
Sample records for meitnerium 272

  1. Dirac-Hartree-Fock studies of X-ray transitions in meitnerium

    International Nuclear Information System (INIS)

    Thierfelder, C.; Schwerdtfeger, P.; Hessberger, F.P.; Hofmann, S.


    The K -shell and L -shell ionizations potentials for 268 109 Mt were calculated at the Dirac-Hartree-Fock level taking into account quantum electrodynamic and finite nuclear-size effects. The K α1 transition energies for different ionization states are accurately predicted and compared with recent experiments in the α -decay of 272 111 Rg. (orig.)

  2. 40 CFR 272.2050-272.2099 - [Reserved (United States)


    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false [Reserved] 272.2050-272.2099 Section 272.2050-272.2099 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) APPROVED STATE HAZARDOUS WASTE MANAGEMENT PROGRAMS South Carolina §§ 272.2050-272.2099 [Reserved] ...

  3. 43 CFR 27.2 - Application. (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 27.2 Section 27.2 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN ACTIVITIES CONDUCTED UNDER... II OF PUBLIC LAW 93-153 § 27.2 Application. This part applies to all activities, including...

  4. 12 CFR 272.1 - Authority. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Authority. 272.1 Section 272.1 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES OF PROCEDURE § 272.1 Authority. This part is issued by the Federal Open Market Committee (the Committee) pursuant to the...

  5. 40 CFR 35.272 - Funding coordination. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Funding coordination. 35.272 Section 35.272 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE....272 Funding coordination. Recipients must use the lead-based paint program funding in a way that...

  6. 36 CFR 272.4 - Commercial use. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Commercial use. 272.4 Section... OWLâ SYMBOL § 272.4 Commercial use. (a) General. The Chief may authorize the Commercial manufacture... charge, royalty charge, or payment in kind which is reasonably related to the commercial value has been...

  7. 14 CFR 272.1 - Purpose. (United States)


    ... and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.1 Purpose. Paragraph 5 of Article IX... Transportation (Department), as successor to the Civil Aeronautics Board (Board), to guarantee essential air...

  8. 14 CFR 272.12 - Termination. (United States)


    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.12 Termination. These provisions shall terminate on October 1, 1998, unless the program of essential air service to the Federated States of...

  9. 14 CFR 272.2 - Applicability. (United States)


    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.2 Applicability. This part establishes the provisions applicable to the Department's guarantee of essential air service to places in the...

  10. 12 CFR 272.4 - Committee actions. (United States)


    ... and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES OF PROCEDURE § 272... System Open Market Account. All communications of recommended actions and votes under this paragraph... execution of any operations pursuant to the action, the action is null and void unless it is ratified and...

  11. 48 CFR 719.272 - Small disadvantaged business policies. (United States)


    ... business policies. 719.272 Section 719.272 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.272 Small disadvantaged business... subcontracting with small disadvantaged businesses and other disadvantaged enterprises based on provisions of the...

  12. 32 CFR 272.3 - Definition of basic research. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Definition of basic research. 272.3 Section 272...) MISCELLANEOUS ADMINISTRATION AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.3 Definition of... increasing fundamental knowledge and understanding in those fields of the physical, engineering...

  13. 14 CFR 272.5 - Determination of essential air service. (United States)


    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.5 Determination of essential air service. Procedures for the determination of essential air service under this... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Determination of essential air service. 272...

  14. 7 CFR 272.10 - ADP/CIS Model Plan. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false ADP/CIS Model Plan. 272.10 Section 272.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... benefit computation (including but not limited to all household members' names, addresses, dates of birth...

  15. 50 CFR 216.272 - Permissible methods of taking. (United States)


    ...) (iii) Pinnipeds: (A) Northern elephant seal (Mirounga angustirostris)—4795 (an average of 959 annually... of the species listed in § 216.272(c)(1)(ii)(D) through (G) over the course of the 5-year regulations. ...

  16. 14 CFR 272.8 - Obligation to continue service. (United States)


    ... PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.8 Obligation to... eligible Freely Associated State place below the level of essential air service to such place, whether or not the Department has previously determined the level of essential air service to such place, the...

  17. 14 CFR 272.7 - Notice of discontinuance of service. (United States)


    ... PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.7 Notice of... of essential air service for such place, the level of service specified in Order 80-9-63; and (2) If the Department has made a determination of essential air service for such place, that level of...

  18. 36 CFR 27.2 - Commercial and industrial activities. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Commercial and industrial... INTERIOR CAPE COD NATIONAL SEASHORE; ZONING STANDARDS § 27.2 Commercial and industrial activities. No commercial or industrial districts may be established within the Cape Cod National Seashore. ...

  19. 47 CFR 25.272 - General inter-system coordination procedures. (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false General inter-system coordination procedures. 25.272 Section 25.272 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.272 General inter-system coordination...

  20. 14 CFR 272.6 - Considerations in the determination of essential air service. (United States)


    ... essential air service. 272.6 Section 272.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.6 Considerations in the determination of essential air service. (a) In the determination of...

  1. Protein expression of Myt272-3 recombinant clone and in silico ...

    African Journals Online (AJOL)

    Purpose: To investigate the expression of Myt272-3 recombinant protein and also to predict a possible protein vaccine candidate against Mycobacterium tuberculosis. Methods: Myt272-3 protein was expressed in pET30a+-Myt272-3 clone. The purity of the protein was determined using Dynabeads® His-Tag Isolation ...

  2. 37 CFR 2.72 - Amendments to description or drawing of the mark. (United States)


    ... drawing of the mark. 2.72 Section 2.72 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND....72 Amendments to description or drawing of the mark. (a) In an application based on use in commerce under section 1(a) of the Act, the applicant may amend the description or drawing of the mark only if...

  3. 34 CFR 272.10 - What types of projects may be funded? (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false What types of projects may be funded? 272.10 Section... Activities Does the Secretary Fund Under This Program? § 272.10 What types of projects may be funded? (a) The Secretary may award funds to DACs for projects offering technical assistance (including training) to school...

  4. Mutation analysis of 272 Spanish families affected by autosomal recessive retinitis pigmentosa using a genotyping microarray.

    NARCIS (Netherlands)

    Avila-Fernandez, A.; Cantalapiedra, D.; Aller, E.; Vallespin, E.; Aguirre-Lamban, J.; Blanco-Kelly, F.; Corton, M.; Riveiro-Alvarez, R.; Allikmets, R.; Trujillo-Tiebas, M.J.; Millan, J.M.; Cremers, F.P.M.; Ayuso, C.


    PURPOSE: Retinitis pigmentosa (RP) is a genetically heterogeneous disorder characterized by progressive loss of vision. The aim of this study was to identify the causative mutations in 272 Spanish families using a genotyping microarray. METHODS: 272 unrelated Spanish families, 107 with autosomal

  5. Draft Genome Sequence of Antimicrobial-Producing Clostridium sp. JC272, Isolated from Marine Sediment


    Tushar, L.; Sasi Jyothsna, T. S.; Sasikala, C.; Ramana, C. V.


    We announce the draft genome sequence of Clostridium sp. JC272, isolated from a sediment sample collected from marine habitats of Gujarat, India. Clostridium sp. JC272 is an obligate anaerobe and has the ability to produce antimicrobial compounds. The genome sequence indicates the strain?s capability of producing small peptides (microcins), which are potential novel antibiotics.

  6. Dendritic cell activation and maturation induced by recombinant calreticulin fragment 39-272. (United States)

    Li, Yue; Zeng, Xiaoli; He, Lijuan; Yuan, Hui


    Dendritic cells (DC) are the most potent antigen-presenting cells for initiating immune responses. DC maturation can be induced by exposing of immature DC to pathogen products or pro-inflammatory factor, which dramatically enhances the ability of DC to activate Ag-specific T cells. In this study, a recombinant calreticulin fragment 39-272 (rCRT/39-272) covering the lectin-like N domain and partial P domain of murine CRT has been expressed and purified in Escherichia coli. Functional analysis studies revealed that rCRT/39-272 has potent immunostimulatory activities in both activating human monocytes and B cells to secrete cytokines. rCRT/39-272 can drive the activation of bone marrow derived DC in TLR4/CD14 dependent way, as indicated by secretion of cytokines IL-12/IL-23 (p40) and IL-1β. Exposure of DC to rCRT/39-272 induces P-Akt, suggesting that rCRT/39-272 induces maturation of DC through PI3K/Akt signaling pathway. The results suggest that soluble rCRT/39-272 is a potent stimulatory agent to DC maturation in TLR4/CD14 and PI3K/Akt dependent pathway. It may play important roles in initiating cellular immunity in vivo and the T cell response in vitro. Thus it could be used for study of DC-based tumor vaccines.

  7. 20 CFR 404.272 - Indexes we use to measure the rise in the cost-of-living. (United States)


    ... cost-of-living. 404.272 Section 404.272 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.272 Indexes we use to measure the rise in the cost-of-living. (a) The bases. To measure...

  8. Solvent extraction of thorium from nitrate medium by TBP, Cyanex272 and their mixture

    International Nuclear Information System (INIS)

    Mostaan Shaeri; Ahmad Rahbar Kelishami; Meisam Torab-Mostaedi


    The extraction behavior of thorium(IV) has been investigated with tri-butyl phosphate (TBP) and bis(2,4,4-trimethylpentyl) phosphinic acid (Cyanex272) in kerosene from nitrate medium. The effect of operating variables including time, aqueous phase acidity (pH), extractant concentration and temperature were investigated. This study also examined the synergistic enhancement of the extraction of thorium(IV) from nitrate medium by mixtures of TBP and Cyanex272 for the first time. The optimum synergistic enhancement factor of 3.86 was obtained at a Cyanex272/TBP molar ratio of 1:4. (author)

  9. Anti-proliferative activity of the quassinoid NBT-272 in childhood medulloblastoma cells

    Directory of Open Access Journals (Sweden)

    Helson Lawrence


    Full Text Available Abstract Background With current treatment strategies, nearly half of all medulloblastoma (MB patients die from progressive tumors. Accordingly, the identification of novel therapeutic strategies remains a major goal. Deregulation of c-MYC is evident in numerous human cancers. In MB, over-expression of c-MYC has been shown to correlate with anaplasia and unfavorable prognosis. In neuroblastoma – an embryonal tumor with biological similarities to MB – the quassinoid NBT-272 has been demonstrated to inhibit cellular proliferation and to down-regulate c-MYC protein expression. Methods To study MB cell responses to NBT-272 and their dependence on the level of c-MYC expression, DAOY (wild-type, empty vector transfected or c-MYC transfected, D341 (c-MYC amplification and D425 (c-MYC amplification human MB cells were used. The cells were treated with different concentrations of NBT-272 and the impact on cell proliferation, apoptosis and c-MYC expression was analyzed. Results NBT-272 treatment resulted in a dose-dependent inhibition of cellular proliferation (IC50 in the range of 1.7 – 9.6 ng/ml and in a dose-dependent increase in apoptotic cell death in all human MB cell lines tested. Treatment with NBT-272 resulted in up to 90% down-regulation of c-MYC protein, as demonstrated by Western blot analysis, and in a significant inhibition of c-MYC binding activity. Anti-proliferative effects were slightly more prominent in D341 and D425 human MB cells with c-MYC amplification and slightly more pronounced in c-MYC over-expressing DAOY cells compared to DAOY wild-type cells. Moreover, treatment of synchronized cells by NBT-272 induced a marked cell arrest at the G1/S boundary. Conclusion In human MB cells, NBT-272 treatment inhibits cellular proliferation at nanomolar concentrations, blocks cell cycle progression, induces apoptosis, and down-regulates the expression of the oncogene c-MYC. Thus, NBT-272 may represent a novel drug candidate to inhibit

  10. Liquid-liquid extraction of uranium (VI) using Cyanex 272 in kerosene from sodium salicylate medium

    International Nuclear Information System (INIS)

    Kamble, Pravin N.; Mohite, Baburao S.; Suryavanshi, Vishal J.; Salunkhe, Suresh T.


    Liquid-liquid extraction of uranium (VI) from sodium salicylate media using Cyanex 272 in kerosene has been carried out. Uranium (VI) was quantitatively extracted from 1x10 -4 M sodium salicylate with 5x10 -4 M Cyanex 272 in kerosene. It was stripped quantitatively from the organic phase with 4M HCl and determined spectrophotometrically with arsenazo(III) at 600 nm. The effects of concentrations of sodium salicylate, metal ions and strippants have been studied. Separation of uranium (VI) from other elements was achieved from binary as well as from multicomponent mixtures. The method is simple, rapid and selective with good reproducibility (approximately ±2%). (author)

  11. 75 FR 29975 - Expansion of Foreign-Trade Zone 272; Lehigh Valley, Pennsylvania (United States)


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1679] Expansion of Foreign-Trade Zone 272; Lehigh Valley, Pennsylvania Pursuant to its authority under the Foreign-Trade Zones Act of June... Bethlehem, Pennsylvania, adjacent to the Philadelphia Customs and Border Protection port of entry (FTZ...

  12. 14 CFR 272.3 - Places eligible for guaranteed essential air service. (United States)


    ... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.3 Places eligible for guaranteed essential air service. (a) Subject to the provisions of this part... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Places eligible for guaranteed essential...

