performed in a timely fashion at an expert 24/7 facility. Fibrinolysis is a well-accepted alternative, especially in patients

    14. New Fellows and Honorary Fellow

      Indian Academy of Sciences (India)

      Elected: 1998 Section: Earth & Planetary Sciences. Srivastava, Prof. Deepak Chandra Ph.D. (ISM, Dhanbad), FNASc, FNA. Date of birth: 1 October 1956. Specialization: Structural Geology and Fluid Inclusions Address: Head, Department of Earth Sciences, Indian Institute of Technology, Roorkee 247 667, Uttarakhand

    15. CPAP Tips

      Medline Plus

      Full Text Available ... Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ads? Get YouTube Red. ... 908 views 6:14 Progressive House · Relaxing Focus Music · 24/7 Live Radio The Grand Sound 577 ...

    16. Královské Vinohrady a jejich urbanizační vývoj v 19. a 20. století

      Czech Academy of Sciences Publication Activity Database

      Platovská, Marie

      2009-01-01

      Roč. 57, č. 3 (2009), s. 236-247 ISSN 0049-5123 R&D Projects: GA ČR GA408/04/1404 Institutional research plan: CEZ:AV0Z80330511 Keywords : urbanism * architecture * 19th century Subject RIV: AL - Art, Architecture, Cultural Heritage

    17. Bioremediation of PAH-contaminated soil with fungi - from laboratory to field scale

      Czech Academy of Sciences Publication Activity Database

      Winquist, E.; Björklöf, K.; Schultz, E.; Räsänen, M.; Salonen, K.; Anasonye, F.; Cajthaml, Tomáš; Steffen, K.; Jorgensen, K.S.; Tuomela, M.

      2014-01-01

      Roč. 86, č. 2 (2014), s. 238-247 ISSN 0964-8305 R&D Projects: GA TA ČR TE01020218 Institutional support: RVO:61388971 Keywords : bioremediation * contaminated soil * PAH * field scale Subject RIV: EE - Microbiology, Virology Impact factor: 2.131, year: 2014

    18. Corrigendum to “Cross-sections of solution funnels” [J. Math. Anal. Appl. 433 (2) (2016) 957–973

      Czech Academy of Sciences Publication Activity Database

      Hájek, Petr Pavel; Vivi, P.

      2016-01-01

      Roč. 435, č. 1 (2016), s. 1017 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : polynomial algebra Subject RIV: BA - General Math ematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X15010264

    19. Brain Health

      Science.gov (United States)

      ... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation to fight Alz Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | ...

    20. CSIR Nyendaweb: embedded measuring instrument of the CSIR ITS Lab® collaboratory

      CSIR Research Space (South Africa)

      Labuschangne, FJJ

      2009-05-01

      Full Text Available The paper describes the NyendaWeb technical development concept, the role of NyendaWeb within the ITS Lab collaboratory® as an international ITS R&D platform, and how the inherent, unobtrusive and 24/7 measurement functionality of NyendaWeb...

    1. Phase diagram of the sodium-rich Na.sub.x./sub.CoO.sub.2./sub. cobaltates

      Czech Academy of Sciences Publication Activity Database

      Zorkovská, A.; Baran, A.; Kajňáková, M.; Feher, A.; Šebek, Josef; Šantavá, Eva; Lin, C. T.; Peng, J.B.

      2010-01-01

      Roč. 247, č. 3 (2010), s. 665-667 ISSN 0370-1972 Institutional research plan: CEZ:AV0Z10100520 Keywords : cobaltates * specific heat * magnetic phase transition * A-type antiferromagnetism Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.344, year: 2010

    2. Regenerative Medicine for Battlefield Injuries

      Science.gov (United States)

      2014-10-01

      Manual of Experimental Embryology . University of Chicago Press, Chicago. Harris JS, Bemenderfer TB, Wessel AR, Kacena MA (2013) A review of mouse...proliferation and apoptosis . Dev Dynam 219:237-247. Patterson TE, Kumagal K, Griffith L, Muschler GF (2008) Cellular strategies for enhancement

    3. Conformational study of melectin and antapin antimicrobial peptides in model membrane environments

      Czech Academy of Sciences Publication Activity Database

      Kocourková, L.; Novotná, P.; Čujová, Sabína; Čeřovský, Václav; Urbanová, M.; Setnička, V.

      2017-01-01

      Roč. 170, Jan 5 (2017), s. 247-255 ISSN 1386-1425 Institutional support: RVO:61388963 Keywords : antimicrobial peptides * conformation * liposomes * model membranes * circular dichroism * infrared spectroscopy Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 2.536, year: 2016

    4. Biosynthesis of the leucine derived α-, β- and γ-hydroxynitrile glucosides in barley (Hordeum vulgare L.)

      DEFF Research Database (Denmark)

      Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik

      2016-01-01

      Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...

    5. Changing compositon of human capital: the Czech Republic, Hungary and Poland

      Czech Academy of Sciences Publication Activity Database

      Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav

      2008-01-01

      Roč. 16, č. 2 (2008), s. 247-271 ISSN 0967-0750 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * occupation * education Subject RIV: AH - Economics Impact factor: 0.614, year: 2008

    6. The development of a wetland classification and risk assessment index (WCRAI) for non-wetland specialists for the management of natural freshwater wetland ecosystems

      CSIR Research Space (South Africa)

      Oberholster, Paul J

      2014-02-01

      Full Text Available Botany 55, 247-260. Mitchell, P., 1990. The Enviromental Conditions of Victoria Streams, Department of Water Resources, Melbourne, Victoria. Mitsch, W.J., Gosselink, J.G., 2000. Wetlands 3 third edition, John Wiley& Sons Inc, New York. Morant, P.D., 1983...

    7. Mung bean sprout (Phaseolus aureus) nuclease and its biological and antitumor effects

      Czech Academy of Sciences Publication Activity Database

      Souček, J.; Škvor, J.; Poučková, P.; Matoušek, Jaroslav; Slavík, Tomáš; Matoušek, Josef

      2006-01-01

      Roč. 53, - (2006), s. 402-409 ISSN 0028-2685 R&D Projects: GA ČR GA521/06/1149; GA ČR GA523/04/0755 Keywords : mung bean * nuclease Subject RIV: FD - Oncology ; Hematology Impact factor: 1.247, year: 2006

    8. Inhibition of DNA binding of Sox2 by the SUMO conjugation

      International Nuclear Information System (INIS)

      Tsuruzoe, Shu; Ishihara, Ko; Uchimura, Yasuhiro; Watanabe, Sugiko; Sekita, Yoko; Aoto, Takahiro; Saitoh, Hisato; Yuasa, Yasuhito; Niwa, Hitoshi; Kawasuji, Michio; Baba, Hideo; Nakao, Mitsuyoshi

      2006-01-01

      Sox2 is a member of the high mobility group (HMG) domain DNA-binding proteins for transcriptional control and chromatin architecture. The HMG domain of Sox2 binds the DNA to facilitate transactivation by the cooperative transcription factors such as Oct3/4. We report that mouse Sox2 is modified by SUMO at lysine 247. Substitution of the target lysine to arginine lost the sumoylation but little affected transcriptional potential or nuclear localization of Sox2. By contrast with the unmodified form, Sox2 fused to SUMO-1 did not augment transcription via the Fgf4 enhancer in the presence of Oct3/4. Further, SUMO-1-conjugated Sox2 at the lysine 247 or at the carboxyl terminus reduced the binding to the Fgf4 enhancer. These indicate that Sox2 sumoylation negatively regulates its transcriptional role through impairing the DNA binding

    9. Characterization of the causal organism of blackleg and soft rot of potato, and management of the disease with balanced fertilization

      International Nuclear Information System (INIS)

      Ali, H.F.; Bibi, A.; Ahmad, M.; Junaid, M.; Ali, A.; Alam, S.

      2014-01-01

      Based upon colony morphology, physio-biochemical tests and polymerase chain reaction (using species or subspecies-specific primers) studies, 20 isolates (out of a total of 42) were found to be Erwinia carotovora subspecies atroseptica (Eca), 19 were identified as Erwinia carotovora subspecies carotovora (Ecc), and 3 as Erwinia chrysanthemi (Ech). Results of the subspecies-differentiating biochemical tests indicated that majority of the candidate Ecc isolates did not produce acid from methyle glucoside (as expected) but their reaction to the production of reducing substances from sucrose was variable. Likewise, some of our Eca and Ecc strains (unexpectedly) were sensitive to erythromycin. Also, most of our Eca strains unexpectedly grew at 36 degree C. Our strains slightly deviate from the standard description in some of their minor characteristics but they still remain the valid members of the Eca, Ecc or Ech group as similar variations in minor characteristics have been found by other workers. The occurrence of intermediate forms of Eca and Ecc (sharing some of the characteristics of both the groups) indicates variability happening among these strains. This variability indicates the potential ability of the pathogen to break the resistance of the host. The results of the effect of balanced nutrition in controlling blackleg and soft rot of potatoes indicated that the fertilizer combination of N3P1K3 (262/252/262 kg.ha-1) which is slightly higher than the normally practiced dose (247/247/247 kg.ha-1) was the best in bringing the disease to a minimum and subsequently increasing the yield. (author)

    10. Prenatal MR imaging of congenital diaphragmatic hernias: association of MR fetal lung volume with the need for postnatal prosthetic patch repair

      Energy Technology Data Exchange (ETDEWEB)

      Hagelstein, Claudia; Weidner, Meike; Schoenberg, Stefan O.; Buesing, Karen A.; Neff, K.W. [University of Heidelberg, Institute of Clinical Radiology and Nuclear Medicine, University Medical Center Mannheim, Mannheim (Germany); Zahn, Katrin [University of Heidelberg, Department of Pediatric Surgery, University Medical Center Mannheim, Mannheim (Germany); Weiss, Christel [University of Heidelberg, Department of Medical Statistics and Biomathematics, University Medical Center Mannheim, Mannheim (Germany); Schaible, Thomas [University of Heidelberg, Department of Pediatrics, University Medical Center Mannheim, Mannheim (Germany)

      2015-01-15

      To assess whether the need for postnatal prosthetic patch repair of the diaphragmatic defect in neonates with a congenital diaphragmatic hernia (CDH) is associated with the antenatal measured observed-to-expected magnetic resonance fetal lung volume (o/e MR-FLV). The o/e MR-FLV was calculated in 247 fetuses with isolated CDH. Logistic regression analysis was used to assess the prognostic value of the individual o/e MR-FLV for association with the need for postnatal patch repair. Seventy-seven percent (77 %) of patients with a CDH (190/247) required prosthetic patch repair and the defect was closed primarily in 23 % (57/247). Patients requiring a patch had a significantly lower o/e MR-FLV (27.7 ± 10.2 %) than patients with primary repair (40.8 ± 13.8 %, p < 0.001, AUC = 0.786). With an o/e MR-FLV of 20 %, 92 % of the patients required patch repair, compared to only 24 % with an o/e MR-FLV of 60 %. The need for a prosthetic patch was further influenced by the fetal liver position (herniation/no herniation) as determined by magnetic resonance imaging (MRI; p < 0.001). Fetal liver position, in addition to the o/e MR-FLV, improves prognostic accuracy (AUC = 0.827). Logistic regression analysis based on the o/e MR-FLV is useful for prenatal estimation of the prosthetic patch requirement in patients with a CDH. In addition to the o/e MR-FLV, the position of the liver as determined by fetal MRI helps improve prognostic accuracy. (orig.)