  13. 7 CFR 272.11 - Systematic Alien Verification for Entitlements (SAVE) Program. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Systematic Alien Verification for Entitlements (SAVE... FOR PARTICIPATING STATE AGENCIES § 272.11 Systematic Alien Verification for Entitlements (SAVE... and Naturalization Service (INS), in order to verify the validity of documents provided by aliens...

  14. Collective dipole motion in highly excited (272)Hs (Z=108) nuclei

    NARCIS (Netherlands)

    Tveter, TS; Gaardhoje, JJ; Maj, A; Ramsay, T; Atac, A; Bacelar, J; Bracco, A; Buda, A; Camera, F; Herskind, B; Korten, W; Krolas, W; Menthe, A; Million, B; Nifenecker, H; Pignanelli, M; Pinston, JA; vanderPloeg, H; Schussler, F; Sletten, G


    The heavy nucleus (272)(108)Hs (Z = 108) and its evaporation daughters were produced using the reaction Th-232(Ar-40, gamma xn) with beam energies 10.5 and 15.0 MeV/A. The giant dipole resonance gamma radiation from the hot composite system prior to fission has been isolated using a differential

  15. Preformulation stability study of the EGFR inhibitor HKI-272 (Neratinib) and mechanism of degradation. (United States)

    Lu, Qinghong; Ku, Mannching Sherry


    The stability in solution of HKI-272 (Neratinib) was studied as a function of pH. The drug is most stable from pH 3 to 4, and degradation rate increases rapidly around pH 6 and appears to approach a maximum asymptotic limit in the range of pH 812. Pseudo first-order reaction kinetics was observed at all pH values. The structure of the major degradation product indicates that it is formed by a cascade of reactions within the dimethylamino crotonamide group of HKI-272. It is assumed that the rate-determining step is the initial isomerization from allyl amine to enamine functionality, followed by hydrolysis and subsequent cyclization to a stable lactam. The maximum change in degradation rate as a function of pH occurs at about pH 6, which corresponds closely to the theoretical pKa value of the dimethylamino group of HKI-272 when accounting for solvent/temperature effects. The observed relationship between pH and degradation rate is discussed, and a self-catalyzed mechanism for the allylamine-enamine isomerization reaction is proposed. The relevance of these findings to other allylamine drugs is discussed in terms of the relative stability of the allylic anion intermediate through which, the isomerization occurs.

  16. Recovery of Ni Metal from Spent Catalyst with Emulsion Liquid Membrane Using Cyanex 272 as Extractant (United States)

    Yuliusman; Huda, M.; Ramadhan, I. T.; Farry, A. R.; Wulandari, P. T.; Alfia, R.


    In this study was conducted to recover nickel metal from spent nickel catalyst resulting from hydrotreating process in petroleum industry. The nickel extraction study with the emulsion liquid membrane using Cyanex 272 as an extractant to extract and separate nickel from the feed phase solution. Feed phase solution was preapred from spent catalyst using sulphuric acid. Liquid membrane consists of a kerosene as diluent, a Span 80 as surfactant, a Cyanex 272 as carrier and sulphuric acid solutions have been used as the stripping solution. The important parameters governing the permeation of nickel and their effect on the separation process have been studied. These parameters are surfactant concentration, extractant concentration feed phase pH. The optimum conditions of the emulsion membrane making process is using 0.06 M Cyanex 272, 8% w/v SPAN 80, 0.05 M H2SO4, internal phase extractant / phase volume ratio: 1/1, and stirring speed 1150 rpm for 60 Minute that can produce emulsion membrane with stability level above 90% after 4 hours. In the extraction process with optimum condition pH 6 for feed phase, ratio of phase emulsion/phase of feed: 1/2, and stirring speed 175 rpm for 15 minutes with result 81.51% nickel was extracted.

  17. Load test of the 272E Building high bay roof deck and support structure

    International Nuclear Information System (INIS)

    McCoy, R.M.


    The 272E Building high bay roof area was load tested according to the approved load-test procedure. The 272E Building is located in the 200 East Area of the Hanford Site and has the following characteristics: Roof deck -- wood decking supported by 4 x 14 timber purlins; Roof membrane -- tar and gravel; Roof slope -- flat (<10 deg); and Roof elevation -- maximum height of about 63 ft. The 272 Building was visited in August 1992 for a visual inspection. During this inspection, cracked areas were visible in the decking, but it was not possible to determine whether these cracks extended completely through the decking, which is 2-in. thick. The building was revisited in March 1994 for the purpose of writing this test report. Because the roof requires personnel access, a test was determine to be the best way to qualify the roof. The pre-test briefing consisted of filling out the pre-test checklist, discussing proper lifting techniques, reviewing the fall-protection plan, reviewing the job hazards analysis, and reviewing the robot travel path. The load-test results consist of visual observations and the test engineer's conclusions. Visual observations found no adverse conditions such as large deflections or permanent deformations. No deflection measurements were recorded because the tar and gravel on roof get displaced by the robot tracks; the result is large variations in deflection measurements. The conclusions are that the roof has been qualified for 500-lb total roof load and that the ''No Roof Access'' signs can be changed to ''Roof Access Restricted'' signs


    Directory of Open Access Journals (Sweden)



    Full Text Available Discarded cell phones contribute significantly to the amount of electronic waste generation whilst some of its components are toxic and recoverable. Also, due to the increasing demand for Cu(II in building/construction, electrical and as chemical tool in freshwater, it is imperative to develop low cost and ecofriendly technique as a substitute for the conventional treatments such as reduction-roasting route at elevated temperatures. In the present study, the hydrometallurgical operations involving leaching, solvent extraction and precipitation for the recovery of Cu(II by Cyanex® 272 in kerosene was examined. Various parameters affecting the extraction of Cu(II such as pH, extractant concentration and phase ratio were optimized. At optimal conditions, about 96.3 % Cu(II was extracted into the organic phase by 0.2 mol/L Cyanex® 272 at equilibrium pH 5.0 and aqueous to organic phase ratio 1:1. The stripping of the loaded organic was carried out by 0.1 mol/L HCl solution and stripping efficiency of 98 % was obtained. By McCabe Thiele diagram, four stages are required for complete extraction of Cu(II.

  19. Mutation analysis of 272 Spanish families affected by autosomal recessive retinitis pigmentosa using a genotyping microarray. (United States)

    Ávila-Fernández, Almudena; Cantalapiedra, Diego; Aller, Elena; Vallespín, Elena; Aguirre-Lambán, Jana; Blanco-Kelly, Fiona; Corton, M; Riveiro-Álvarez, Rosa; Allikmets, Rando; Trujillo-Tiebas, María José; Millán, José M; Cremers, Frans P M; Ayuso, Carmen


    Retinitis pigmentosa (RP) is a genetically heterogeneous disorder characterized by progressive loss of vision. The aim of this study was to identify the causative mutations in 272 Spanish families using a genotyping microarray. 272 unrelated Spanish families, 107 with autosomal recessive RP (arRP) and 165 with sporadic RP (sRP), were studied using the APEX genotyping microarray. The families were also classified by clinical criteria: 86 juveniles and 186 typical RP families. Haplotype and sequence analysis were performed to identify the second mutated allele. At least one-gene variant was found in 14% and 16% of the juvenile and typical RP groups respectively. Further study identified four new mutations, providing both causative changes in 11% of the families. Retinol Dehydrogenase 12 (RDH12) was the most frequently mutated gene in the juvenile RP group, and Usher Syndrome 2A (USH2A) and Ceramide Kinase-Like (CERKL) were the most frequently mutated genes in the typical RP group. The only variant found in CERKL was p.Arg257Stop, the most frequent mutation. The genotyping microarray combined with segregation and sequence analysis allowed us to identify the causative mutations in 11% of the families. Due to the low number of characterized families, this approach should be used in tandem with other techniques.

  20. Extraction and Separation of Cobalt and Nickel with Extractants Cyanex 302, Cyanex 272 and Their Mixture

    Directory of Open Access Journals (Sweden)

    Lenhard, Z.


    Full Text Available The extraction and separation of cobalt(II and nickel(II from sulphate solutions with different initial volume fractions of commercial organophosphorus extractants Cyanex 302, Cyanex 272 and their mixture, in kerosene as diluent, were investigated. Prepared samples contained the mixture of cobalt(II and nickel(II in mass concentrations chosen to approximate the mass concentrations of the two metals in solutions obtained by leaching typical low-grade ores or waste materials with sulphuric acid. The experiments were carried out at two concentration ratios of nickel to cobalt(ζNi/Co, 25 and 125. The latter ratio was chosen as model for the solutions of naturally occurring ores and other materials in which the concentration of nickel is much higher than that of cobalt. In all cases, the concentration of cobalt was approximately y= 0.15 g L–1, and the concentration of nickel was approximately g= 3.80 g L–1 (at ζNi/Co = 25 and 18.80 g L–1 (at ζNi/Co = 125. Other initial values were based on conditions found to be optimal in previous investigations, and kept constant in all experiments: pH0= 8, θ0 = 25 °C, phase volume ratio organic to aqueous ψ = 1 and 0.5, contact time 2 minutes.The tested fractions of extractants (Cyanex 302 or Cyanex 272, diluted in kerosene, were j = 2.5, 5.0, 7.5 and φ = 10 %. The studies of the mixture of extractants were carried out at two sets of fractions. In the first set, the fraction of Cyanex 302 was kept at φ = 10 %, and Cyanex 272 was varied in the range φ = 2.5 –10 %. In the second set, the mass concentration of each of the two extractants was varied in the range φ = 2.5–10 % so that the total fraction of the two extractants always added up to φ= 10 %.The obtained results describe the influences of type and initial volume fraction of extractant on the separation and extraction of cobalt and nickel. Under the investigated range of conditions, Cyanex 302 outperformed Cyanex 272 in cobalt

  1. 14 CFR 272.9 - Selection of a carrier to provide essential air service and payment of compensation. (United States)


    ... SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES § 272.9 Selection of a carrier to provide essential air service and... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Selection of a carrier to provide essential...

  2. 30 CFR 250.272 - If a State objects to the DPP's or DOCD's coastal zone consistency certification, what can I do? (United States)


    ... coastal zone consistency certification, what can I do? 250.272 Section 250.272 Mineral Resources MINERALS... objects to the DPP's or DOCD's coastal zone consistency certification, what can I do? If an affected State objects to the coastal zone consistency certification accompanying your proposed or disapproved DPP or...

  3. Traditional Chinese Medicine Syndromes for Essential Hypertension: A Literature Analysis of 13,272 Patients

    Directory of Open Access Journals (Sweden)

    Jie Wang


    Full Text Available Background. To simplify traditional Chinese medicine syndrome differentiation and allow researchers to master syndrome differentiation for hypertension, this paper retrospectively studied the literature and analyzed syndrome elements corresponding to hypertension syndromes. Methods. Six databases including PubMed, EMBASE, Chinese Bio-Medical Literature Database, Chinese National Knowledge Infrastructure, Chinese Scientific Journal Database, and Wan-fang Data were searched from 1/January/2003 to 30/October/2013. We included all clinical literature testing hypertension syndromes and retrospectively studied the hypertension literature published from 2003 to 2013. Descriptive statistics calculated frequencies and percentages. Results. 13,272 patients with essential hypertension were included. Clinical features of hypertension could be attributed to 11 kinds of syndrome factors. Among them, seven syndrome factors were excess, while four syndrome factors were deficient. Syndrome targets were mainly in the liver and related to the kidney and spleen. There were 33 combination syndromes. Frequency of single-factor syndromes was 31.77% and frequency of two-factor syndromes was 62.26%. Conclusions. Excess syndrome factors of hypertension patients include yang hyperactivity, blood stasis, phlegm turbidity, internal dampness, and internal fire. Deficient syndrome factors of hypertension patients are yin deficiency and yang deficiency. Yin deficiency with yang hyperactivity, phlegm-dampness retention, and deficiency of both yin and yang were the three most common syndromes in clinical combination.

  4. Genotyping-by-sequencing data of 272 crested wheatgrass (Agropyron cristatum genotypes

    Directory of Open Access Journals (Sweden)

    Pingchuan Li


    Full Text Available Crested wheatgrass [Agropyron cristatum L. (Gaertn.] is an important cool-season forage grass widely used for early spring grazing. However, the genomic resources for this non-model plant are still lacking. Our goal was to generate the first set of next generation sequencing data using the genotyping-by-sequencing technique. A total of 272 crested wheatgrass plants representing seven breeding lines, five cultivars and five geographically diverse accessions were sequenced with an Illumina MiSeq instrument. These sequence datasets were processed using different bioinformatics tools to generate contigs for diploid and tetraploid plants and SNPs for diploid plants. Together, these genomic resources form a fundamental basis for genomic studies of crested wheatgrass and other wheatgrass species. The raw reads were deposited into Sequence Read Archive (SRA database under NCBI accession SRP115373 ( and the supplementary datasets are accessible in Figshare (10.6084/m9.figshare.5345092. Keywords: Crested wheatgrass, Genotyping-by-sequencing, Diploid, Tetraploid, Raw sequence data

  5. The extraction of zinc and other minor metals from concentrated ammonium chloride solutions with D2EHPA and Cyanex 272

    Directory of Open Access Journals (Sweden)

    Amer, S.


    Full Text Available A comparative study is made of the extractants D2EHPA and Cyanex 272 for the zinc and minor metal extraction from aqueous concentrated ammonium chloride solutions, as those of the leaching liquors of the CENIM-LNETI process. Extraction equilibrium data for zinc are presented as extraction isotherms at constant pH and at a temperature of 50 °C. Zinc extraction and coextraction of minor metal ions as Cu, Ca, Pb, Mg, Cd, Co, Ni and Hg are studied. Mercury does not extract from concentrated ammonium chloride solutions. Cyanex 272 shows a better selectivity for zinc with regard to the minor metals than D2EHPA, which is especially remarkable for calcium, the most coextracted element by D2EHPA. Nickel and cadmium coextraction is negligible for both extractants. The possible use of the Cyanex 272 as an alternative to D2EHPA is considered.

    Se realiza un estudio comparativo del comportamiento del D2EHPA y del Cyanex 272 durante la extracción del cinc y otros metales minoritarios de soluciones acuosas concentradas de cloruro amónico, como las de las soluciones de lixiviación del proceso CENIM-LNETI. Se presentan los datos de equilibrio de extracción del cinc en forma de isotermas de extracción a una temperatura de 50 °C y pH constante y se estudia la coextracción de los metales minoritarios Cu, Ca, Pb, Mg, Cd, Co, Ni y Hg. El mercurio no se extrae de las soluciones concentradas de cloruro amónico. La selectividad del Cyanex 272 para el cinc respecto de esos metales minoritarios es mejor que la del D2EHPA, siendo verdaderamente notable para el calcio, que es la impureza que más se coextrae con el D2EHPA. La coextracción de níquel y de cadmio es muy pequeña para ambos extractantes. Se considera la posibilidad del uso alternativo del Cyanex 272 en lugar del D2EHPA.

  6. Liquid-liquid extraction of uranium(VI) using Cyanex 272 in toluene from sodium salicylate medium

    International Nuclear Information System (INIS)

    Madane, Namdev S.; Nikam, Gurunath H.; Jadhav, Deepali V.; Mohite, Baburao S.


    Liquid-liquid extraction of U(VI) from sodium salicylate media using Cyanex 272 in toluene has been carried out. Uranium(VI) was quantitatively extracted from 1 x 10 -3 M sodium salicylate with 5 x 10 -4 M Cyanex 272 in toluene. It was stripped quantitatively from the organic phase with 1M HCl and determined spectrophotometrically with arsenazo(III) at 660 nm. The effect of concentrations of sodium salicylate, extractant, diluents, metal ion and strippants have been studied. Separation of uranium(VI) from other elements was achieved from binary as well as from multicomponent mixtures. The method was extended to determination of uranium(VI) in geological samples. The method is simple, rapid and selective with good reproducibility (approximately ± 2%). (author)

  7. ECG changes in factory workers exposed to 27.2  MHz radiofrequency radiation. (United States)

    Chen, Qingsong; Xu, Guoyong; Lang, Li; Yang, Aichu; Li, Shilin; Yang, Liwen; Li, Chaolin; Huang, Hanlin; Li, Tao


    To research the effect of 27.2 MHz radiofrequency radiation on electrocardiograms (ECG), 225 female workers operating radiofrequency machines at a shoe factory were chosen as the exposure group and 100 female workers without exposure from the same factory were selected as the control group. The 6 min electric field strength that the female workers were exposed to was 64.0 ± 25.2 V/m (mean ± SD), which exceeded 61 V/m, the International Commission on Non-Ionizing Radiation Protection reference root mean square levels for occupational exposure. A statistical difference was observed between the exposed group and the control group in terms of the rate of sinus bradycardia (χ(2)  = 11.48, P = 0.003). When several known risk factors for cardiovascular disease were considered, including smoking, age, alcohol ingestion habit, and so on, the exposure duration was not an effective factor for ECG changes, sinus arrhythmia, or sinus bradycardia according to α = 0.05, while P = 0.052 for sinus arrhythmia was very close to 0.05. We did not find any statistical difference in heart rate, duration of the QRS wave (ventricular depolarization), or corrected QT intervals (between the start of the Q wave and end of the T wave) between the exposed and control groups. Occupational exposure to radiofrequency radiation was not found to be a cause of ECG changes after consideration of the confounding factors. Copyright © 2012 Wiley Periodicals, Inc.

  8. Ambient Ozone Pollution and Daily Mortality: A Nationwide Study in 272 Chinese Cities. (United States)

    Yin, Peng; Chen, Renjie; Wang, Lijun; Meng, Xia; Liu, Cong; Niu, Yue; Lin, Zhijing; Liu, Yunning; Liu, Jiangmei; Qi, Jinlei; You, Jinling; Zhou, Maigeng; Kan, Haidong


    Few large multicity studies have been conducted in developing countries to address the acute health effects of atmospheric ozone pollution. We explored the associations between ozone and daily cause-specific mortality in China. We performed a nationwide time-series analysis in 272 representative Chinese cities between 2013 and 2015. We used distributed lag models and over-dispersed generalized linear models to estimate the cumulative effects of ozone (lagged over 0-3 d) on mortality in each city, and we used hierarchical Bayesian models to combine the city-specific estimates. Regional, seasonal, and demographic heterogeneity were evaluated by meta-regression. At the national-average level, a 10-μg/m 3 increase in 8-h maximum ozone concentration was associated with 0.24% [95% posterior interval (PI): 0.13%, 0.35%], 0.27% (95% PI: 0.10%, 0.44%), 0.60% (95% PI: 0.08%, 1.11%), 0.24% (95% PI: 0.02%, 0.46%), and 0.29% (95% PI: 0.07%, 0.50%) higher daily mortality from all nonaccidental causes, cardiovascular diseases, hypertension, coronary diseases, and stroke, respectively. Associations between ozone and daily mortality due to respiratory and chronic obstructive pulmonary disease specifically were positive but imprecise and nonsignificant. There were no statistically significant differences in associations between ozone and nonaccidental mortality according to region, season, age, sex, or educational attainment. Our findings provide robust evidence of higher nonaccidental and cardiovascular mortality in association with short-term exposure to ambient ozone in China.

  9. Fine Particulate Air Pollution and Daily Mortality. A Nationwide Analysis in 272 Chinese Cities. (United States)

    Chen, Renjie; Yin, Peng; Meng, Xia; Liu, Cong; Wang, Lijun; Xu, Xiaohui; Ross, Jennifer A; Tse, Lap A; Zhao, Zhuohui; Kan, Haidong; Zhou, Maigeng


    Evidence concerning the acute health effects of air pollution caused by fine particulate matter (PM 2.5 ) in developing countries is quite limited. To evaluate short-term associations between PM 2.5 and daily cause-specific mortality in China. A nationwide time-series analysis was performed in 272 representative Chinese cities from 2013 to 2015. Two-stage Bayesian hierarchical models were applied to estimate regional- and national-average associations between PM 2.5 concentrations and daily cause-specific mortality. City-specific effects of PM 2.5 were estimated using the overdispersed generalized additive models after adjusting for time trends, day of the week, and weather conditions. Exposure-response relationship curves and potential effect modifiers were also evaluated. The average of annual mean PM 2.5 concentration in each city was 56 μg/m 3 (minimum, 18 μg/m 3 ; maximum, 127 μg/m 3 ). Each 10-μg/m 3 increase in 2-day moving average of PM 2.5 concentrations was significantly associated with increments in mortality of 0.22% from total nonaccidental causes, 0.27% from cardiovascular diseases, 0.39% from hypertension, 0.30% from coronary heart diseases, 0.23% from stroke, 0.29% from respiratory diseases, and 0.38% from chronic obstructive pulmonary disease. There was a leveling off in the exposure-response curves at high concentrations in most, but not all, regions. The associations were stronger in cities with lower PM 2.5 levels or higher temperatures, and in subpopulations with elder age or less education. This nationwide investigation provided robust evidence of the associations between short-term exposure to PM 2.5 and increased mortality from various cardiopulmonary diseases in China. The magnitude of associations was lower than those reported in Europe and North America.

  10. Calreticulin Fragment 39-272 Promotes B16 Melanoma Malignancy through Myeloid-Derived Suppressor Cells In Vivo

    Directory of Open Access Journals (Sweden)

    Xiao-Yan He


    Full Text Available Calreticulin (CRT, a multifunctional Ca2+-binding glycoprotein mainly located in the endoplasmic reticulum, is a tumor-associated antigen that has been shown to play protective roles in angiogenesis suppression and anti-tumor immunity. We previously reported that soluble CRT (sCRT was functionally similar to heat shock proteins or damage-associated molecular patterns in terms of ability to activate myeloid cells and elicit strong inflammatory cytokine production. In the present study, B16 melanoma cell lines expressing recombinant CRT fragment 39-272 (sCRT/39-272 in secreted form (B16-CRT, or recombinant enhanced green fluorescence protein (rEGFP (B16-EGFP, were constructed for investigation on the roles of sCRT in tumor development. When s.c. inoculated into C57BL/6 mice, the B16-CRT cells were significantly more aggressive (in terms of solid tumor growth rate than B16-EGFP controls in a TLR4- and myeloid-derived suppressor cells (MDSC-dependent manner. The B16-CRT-bearing mice showed increased Gr1+ MDSC infiltration in tumor tissues, accelerated proliferation of CD11b+Ly6G+Ly6Clow (G-MDSC precursors in bone marrow, and higher percentages of G-MDSCs in spleen and blood, which was mirrored by decreased percentage of dendritic cells (DC in periphery. In in vitro studies, recombinant sCRT/39-272 was able to promote migration and survival of tumor-derived MDSCs via interaction with TLR4, inhibit MDSC differentiation into DC, and also elicit expression of inflammatory proteins S100A8 and S100A9 which are essential for functional maturation and chemotactic migration of MDSCs. Our data provide solid evidence for CRT as a double-edged sword in tumor development.

  11. [A protective effect of GLY272SER polymorphism of GNB3 gene in development of essential hypertension and its relations with environmental hypertension risk factors]. (United States)

    Polonikov, A V; Solodilova, M A; Ivanov, V P; Shestakov, A M; Ushachev, D V; Vialykh, E K; Vasil'eva, O V; Poliakova, N V; Antsupov, V V; Kabanina, V A; Kupriianova, Ia S; Bulgakova, I V; Kozhukhov, M A; Tevs, D S


    To study associations of C825T (rs5443) and G272S (rs16932941) polymorphisms of GNB3 gene in Russian population of the Central Chernozem region with essential hypertension (EH) risk; to elicit the role of environmental risk factors in realization of EH predisposition in this gene genotypes carriers. We studied DNA samples obtained from 205 EH patients and 207 healthy individuals. EH patients were treated in Kursk hospitals. Genotyping of GNB3 gene polymorphisms was conducted by polymerase chain reaction and restriction analysis. Prevalence of 82ST allele of GNB3 gene in EH patients and healthy individual was 0.334 and 0.295, respectively, of 272S allele--0.037 and 0.058, respectively. We found no significant differences by prevalence of genotypes of gene GNB3 polymorphisms C825T and G272S in EH patients and healthy individuals. Non-smoking carriers of 272GS genotype had a low risk of EH (OR 0.42 in 95% CI from 0.18 to 0.97; p = 0.04). Smokers had no protective effect of this genotype. The protective effect of 272GS genotype was also found in individuals with low or moderate alcohol drinking habits (OR 0.29 in 95% CI from 0.11 to 0.77, p = 0.02) and in individuals without chronic exposure to stress (OR 0.29 in 95% CI from 0.09 to 0.91, p = 0.04). In contrast, hard drinkers and patients exposed to chronic stress had no protective effect of heterozygous genotype 272GS of gene GNB3. G272S polymorphism of GNB3 gene can be considered as a new genetic marker of predisposition to EH. The protective effect depends of environmental factors associated with high risk to develop EH.

  12. Development of reliable analytical method for extraction and separation of thorium(IV) by Cyanex 272 in kerosene

    International Nuclear Information System (INIS)

    Madane, N.S.; Mohite, B.S.