    11. Changes in blood aggregation with differences in molecular weight and degree of deacetylation of chitosan

      International Nuclear Information System (INIS)

      Hattori, Hidemi; Ishihara, Masayuki

      2015-01-01

      Because the molecular weight (Mw) and degree of deacetylation (DDA) of chitosan can vary depending on the purification method, the identification of appropriate chitosan structures is important for developing more effective hemostatic agents. In this study, the influence of varying Mw and DDA of chitosan on blood aggregation was characterized by 10 types of chitosan with different Mw and DDA, including oligomers. The highest aggregation of whole blood, washed erythrocytes and platelets in platelet-rich plasma (PRP) were observed in chitosan with Mw of 8.6 kDa or more and with DDA of 75 to 88%. However, chitosan with too high Mw (247 kDa) inhibited the aggregation of whole blood, washed erythrocytes and PRP at high chitosan concentration. At certain concentrations, chitosan with 75–85% DDA and 50–190 kDa and chitosan with 87.6% DDA and 247 kDa both aggregated proteins in PRP. Chitosan oligomer did not affect blood aggregation. The results suggested that the aggregation by chitosan depended on the interaction of positively charged chitosan with negatively charged erythrocytes, platelets and plasma protein. It seemed that a suitable balance of positive charge in chitosan and negative charge in hemocytes and some kinds of proteins was important. To develop a hemostatic with effective blood aggregation, the chitosan should not be limited to a single Mw and a single DDA but may be a mixed chitosan with wide range of Mw (8.6–247 kDa) and DDA of 75 to 88%. (paper)

    12. Acculturation, White Marginalization, and Family Support as Predictors of Perceived Distress in Mexican American Female College Students

      Science.gov (United States)

      Castillo, Linda G.; Conoley, Collie W.; Brossart, Daniel F.

      2004-01-01

      This study examined the influence of psychosociocultural variables of acculturation, White attitudinal marginalization, family support, and income on perceived distress in 247 Mexican American female college students. Participants were bicultural and attended primarily White universities in the West and Southwest. Results showed that comfort with…

    13. Euroclay 95. Clays and clay materials sciences. Book of abstracts

      Energy Technology Data Exchange (ETDEWEB)

      Elsen, A; Grobet, P; Keung, M; Leeman, H; Schoonheydt, R; Toufar, H [eds.

      1995-08-20

      The document contains the abstracts of the invited lecturers (18) and posters (247) presented at EUROCLAY `95. Clays and clay materials sciences. 13 items (4 from the invited lecturers and 12 from posters) have been considered within the INIS Subject Scope and indexed separately.

    14. Bulletin of Materials Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Author Affiliations. Sanjay Panwar1 D B Goel2 O P Pandey1. School of Physics and Materials Science, Thapar Institute of Engineering & Technology, Patiala 147 004, India; Department of Metallurgical and Materials Engineering, Indian Institute of Technology Roorkee, Roorkee 247 667, India ...

    15. Scedosporium and Pseudallescheria low molecular weight metabolites revealed by database search

      Czech Academy of Sciences Publication Activity Database

      Krásný, Lukáš; Strohalm, Martin; Bouchara, J.-P.; Šulc, Miroslav; Lemr, Karel; Barreto-Bergter, E.; Havlíček, Vladimír

      2011-01-01

      Roč. 54, č. 3 (2011), s. 37-42 ISSN 0933-7407 R&D Projects: GA MŠk LC07017 Institutional research plan: CEZ:AV0Z50200510 Keywords : Scedosporium apiospermum * Scedosporium prolificans * Pseudallescheria boydii Subject RIV: CE - Biochemistry Impact factor: 2.247, year: 2011

    16. Tree-stem diameter fluctuates with the lunar tides and perhaps with geomagnetic activity

      Czech Academy of Sciences Publication Activity Database

      Barlow, P. W.; Mikulecký, M.; Střeštík, Jaroslav

      2010-01-01

      Roč. 247, č. 1-2 (2010), s. 25-43 ISSN 0033-183X Institutional research plan: CEZ:AV0Z30120515 Keywords : lunisolar tidal acceleration * stem diameter variation * transpiration * Thule index Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.488, year: 2010

    17. PAVE PAWS Early Warning Radar Operation Cape Cod Air Force Station, MA. Record of Decision

      Science.gov (United States)

      2009-06-01

      Effects of Electromagnetic Super-high Frequency Fields]. Moscow, Medicina (In Russian) (English Translation in NASA Rep. TT-F-633). Guy, A.W...Baselines. Ann. New York Acad. Sci., 247: 425-432. Tjagin, N.W., 1971. [Clinical Aspects of Super-high Frequency Irradiation]. Leningrad, Medicina , pp

    18. Nikkaji Dictionary: キノジメタン [MeCab user dictionary for science technology term[Archive

      Lifescience Database Archive (English)

      Full Text Available MeCab user dictionary for science technology term キノジメタン 名詞 一般 * * * * キノジメタン ... Nikkaji J247.762I 200906009839104069 C CA06 UNKNOWN_1 キノジメタン

    19. Sleep disturbances and glucose homeostasis

      NARCIS (Netherlands)

      Barf, R. Paulien; Scheurink, Anton J.W.

      2011-01-01

      Sleep disturbances, induced by either lifestyle, shift work or sleeping disorders, have become more prevalent in our 24/7 Western society. Sleep disturbances are associated with impaired health including metabolic diseases such as obesity and type 2 diabetes. The question remains whether there is a

    20. The Central Dogma of Molecular Biology

      Indian Academy of Sciences (India)

      Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 3. The Central Dogma of Molecular Biology - A Retrospective after Fifty Years. Michel Morange. General Article Volume 14 Issue 3 March 2009 pp 236-247. Fulltext. Click here to view fulltext PDF. Permanent link:

    1. Multimodal Surveillance : Behavior analysis for recognizing stress and aggression

      NARCIS (Netherlands)

      Lefter, I.

      2014-01-01

      Nowadays, camera systems are installed in military areas as well as in public spaces like schools, shopping malls, airports, and football stadiums. Human operators are monitoring the screens, looking for any signs of unwanted behavior and negative incidents. The task requires working personnel 24/7.

    2. Innovative collection development for e-books at the TU Delft Library

      NARCIS (Netherlands)

      Brinkman Dzwig, Z.E.

      2013-01-01

      Thanks to new technologies libraries worldwide go digital and are accessible 24/7 from remote locations. The innovation is even more visible in traditional library tasks such as collection development and acquisitions. Those tasks are undergoing rapid transformation as well. One of the reasons is

    3. Micro and nanohardness testing of laser welds

      Czech Academy of Sciences Publication Activity Database

      Šebestová, H.; Čtvrtlík, Radim; Chmelíčková, H.; Tomáštík, J.

      2014-01-01

      Roč. 15, č. 3 (2014), s. 247-253 ISSN 1454-9069 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : Vickers microhardness * depth sensing indentation * laser welding Subject RIV: JP - Industrial Processing Impact factor: 1.658, year: 2014

    4. Nematode assemblages indicate soil restoration on colliery spoils afforested by planting different tree species and by natural succession

      Czech Academy of Sciences Publication Activity Database

      Háněl, Ladislav

      2008-01-01

      Roč. 40, č. 1 (2008), s. 86-99 ISSN 0929-1393 R&D Projects: GA AV ČR 1QS600660505 Institutional research plan: CEZ:AV0Z60660521 Keywords : nematoda * diversity * maturity Subject RIV: EH - Ecology, Behaviour Impact factor: 2.247, year: 2008

    5. Euroclay 95. Clays and clay materials sciences. Book of abstracts

      International Nuclear Information System (INIS)

      Elsen, A.; Grobet, P.; Keung, M.; Leeman, H.; Schoonheydt, R.; Toufar, H.

      1995-01-01

      The document contains the abstracts of the invited lecturers (18) and posters (247) presented at EUROCLAY '95. Clays and clay materials sciences. 13 items (4 from the invited lecturers and 12 from posters) have been considered within the INIS Subject Scope and indexed separately

    6. New Fellows and Honorary Fellow

      Indian Academy of Sciences (India)

      Elected: 1974 Section: Engineering & Technology. Lal, Prof. Shankar Ph.D. (CIT). Date of birth: 25 June 1923. Date of death: 25 September 1991. Specialization: Fluid Mechanics, Heat Transfer and Solid Mechanics Last known address: Dept. of Mechanical & Industrial, Engineering, University of Roorkee, Roorkee 247 667.

    7. Enamel paint techniques in archaeology and their identification using XRF and micro-XRF

      Czech Academy of Sciences Publication Activity Database

      Hložek, M.; Trojek, T.; Komoróczy, Balázs; Prokeš, R.