    A simple and selective spectrophotometric method has been developed for the extraction and separation of thorium(IV) from sodium salicylate media using Cyanex 272 in kerosene. Thorium(IV) was quantitatively extracted by 5 x 10 -4 M Cyanex 272 in kerosene from 1 x 10 -5 M sodium salicylate medium. The extracted thorium(IV) was stripped out quantitatively from the organic phase with 4.0 M hydrochloric acid and determined spectrophotometrically with arsenazo(III) at 620 nm. The effect of concentrations of sodium salicylate, extractant, diluents, metal ion and strippants has been studied. Separation of thorium(IV) from other elements was achieved from binary as well as multicomponent mixtures such as uranium(VI), strontium(II), rubidium(I), cesium(I), potassium(I), Sodium(I), lithium(I), lead(II), barium(II), beryllium(II) etc. Using this method separation and determination of thorium(IV) in geological and real samples has been carried out. The method is simple, rapid and selective with good reproducibility (approximately ±2%). (author)

  13. Studies on thermo-acoustic parameters in binary liquid mixtures of phosphinic acid (Cyanex 272) with different diluents at temperature 303.15 K: an ultrasonic study

    International Nuclear Information System (INIS)

    Kamila, Susmita; Jena, Satyaban; Swain, Bipin Bihari


    Acoustical investigations for the binary mixtures of phosphinic acid (Cyanex 272), used as liquid-liquid extractant, have been made in various diluents such as benzene, toluene, and xylene from ultrasonic velocity and density measurements at temperature 303.15 K and atmospheric pressure. This study involves evaluation of different thermo-acoustic parameters along with the excess properties, which are interpreted in the light of molecular interaction between a polar extractant, Cyanex 272 with non-polar diluent, benzene and weakly polar diluents, toluene and xylene. The excess values are correlated using Redlich-Kister polynomial equation, and corresponding adjustable parameters are derived

  14. Associations between short-term exposure to ambient sulfur dioxide and increased cause-specific mortality in 272 Chinese cities. (United States)

    Wang, Lijun; Liu, Cong; Meng, Xia; Niu, Yue; Lin, Zhijing; Liu, Yunning; Liu, Jiangmei; Qi, Jinlei; You, Jinling; Tse, Lap Ah; Chen, Jianmin; Zhou, Maigeng; Chen, Renjie; Yin, Peng; Kan, Haidong


    Ambient sulfur dioxide (SO 2 ) remains a major air pollutant in developing countries, but epidemiological evidence about its health effects was not abundant and inconsistent. To evaluate the associations between short-term exposure to SO 2 and cause-specific mortality in China. We conducted a nationwide time-series analysis in 272 major Chinese cities (2013-2015). We used the over-dispersed generalized linear model together with the Bayesian hierarchical model to analyze the data. Two-pollutant models were fitted to test the robustness of the associations. We conducted stratification analyses to examine potential effect modifications by age, sex and educational level. On average, the annual-mean SO 2 concentrations was 29.8 μg/m 3 in 272 cities. We observed positive and associations of SO 2 with total and cardiorespiratory mortality. A 10 μg/m 3 increase in two-day average concentrations of SO 2 was associated with increments of 0.59% in mortality from total non-accidental causes, 0.70% from total cardiovascular diseases, 0.55% from total respiratory diseases, 0.64% from hypertension disease, 0.65% from coronary heart disease, 0.58% from stroke, and 0.69% from chronic obstructive pulmonary disease. In two-pollutant models, there were no significant differences between single-pollutant model and two-pollutant model estimates with fine particulate matter, carbon monoxide and ozone, but the estimates decreased substantially after adjusting for nitrogen dioxide, especially in South China. The associations were stronger in warmer cities, in older people and in less-educated subgroups. This nationwide study demonstrated associations of daily SO 2 concentrations with increased total and cardiorespiratory mortality, but the associations might not be independent from NO 2 . Copyright © 2018 Elsevier Ltd. All rights reserved.

  15. Separation of Pr and Nd from La in chloride solution by extraction with a mixture of Cyanex 272 and Alamine 336 (United States)

    Liu, Yang; Jeon, Ho Seok; Lee, Man Seung


    The possibility of separation of Pr and Nd from La in a chloride leaching solution of monazite sand has been investigated by using a binary mixture of Cyanex 272 (bis(2,4,4-trimethylpentyl) phosphinic acid) and Alamine 336 (tri-octyl/decyl amine). The binary mixture showed synergism on the extraction of the three metals and led to an increase in the separation factor between Pr/Nd and La compared to Cyanex 272 alone. Although the addition of chloride ion into aqueous increased the extraction of the metals, this addition had negative effect on the separation of Nd/Pr and La. McCabe-Thiele diagrams for the extraction of Pr and Nd with the binary mixture were constructed. Stripping of metals from the loaded organic phase was achieved with 0.7 M HCl. The difference in the solvent extraction of the rare earth elements from chloride solution between the binary mixture and saponified extractants was also discussed.

  16. Measurement of polarization in K-p elastic scattering between 0.955 GeV/c and 1.272 GeV/c

    International Nuclear Information System (INIS)

    Bryant, H.C.; Carter, A.A.; Coupland, M.


    The polarization parameter has been measured for K - p elastic scattering at nine incident beam momenta between 0.955 GeV/c and 1.272 GeV/c covering the centre of mass angular range -0.9 < costheta*<+0.9. Experimental results and coefficients of Legendre polynomial fits to the data are presented and compared with other measurements and a partial wave analysis. (author)

  17. Final report on CCQM-K27.2: Second Subsequent study: determination of ethanol in aqueous media (United States)

    Schantz, Michele M.; Parris, Reenie M.; May, Willie E.; Rosso, Adriana; Puglisi, Celia; Marques Rodrigues Caixeiro, Janaína; Massiff, Gabriela; Camacho Frías, Evangelina; Pérez Urquiza, Melina; Archer, Marcellé; Visser, M. S.; deVos, Betty-Jayne


    subsequent study (nominal concentrations of 0.2 mg/g, 1 mg/g, 3 mg/g and 60 mg/g). The three participants in the CCQM-K27-Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in the concentration range of 0.2 mg/g to 60 mg/g. A report on this project has been approved by the CCQM and can be found at the BIPM website. A second follow-on key comparison, CCQM-K27.2 Second Subsequent, was initiated in 2006 to accommodate laboratories that had not been ready to benchmark their methods in the previous two CCQM-K27 studies. Two levels of ethanol in water were used in the second subsequent study ranging in concentration between 0.5 mg/g and 4 mg/g. Four of the five participants in the CCQM-K27.2 Second Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in that concentration range. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database The final report has been peer-reviewed and approved for publication by the CCQM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  18. RNA-seq of 272 gliomas revealed a novel, recurrent PTPRZ1-MET fusion transcript in secondary glioblastomas. (United States)

    Bao, Zhao-Shi; Chen, Hui-Min; Yang, Ming-Yu; Zhang, Chuan-Bao; Yu, Kai; Ye, Wan-Lu; Hu, Bo-Qiang; Yan, Wei; Zhang, Wei; Akers, Johnny; Ramakrishnan, Valya; Li, Jie; Carter, Bob; Liu, Yan-Wei; Hu, Hui-Min; Wang, Zheng; Li, Ming-Yang; Yao, Kun; Qiu, Xiao-Guang; Kang, Chun-Sheng; You, Yong-Ping; Fan, Xiao-Long; Song, Wei Sonya; Li, Rui-Qiang; Su, Xiao-Dong; Chen, Clark C; Jiang, Tao


    Studies of gene rearrangements and the consequent oncogenic fusion proteins have laid the foundation for targeted cancer therapy. To identify oncogenic fusions associated with glioma progression, we catalogued fusion transcripts by RNA-seq of 272 gliomas. Fusion transcripts were more frequently found in high-grade gliomas, in the classical subtype of gliomas, and in gliomas treated with radiation/temozolomide. Sixty-seven in-frame fusion transcripts were identified, including three recurrent fusion transcripts: FGFR3-TACC3, RNF213-SLC26A11, and PTPRZ1-MET (ZM). Interestingly, the ZM fusion was found only in grade III astrocytomas (1/13; 7.7%) or secondary GBMs (sGBMs, 3/20; 15.0%). In an independent cohort of sGBMs, the ZM fusion was found in three of 20 (15%) specimens. Genomic analysis revealed that the fusion arose from translocation events involving introns 3 or 8 of PTPRZ and intron 1 of MET. ZM fusion transcripts were found in GBMs irrespective of isocitrate dehydrogenase 1 (IDH1) mutation status. sGBMs harboring ZM fusion showed higher expression of genes required for PIK3CA signaling and lowered expression of genes that suppressed RB1 or TP53 function. Expression of the ZM fusion was mutually exclusive with EGFR overexpression in sGBMs. Exogenous expression of the ZM fusion in the U87MG glioblastoma line enhanced cell migration and invasion. Clinically, patients afflicted with ZM fusion harboring glioblastomas survived poorly relative to those afflicted with non-ZM-harboring sGBMs (P < 0.001). Our study profiles the shifting RNA landscape of gliomas during progression and reveled ZM as a novel, recurrent fusion transcript in sGBMs. © 2014 Bao et al.; Published by Cold Spring Harbor Laboratory Press.

  19. An Investigation of Comet Hale-Bopp at 21.6 and 27.2 AU from the Sun (United States)

    Kramer, Emily A.; Fernandez, Y. R.; Kelley, M. S.; Woodney, L. M.; Lisse, C. M.


    Comet Hale-Bopp offered us an unprecedented opportunity to observe a large, bright comet in great detail. Since its 1997 perihelion, continued observations have let us observe how its activity has changed over time. Here we present 2005 and 2008 Spitzer Space Telescope observations of Hale-Bopp that show coma and tail, which is uncommon given its heliocentric distance -- 21.6 AU in 2005 and 27.2 AU in 2008. We have images at 24 µm (obtained with MIPS, the Multiband Imaging Photometer for Spitzer) that show thermal emission from the dust, and we are using dynamical models [1,2] to explain the dust morphology and constrain the dust's properties. Preliminary work suggests that the motion of the dust cannot be solely due to the effects of gravity and radiation pressure, which generally are the dominant forces. We investigate the role of other possible driving forces such as the so-called rocket force [3]. Our science goals are to: understand the comet's activity mechanism, constrain the age of the dust, find the size of the grains, and compare properties of the dust we see now to those of the dust seen in the 1990s. Our overarching goal is to use Hale-Bopp and other distant, active comets to understand cometary activity and the structure of cometary nuclei, which is related to icy planetesimal formation and evolution. We acknowledge support from the NSF, NASA and the Spitzer Science Center for this work. References: [1] Kelley, M.S., et al. 2008, Icarus 193, 572, [2] Lisse, C.M., et al. 1998, ApJ 496, 971, [3] Reach, W.T., et al. 2009, Icarus 203, 571.

  20. Ambient carbon monoxide and cardiovascular mortality: a nationwide time-series analysis in 272 cities in China. (United States)

    Liu, Cong; Yin, Peng; Chen, Renjie; Meng, Xia; Wang, Lijun; Niu, Yue; Lin, Zhijing; Liu, Yunning; Liu, Jiangmei; Qi, Jinlei; You, Jinling; Kan, Haidong; Zhou, Maigeng


    Evidence of the acute health effects of ambient carbon monoxide air pollution in developing countries is scarce and mixed. We aimed to evaluate short-term associations between carbon monoxide and daily cardiovascular disease mortality in China. We did a nationwide time-series analysis in 272 major cities in China from January, 2013, to December, 2015. We extracted daily cardiovascular disease mortality data from China's Disease Surveillance Points system. Data on daily carbon monoxide concentrations for each city were obtained from the National Urban Air Quality Real-time Publishing Platform. City-specific associations between carbon monoxide concentrations and daily mortality from cardiovascular disease, coronary heart disease, and stroke were estimated with over-dispersed generalised linear models. Bayesian hierarchical models were used to obtain national and regional average associations. Exposure-response association curves and potential effect modifiers were evaluated. Two-pollutant models were fit to evaluate the robustness of the effects of carbon monoxide on cardiovascular mortality. The average annual mean carbon monoxide concentration in these cities from 2013 to 2015 was 1·20 mg/m 3 , ranging from 0·43 mg/m 3 to 2·45 mg/m 3 . For a 1 mg/m 3 increase in average carbon monoxide concentrations on the present day and previous day (lag 0-1), we observed significant increments in mortality of 1·12% (95% posterior interval [PI] 0·42-1·83) from cardiovascular disease, 1·75% (0·85-2·66) from coronary heart disease, and 0·88% (0·07-1·69) from stroke. These associations did not vary substantially by city, region, and demographic characteristics (age, sex, and level of education), and the associations for cardiovascular disease and coronary heart disease were robust to the adjustment of criteria co-pollutants. We did not find a threshold below which carbon monoxide exposure had no effect on cardiovascular disease mortality. This analysis is, to our

  1. Recovery of Cobalt from leach solution of spent oil Hydrodesulphurization catalyst using a synergistic system consisting of VersaticTM10 and Cyanex®272 (United States)

    Yuliusman; Ramadhan, I. T.; Huda, M.


    Catalyst are often used in the petroleum refinery industry, especially cobalt-based catalyst such as CoMoX. Every year, Indonesia’s oil industry produces around 1350 tons of spent hydrodesulphurization catalyst in which cobalt makes up for 7%wt. of them. Cobalt is a non-renewable and highly valuable resource. Taking into account the aforementioned reasons, this research was made to recover cobalt from spent hydrodesulphurization catalyst so that it can be reused by industries needing them. The methods used in the recovery of cobalt from the waste catalyst leach solution are liquid-liquid extraction using a synergistic system of VersaticTM 10 and Cyanex®272. Based on the experiments done using the aforementioned methods and materials, the optimum condition for the extraction process: concentration of VersaticTM 10 of 0.35 M, Cyanex®272 of 0.25 M, temperature of 23-25°C (room temperature), and pH of 6 with an extraction percentage of 98.80% and co-extraction of Ni at 93.51%.

  2. A Novel Melanocortin-4 Receptor Mutation MC4R-P272L Associated with Severe Obesity Has Increased Propensity To Be Ubiquitinated in the ER in the Face of Correct Folding (United States)

    Granell, Susana; Serra-Juhé, Clara; Martos-Moreno, Gabriel Á.; Díaz, Francisca; Pérez-Jurado, Luis A.; Baldini, Giulia; Argente, Jesús


    Heterozygous mutations in the melanocortin-4 receptor (MC4R) gene represent the most frequent cause of monogenic obesity in humans. MC4R mutation analysis in a cohort of 77 children with morbid obesity identified previously unreported heterozygous mutations (P272L, N74I) in two patients inherited from their obese mothers. A rare polymorphism (I251L, allelic frequency: 1/100) reported to protect against obesity was found in another obese patient. When expressed in neuronal cells, the cell surface abundance of wild-type MC4R and of the N74I and I251L variants and the cAMP generated by these receptors in response to exposure to the agonist, α-MSH, were not different. Conversely, MC4R P272L was retained in the endoplasmic reticulum and had reduced cell surface expression and signaling (by ≈3-fold). The chemical chaperone PBA, which promotes protein folding of wild-type MC4R, had minimal effects on the distribution and signaling of the P272L variant. In contrast, incubation with UBE-41, a specific inhibitor of ubiquitin activating enzyme E1, inhibited ubiquitination of MC4R P272L and increased its cell surface expression and signaling to similar levels as wild-type MC4R. UBE41 had much less profound effects on MC4R I316S, another obesity-linked MC4R variant trapped in the ER. These data suggest that P272L is retained in the ER by a propensity to be ubiquitinated in the face of correct folding, which is only minimally shared by MC4R I316S. Thus, studies that combine clinical screening of obese patients and investigation of the functional defects of the obesity-linked MC4R variants can identify specific ways to correct these defects and are the first steps towards personalized medicine. PMID:23251400

  3. Extreme 15N-enrichments in 2.72-Gyr-old sediments: evidence for a turning point in the nitrogen cycle. (United States)

    Thomazo, C; Ader, M; Philippot, P


    Although nitrogen is a key element in organic molecules such as nucleic acids and proteins, the timing of the emergence of its modern biogeochemical cycle is poorly known. Recent studies on the antiquity of the nitrogen cycle and its interaction with free oxygen suggests the establishment of a complete aerobic N biogeochemical cycle with nitrification, denitrification, and nitrogen fixation at about 2.68 Gyr. Here, we report new bulk nitrogen isotope data for the 2.72 billion-year-old sedimentary succession of the Tumbiana Formation (Pilbara Craton, Western Australia). The nitrogen isotopic compositions vary widely from +8.6‰ up to +50.4‰ and are inversely correlated with the very low δ(13)C values of associated organic matter defining the Fortescue excursion (down to about -56‰). We propose that this (15)N-enrichment records the onset of nitrification coupled to the continuous removal of its derivatives (nitrite and nitrate) by denitrification. This finding implies an increase in the availability of electron acceptors and probably oxygen in the Tumbiana depositional environment, 300 million years before the oxygenation of the Earth's atmosphere. © 2011 Blackwell Publishing Ltd.

  4. Recovery of Cd(II), Co(II) and Ni(II) from Chloride Medium by Solvent Extraction Using CYANEX 923 and CYANEX 272 I

    International Nuclear Information System (INIS)

    Ahmed, M.; El Dessouky, S.I.; El-Nadi, Y.A.; Daoud, J.A.; Saad, E.A.


    The paper aims to study the extraction and separation of Cd(II), Co(II) and Ni(II) from their mixtures in hydrochloric acid medium with CYANEX 923 in kerosene. Preliminary investigations showed that only Cd(II) is extracted with CYANEX 923 while Co(II) and Ni(II) are not extracted. Different parameters affecting the extraction of Cd(II) with CYANEX 923 such as hydrochloric acid, hydrogen ion, extractant and metal concentrations, temperature investigations were also investigated. The stoichiometry of the extracted metal species investigated was found to be HCdCl 3 . 2 CYANEX 923. The stripping of the extracted Cd(II) species is obtained with 0.1 M HCl solution. Co(II) was found to be extracted with CYANEX 272 at ph 5.8 leaving Ni(II) in the solution. A developed process for the sequential of Cd(II), Co(II) and Ni(II) from their mixture in hydrochloric acid medium is proposed

  5. The total angular moment selectivity in 7Li(α, α) 7Li(4.63 MeV, 7/2-) reaction at Eα = 27.2 MeV

    International Nuclear Information System (INIS)

    Dmitrenko, V.N.; Kozyr', Yu.E.


    The DWBA calculation of tensor polarisation of residual nuclei for direct inelastic scattering 7 Li(α, α) 7 Li(4.63 MeV, 7/2 - ) gives the lest approximation to experimental data at selected total angular moment and parity values J π 13/2 + . The microscopic coupled channel calculation also predicts a significant role of total angular moment states with J ≥ 13/2. at E α 27.2 MeV

  6. Safety, efficacy and pharmacokinetics of neratinib (HKI-272) in Japanese patients with advanced solid tumors: a Phase 1 dose-escalation study. (United States)

    Ito, Yoshinori; Suenaga, Mitsukuni; Hatake, Kiyohiko; Takahashi, Shunji; Yokoyama, Masahiro; Onozawa, Yusuke; Yamazaki, Kentaro; Hironaka, Shuichi; Hashigami, Kiyoshi; Hasegawa, Hirotaka; Takenaka, Nobuko; Boku, Narikazu


    Neratinib (HKI-272), a potent, irreversible, small-molecule, orally administered, pan-ErbB inhibitor that blocks signal transduction via inhibition of three epidermal growth factor receptors [ErbB1, ErbB2 (Her2) and ErbB4], is being developed for the treatment of solid tumors, including breast cancer. This Phase 1 dose-escalation study assessed the safety, tolerability, maximum-tolerated dose, antitumor activity and pharmacokinetics of neratinib in Japanese patients with advanced solid tumors. Patients received neratinib 80, 160, 240 or 320 mg orally; each patient enrolled in only one dose cohort. Patients received a single dose in week 1, followed by daily continuous doses. Blood samples collected were on days 1 and 21 for pharmacokinetic analyses. Twenty-one patients were enrolled (3 breast cancer; 17 colorectal cancer; 1 gastric cancer). Neratinib-related adverse events (all grades) included diarrhea (20 patients), fatigue (14 patients), nausea and abdominal pain (9 patients each) and anorexia (8 patients). Grade ≥3 neratinib-related adverse events in two or more patients were diarrhea and anorexia (two patients each). Dose-limiting toxicities were diarrhea and anorexia (two patients, 320 mg dose). The maximum-tolerated dose and recommended dose was neratinib 240 mg once daily. Of 21 evaluable patients, 2 with breast cancer had partial response, 3 had stable disease ≥24 weeks, 7 had stable disease ≥16 weeks and 9 had progressive disease. Pharmacokinetic analyses indicated that neratinib exposures increased with dose. The safety, efficacy and pharmacokinetic profiles of neratinib are consistent with those reported for non-Japanese patients and warrant further investigation of neratinib in Japanese patients with solid tumors.

  7. A phase I study with neratinib (HKI-272), an irreversible pan ErbB receptor tyrosine kinase inhibitor, in patients with solid tumors. (United States)

    Wong, Kwok-K; Fracasso, Paula M; Bukowski, Ronald M; Lynch, Thomas J; Munster, Pamela N; Shapiro, Geoffrey I; Jänne, Pasi A; Eder, Joseph P; Naughton, Michael J; Ellis, Matthew J; Jones, Suzanne F; Mekhail, Tarek; Zacharchuk, Charles; Vermette, Jennifer; Abbas, Richat; Quinn, Susan; Powell, Christine; Burris, Howard A


    The dose-limiting toxicities, maximum tolerated dose, pharmacokinetic profile, and preliminary antitumor activity of neratinib (HKI-272), an irreversible pan ErbB inhibitor, were determined in patients with advanced solid tumors. Neratinib was administered orally as a single dose, followed by a 1-week observation period, and then once daily continuously. Planned dose escalation was 40, 80, 120, 180, 240, 320, 400, and 500 mg. For pharmacokinetic analysis, timed blood samples were collected after administration of the single dose and after the first 14 days of continuous daily administration. Dose-limiting toxicity was grade 3 diarrhea, which occurred in one patient treated with 180 mg and in four patients treated with 400 mg neratinib; hence, the maximum tolerated dose was determined to be 320 mg. Other common neratinib-related toxicities included nausea, vomiting, fatigue, and anorexia. Exposure to neratinib was dose dependent, and the pharmacokinetic profile of neratinib supports a once-a-day dosing regimen. Partial response was observed for 8 (32%) of the 25 evaluable patients with breast cancer. Stable disease >or=24 weeks was observed in one evaluable breast cancer patient and 6 (43%) of the 14 evaluable non-small cell lung cancer patients. The maximum tolerated dose of once-daily oral neratinib is 320 mg. The most common neratinib-related toxicity was diarrhea. Antitumor activity was observed in patients with breast cancer who had previous treatment with trastuzumab, anthracyclines, and taxanes, and tumors with a baseline ErbB-2 immunohistochemical staining intensity of 2+ or 3+. The antitumor activity, tolerable toxicity profile, and pharmacokinetic properties of neratinib warrant its further evaluation.

  8. Interaction between ADH1C Arg272Gln and alcohol intake in relation to breast cancer risk suggests that ethanol is the causal factor in alcohol related breast cancer

    DEFF Research Database (Denmark)

    Benzon Larsen, Signe; Vogel, Ulla Birgitte; Christensen, Jane


    Alcohol is a risk factor for breast cancer. We wanted to determine if ADH polymorphisms which modify the rate of ethanol oxidation to acetaldehyde, were associated with breast cancer risk. We matched 809 postmenopausal breast cancer cases with 809 controls, nested within the prospective Diet......, Cancer and Health study. Among variant allele carriers of ADH1C Arg(272)Gln, alcohol intake increased the risk of breast cancer with 14% (95% CI: 1.04-1.24) per 10g alcohol/day, but not among homozygous wild type carriers (p for interaction=0.06). Thus, slow oxidation of ethanol seemed to be associated...

  9. Safety and efficacy of neratinib (HKI-272) plus vinorelbine in the treatment of patients with ErbB2-positive metastatic breast cancer pretreated with anti-HER2 therapy. (United States)

    Awada, A; Dirix, L; Manso Sanchez, L; Xu, B; Luu, T; Diéras, V; Hershman, D L; Agrapart, V; Ananthakrishnan, R; Staroslawska, E


    Neratinib (HKI-272) is a potent irreversible pan-ErbB tyrosine kinase inhibitor with clinical activity in patients with ErbB2/HER2-positive breast cancer. Phase I of this open-label, phase I/II study investigated the maximum tolerated dose (MTD) of oral neratinib (160 or 240 mg/day) plus vinorelbine (25 mg/m2; days 1 and 8 of each 21-day cycle) in patients with solid tumors. Phase II assessed the safety, clinical activity, and pharmacokinetics of the combination in patients with HER2-positive metastatic breast cancer; the primary efficacy end point was objective response (OR). In phase I (n=12), neratinib (240 mg) plus vinorelbine (25 mg/m2) was established as the MTD. In phase II, 79 patients with HER2-positive metastatic breast cancer were treated at the MTD. The most common treatment-related adverse events were diarrhea (96%), neutropenia (54%), and nausea (50%). Three patients discontinued treatment due to diarrhea. No clinically important skin side-effects were observed. The OR rate in assessable phase II patients was 41% (no prior lapatinib) and 8% (prior lapatinib). There was no evidence of pharmacokinetic interaction between neratinib and vinorelbine. Neratinib plus vinorelbine showed promising antitumor activity and no unexpected toxic effects in HER2-positive metastatic breast cancer patients. Trial registration #NCT00706030.

  10. Comprehensive review of the duplication 3q syndrome and report of a patient with Currarino syndrome and de novo duplication 3q26.32-q27.2. (United States)

    Dworschak, G C; Crétolle, C; Hilger, A; Engels, H; Korsch, E; Reutter, H; Ludwig, M


    Partial duplications of the long arm of chromosome 3, dup(3q), are a rare but well-described condition, sharing features of Cornelia de Lange syndrome. Around two thirds of cases are derived from unbalanced translocations, whereas pure dup(3q) have rarely been reported. Here, we provide an extensive review of the literature on dup(3q). This search revealed several patients with caudal malformations and anomalies, suggesting that caudal malformations or anomalies represent an inherent phenotypic feature of dup(3q). In this context, we report a patient with a pure de novo duplication 3q26.32-q27.2. The patient had the clinical diagnosis of Currarino syndrome (CS) (characterized by the triad of sacral anomalies, anorectal malformations and a presacral mass) and additional features, frequently detected in patients with a dup(3q). Mutations within the MNX1 gene were found to be causative in CS but no MNX1 mutation could be detected in our patient. Our comprehensive search for candidate genes located in the critical region of the duplication 3q syndrome, 3q26.3-q27, revealed a so far neglected phenotypic overlap of dup(3q) and the Pierpont syndrome, associated with a mutation of the TBL1XR1 gene on 3q26.32. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  11. Phase 1 trial of ALT-801, an interleukin-2/T cell receptor fusion protein targeting p53 (aa264-272)/HLA-A*0201 complex, in patients with advanced malignancies (United States)

    Fishman, Mayer N.; Thompson, John A.; Pennock, Gregory K.; Gonzalez, Rene; Diez, Luz M.; Daud, Adil I.; Weber, Jeffery S.; Huang, Bee Y.; Tang, Shamay; Rhode, Peter R.; Wong, Hing C.