      2017-01-01

      Roč. 137, August (2017), s. 243-247 ISSN 0969-806X R&D Projects: GA ČR(CZ) GA15-20700S Keywords : X-ray fluorescence * Scanning * Enamel * Microanalysis Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.315, year: 2016

    8. Dissipative weak solutions to compressible Navier–Stokes–Fokker–Planck systems with variable viscosity coefficients

      Czech Academy of Sciences Publication Activity Database

      Feireisl, Eduard; Lu, Y.; Süli, E.

      2016-01-01

      Roč. 443, č. 1 (2016), s. 322-351 ISSN 0022-247X Keywords : weak solutions * kinetic polymer models * FENE chain Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X1630172X

    9. Advanced Age and Female Gender are Predictors of Minor Adherence to Guidelines in Acute Pharmacotherapy of Myocardial Infarction Patients

      Czech Academy of Sciences Publication Activity Database

      Monhart, Z.; Grünfeldová, H.; Zvárová, Jana; Janský, P.

      2010-01-01

      Roč. 122, č. 2 (2010), e247 ISSN 0009-7322. [World Congress of Cardiology . 16.06.2010-19.06.2010, Beijing] Institutional research plan: CEZ:AV0Z10300504 Keywords : cardiology * clinical guidelines * myocardial infarction Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery

    10. Resonance – Journal of Science Education | Indian Academy of ...

      Indian Academy of Sciences (India)

      Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of a Boson at CERN and Indian Connections. Gagan B Mohanty. General Article Volume 18 Issue 3 March 2013 pp 241-247. Fulltext. Click here to view fulltext PDF. Permanent link:

    11. 78 FR 42544 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning...

      Science.gov (United States)

      2013-07-16

      ... Prepare a Supplemental Environmental Impact Statement (EIS) SUMMARY: Consistent with the regulations... 248; Central Planning Area (CPA) Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact... Supplemental Environmental Impact Statement (OCS EIS/EA BOEM 2013-0118) (WPA 233/CPA 231 Supplemental EIS). The...

    12. Effect of desferrioxamine on reperfusion damage of rat heart ...

      African Journals Online (AJOL)

      1990-09-01

      Sep 1, 1990 ... ... deferrioxamine on rat heart mitochondrial oxidative phosphorylation after normothermic ischemic cardiac arrest and of reperfusion. Res Commun Chem Pathol Pharmacol 1988;. 62: 419-434. IL Sordahl LA, Johnson C, Blailock ZR. Schwartz A. The mitochondrion. Mechods Phannacol1971; 1: 247-286.

    13. ECAJS Vol 15 no 1 FINAL April 2010 _Repaired_ to Bioline 6th ...

      African Journals Online (AJOL)

      user

      2010-06-06

      Jun 6, 2010 ... Rib fractures were the most clinical type of chest injury and ... rate of the chest tubes was 32.9% of which infection (24.7%) and Nonfunctional tubes (17.4%) .... mostly affected and this was due to their occupational exposure. 2 ...

    14. The prevalence of HIV among patients admitted with stroke at the ...

      African Journals Online (AJOL)

      lmboera

      The respective proportions were 44% vs 24.7%; 26.7% vs 7.6%; 20.0% vs 2.9%; 13.3% vs 1.2%; ... Key words: HIV, stroke, prevalence, hospital, Tanzania ..... The clinical picture of patients with stroke and HIV infection is of importance. As.

    15. Spatiotemporal AED Location Optimization

      NARCIS (Netherlands)

      Chan, Timothy C.Y.; Sun, Christopher L.F.; Demirtas, Derya; Morrison, Laurie J.; Brooks, Steven C.

      2015-01-01

      Background: Mathematical optimization can be used to plan future AED placement to maximize out-of-hospital cardiac arrest (OHCA) coverage. Many public access AEDs are placed in locations without 24/7 access. AED coverage can be overestimated unless temporal availability is considered. Objective: To

    16. Attachment, Autonomy, and Emotional Reliance: A Multilevel Model

      Science.gov (United States)

      Lynch, Martin F.

      2013-01-01

      This article reports a test of a multilevel model investigating how attachment security and autonomy contribute to emotional reliance, or the willingness to seek interpersonal support. Participants ("N" = 247) completed online measures of attachment, autonomy, emotional reliance, and vitality with respect to several everyday…

    17. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

      DEFF Research Database (Denmark)

      Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

      2014-01-01

      at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

    18. Interpersonal Competence Configurations and Peer Relations in Early Elementary Classrooms: Perceived Popular and Unpopular Aggressive Subtypes

      Science.gov (United States)

      Robertson, Dylan L.; Farmer, Thomas W.; Fraser, Mark W.; Day, Steven H.; Duncan, Tisha; Crowther, Amity; Dadisman, Kimberly A.

      2010-01-01

      Social relations of second grade students (247 boys, 290 girls) were examined in rural elementary classrooms. Cluster analysis of teacher ratings was used to identify interpersonal competence configurations including perceived unpopular-aggressive (i.e., "Troubled") and perceived popular-aggressive (i.e., "Tough") subtypes for…

    19. Journal de la Recherche Scientifique de l'Université de Lomé - Vol ...

      African Journals Online (AJOL)

      Journal de la Recherche Scientifique de l'Universite de Lome. ... V.J. Mama, J Oloukoi, F.C. Biaou, R Tete, 231-247 ... Etat des lieux et profil de l'imagerie par resonance magnetique dans l'exploration du cancer de la prostate au Togo · EMAIL ...

    20. Phylogeny of the Neotropical cichlid fish tribe Cichlasomatini (Teleostei: Cichlidae) based on morphological and molecular data, with the description of a new genus

      Czech Academy of Sciences Publication Activity Database

      Musilová, Zuzana; Říčan, Oldřich; Novák, J.

      2009-01-01

      Roč. 47, č. 3 (2009), s. 234-247 ISSN 0947-5745 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Cichlasomatini * And inoacara * Aequidens Subject RIV: EH - Ecology, Behaviour Impact factor: 1.850, year: 2009

    1. Application of the Monte Carlo method for investigation of dynamical parameters of rotors supported by magnetorheological squeeze film damping devices

      Czech Academy of Sciences Publication Activity Database

      Zapoměl, Jaroslav; Ferfecki, Petr; Kozánek, Jan

      2014-01-01

      Roč. 8, č. 1 (2014), s. 129-138 ISSN 1802-680X Institutional support: RVO:61388998 Keywords : uncertain parameters of rigid motors * magnetorheological dampers * force transmission * Monte Carlo method Subject RIV: BI - Acoustics http://www.kme.zcu.cz/acm/acm/article/view/247/275

    2. The "Small Change" of Soldiering? Peace Operations as Preparation for Future Wars

      Science.gov (United States)

      1998-06-05

      the 112 Raymond Aron, Main Currents in Sociological Thought 2: Pareto, Weber, Durkheim (Middlesex, U.K.: Penguin Books, 1967), 219, 247-48; Max...Great War. West Point, NY: United States Military Academy, 1977. Aron, Raymond. Main Currents in Sociological Thought 2: Pareto, Weber, Durkheim

    3. Assessment of burn size in obese adults; a literature review

      DEFF Research Database (Denmark)

      Borhani-Khomani, Kaveh; Partoft, Søren; Holmgaard, Rikke

      2017-01-01

      : The current literature was reviewed using relevant electronic databases. The initial search yielded 247 results. Relevant articles were then reviewed. A total of seven publications fulfilled the inclusion criteria. Results: The palmar surface area ranged between 0.59%–1.22%, depending on BMI, gender...

    4. Antibiotic susceptibility profiles of oral pathogens

      NARCIS (Netherlands)

      Veloo, A. C. M.; Seme, K.; Raangs, Gerwin; Rurenga, P.; Singadji, Z.; Wekema - Mulder, G.; van Winkelhoff, A. J.

      2012-01-01

      Periodontitis is a bacterial disease that can be treated with systemic antibiotics. The aim of this study was to establish the antibiotic susceptibility profiles of five periodontal pathogens to six commonly used antibiotics in periodontics. A total of 247 periodontal bacterial isolates were tested

    5. Development and evaluation of a rapid dipstick assay for serodiagnosis of acute human brucellosis

      NARCIS (Netherlands)

      Smits, H. L.; Basahi, M. A.; Díaz, R.; Marrodan, T.; Douglas, J. T.; Rocha, A.; Veerman, J.; Zheludkov, M. M.; Witte, O. W.; de Jong, J.; Gussenhoven, G. C.; Goris, M. G.; van der Hoorn, M. A.

      1999-01-01

      A dipstick assay for the detection of brucella-specific immunoglobulin M antibodies was evaluated with 707 sera from 247 laboratory-confirmed brucellosis patients and 342 control sera from brucellosis-free individuals. These sera were collected from six different countries. The assay was found to be

    6. Recirkulace výkonu ve fúzních elektrárnách.

      Czech Academy of Sciences Publication Activity Database

      Entler, Slavomír; Kolovratník, M.; Dostál, V.

      2017-01-01

      Roč. 67, č. 4 (2017), s. 247-250 ISSN 0375-8842 Grant - others:AV ČR(CZ) StrategieAV21/2 Program:StrategieAV Institutional support: RVO:61389021 Keywords : fusion energy * power recirculation * net efficiency Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering

    7. The sensitivity status of community-acquired Staphylococcus aureus ...

      African Journals Online (AJOL)

      Community acquired Staphylococcus aureus was isolated from various infectious sites in two private laboratories in Kano-city, Nigeria. A total of 247 (11%) Staphylococcu aureus isolates were recovered from all infectious sites except cerebro-spinal fluid. The least Staphylococcus aureus isolates were found in urine ...

    8. Sequence-characterized markers from Begonia x tuberhybrida Voss..

      Czech Academy of Sciences Publication Activity Database

      Wiesner, Ivo; Wiesnerová, Dana

      2008-01-01

      Roč. 73, č. 6 (2008), s. 244-247 ISSN 1611-4426 R&D Projects: GA AV ČR 1QS500510566 Institutional research plan: CEZ:AV0Z50510513 Keywords : Begonia * genetic markers Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.300, year: 2008

    9. Nikkaji Dictionary: メタンジアミン [MeCab user dictionary for science technology term[Archive

      Lifescience Database Archive (English)

      Full Text Available MeCab user dictionary for science technology term メタンジアミン 名詞 一般 * * * * メタンジアミン ... Nikkaji J247.892G 200906035896340195 C CA06 UNKNOWN_1 メタンジアミン

    10. Growth response of downy birch (Betula pubescens) to moisture treatment at an cut-over peat bog in the Šumava Mts., Czech Republic

      Czech Academy of Sciences Publication Activity Database

      Lanta, Vojtěch; Hazuková, I.