    Purpose ALT-801 is a bifunctional fusion protein comprising interleukin-2 (IL-2) linked to a soluble, single-chain T cell receptor domain that recognizes a peptide epitope (aa264-272) of the human p53 antigen displayed on cancer cells in the context of HLA-A*0201 (p53+/HLA-A*0201). We evaluated the safety, pharmacokinetics and pharmacodynamics of ALT-801 in p53+/HLA-A*0201 patients with metastatic malignancies. Experimental Design p53+/HLA-A*0201 patients were treated with ALT-801 on a schedule of 4 daily 15-minute intravenous infusions, then 10 days rest and 4 more daily infusions. Cohorts of patients were treated at 0.015, 0.040, and 0.080 mg/kg/dose. Results Four, sixteen, and six patients were treated at the 0.015, 0.04 and 0.08 mg/kg cohorts, respectively. Two dose limiting toxicities (a grade 4 transient thrombocytopenia and a myocardial infarction) in the 0.08 mg/kg cohort established the maximum tolerated dose (MTD) at 0.04 mg/kg. Patients treated at the MTD experienced toxicities similar to those associated with high-dose IL-2 but of lesser severity. The serum half-life of ALT-801 was 4 hours and ALT-801 serum recovery was as expected based on the dose administered. ALT-801 treatment induced an increase of serum interferon-γ but not tumor necrosis factor-α. Response assessment showed 10 subjects with stable disease at at least 11 weeks, and in one who had melanoma metastasis, there is an ongoing complete absence of identifiable disease after resection of radiographically identified lesions. Conclusion This first-in-man study defines an ALT-801 regimen that can be administered safely and is associated with immunological changes of potential antitumor relevance. PMID:21994418

  12. 30 CFR 27.2 - Definitions. (United States)


    ... mixture has been ignited, or has been found with a permissible flame safety lamp, or has been determined... enclosure and/or flame arrester(s). Also the enclosure and/or flame arrester(s) shall prevent the discharge...

  13. 12 CFR 272.3 - Meetings. (United States)


    ... time until a quorum is in attendance. (d) Attendance at meetings. Attendance at Committee meetings is... discussion of, the economic and financial situation and outlook; Committee discussion of monetary policy and...

  14. 40 CFR 27.2 - Definitions. (United States)


    ... services; (ii) Provided any portion of the funds for the purchase of such property or services; or (iii) Will reimburse such recipient or party for the purchase of such property or services; or (2) For the... representative who must conform to the standards of conduct and ethics required of practitioners before the...

  15. Reference: 272 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available m L et al. 2005 Oct. Plant J. 44(1):114-27. The specification of epidermal (L1) identity occurs early during...s within the suspensor. Markers for L1 identity, ACR4 and ATML1, are not expressed in homozygous mutant seedlings showed a specific loss of epidermal cell identity within large portions of the cotyledons. In a

  16. 12 CFR 27.2 - Definitions. (United States)


    ... considers in evaluating the amount and type of credit requested. (e) Decision center means the place where... purchase, permanent financing for construction, or the refinancing of residential real property which the.... Where the bank in its judgment relies substantially upon other factors, such as the general credit...

  17. Publications | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... in Communicating Agricultural Biotechnology in Africa: Case Studies of Burkina Faso and Kenya ...

  18. Publications | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Fighting the violet vampire. In the fields of sub-Saharan Africa, Alan Watson and McGill University's Weed Research Group are battling devastating parasites — naturally. Something big was happening in these agricultural fields of.

  19. 32 CFR 272.5 - Responsibilities. (United States)


    ... Director of Defense Research and Engineering, under the Under Secretary of Defense for Acquisition, Technology, and Logistics (USD(AT&L)), shall: (1) Provide technical leadership and oversight, issue guidance...

  20. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.


    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  1. 7 CFR 2.72 - Chairman, World Agricultural Outlook Board. (United States)


    ... OF AGRICULTURE AND GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Economist... (a)(7), the following delegations of authority are made by the Chief Economist to the Chairman, World... following authority is reserved to the Chief Economist: Review all proposed decisions having substantial...

  2. Dicty_cDB: SFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KEEIEKMVADAEKFKQQDE HKKIVLNQRINWKIMHSLLKIQLKMKKLQPKFQIQINQLLNLKLKVYSNG*nqikpqkrm nmkir*kp*kqlsiqimsxlxqeggmp...IQLKMKKLQPKFQIQINQLLNLKLKVYSNG*nqikpqkrm nmkir*kp*kqlsiqimsxlxqeggmpqgggtarwyvk F

  3. 40 CFR 180.272 - Tribuphos; tolerances for residues. (United States)


    ...: Commodity Parts per million Cattle, fat 0.15 Cattle, meat 0.02 Cattle, meat byproducts 0.02 Cotton, gin byproducts 40.0 Cotton, undelinted seed 4.0 Goat, fat 0.15 Goat, meat 0.02 Goat, meat byproducts 0.02 Hog, fat 0.15 Hog, meat 0.02 Hog, meat byproducts 0.02 Horse, fat 0.15 Horse, meat 0.02 Horse, meat...

  4. 48 CFR 538.272 - MAS price reductions. (United States)


    ... maintain during the contract period the negotiated price/discount relationship (and/or term and condition relationship) between the eligible ordering activities and the offeror's customer or category of customers on... customers) that results in a less advantageous relationship between the eligible ordering activities and...

  5. Translations on Narcotics and Dangerous Drugs, Number 272 (United States)


    including "marihuana" paper, and a stapler. On 18 September. 28 Luis, who said that he was a receptionist at Comodoro Hotel ( Duque de Caxias Avenue...people. Two hours later the five men from Sinaloa were arrested at the Elba Hotel. They were identified as Efrain Zazueta Beltran, Pedro Salazar Ramirez...national ring of drug traffickers known as the "French Connection" entered the state penitentiary today to begin serving their terms. They are: Pedro

  6. 46 CFR 272.23 - Examples of ineligible expenses. (United States)


    ... loading of stores, the landing and sorting of laundry, pilot service, tug charges, removing surplus... or otherwise equip a vessel for its intended subsidized service which MARAD determines should have been performed before the initial entry of the vessel into subsidized service; (b) Convenience items...

  7. 7 CFR 272.5 - Program informational activities. (United States)


    ... creed, national origin or political belief. (c) Program informational activities for low-income..., application procedures, and benefits of the Food Stamp Program. Program informational materials used in such... the socio-economic and demographic characteristics of the target population, types of media used...

  8. 38 CFR 17.272 - Benefits limitations/exclusions. (United States)


    ... fabric versus synthetic fabric and vegetable-dyed shoes). (51) Food, food substitutes, vitamins or other... services in excess of 30 days in any fiscal year (or in an admission), in the case of a patient nineteen... excess of 23 visits in a fiscal year unless a waiver for extended coverage is granted in advance. (62...

  9. Dicty_cDB: SFC272 [Dicty_cDB

    Lifescience Database Archive (English)


  10. 38 CFR 21.272 - Veteran-student services. (United States)


    ... eligible to receive a work-study allowance. (Authority: 38 U.S.C. 3104(a)(4), 3485) (b) Selection criteria... by the Chapter 30 rate; (2) Motivation of the veteran; and (3) Compatibility of the work assignment with the veteran's physical condition. (Authority: 38 U.S.C. 3104(a)(4), 3108(f), 3485) (c) Utilization...

  11. 29 CFR 1910.272 - Grain handling facilities. (United States)


    ... shall provide training to employees at least annually and when changes in job assignment will expose... agriculture schools, industry associations, union organizations, and insurance groups. 4. Hot Work Permit The... Methods for D-C Resistance or Conductance of Insulating Materials”; and, the International Standards...

  12. All projects related to | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)


    How can science, technology, and innovation contribute to poverty reduction and inclusive development, especially in Brazil, Russia, India, China, and South Africa, otherwise known as the BRICS countries? Start Date: March 16, 2012. End Date: September 16, 2013. Topic: SCIENCE AND TECHNOLOGY POLICY, ...

  13. 272--11 Dec 2009 [final version].indd

    African Journals Online (AJOL)


    Dec 11, 2009 ... e o lo g ic a l S tu d ie s HTS. Original Research. A rtic le # .... of departure is only possible due to an extra-biblical maxim, to ... John Hart points out ...... Jean-Pierre Changeaux and the philosopher Paul Ricoeur, is ..... De Cruchy, J.W., 1986, The church struggle in South Africa, Collins.

  14. Neratinib (HKI-272) in the treatment of breast cancer. (United States)

    López-Tarruella, Sara; Jerez, Yolanda; Márquez-Rodas, Iván; Martín, Miguel


    Neratinib is an orally available, small, irreversible, pan-HER kinase inhibitor. HER-2-positive breast cancer is a breast cancer subtype with an increasing body of knowledge regarding potential targeted drug combinations that are significantly improving outcomes through a biologically tailored therapy approach; neratinib emerges as a promising tool in this context. This article reviews the molecular and clinical development of neratinib, an example of a covalent drug, from preclinical models to Phase III clinical trials, focusing on breast cancer treatment. The potential combinations of neratinib with chemotherapy in the metastatic, adjuvant and even neoadjuvant settings are appraised. These results and future perspectives will be discussed.

  15. 46 CFR 272.24 - Subsidy repair summaries. (United States)


    ... an Operator in the following manner: This is to certify that, to the best of my knowledge and belief... completed, and the price is fair and reasonable (exceptions are listed on separate page). (c) Categorization... reasonableness of the prices for the submitted work. With respect to any claims for M&R performed outside the...

  16. 40 CFR 97.272 - Out of control periods. (United States)


    ... Out of control periods. (a) Whenever any monitoring system fails to meet the quality-assurance and.... (b) Audit decertification. Whenever both an audit of a monitoring system and a review of the initial... certification or recertification application submission and at the time of the audit, the Administrator will...

  17. 40 CFR 96.272 - Out of control periods. (United States)


    ... the quality-assurance and quality-control requirements or data validation requirements of part 75 of... appendix D to part 75 of this chapter. (b) Audit decertification. Whenever both an audit of a monitoring... the time of the audit, the permitting authority or, for a CAIR SO2 opt-in unit or a unit for which a...

  18. 1935 15' Quad #272 Aerial Photo Mosaic Index (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  19. 20 CFR 702.272 - Informal recommendation by district director. (United States)


    ... LONGSHOREMEN'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION AND PROCEDURE Claims... any wage loss suffered as the result of the discharge or discrimination. The district director may... of the Chief Administrative Law Judge for hearing pursuant to § 702.317. [42 FR 45302, Sept. 9, 1977] ...

  20. 12 CFR 272.2 - Functions of the Committee. (United States)


    ... and domestic and international economic and financial developments, and other pertinent information... takes actions from time-to-time to regulate and direct the open market operations of the Reserve banks...

  1. Dicty_cDB: VFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA

  2. 38 CFR 3.272 - Exclusions from income. (United States)


    .... Amounts equal to expenses paid by a veteran or surviving spouse pursuing a course of education or... section 2(b) of such Code); and (2) If the child is pursuing a course of postsecondary education or... Therapeutic and Rehabilitation Activities Fund as a result of participation in a therapeutic or rehabilitation...

  3. 46 CFR 272.42 - Audit requirements and procedures. (United States)


    ... procedures. (a) Required audit. In connection with the audit of the Operator's subsidizable expenses, the... of audit results. Upon completion of the audit by the Office of Inspector General, the MARAD Office of Financial Approvals shall notify the Operator of the audit results, including any items disallowed...

  4. 7 CFR 272.4 - Program administration and personnel requirements. (United States)


    ... from unauthorized creation or tampering, the State agency shall establish an organizational structure..., tapes, or similar memory devices. The issuance unit shall provide certified households with the...

  5. 40 CFR 1065.272 - Nondispersive ultraviolet analyzer. (United States)


    ... measure NOX concentration in raw or diluted exhaust for batch or continuous sampling. We generally accept... high concentrations to interfere with proper operation. (b) Component requirements. We recommend that... other gaseous measurements and the engine's known or assumed fuel properties. The target value for any...

  6. Page 1 272 Ethiopian Journal of Environmental Studies ...

    African Journals Online (AJOL)



    Mar 24, 2015 ... Department of Science Laboratory Technology, University of Jos, P.M.B. 2084, Jos, Plateau ..... Lowlands: A Field Guide 4th Edition, ... Entomology and Guide to insect. Identification,. Feline. Press ... University of California.

  7. 29 CFR 1952.272 - Level of Federal enforcement. (United States)


    ... case of temporary emergency standards promulgated under section 6(c) of the Act (29 U.S.C. 665(c)), in... sections 18(e) and (f) of the Act (29 U.S.C. 667(e) and (f)). Federal OSHA will also retain authority for... operations. The OSHA Regional Administrator will make a prompt recommendation for the resumption of the...

  8. 7 CFR 272.1 - General terms and conditions. (United States)


    ... participating State or political subdivision shall decrease any assistance otherwise provided an individual or... the conversion process as required), shall be subject to standard QC review procedures. When the QC... shall issue press releases to the news media advising of the impending program changes. (v) For the...