      2005-01-01

      Roč. 42, - (2005), s. 247-256 ISSN 0003-3847 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z6005908 Keywords : Betula pubescens * cut-over peatland * increment Subject RIV: EF - Botanics Impact factor: 0.315, year: 2005

    11. A Decade of International Activities by U.S. Nurse Faculty: A Descriptive Analysis.

      Science.gov (United States)

      Lusk, Brigid; Lash, Ayhan Aytekin

      2002-01-01

      A study to assess scholarly activities of U.S. nursing faculty abroad from 1985-1995 resulted in descriptions of 805 visits to 109 countries by 247 scholars. Results showed that U.S. nurse faculty were involved in diverse and widespread international nursing activities. (Contains 25 references.) (JOW)

    12. A regularity criterion for the Navier-Stokes equations based on the gradient of one velocity component

      Czech Academy of Sciences Publication Activity Database

      Skalák, Zdeněk

      2016-01-01

      Roč. 437, č. 1 (2016), s. 474-484 ISSN 0022-247X R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985874 Keywords : Navier - Stokes equations * regularity of solutions * regularity criteria Subject RIV: BK - Fluid Dynamics Impact factor: 1.064, year: 2016

    13. Oxygen consumption of the earthworm species .i.Dendrobaena mrazeki./i

      Czech Academy of Sciences Publication Activity Database

      Šustr, Vladimír; Pižl, Václav

      2009-01-01

      Roč. 45, 5-6 (2009), s. 478-482 ISSN 1164-5563 R&D Projects: GA ČR GA206/03/0056 Institutional research plan: CEZ:AV0Z60660521 Keywords : earthworms * Dendrobaena mrazeki * respiration rate Subject RIV: EH - Ecology, Behaviour Impact factor: 1.247, year: 2009

    14. Software News and Update MOLCAS 7: The Next Generation

      Czech Academy of Sciences Publication Activity Database

      Aquilante, F.; De Vico, L.; Ferré, N.; Ghigo, G.; Malmqvist, P. A.; Neogrady, P.; Pedersen, T. B.; Pitoňák, Michal; Reiher, M.; Roos, B. O.; Serrano-Andrés, L.; Urban, M.; Veryazov, V.; Lindh, R.

      2010-01-01

      Roč. 31, č. 1 (2010), s. 224-247 ISSN 0192-8651 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : MOLCAS * Cholesky decomposition * coupled cluster Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.050, year: 2010

    15. Segmentation of anatomical structures in chest radiographs using supervised methods: a comparative study on a public database

      DEFF Research Database (Denmark)

      van Ginneken, Bram; Stegmann, Mikkel Bille; Loog, Marco

      2006-01-01

      classification method that employs a multi-scale filter bank of Gaussian derivatives and a k-nearest-neighbors classifier. The methods have been tested on a publicly available database of 247 chest radiographs, in which all objects have been manually segmented by two human observers. A parameter optimization...

    16. Good agreement of conventional and gel-based direct agglutination test in immune-mediated haemolytic anaemia

      NARCIS (Netherlands)

      Piek, C.J.; Teske, E.; van Leeuwen, M.W.; Day, M.J.

      2012-01-01

      Abstract Background The aim of this study was to compare a gel-based test with the traditional direct agglutination test (DAT) for the diagnosis of immune-mediated haemolytic anaemia (IMHA). Methods Canine (n = 247) and feline (n = 74) blood samples were submitted for DAT testing to two

    17. Chemical nature of catalysts of oxide nanoparticles in environment ...

      Indian Academy of Sciences (India)

      12

      Chemical nature of catalysts of oxide nanoparticles in environment prevailing during growth of carbon nanostructures by CCVD. M. Jana*, A. Sil and S. Ray. †. Department of Metallurgical and Materials Engineering. Indian Institute of Technology Roorkee. Roorkee 247 667, India. Present address: *School of Materials ...

    18. An FMRI Study of Olfactory Cues to Perception of Conspecific Stress

      Science.gov (United States)

      2010-04-01

      Petrovic P, Ingvar M, Stone-Elander S, Petersson KM, Hansson P (1999) A PET activation study of dynamic mechanical allodynia in patients with...state on olfactory sensitivity suggest odor specificity. Biol Psychol 71: 244-247. 67. Mair RG, Bouffard JA, Engen T, Morton TH (1978) Olfactory

    19. Crossing Cross-Platform: Comparing Skills Preferences and Convergence Attitudes in Strategic Communication and News Disciplines

      Science.gov (United States)

      Hubbard, Glenn T.; Kang, Jin-Ae; Crawford, Elizabeth Crisp

      2016-01-01

      National survey of college mass communication students (N = 247) analyzed attitudes on the teaching of print and electronic media skills, using journalism students as comparison group. Previous research had not explored strategic communication student responses to convergence. Found identity variables within public relations (PR) field related to…

    20. Reaction between Hydrogen Sulfide and Limestone Calcines

      Czech Academy of Sciences Publication Activity Database

      Hartman, Miloslav; Svoboda, Karel; Trnka, Otakar; Čermák, Jiří

      2002-01-01

      Roč. 41, č. 10 (2002), s. 2392-2398 ISSN 0888-5885 R&D Projects: GA AV ČR IAA4072711; GA AV ČR IAA4072801 Keywords : hydrogen sulfide * limestone calcines * desulfurization Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.247, year: 2002

    1. Electronic structure and optical properties of thorium monopnictides

      Indian Academy of Sciences (India)

      Unknown

      Indian Academy of Sciences. 165. Electronic structure and optical properties of thorium monopnictides. S KUMAR* and S AULUCK†. Physics Department, Institute of Engineering and Technology, M.J.P. Rohilkhand University, Bareilly 243 006,. India. †Department of Physics, Indian Institute of Technology, Roorkee 247 667, ...

    2. 78 FR 52562 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning...

      Science.gov (United States)

      2013-08-23

      ... Prepare a Supplemental Environmental Impact Statement (EIS). SUMMARY: Consistent with the regulations... Supplemental EIS will update the environmental and socioeconomic analyses in the Gulf of Mexico OCS Oil and Gas... Area Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact Statement (OCS EIS/EA BOEM...

    3. Primary PCI as the preferred reperfusion therapy in STEMI: it is a matter of time

      DEFF Research Database (Denmark)

      Terkelsen, C J; Christiansen, E H; Sørensen, J T

      2009-01-01

      There is a continuing controversy about the acceptable time-window for primary percutaneous coronary intervention (PPCI) in patients with ST-elevation myocardial infarction (STEMI). Recent American and European guidelines recommend PPCI if the delay in performing PPCI instead of administering...... directly to catheterisation laboratories running 24/7....

    4. Resolution of alpha/beta-amino acids by enantioselective penicillin G acylase from Achromobacter sp

      Czech Academy of Sciences Publication Activity Database

      Grulich, Michal; Brezovský, J.; Štěpánek, Václav; Palyzová, Andrea; Kyslíková, Eva; Kyslík, Pavel

      2015-01-01

      Roč. 122, DEC 2015 (2015), s. 240-247 ISSN 1381-1177 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : Penicillin G acylase * Enantioselectivity * Homologous model Subject RIV: CE - Biochemistry Impact factor: 2.189, year: 2015

    5. Buckling of plate strip subjected to localized corrosion a stochastic model

      Czech Academy of Sciences Publication Activity Database

      Sadovský, Z.; Drdácký, Miloš

      2001-01-01

      Roč. 39, č. 3 (2001), s. 247-259 ISSN 0263-8231 R&D Projects: GA ČR GA103/97/S051 Grant - others:GA SR(SK) GA2/5102/20 Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.429, year: 2001

    6. The Relation between Different Facets of Creativity and the Dark Side of Personality

      Science.gov (United States)

      Dahmen-Wassenberg, Phoebe; Kämmerle, Monika; Unterrainer, Human-Friedrich; Fink, Andreas

      2016-01-01

      This study examined the relation between different facets of creativity and personality, focusing on the dark side of personality. In a sample of 247 students, psychometric measures for the assessment of the dark triad of personality (subclinical narcissism, Machiavellianism, subclinical psychopathy), personality organization (structural deficit:…

    7. Extremal solutions of measure differential equations

      Czech Academy of Sciences Publication Activity Database

      Monteiro, Giselle Antunes; Slavík, A.

      2016-01-01

      Roč. 444, č. 1 (2016), s. 568-597 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : measure differential equations * extremal solution * lower solution Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X16302724

    8. Special Section: A Conversation with Katie Couric

      Science.gov (United States)

      ... some significant breakthroughs in record time. In my book, they and all the other cancer researchers who work 24/7 to ... Whatever one individual can do in these tough economic times, every contribution—of any size—helps. The first "Dream Teams" funded by Stand Up To ...

    9. CHAPTER 1

      African Journals Online (AJOL)

      Dr Olaleye

      247(98.9%), Resistance was highest to Co-trimoxazole 108(44.8%) and Tetracycline: 108(43.7%). ... (Lieff et al., 2004) and gram-negative anaerobic bacteria .... pregnancy is as shown in Table 2. Table 3: Antibiotic Sensitivity Pattern. Antibiotic. Sensitive. Frequency (%). Resistant. Frequency (%). Augmentin. 166 (84.7).

    10. Resonance – Journal of Science Education | Indian Academy of ...

      Indian Academy of Sciences (India)

      Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 1. The Riddle of the Apparently Hollow Himalaya. Ramesh Chander. General Article Volume 3 Issue 1 January 1998 pp 21- ... Author Affiliations. Ramesh Chander1. Department of Earth Sciences, University of Roorkee, Roorkee 247 667, India.