  9. 7 CFR 272.2 - Plan of operation. (United States)


    ... next year, State agencies shall consider major corrective action objectives, existing program strengths... Plan of Operation. The State and FNS (USDA) further agree to fully comply with any changes in Federal... belief, religion, handicap, or national origin, be excluded from participation in, be denied the benefits...

  10. Automated Laser Ultrasonic Testing (ALUT) of Hybrid Arc Welds for Pipeline Construction, #272 (United States)


    One challenge in developing new gas reserves is the high cost of pipeline construction. Welding costs are a major component of overall construction costs. Industry continues to seek advanced pipeline welding technologies to improve productivity and s...

  11. SU-F-T-272: Patient Specific Quality Assurance of Prostate VMAT Plans with Portal Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Darko, J; Osei, E [Grand River Cancer Centre @ Grand River Hospital, Kitchener, ON (Canada); University of Waterloo, Waterloo, ON (Canada); Kiciak, A [University of Waterloo, Waterloo, ON (Canada); Badu, S; Grigorov, G; Fleck, A [Grand River Cancer Centre @ Grand River Hospital, Kitchener, ON (Canada)


    Purpose: To evaluate the effectiveness of using the Portal Dosimetry (PD) method for patient specific quality assurance of prostate VMAT plans. Methods: As per institutional protocol all VMAT plans were measured using the Varian Portal Dosimetry (PD) method. A gamma evaluation criterion of 3%-3mm with a minimum area gamma pass rate (gamma <1) of 95% is used clinically for all plans. We retrospectively evaluated the portal dosimetry results for 170 prostate patients treated with VMAT technique. Three sets of criterions were adopted for re-evaluating the measurements; 3%-3mm, 2%-2mm and 1%-1mm. For all criterions two areas, Field+1cm and MLC-CIAO were analysed.To ascertain the effectiveness of the portal dosimetry technique in determining the delivery accuracy of prostate VMAT plans, 10 patients previously measured with portal dosimetry, were randomly selected and their measurements repeated using the ArcCHECK method. The same criterion used in the analysis of PD was used for the ArcCHECK measurements. Results: All patient plans reviewed met the institutional criteria for Area Gamma pass rate. Overall, the gamma pass rate (gamma <1) decreases for 3%-3mm, 2%-2mm and 1%-1mm criterion. For each criterion the pass rate was significantly reduced when the MLC-CIAO was used instead of FIELD+1cm. There was noticeable change in sensitivity for MLC-CIAO with 2%-2mm criteria and much more significant reduction at 1%-1mm. Comparable results were obtained for the ArcCHECK measurements. Although differences were observed between the clockwise verses the counter clockwise plans in both the PD and ArcCHECK measurements, this was not deemed to be statistically significant. Conclusion: This work demonstrates that Portal Dosimetry technique can be effectively used for quality assurance of VMAT plans. Results obtained show similar sensitivity compared to ArcCheck. To reveal certain delivery inaccuracies, the use of a combination of criterions may provide an effective way in improving the overall sensitivity of PD. Funding provided in part by the Prostate Ride for Dad, Kitchener-Waterloo, Canada.

  12. 34 CFR 272.30 - What criteria does the Secretary use to make a grant? (United States)


    ...; and (iv) How the applicant, as part of its nondiscriminatory employment practices, will ensure that its personnel are selected for employment without regard to race, color, national origin, gender, age...

  13. 26 CFR 1.272-1 - Expenditures relating to disposal of coal or domestic iron ore. (United States)


    ... imposed by State or local authorities, costs of fire protection, costs of insurance (other than liability insurance), costs incurred in administering the contract (including costs of bookkeeping and technical... the ownership and protection of such property and depreciation of improvements thereon, fire insurance...

  14. BKR 27(2) pp. 89-97 (Sunmonu et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... are used as analgesic and in the treatment of sexual diseases, malaria, dysentery, stroke, heart failure, gonorrhea, arthritis, diabetes, snake bites ..... Traditional Medical Development for medical and dental primary. Health care .... of coronary artery disease in patients with type 1 diabetes mellitus,” American.

  15. BKR 27(2) pp. 68-75 (Muhammad et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... 2Department of Animal Science, University of Maiduguri. P.M.B. 1056, Borno State, ..... Parasitic and Infectious Diseases, Proceeding of American. Animals Hospital Association, South Bend, IN. Anon (1980). Guide to the care ...

  16. BKR 27(2) pp. 63-67 (Ejike et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... (Ejike and Ezeanyika, 2008; Bastien et al., 2014). The body mass index (BMI) is the .... Mei Z, Grummer-Strawm LM, Pietrobelli A, Goulding A,. Goran MI, Dietz WH. ... Nutrition Examination Survey (1988-1994). Am J Clin Nutr;.

  17. BKR 27(2) pp. 56-62 (Omage et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... creatinine in normal experimental rabbits. Kingsley ... 0.05) lower serum creatinine. Treatment with ... heart failure and arterial aneurysm, and is a leading cause of chronic renal ... At severely high pressure, defined as mean ...

  18. Crystal structure of spinach major light-harvesting complex at 2.72Å resolution (United States)

    Liu, Zhenfeng; Yan, Hanchi; Wang, Kebin; Kuang, Tingyun; Zhang, Jiping; Gui, Lulu; An, Xiaomin; Chang, Wenrui


    The major light-harvesting complex of photosystem II (LHC-II) serves as the principal solar energy collector in the photosynthesis of green plants and presumably also functions in photoprotection under high-light conditions. Here we report the first X-ray structure of LHC-II in icosahedral proteoliposome assembly at atomic detail. One asymmetric unit of a large R32 unit cell contains ten LHC-II monomers. The 14 chlorophylls (Chl) in each monomer can be unambiguously distinguished as eight Chla and six Chlb molecules. Assignment of the orientation of the transition dipole moment of each chlorophyll has been achieved. All Chlb are located around the interface between adjacent monomers, and together with Chla they are the basis for efficient light harvesting. Four carotenoid-binding sites per monomer have been observed. The xanthophyll-cycle carotenoid at the monomer-monomer interface may be involved in the non-radiative dissipation of excessive energy, one of the photoprotective strategies that have evolved in plants.

  19. 40 CFR 272.2101 - South Dakota State-Administered Program: Final Authorization. (United States)


    ...) introductory paragraph, 1-26-1(8)(a), 1-26-2, 1-26-6.6, 1-26-16 through 1-26-19, 1-26-19.1, 1-26-19.2, 1-26-27... introductory paragraph and 22-6-1(6). (vi) SDCL, as amended, effective July 1, 2004, Title 23, Law Enforcement... first sentence; Chapter 23-6, Criminal Statistics, section 23-6-4. (vii) SDCL, as amended, effective...

  20. Combination neratinib (HKI-272) and paclitaxel therapy in patients with HER2-positive metastatic breast cancer. (United States)

    Chow, L W-C; Xu, B; Gupta, S; Freyman, A; Zhao, Y; Abbas, R; Vo Van, M-L; Bondarenko, I


    Neratinib is a potent irreversible pan-ErbB tyrosine kinase inhibitor that has demonstrated antitumour activity and an acceptable safety profile in patients with human epidermal growth factor receptor (HER)-2-positive breast cancer and other solid tumours. This was a phase I/II, open-label, two-part study. Part 1 was a dose-escalation study to determine the maximum tolerated dose (MTD) of neratinib plus paclitaxel in patients with solid tumours. Part 2 evaluated the safety, efficacy, and pharmacokinetics of the combination at the MTD in patients with HER2-positive breast cancer. Eight patients were included in the dose-escalation study; no dose-limiting toxicities were observed, and an MTD of oral neratinib 240 mg once daily plus intravenous paclitaxel 80 mg m(-2) on days 1, 8, and 15 of each 28-day cycle was determined. A total of 102 patients with HER2-positive breast cancer were enrolled in part 2. The overall median treatment duration was 47.9 weeks (range: 0.1-147.3 weeks). Common treatment-emergent adverse events (all grades/grade ≥3) included diarrhoea (92%/29%; none grade 4), peripheral sensory neuropathy (51%/3%), neutropenia (50%/20%), alopecia (46%/0%), leukopenia (41%/18%), anaemia (37%/8%), and nausea (34%/1%). Three (3%) patients discontinued treatment due to an adverse event (mouth ulceration, left ventricular ejection fraction reduction, and acute renal failure). Among the 99 evaluable patients in part 2 of the study, the overall response rate (ORR) was 73% (95% confidence interval (CI): 62.9-81.2%), including 7 (7%) patients who achieved a complete response; an additional 9 (9%) patients achieved stable disease for at least 24 weeks. ORR was 71% among patients with 0/1 prior chemotherapy regimen for metastatic disease and no prior lapatinib, and 77% among those with 2/3 prior chemotherapy regimens for metastatic disease with prior lapatinib permitted. Kaplan-Meier median progression-free survival was 57.0 weeks (95% CI: 47.7-81.6 weeks). Pharmacokinetic analyses indicated no interaction between neratinib and paclitaxel. The combination of neratinib and paclitaxel was associated with higher toxicity than that of neratinib as a single agent, but was manageable with antidiarrhoeal agents and dose reductions in general. The combination therapy also demonstrated a high rate of response in patients with HER2-positive breast cancer. A phase III trial is ongoing to assess the benefit and risk of this combination in the first-line setting.

  1. BKR 27(2) pp. 85-88 (Adekanle et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... several disease states in adult and infants. Reactive oxygen species (ROS) are generated spontaneously in cells during metabolism and are implicated in the aetiology of different degenerative diseases, such as heart diseases, stroke, rheumatoid arthritis, diabetes and cancer (Oloyede and. Afolabi, 2012).

  2. People and things. CERN Courier, Mar 1987, v. 27(2)

    Energy Technology Data Exchange (ETDEWEB)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A symposium to celebrate the sixtieth birthday of T. D. Lee and to commemorate the thirtieth anniversary of the discovery of parity (left-right symmetry) nonconservation was held at Columbia in November. Last year's traditional annual summer Workshop on High Energy Physics and Field Theory was held in Protvino near Serpukhov, USSR, under the sponsorship of the Institute for High Energy Physics. A special symposium at the University of Timisoara, Roumania, in November marked the 50th anniversary of the landmark contributions to the physics of vector fields by the Roumanian theoretician Alexandru Proca (1897-1955). The Computer Applications in Nuclear and Plasma Sciences Technical Committee of the Nuclear and Plasma Physics Society, US Institute of Electrical and Electronics Engineers, has set up a new individual award 'for outstanding professional contributions to the profession of using computers in nuclear and/or plasma scientific research', regardless of nationality.

  3. 40 CFR 272.1751 - North Dakota State-administered program: Final authorization. (United States)


    ... EPA effective on October 19, 1984. Subsequent program revision applications were approved effective on... program. However, EPA retains the authority to exercise its inspection and enforcement authorities in... “Department of Health” Section 23-01-04.1, (except (6)). (iii) North Dakota Century Code, Volume 4A, 2002...

  4. 14 CFR 272.10 - Conditions applicable to carriers serving a subsidized market. (United States)


    ... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY ASSOCIATED STATES... precondition to the payment of compensation necessary to maintain essential air service, whether or not the affected carrier is itself receiving subsidy compensation in the market, if it finds that: (1) Essential...

  5. 46 CFR 272.12 - Determining the condition of eligible vessels. (United States)


    ... vessel may be surveyed at the first United States port of call; (b) At the commencement of the first...) During the dry docking period incident to the vessel's American Bureau of Shipping Special Surveys; (g...

  6. 75 FR 15679 - Foreign-Trade Zone 272-Lehigh Valley, Pennsylvania Application for Subzone Grundfos Pumps... (United States)


    ..., plastic closures and o- rings, rubber o-rings and gaskets, labels, pipe fittings, fasteners, motor... to realize logistical benefits through the use of weekly customs entry procedures. Customs duties also could possibly be deferred or reduced on foreign status production equipment. The request...

  7. : tous les projets | Page 272 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les mégapoles côtières situées dans des basses terres, déjà aux prises avec une croissance démographique rapide et d'autres problèmes d'ordre économique, social, sanitaire et culturel, doivent en outre faire face à la menace que font peser sur elles les changements climatiques. Date de début : 1 mars 2011. End Date: ...

  8. 40 CFR 272.2201 - Texas State-Administered Program: Final Authorization. (United States)


    ... Recycling Act, sections 371.0025(b) and (c), 371.024(a), 371.024(c) and (d), 371.026(a) and (b), 371.028... title (relating to Purpose) * * * § 55.21 of this title (relating to Requests for Contested Case..., sections 361.131 through 140; Chapter 371, Texas Oil Collection, Management, and Recycling Act, sections...

  9. BKR 27(2) pp. 106-110 (Mohammed et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... conventional feeds (crop by-products) are fundamental to farming systems that ... groundnut haulm, groundnut cake, fish meal, limestone, common salt and premix .... peel meal in place of maize base diets. Pakistan Journal of.

  10. 34 CFR 272.12 - What geographic regions do the DACs serve? (United States)


    ... Hampshire, Rhode Island, Vermont. (b) New York, New Jersey, Puerto Rico, Virgin Islands. (c) Delaware..., Kentucky, Mississippi, North Carolina, South Carolina, Tennessee. (e) Illinois, Indiana, Michigan...