    11. The Role of Individualism-Collectivism in the Individual Creative Process

      Science.gov (United States)

      Yao, Xiang; Wang, Shuhong; Dang, Junhua; Wang, Lei

      2012-01-01

      This study is among the first to examine how individuals' cultural value orientations impact 2 separate stages of creativity: idea generation and idea implementation. A total of 247 Chinese employees completed questionnaires including individualism-collectivism culture orientation and their idea generation behavior. Supervisor ratings of idea…

    12. Molecular characterization of true morels (Morchella) in Turkey

      Science.gov (United States)

      A collection of 247 true morels (Morchella spp.) was made from 10 different provinces of Turkey during the 2007-2008 growing season. This collection was analyzed for species diversity using phylogenetic analyses of partial Ribonucleic acid (RNA) polymerase I (RPB1) and nuclear ribosomal large subuni...

    13. Možnosti zobrazení a analýzy v rastrovacím elektronovém mikroskopu s vysokým rozlišením.

      Czech Academy of Sciences Publication Activity Database

      Mika, Filip; Paták, Aleš; Pokorná, Zuzana

      2017-01-01

      Roč. 62, č. 10 (2017), s. 245-247 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * display and analysis capabilities Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Particles and field physics

    14. Work and workload of Dutch primary care midwives in 2010.

      NARCIS (Netherlands)

      Wiegers, T.A.; Warmelink, J.C.; Spelten, E.R.; Klomp, G.M.T.; Hutton, E.K.

      2014-01-01

      Objective: To re-assess the work and workload of primary care midwives in the Netherlands. Background: In the Netherlands most midwives work in primary care as independent practitioners in a midwifery practice with two or more colleagues. Each practice provides 24/7 care coverage through office

    15. 77 FR 74177 - Information Collection Requirement; Defense Federal Acquisition Regulation Supplement; Production...

      Science.gov (United States)

      2012-12-13

      .../index.htm . Paper copies are available from Ms. Meredith Murphy, OUSD (AT&L) DPAP (DARS), IMD 3C132... material management and accounting systems conform to established DoD standards. c. The information... to establish, maintain, and disclose material management and accounting systems. c. DFARS 252.247...

    16. Individual differences in shift work tolerance

      NARCIS (Netherlands)

      Lammers-van der Holst, H.M.

      2016-01-01

      Shift work is a key feature of our contemporary 24/7 society, employing several successive work teams to sustain around-the-clock operations. However, numerous studies imply that frequently shifting the periods of sleep and wakefulness poses a serious threat to the shift worker’s physical, mental

    17. A Decision Support System for Identifying and Ranking Critical Habitat Parcels on and in the Vicinity of Department of Defense Installations

      Science.gov (United States)

      2011-01-01

      OPEN Pasture /Hay SEGAP810 OPEN Row Crop SEGAP820 OPEN Atlantic Coastal Plain Blackwater Stream Floodplain Forest - Forest Modifier CES203.247a HARD... genetic connectivity. One possible explanation is that the model evaluates jumping for every gap encountered, making movement over long distances across

    18. Transverse sphericity of primary charged particles in minimum bias proton–proton collisions at s√=0.9, 2.76 and 7 TeV

      Czech Academy of Sciences Publication Activity Database

      Abelev, B.; Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Čepila, J.; Křelina, M.; Krus, M.; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Pachr, M.; Petráček, V.; Petráň, M.; Polák, Karel; Pospíšil, V.; Šmakal, R.; Šumbera, Michal; Tlustý, D.; Vajzer, Michal; Wagner, V.; Zach, Č.; Závada, Petr

      2012-01-01

      Roč. 72, č. 9 (2012), 2124/1-2124/16 ISSN 1434-6044 R&D Projects: GA MŠk LA08015 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : energies * ALICE * LHC Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.247, year: 2012

    19. Physical activity energy expenditure and sarcopenia in black South African urban women

      NARCIS (Netherlands)

      Kruger, Herculina S.; Havemann-Nel, Lize; Ravyse, Chrisna; Moss, Sarah J.; Tieland, Michael

      2016-01-01

      Background: Black women are believed to be genetically less predisposed to age-related sarcopenia. The objective of this study was to investigate lifestyle factors associated with sarcopenia in black South African (SA) urban women. Methods: In a cross-sectional study, 247 women (mean age 57 y)

    20. The National Health Services Conunission, 1942 - 1944 - its origins ...

      African Journals Online (AJOL)

      (i) an analysis of the origins and impact ofthe National .... employee. ... century, there was growing recognition of the 'pressing ... motivated not entirely by selfless concern.30 For exam- ..... local, regional and national level satisfied the MASA, .... Rewards. Johannesburg: Caxton Press, 1977: 246-247. 62. MASA News.

    1. Spectroscopic studies of two dynamically different 1,4-dihydropyridine structures

      Czech Academy of Sciences Publication Activity Database

      Sliwinska, E.; Palewska, K.; Lewanowicz, A.; Lipinski, J.; Sworakowski, J.; Gancarz, R.; Nešpůrek, Stanislav

      2002-01-01

      Roč. 76, 2-3 (2002), s. 235-247 ISSN 0137- 5083 R&D Projects: GA AV ČR KSK4050111 Institutional research plan: CEZ:AV0Z4050913 Keywords : dihydropyridine * UV-Vis spectroscopy * NMR spectroscopy Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.528, year: 2002

    2. 12-core x 3-mode Dense Space Division Multiplexed Transmission over 40 km Employing Multi-carrier Signals with Parallel MIMO Equalization

      DEFF Research Database (Denmark)

      Mizuno, T.; Kobayashi, T.; Takara, H.

      2014-01-01

      We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier....

    3. Global Delivery Models

      DEFF Research Database (Denmark)

      Manning, Stephan; Møller Larsen, Marcus; Bharati, Pratyush

      -zone spread allowing for 24/7 service delivery and access to resources. Based on comprehensive data we show that providers are likely to establish GDM configurations when clients value access to globally distributed talent pools and speed of service delivery, and in particular when services are highly...

    4. Study of the decay /sup 184/Hg. -->. /sup 184/Au (Tsub(1/2)=30s). [Lifetime, upper limits

      Energy Technology Data Exchange (ETDEWEB)

      Nettles, W G; Beraud, R; Cole, J D; Hamilton, J H; Ramayya, A V; Kawakami, H [Vanderbilt Univ., Nashville, TN (USA). Dept. of Physics; Sastry, K S.R. [Massachusetts Univ., Amherst (USA); Spejewski, E H

      1978-04-01

      The radioactive decay of /sup 184/Hg to /sup 184/Au was studied on line with the UNISOR isotope separator. The 184 mass chain was entered at /sup 184/Tl and /sup 184/Hg by bombarding an isotopically-enriched target of /sup 180/W with /sup 14/N ions of 177 MeV. Multiscale singles and ..gamma..-..gamma..-time coincidence studies were carried out. No previous levels have been assigned to /sup 184/Au. From the coincidence data eight levels at 156.2, 159.1, 247.7, 282.8, 295.1, 392.4, 418.0 and 412.4 keV are assigned and two tentative levels at 534.0 and 551.6 keV are proposed. By using the delayed coincidence technique, a half-life of 36+-6 nanoseconds was measured for the 156.2 keV first-excited level and upper limits of 2 nanoseconds were determined for the half-lives of levels at 159.1, 247.7, 295.1 and 392.4 keV.

    5. Accuracy of Automated Flow Cytometry-Based Leukocyte Counts To Rule Out Urinary Tract Infection in Febrile Children: a Prospective Cross-Sectional Study

      Science.gov (United States)

      Duong, Hong Phuoc; Wissing, Karl Martin; Tram, Nathalie; Mascart, Georges; Lepage, Philippe

      2016-01-01

      Automated flow cytometry of urine remains an incompletely validated method to rule out urinary tract infection (UTI) in children. This cross-sectional analytical study was performed to compare the predictive values of flow cytometry and a dipstick test as initial diagnostic tests for UTI in febrile children and prospectively included 1,106 children (1,247 episodes). Urine culture was used as the gold standard test for diagnosing UTI. The performance of screening tests to diagnose UTI were established using receiver operating characteristic (ROC) analysis. Among these 1,247 febrile episodes, 221 UTIs were diagnosed (17.7% [95% confidence interval {CI}, 15.6 to 19.8%]). The area under the ROC curve for flow cytometry white blood cell (WBC) counts (0.99 [95% CI, 0.98 to 0.99]) was significantly superior to that for red blood cell (0.74 [95% CI, 0.70 to 0.78]) and bacterial counts (0.89 [95% CI, 0.87 to 0.92]) (P UTI in febrile children. PMID:27682127

    6. Sarcoidose: a propósito de um caso clínico

      Directory of Open Access Journals (Sweden)

      Adelaide Freire

      2000-05-01

      Full Text Available RESUMO: Descrevemos um caso de uma jovem com um quadro clínico compatível com sarcoidose mas com resultados radioiógicos com imagens nodulares disseminadas o que é pouco provável nesta doença.O aumento sérico do ECA, a linfocitose do lavado broncoalveolar com uma relação CD4/CD8 de 4,47 e a evolução clínica apoiaram o diagnóstico.REV PORT PNEUMOL 2000; VI (3: 247-251 ABSTRACT: We present the case of a young woman with a compatible clinical picture of sarcoidosis. Chest X­ ray with multiple noduls opacities that is not very frequent. The incresed level or serum angiotensin converting enzyme, the increased in Bronchoalveolar lavage lynfocytes with a CD4/CD8 ratio of 4,47 and spontaneous remission makes the diagnosis of sarcoidosis.REV PORT PNEUMOL 2000; VI (3: 247-251

    7. Zinc status in HIV infected Ugandan children aged 1-5 years: a cross sectional baseline survey

      Directory of Open Access Journals (Sweden)

      Ndugwa Christopher M

      2010-09-01

      Full Text Available Abstract Background Low concentrations of serum zinc have been reported in HIV infected adults and are associated with disease progression and an increased risk of death. Few studies have been conducted in HIV infected children in Africa. We determined serum zinc levels and factors associated with zinc deficiency in HIV infected Ugandan children. Methods We measured the baseline zinc status of 247 children aged 1-5 years enrolled in a randomised trial for multiple micronutrient supplementation at paediatric HIV clinics in Uganda (http://ClinicalTrials.gov NCT00122941. Zinc status was determined using inductively coupled atomic emission spectrophotometry (ICP-AES. Clinical and laboratory characteristics were compared among zinc deficient (zinc Results Of the 247 children, 134 (54.3% had low serum zinc ( Conclusion Almost two thirds of HAART naïve and a third of HAART treated HIV infected children were zinc deficient. Increased access to HAART among HIV infected children living in Uganda might reduce the prevalence of zinc deficiency.

    8. Study of the decay 184Hg→184Au (Tsub(1/2)=30s)

      International Nuclear Information System (INIS)

      Nettles, W.G.; Beraud, R.; Cole, J.D.; Hamilton, J.H.; Ramayya, A.V.; Kawakami, H.; Spejewski, E.H.

      1978-01-01

      The radioactive decay of 184 Hg to 184 Au was studied on line with the UNISOR isotope separator. The 184 mass chain was entered at 184 Tl and 184 Hg by bombarding an isotopically-enriched target of 180 W with 14 N ions of 177 MeV. Multiscale singles and γ-γ-time coincidence studies were carried out. No previous levels have been assigned to 184 Au. From the coincidence data eight levels at 156.2, 159.1, 247.7, 282.8, 295.1, 392.4, 418.0 and 412.4 keV are assigned and two tentative levels at 534.0 and 551.6 keV are proposed. By using the delayed coincidence technique, a half-life of 36+-6 nanoseconds was measured for the 156.2 keV first-excited level and upper limits of 2 nanoseconds were determined for the half-lives of levels at 159.1, 247.7, 295.1 and 392.4 keV [fr

    9. 48 CFR 47.207-1 - Qualifications of offerors.

      Science.gov (United States)

      2010-10-01

      ... clause at 52.247-2, Permits, Authorities, or Franchises, when regulated transportation is involved. The... that it is in the Government's interest not to apply the requirement for holding or obtaining State... interest not to apply the requirements for holding or obtaining State authority to operate within the State...

    10. Modern Time as Historical Artifact

      DEFF Research Database (Denmark)

      Nye, David Edwin

      2015-01-01

      Explores different aspects of how Americans have understood and used time since the late eighteenth century through the historical transition that has led to the present 24/7 world, where time-keeping is built into a myriad of devices that record and to some degree direct our actions....

    11. Journal of Earth System Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      ... 2003 pp 61-77. Indian Ocean surface winds from NCMRWF analysis as compared to QuikSCAT and moored buoy winds ... Skills of different mesoscale models over Indian region during monsoon season: Forecast errors · Someshwar Das ... pp 247-258. Improvements in medium range weather forecasting system of India.

    12. Health and Quality of Life in Northern Plains Indians

      Science.gov (United States)

      Quality of life and standard of living are consistently depicted as indigent among American Indian and Alaska Native (AI/AN) populations. American Indians (AI) are among the most heterogeneous and impoverished ethnic groups in the U.S.,have the highest per capita suicide rate at 247% of the national...

    13. Sosiaal-wetenskaplike kritiese eksegese van Nuwe-Testamentiese ...

      African Journals Online (AJOL)

      UPuser

      Nicht viele Mächtige: Annäherungen an eine Soziologie des. Urchristentums, in Befreiungserfahrungen: Studien zur Sozialgeschichte des. Neuen Testaments, 247-256. München: Kaiser. Scott, B B [1989] 1990. Hear then the parable: A commentary on the parables of. Jesus. Minneapolis, MN: Fortress. Scott, J C 1990.

    14. Die benutting van ureumaangevulde en verskillende tipes ...

      African Journals Online (AJOL)

      compared with urea-supplemented barley straw in an intake and in vivo digestibility study. The ADF-N content ... mied- en oondmetode is in 'n inname- en in vivo-verteringstudie onderling en met ureumaangevulde garsstrooi vergelyk. ..... of 24,7% between the latter treatment and stack-ammoniated wheat straw reaching.

    15. Nikkaji Dictionary: o−キノジメタン [MeCab user dictionary for science technology term[Archive

      Lifescience Database Archive (English)

      Full Text Available MeCab user dictionary for science technology term o−キノジメタン 名詞 一般 * * * * o-キノジメタン ... Nikkaji J247.761K 200906018564291393 C CA06 UNKNOWN_2 o − キノジメタン

    16. SQSQh: 1H-detected SQ-SQ Experiment for Determination of Signed Silicon-Carbon Coupling Constants

      Czech Academy of Sciences Publication Activity Database

      Blechta, Vratislav; Schraml, Jan

      2010-01-01

      Roč. 48, č. 6 (2010), s. 464-470 ISSN 0749-1581 R&D Projects: GA AV ČR IAA400720706 Institutional research plan: CEZ:AV0Z40720504 Keywords : nmr * sqsq sequence * sign of coupling constant Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.247, year: 2010

    17. K pramenům Husových Punkt: Jan Hus a Bernard Gui

      Czech Academy of Sciences Publication Activity Database

      Soukup, Pavel

      2015-01-01

      Roč. 62, č. 1 (2015), s. 235-247 ISSN 1803-7429 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : Medieval sermons * Hussitism * preaching aids * John Hus * Bernard Gui Subject RIV: AB - History http://hdl.handle.net/11222.digilib/134673

    18. Improving Mathematics Learning of Kindergarten Students through Computer-Assisted Instruction

      Science.gov (United States)

      Foster, Matthew E.; Anthony, Jason L.; Clements, Doug H.; Sarama, Julie; Williams, Jeffrey M.

      2016-01-01

      This study evaluated the effects of a mathematics software program, the Building Blocks software suite, on young children's mathematics performance. Participants included 247 Kindergartners from 37 classrooms in 9 schools located in low-income communities. Children within classrooms were randomly assigned to receive 21 weeks of computer-assisted…

    19. Resonance – Journal of Science Education | Indian Academy of ...

      Indian Academy of Sciences (India)

      Home; Journals; Resonance – Journal of Science Education. Michel Morange. Articles written in Resonance – Journal of Science Education. Volume 14 Issue 3 March 2009 pp 236-247 General Article. The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF ...

    20. Operational experience with a seasonally operated full-scale membrane bioreactor plant

      Czech Academy of Sciences Publication Activity Database

      Gómez, M.; Dvořák, L.; Růžičková, I.; Holba, Marek; Wanner, J.

      2012-01-01

      Roč. 121, OCT 2012 (2012), s. 241-247 ISSN 0960-8524 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : full-scale membrane bioreactor * soluble microbibal products * nutrient removal * fouling * microbiological effluent quality Subject RIV: EF - Botanics Impact factor: 4.750, year: 2012

    1. NIGERIAN VETERINARY JOURNAL

      African Journals Online (AJOL)

      ADEYEYE

      the prevalence of cattle co-infected with parasites. There was a correlation ... infertility, and as such poses a serious threat to the food security of .... Male. 146. 37.2. 32.5 – 42.0. Female. 247. 62.8. 58.0 – 67.5. Season. Dry season. 296. 75.3.

    2. Haar meager sets revisited

      Czech Academy of Sciences Publication Activity Database

      Doležal, Martin; Rmoutil, M.; Vejnar, B.; Vlasák, V.

      2016-01-01

      Roč. 440, č. 2 (2016), s. 922-939 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : Haar meager set * Haar null set * Polish group Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0022247X1600305X

    3. Conceptual Scoring and Classification Accuracy of Vocabulary Testing in Bilingual Children

      Science.gov (United States)

      Anaya, Jissel B.; Peña, Elizabeth D.; Bedore, Lisa M.

      2018-01-01

      Purpose: This study examined the effects of single-language and conceptual scoring on the vocabulary performance of bilingual children with and without specific language impairment. We assessed classification accuracy across 3 scoring methods. Method: Participants included Spanish-English bilingual children (N = 247) aged 5;1 (years;months) to…

    4. The unimolecular chemistry of protonated and deprotonated 2,2-dinitroethene-1,1-diamine (FOX-7) studied by tandem mass spectrometry and computational chemistry

      Czech Academy of Sciences Publication Activity Database

      Žabka, Ján; Šimková, Ludmila; Jalový, Z.; Polášek, Miroslav

      2014-01-01

      Roč. 20, č. 3 (2014), s. 233-247 ISSN 1469-0667 R&D Projects: GA ČR GAP206/11/0727 Institutional support: RVO:61388955 Keywords : 2,2-dinitroethene-1,1-diamine * electrospray ionization * chemical ionization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.000, year: 2014

    5. What to Do about Being Overwhelmed: Graduate Students, Stress and University Services

      Science.gov (United States)

      Oswalt, Sara B.; Riddock, Christina C.

      2007-01-01

      Few studies have examined graduate students and stress. At a large, Southeastern university, 223 graduate students completed a survey about factors contributing their stress, current coping strategies and related university services. A majority felt stressed (48.9%) or very stressed (24.7%). There were significant differences in coping strategies…

    6. Antibioticumresistentie in Escherichia coli O 157 geisoleerd tussen 1998 en 2003 in Nederland = Antibiotic resistance in Escherichia coli O157 isolated between 1998 and 2003 in The Netherlands

      NARCIS (Netherlands)

      Roest, H.I.J.; Liebana, E.; Wannet, W.; Duynhoven, van Y.; Veldman, K.T.; Mevius, D.J.

      2007-01-01

      Nederlands: Over het vóórkomen van antibioticumresistentie bij E. coli O157 in Nederland is weinig bekend. In deze studie werden tussen 1998 en 2003 218 humane en 247 niethumane isolaten onderzocht op antibioticumgevoeligheid. Het antibioticumresistentieniveau van E. coli O157 geïsoleerd uit de

    7. 77 FR 25753 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses and Combined Licenses...

      Science.gov (United States)

      2012-05-01

      ... thermal shock are bounded by the current analyses. Systems will continue to operate within their design.... Markley. Entergy Nuclear Operations, Inc., Docket No. 50-247, Indian Point Nuclear Generating Unit 2... the SG tube below the top of the SG tubesheet from periodic inspections. In addition, this amendment...

    8. Sexing monomorphic western mountain greenbuls on Mount Cameroon using morphometric measurements

      Czech Academy of Sciences Publication Activity Database

      Djomo Nana, E.; Munclinger, P.; Ferenc, M.; Sedláček, O.; Albrecht, Tomáš; Hořák, D.

      2014-01-01

      Roč. 49, č. 2 (2014), s. 247-252 ISSN 1562-7020 R&D Projects: GA ČR(CZ) GAP505/11/1617 Institutional support: RVO:68081766 Keywords : morphology * And ropadus tephrolaemus * sex ratio * discriminant function analysis * tropical Africa Subject RIV: EG - Zoology Impact factor: 0.612, year: 2014

    9. Assessment of Self-Efficacy in Systems Engineering as an Indicator of Competency Level Achievement

      Science.gov (United States)

      2014-06-01

      i.e., students, or entry level employees) towards a common goal (i.e., the desired future state) (Ponton et al. 2001, 247). Robbins , Bradley and...04, MIT Sloan, Cambridge, MA. Lucas, William A., Sarah Y. Cooper, Tony Ward, and Frank Cave. 2009. “Industry Placement, Authentic Experience and

    10. Comments on "Proposal for a Regenerative High-Temperature Process for Coal Gas Cleanup with Calcined Limestone"

      Czech Academy of Sciences Publication Activity Database

      Hartman, Miloslav; Trnka, Otakar

      2002-01-01

      Roč. 41, č. 24 (2002), s. 6207-6208 ISSN 0888-5885 R&D Projects: GA ČR GA203/98/0101; GA AV ČR IAA4072711 Keywords : H2S removal * coal gas * limestone Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.247, year: 2002

    11. Ecophysiological characterization of carnivorous plant roots: oxygen fluxes, respiration, and water exudation

      Czech Academy of Sciences Publication Activity Database

      Adamec, Lubomír

      2005-01-01

      Roč. 49, č. 2 (2005), s. 247-255 ISSN 0006-3134 R&D Projects: GA AV ČR(CZ) IAA6005909 Institutional research plan: CEZ:AV0Z6005908 Keywords : terrestrial carnivorous plants * soil anoxia * Genlisea traps Subject RIV: EF - Botanics Impact factor: 0.792, year: 2005

    12. 78 FR 78063 - Appendix 4 to Draft Qualitative Risk Assessment of Risk of Activity/Food Combinations for...

      Science.gov (United States)

      2013-12-24

      ... small or very small businesses that are engaged only in specific types of on-farm food production... Vol. 78 Tuesday, No. 247 December 24, 2013 Part IV Department of Health and Human Services Food... Risk of Activity/ Food Combinations for Activities (Outside the Farm Definition) Conducted in a...

    13. Organizational Commitment DEOCS 4.1 Construct Validity Summary

      Science.gov (United States)

      2017-08-01

      Porter, L. W. (1979). The measurement of organizational commitment. Journal of vocational behavior, 14(2), 224-247. Norusis, M.J., 1993. SPSS for...Windows Base System User’s Guide Release 6.0, SPSS Inc. Porter, L. W., Crampon, W. J., & Smith, F. J. (1976). Organizational commitment and managerial

    14. Bulletin of Materials Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 247-253 Electrical Properties. Impedance spectroscopy ... the a.c. conductivity data. Volume 26 Issue 7 December 2003 pp 745-747 Electrical Properties. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate.

    15. Perceptions of Retirement Affect Career Commitment: The Mediating Role of Retirement System Satisfaction for Two Teacher Age Groups

      Science.gov (United States)

      Smith, Justin L.; Conley, Sharon; You, Sukkyung

      2015-01-01

      This study investigated a sample of California elementary, intermediate, and high school employed teachers (N = 247) to assess the effects of retirement perceptions on career commitment among teachers who are in different age groupings. Using path analysis, the influence of five retirement perceptions variables was examined: concerns about…

    16. 76 FR 38220 - Submission for OMB Review

      Science.gov (United States)

      2011-06-29

      ... Insurance. Form Number: OPIC-247. Frequency of Use: Once per investor per project. Type of Respondents.... Description of Affected Public: U.S. companies or citizens investing overseas. Reporting Hours: 2 hours per... and Uses): The application is the document used by OPIC to determine the investor's and the project's...

    17. Utilfredsstillende langtidsresultater efter konservativ behandling af patellofemoralt smertesyndrom

      DEFF Research Database (Denmark)

      Rathleff, Michael Skovdal; Rasmussen, Sten; Olesen, Jens Lykkegaard

      2012-01-01

      This review overviews the long-term prognosis of conservatively treated patients with patellofemoral pain syndrome (PFPS). Median values of the 16 included studies show that 29% of soldiers, 27.8% of sports active and 24,7% of the general public will become pain free after they are diagnosed...

    18. 78 FR 60981 - Self-Regulatory Organizations; Chicago Board Options Exchange, Incorporated; Order Approving a...

      Science.gov (United States)

      2013-10-02

      ... proposes to define the term ``current index level'' in new Interpretation and Policy .03 to Rule 24.7 to mean the implied forward level based on corresponding volatility index (security) futures prices. See...) whether the ``current index level'' (as measured by the implied forward level based on volatility index...

    19. Engineering as a Social Activity: Preparing Engineers to Thrive in the Changing World of Work

      Science.gov (United States)

      Joyner, Fredricka F.; Mann, Derek T. Y.; Harris, Todd

      2012-01-01

      Key macro-trends are combining to create a new work context for the practice of engineering. Telecommuting and virtual teams create myriad possibilities and challenges related to managing work and workers. Social network technology tools allow for unprecedented global, 24/7 collaboration. Globalization has created hyper-diverse organizations,…

    20. Transport properties of aluminophosphate nanocomposite membranes prepared by in-situ polymerization

      Czech Academy of Sciences Publication Activity Database

      Vaughan, B. R.; Peter, Jakub; Marand, E.; Bleha, Miroslav

      2008-01-01

      Roč. 316, 1-2 (2008), s. 153-163 ISSN 0376-7388 R&D Projects: GA MŠk 1P05ME797 Institutional research plan: CEZ:AV0Z40500505 Keywords : layered aluminophosphate * nanocomposites * gas separation Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.247, year: 2008

    1. Polypyrrole nanotubes: the tuning of morphology and conductivity

      Czech Academy of Sciences Publication Activity Database

      Sapurina, Irina; Li, Yu; Alekseeva, E.; Bober, Patrycja; Trchová, Miroslava; Morávková, Zuzana; Stejskal, Jaroslav

      2017-01-01

      Roč. 113, 24 March (2017), s. 247-258 ISSN 0032-3861 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : conducting polymer * conductivity * dyes Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer sci ence Impact factor: 3.684, year: 2016

    2. Social Support and Physical Health: The Importance of Belonging.

      Science.gov (United States)

      Hale, Cara J.; Hannum, James W.; Espelage, Dorothy L.

      2005-01-01

      Social support is a multifaceted construct recognized as a significant predictor of physical health. In this study, the authors examined several support domains simultaneously in a sample of 247 college students to determine their unique prediction of physical health perceptions and physical symptoms. They also examined gender differences across…

    3. Introduction to the special section: Designing a better user experience for self-service systems

      NARCIS (Netherlands)

      van der Geest, Thea; Ramey, J.; Rosenbaum, S.; van Velsen, Lex Stefan

      2013-01-01

      June 2013 issue of IEEE Transactions on Professional Communication features a special section on 'Designing a Better User Experience for Self-Service Systems'. Self-service systems offers the users the benefit of 24/7 access to an ever-growing range of services and perhaps also a strong sense of

    4. Untitled

      Indian Academy of Sciences (India)

      In vitro antimicrobial-activity studies on the. Imixed ligand complexes of Hg (II) with. 8-hydroxyquinoline and salicylic acids 157. Annuar Bookhari see Magee R J. Aravamuthan S. Determination of nitrobenzidines. Avijit Banerji. 491 ionisation constants of. 311. Reactions of indoles with meruury (II). Salts 247. Bakare P P.

    5. Nedožité devadesátiny Milana Otáhala

      Czech Academy of Sciences Publication Activity Database

      Tůma, Oldřich

      2017-01-01

      Roč. 24, 1/2 (2017), s. 247-251 ISSN 1210-7050 Institutional support: RVO:68378114 Keywords : Milan Otáhal * obituary * historiography Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

    6. Transgenic plants to improve rhizoremediation of polychlorinated biphenyls (PCBs)

      Czech Academy of Sciences Publication Activity Database

      Sylvestre, M.; Macek, Tomáš; Macková, Martina

      2009-01-01

      Roč. 20, č. 2 (2009), s. 242-247 ISSN 0958-1669 R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z40550506 Keywords : bacterial dioxygenases * GM- plants * polychlorinated biphenyls * rhizoremediation Subject RIV: EI - Biotechnology ; Bionics Impact factor: 7.820, year: 2009

    7. Skeletal changes, dental and face of class III skeletal malocclusion treated with philosophy MEAW (Multiloop Edgewise Arch Wire: a descriptive retrospective

      Directory of Open Access Journals (Sweden)

      Ángela Anyur García Bernal

      2013-07-01

      Plano (PP increase of 114,3°a 115,4° and the occlusal plane inclination increased from 17,8°a 24,7°. The average treatment time was 19,4 months. Conclusions: MEAW philosophy is a therapeutic alternative camouflage in the treatment of skeletal Class III malocclusions.

    8. Towards Online Relational Schema Transformations

      NARCIS (Netherlands)

      Wevers, L.; Hofstra, M; Tammens, M; Huisman, Marieke; van Keulen, Maurice

      2014-01-01

      Current relational database systems are ill-equipped for changing the structure of data while the database is in use. This is a real problem for systems for which we expect 24/7 availability, such as telecommunication, payment, and control systems. As a result, developers tend to avoid making

    9. Reálné možnosti reduktivní dehalogenace chlorovaných látek přítomných ve vodách pomocí elementárních kovů

      Czech Academy of Sciences Publication Activity Database

      Kaštánek, František; Čížek, Z.

      2010, č. 3 (2010), s. 247-254 ISSN 1804-0195 R&D Projects: GA MPO FI-IM3/050 Institutional research plan: CEZ:AV0Z40720504 Keywords : reductive dehalogenation * grey cast iron * cast iron with palladium Subject RIV: CI - Industrial Chemistry, Chemical Engineering www.WasteForum.cz

    10. Vorticity and circulation aspects of twin jets in cross-flow for an oblique nozzle arrangement

      Czech Academy of Sciences Publication Activity Database

      Kolář, Václav; Savory, E.; Takao, H.; Todoroki, T.; Okamoto, S.; Toy, N.

      2006-01-01

      Roč. 220, č. 4 (2006), s. 247-252 ISSN 0954-4100 R&D Projects: GA AV ČR IAA2060302 Institutional research plan: CEZ:AV0Z20600510 Keywords : twin jets in cross-flow * vorticity * circulation Subject RIV: BK - Fluid Dynamics Impact factor: 0.143, year: 2006

    11. Quality of Life

      Science.gov (United States)

      Military Child Education DSN: (315) 477-9422 COMM: (808) 477-9422 Individual Contacts Branch Chief, Quality Directory Media Inquiries Home : Resources : Quality of Life J102 Quality of Life and Military Child Education Branch PACOM Quality of Life and Education Facebook Page | USPACOM SAPR 24/7 Emergency Lines and

    12. Enhanced Aircraft Platform Availability Through Advanced Maintenance Concepts and Technologies (Amelioration de la disponibilite des plateformes d’aeronefs au moyen de concepts de maintenance et de technologies evolues)

      Science.gov (United States)

      2011-06-01

      Centralna Biblioteka Wojskowa 1000 Ljubljana NASA Center for AeroSpace Information (CASI) ul. Ostrobramska 109 7115 Standard Drive 04-041 Warszawa ...Building 247 29, Avenue de la Division Leclerc ul. Ostrobramska 109 Porton Down BP 72, 92322 Châtillon Cedex 04-041 Warszawa Salisbury SP4 0JQ

    13. High Cycle Fatigue Damage Mechanisms of MAR-M 247 Superalloy at High Temperatures

      Czech Academy of Sciences Publication Activity Database

      Šmíd, Miroslav; Horník, Vít; Hutař, Pavel; Hrbáček, K.; Kunz, Ludvík

      2016-01-01

      Roč. 69, č. 2 (2016), s. 393-397 ISSN 0972-2815 R&D Projects: GA TA ČR(CZ) TA04011525; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : High cycle fatigue * S-N curves * Fractography * High temperature * EBSD analysis Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.533, year: 2016

    14. Media Madness: With TV and the Internet Available 24/7, Can Libraries Compete?

      Science.gov (United States)

      Jones, Jami

      2004-01-01

      Today's teens face an endless barrage of media--television, movies, radio, the Internet, magazines, and electronic games, not to mention those advertising slogans that shout out at them from billboards, bumper stickers, and even T-shirts. The sheer amount of time that teens spend with media is mind-boggling. Over the course of a year, young adults…

    15. Learning and Teaching 24/7: Daily Internet Usage Patterns at Nine Australian Universities

      Science.gov (United States)

      Spennemann, Dirk H. R.

      2007-01-01

      Purpose: This paper seeks to look at the usage of the internet by students, academics and university administrators as part of their normal working day. It investigates whether access to computer facilities and the mode of study have any influence, or whether other factors need to be considered when providing services. Design/methodology/approach:…

    16. Buli. Mater. Sci., Vol. 20, No. 2, April 1997, pp. 247-257. (C

      Indian Academy of Sciences (India)

      Synthesis of spodumene and spodumene-zirconia composite ... were prepared using aqueous sol-gel method employing lithium formate, aluminium formate, ... synthesis and the processing of spodumene using different precursor compounds.

    17. Radioactive air emissions notice of construction 241-ER-311 catch tank

      International Nuclear Information System (INIS)

      HILL, J.S.

      1999-01-01

      The following description, attachments and references are provided to the Washington State Department of Health (WDOH), Division of Radiation Protection, Air Emissions and Defense Waste Section as a notice of construction (NOC) in accordance with the Washington Administrative Code (WAC) 246-247, Radiation Protection - Air Emissions. The WAC 246-247-060, ''Applications, registration and licensing,'' states ''This section describes the information requirements for approval to construct, modify, and operate an emission unit. Any NOC requires the submittal of the information listed in Appendix A,'' Appendix A (WAC 246-247-110) lists the requirements that must be addressed. Additionally, the following description, attachments and references are provided to the U.S. Environmental Protection Agency (EPA) as an NOC, in accordance with Title 40, Code of Federal Regulations (CFR), Part 6 1, ''National Emission Standards for Hazardous Air Pollutants.'' The information required for submittal to the EPA is specified in 40 CFR 61.07. The potential emissions from this activity are estimated to provide less than 0.1 millirem/year total effective dose equivalent (TEDE) to the hypothetical offsite maximally exposed individual (MEI), and commencement is needed within a short time frame. Therefore, this application is also intended to provide notification of the anticipated date of initial startup in accordance with the requirement listed in 40 CFR 61.09(a)(l), and it is requested that approval of this application will also constitute EPA acceptance of this 40 CFR 61.09(a)(l) notification. Written notification of the actual date of initial startup, in accordance with the requirement listed in 40 CFR 61.09(a)(2) will be provided later

    18. Identification and semi-quantification of biogenic organic nitrates in ambient particulate matters by UHPLC/ESI-MS

      Science.gov (United States)

      Li, Rui; Wang, Xinfeng; Gu, Rongrong; Lu, Chunying; Zhu, Fanping; Xue, Likun; Xie, Huijun; Du, Lin; Chen, Jianmin; Wang, Wenxing

      2018-03-01

      Particulate biogenic organic nitrates (PBONs) are important components of secondary organic aerosols and play an important role in the tropospheric atmosphere chemistry. However, the concentrations and the chemistry of PBONs remain poorly understood due to the lack of accurate measurement techniques on specific organic nitrates. In this study, ultra high performance liquid chromatography/electrospray mass spectrometry was applied in detection of individual PBONs in ambient atmosphere. Total five kinds of PBONs were identified in PM2.5 samples collected in urban Ji'nan in spring according to characteristic fragments of NO2, NO3, HNO3, CO2, and H2O, including monoterpene hydroxyl nitrate (MW = 215, MHN215), pinene keto nitrate (MW = 229, PKN229), limonene di-keto nitrate (MW = 247, LDKN247), oleic acid keto nitrate (MW = 359, OAKN359), and oleic acid hydroxyl nitrate (MW = 361, OAHN361). Among them, three kinds of PBONs originated from biogenic volatile organic compounds of pinene and limonene and two kinds of PBONs came from chemical conversion of oleic acid. The concentrations of these PBONs were roughly quantified with surrogate standards of (1R,2R,5R)-(+)-2-hydroxy-3-pinanone and ricinoleic acid. The average concentrations of MHN215, PKN229, LDKN247, OAKN359, and OAHN361 were 111.6 ± 23.0, 93.1 ± 49.6, 55.3 ± 7.4, 23.4 ± 14.5, 36.8 ± 18.3 ng m-3, respectively. The total concentration of these PBONs was 325.4 ± 116.7 ng m-3, contributing to 1.64 ± 0.34‰ of PM2.5.

    19. PROBING FUNDAMENTAL CONSTANT EVOLUTION WITH REDSHIFTED CONJUGATE-SATELLITE OH LINES

      International Nuclear Information System (INIS)

      Kanekar, Nissim; Chengalur, Jayaram N.; Ghosh, Tapasi

      2010-01-01

      We report Westerbork Synthesis Radio Telescope and Arecibo Telescope observations of the redshifted satellite OH 18 cm lines at z ∼ 0.247 toward PKS 1413+135. The 'conjugate' nature of these lines, with one line in emission and the other in absorption, but with the same shape, implies that the lines arise in the same gas. The satellite OH 18 cm line frequencies also have different dependences on the fine structure constant α, the proton-electron mass ratio μ = m p /m e , and the proton gyromagnetic ratio g p . Comparisons between the satellite line redshifts in conjugate systems can hence be used to probe changes in α, μ, and g p , with few systematic effects. The technique yields the expected null result when applied to Cen.A, a nearby conjugate satellite system. For the z ∼ 0.247 system toward PKS 1413+135, we find, on combining results from the two telescopes, that (ΔG/G) = (-1.18 ± 0.46) x 10 -5 (weighted mean), where G = g p (μα 2 ) 1.85 ; this is tentative evidence (with 2.6 σ significance, or at 99.1% confidence) for a smaller value of α, μ, and/or g p at z ∼ 0.247, i.e., at a lookback time of ∼2.9 Gyr. If we assume that the dominant change is in α, this implies (Δα/α) = (-3.1 ± 1.2) x 10 -6 . We find no evidence that the observed offset might be produced by systematic effects, either due to observational or analysis procedures, or local conditions in the molecular cloud.

    20. Circular dichroism study of the interaction between mutagens and bilirubin bound to different binding sites of serum albumins

      Science.gov (United States)

      Orlov, Sergey; Goncharova, Iryna; Urbanová, Marie

      Although recent investigations have shown that bilirubin not only has a negative role in the organism but also exhibits significant antimutagenic properties, the mechanisms of interactions between bilirubin and mutagens are not clear. In this study, interaction between bilirubin bound to different binding sites of mammalian serum albumins with structural analogues of the mutagens 2-aminofluorene, 2,7-diaminofluorene and mutagen 2,4,7-trinitrofluorenone were investigated by circular dichroism and absorption spectroscopy. Homological human and bovine serum albumins were used as chiral matrices, which preferentially bind different conformers of bilirubin in the primary binding sites and make it observable by circular dichroism. These molecular systems approximated a real system for the study of mutagens in blood serum. Differences between the interaction of bilirubin bound to primary and to secondary binding sites of serum albumins with mutagens were shown. For bilirubin bound to secondary binding sites with low affinity, partial displacement and the formation of self-associates were observed in all studied mutagens. The associates of bilirubin bound to primary binding sites of serum albumins are formed with 2-aminofluorene and 2,4,7-trinitrofluorenone. It was proposed that 2,7-diaminofluorene does not interact with bilirubin bound to primary sites of human and bovine serum albumins due to the spatial hindrance of the albumins binding domains. The spatial arrangement of the bilirubin bound to serum albumin along with the studied mutagens was modelled using ligand docking, which revealed a possibility of an arrangement of the both bilirubin and 2-aminofluorene and 2,4,7-trinitrofluorenone in the primary binding site of human serum albumin.