  11. BKR 27(2) pp. 76-84 (Mordi et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... Hepatoprotective effects of palm oil and coconut water in the serum of Wistar rats ..... enzymes are indicative of cellular leakage and loss of functional integrity of cell ..... Detection of Hair in Food. Regulatory Toxicology and.

  12. Protein expression of Myt272-3 recombinant clone and in silico ...

    African Journals Online (AJOL)

    Usman et al. Trop J Pharm Res, July ... silico prediction of a possible vaccine candidate against .... standard methods described by Bringans et al. [12]. ..... Payan J, Francisco-Cruz A, Valdivia JA, Hernández- ... Nat Protoc 2006; 1: 16-. 22. 12.

  13. Mutational analysis of Glu272 in elongation factor 1A of E. coli

    DEFF Research Database (Denmark)

    Mansilla, Francisco; Knudsen, Charlotte Rohde; Clark, Brian F. C.


    In our previous work (Mansilla et al. (1997) Protein Eng. 10, 927-934) we showed that Arg7 of Escherichia coli elongation factor Tu (EF1A) plays an essential role in aminoacyl-tRNA (aa-tRNA) binding. Substitution of Arg7 by Ala or Glu lost this activity. We proposed that Arg7 forms a salt bridge...

  14. 46 CFR 272.41 - Requirements for examination and allocation of M&R expenses. (United States)


    ... such repairs does not exceed the franchise or deductible of the policy, or (ii) The date of the... requirements contained in paragraph (d) introductory text were approved by the Office of Management and Budget...

  15. Sud du Sahara | Page 272 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sud du Sahara. Read more about Decentralization, Local Politics and the Construction of Women's Citizenship (Uganda, Kenya and Tanzania) - Phase I. Langue English. Read more ... Read more about Monitoring Progress Toward the Information Society : Digital Divide Index. Langue English. Read more about Réforme ...

  16. People and things. CERN Courier, Mar 1987, v. 27(2)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A symposium to celebrate the sixtieth birthday of T. D. Lee and to commemorate the thirtieth anniversary of the discovery of parity (left-right symmetry) nonconservation was held at Columbia in November. Last year's traditional annual summer Workshop on High Energy Physics and Field Theory was held in Protvino near Serpukhov, USSR, under the sponsorship of the Institute for High Energy Physics. A special symposium at the University of Timisoara, Roumania, in November marked the 50th anniversary of the landmark contributions to the physics of vector fields by the Roumanian theoretician Alexandru Proca (1897-1955). The Computer Applications in Nuclear and Plasma Sciences Technical Committee of the Nuclear and Plasma Physics Society, US Institute of Electrical and Electronics Engineers, has set up a new individual award 'for outstanding professional contributions to the profession of using computers in nuclear and/or plasma scientific research', regardless of nationality

  17. 40 CFR 272.1351 - Montana State-Administered Program: Final Authorization. (United States)


    ... the EPA Regional Administrator on December 25, 1993, and the Enforcement Agreement between EPA Region... Annotated (MCA) 2005, Title 30, “Trade and Commerce”: Chapter 14, “Unfair Trade Practices and Consumer... Agreement and Enforcement Agreement. The Memorandum of Agreement between EPA Region 8 and the State of...

  18. BKR 27(2) pp. 98-105 (Ugbaja et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... Vitamins C and E attenuate lipid dystrophy in tissues of rats administered .... weeks for acclimation prior to experimental treatment. The rats were ..... fluoride and aluminium in liver and gastrocnemium muscle of female mice.

  19. Mutational analysis of Glu272 in elongation factor 1A of E. coli

    DEFF Research Database (Denmark)

    Mansilla, Francisco; Knudsen, Charlotte Rohde; Clark, Brian F. C.


    In our previous work (Mansilla et al. (1997) Protein Eng. 10, 927-934) we showed that Arg7 of Escherichia coli elongation factor Tu (EF1A) plays an essential role in aminoacyl-tRNA (aa-tRNA) binding. Substitution of Arg7 by Ala or Glu lost this activity. We proposed that Arg7 forms a salt bridge ...

  20. 27 CFR 24.272 - Payment of tax by electronic fund transfer. (United States)


    ... States Customs Service for payment of excise tax on imported wine. (Sec. 201, Pub. L. 85-859, 72 Stat... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Removal, Return and Receipt of Wine... year any proprietor who is liable for a gross amount of wine excise tax equal to or exceeding $5...

  1. Sloshing, fluid-structure interaction and structural response due to shock and impact loads 1994. PVP-Vol. 272

    International Nuclear Information System (INIS)

    Ma, D.C.; Shin, Y.S.; Brochard, D.; Fujita, K.


    This volume is comprised of papers presented in two symposia at the 1994 ASME Pressure Vessels and Piping Conference. These sessions, sponsored by the Fluid-Structure Interaction and Seismic Engineering Technical Committees, provided a forum for the discussion of recent advances in sloshing, fluid-structure interaction, and structural dynamics produced by high energy excitations. The papers presented at the four technical sessions on Sloshing and Fluid-Structure Interaction represent a broad spectrum of fluid-structure systems: sloshing, fluid-structure interaction, and dynamic and seismic response of various fluid-structure systems such as reactor components, liquid storage tanks, submerged structures and piping systems, etc. The paper presented at the session on Structural Dynamics Produced by High-Energy Excitations cover underwater explosion effects on submerged structures, bubble loading phenomena, finite element mesh refinements on failure predictions, penetration and impact problems, and dynamic design of blast containment vessels. Also included are numerical analysis, design, and testing to understand difficult transient response phenomena. Separate abstracts were prepared for 24 papers in this volume

  2. The importance of shared environment in mother-infant attachment security: A behavioral genetic study [IF: 3.272

    NARCIS (Netherlands)

    Bokhorst, C.L.; Bakermans-Kranenburg, M.J.; Fearon, R.M.; van IJzendoorn, M.H.; Fonagy, P.; Schuengel, C.


    In a sample of 157 monozygotic and dizygotic twins, genetic and environmental influences on infant attachment and temperament were quantified. Only unique environmental or error components could explain the variance in disorganized versus organized attachment as assessed in the Ainsworth Strange

  3. Nocturnum (Plaut., Amph. 272. Cuestión filológica, solución semántica

    Directory of Open Access Journals (Sweden)

    Benjamín García-Hernández


    Full Text Available Nocturnum is neither an epithet of the god Bacchus, nor of the planet Saturn, nor of any other god of the night, in the Plautine passage we are dealing with; it is simply the epithet of Iubar (= Lucifer. The presence of Vesperugo in the same context does not exclude this reference; both Nocturnus and Vesperugo have the same referent, the planet Venus; but, owing to their different reference and connotation, they are clearly seen as separate by the popular mind mirrored in the comedy.

  4. SU-E-J-272: Auto-Segmentation of Regions with Differentiating CT Numbers for Treatment Response Assessment

    International Nuclear Information System (INIS)

    Yang, C; Noid, G; Dalah, E; Paulson, E; Li, X; Gilat-Schmidt, T


    Purpose: It has been reported recently that the change of CT number (CTN) during and after radiation therapy (RT) may be used to assess RT response. The purpose of this work is to develop a tool to automatically segment the regions with differentiating CTN and/or with change of CTN in a series of CTs. Methods: A software tool was developed to identify regions with differentiating CTN using K-mean Cluster of CT numbers and to automatically delineate these regions using convex hull enclosing method. Pre- and Post-RT CT, PET, or MRI images acquired for sample lung and pancreatic cancer cases were used to test the software tool. K-mean cluster of CT numbers within the gross tumor volumes (GTVs) delineated based on PET SUV (standard uptake value of fludeoxyglucose) and/or MRI ADC (apparent diffusion coefficient) map was analyzed. The cluster centers with higher value were considered as active tumor volumes (ATV). The convex hull contours enclosing preset clusters were used to delineate these ATVs with color washed displays. The CTN defined ATVs were compared with the SUV- or ADC-defined ATVs. Results: CTN stability of the CT scanner used to acquire the CTs in this work is less than 1.5 Hounsfield Unit (HU) variation annually. K-mean cluster centers in the GTV have difference of ∼20 HU, much larger than variation due to CTN stability, for the lung cancer cases studied. The dice coefficient between the ATVs delineated based on convex hull enclosure of high CTN centers and the PET defined GTVs based on SUV cutoff value of 2.5 was 90(±5)%. Conclusion: A software tool was developed using K-mean cluster and convex hull contour to automatically segment high CTN regions which may not be identifiable using a simple threshold method. These CTN regions were reasonably overlapped with the PET or MRI defined GTVs

  5. Certification of polycyclic aromatic compounds. Pt. 6. CRM Nos. 152, 265, 266, 267, 268, 269, 270, 271, 272

    Energy Technology Data Exchange (ETDEWEB)

    Jacob, J; Belliardo, J J; Wagstaffe, P J


    The purity of samples of seven polycyclic aromatic hydrocarbons and two nitrogen-containing heterocyclics has been determined in an interlaboratory exercise, involving eleven laboratories of the EC member countries. The purity measurements were carried out using independent analytical methods (gas liquid chromatography, high performance liquid chromatography and mass spectrometry). This report describes the certification procedure and experimental details of the interlaboratory analyses of standard materials for environmental pollutants.

  6. 76 FR 65171 - Foreign-Trade Zone 272-Counties of Lehigh and Northampton, PA; Application for Reorganization... (United States)


    ... acres)--Lehigh Valley West Corporate Center, Nestle Way and Schantz Rd., Breinigsville; Site 7 (213... able to serve sites throughout the service area based on companies' needs for FTZ designation. The... Company, 6950 Ambassador Drive, Allentown, Lehigh County, Pennsylvania. Because the ASF only pertains to...

  7. 14 CFR 272.4 - Applicability of procedures and policies under 49 U.S.C. 41731-42. (United States)


    ... OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ESSENTIAL AIR SERVICE TO THE FREELY... authority of the Department to guarantee essential air service is derived from the Federal Programs and...

  8. Health education as a tool in the prevention of parasitosis - doi:10.5020/18061230.2009.p272

    Directory of Open Access Journals (Sweden)

    Loeste de Arruda Barbosa


    Full Text Available in childhood by means of Health Education actions. Methods: A descriptive study of educational intervention with residents of a neighborhood in the municipality of Crato - CE, in partnership with the Family Health strategy. Fecal samples from children aged 2 to 8 years were collected for analysis by both direct and Holffmann methods and from the results, we directed the educational process for children and their parents on preventive behaviors for infection by intestinal parasites. Results: Regarding to material collection and the analysis of the results, approximately 47% of the containers for collection of feces were delivered, comprising 21 samples and, from this total, 10 children had some type of parasites, the most frequent being: Giardia lamblia, Entamoeba histolytic, Entamoeba coli, Endomilax nana and Ascaris lumbricoides. The educational moment occurred with the participation of 48 persons, among them 16 children. There was medical consultation and prescription of antiparasitic drugs to children, with positive results for some type of parasites. Both children and their parents showed to have understood the message by actively participating in educational activities. Conclusion: The population proved to be aware of the actions taken, and succeeded the educational process carried out in a subject-subject approach and not in a vertical manner, in the search for community empowerment on the issues raised, stressing the importance of a continuous process of health education.

  9. Multibeam collection for TN272: Multibeam data collected aboard Thomas G. Thompson from 2011-11-05 to 2011-12-17, Honolulu, HI to Apra, Guam (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. Prevalence of overweight, obesity and hypertension in adolescents attending an art school. DOI: 10.5007/1980-0037.2011v13n4p272

    Directory of Open Access Journals (Sweden)

    Patricia Torres


    Full Text Available A cross-sectional analytical study involving the population of adolescent students attending the Nigelia Soria Public School and Art Institute (n=213, 24% boys, 76% girls in the two career paths (non-physical: visual arts and music, and physical artistic activities: dance was conducted. Anthropometric variables, blood pressure (systolic, SBP, and diastolic, DBP, and heart rate were measured. A semi-structured questionnaire collecting personal data regarding non-communicable chronic diseases, trauma, menstrual cycle, non-school physical activity, inactivity, and sleep duration was administered. The participation rate was 70%. In boys (age 15.6±1.8 years, the prevalence rates of low weight, eutrophy, overweight, and obesity were 0%, 87.5%, 12.5% and 0%, respectively. In girls (age 15.5±1.7 years, these rates were 1.1%, 86%, 8.6%, and 4.3%. Body mass index was significantly associated with waist circumference and brachial circumference in both genders (p<0.001. In the overweight/obesity group, two students were diagnosed with isolated systolic hypertension (SBP 90th percentile. A eutrophic male student with SBP/DBP 90th percentile was confirmed as borderline by 24-h blood pressure measurement. In the group of overweight/obese girls, two students were identified with isolated SBP 90th percentile, one with isolated DBP 90th percentile, and two with SBP/DBP 90th percentile. The nutritional status of students is satisfactory, with a high proportion of young healthy adolescents of both genders. However, the implementation of this protocol permitted to identify adolescents with high blood pressure, overweight, and obesity. These factors may pose a health risk considering the school activity of these students.

  11. SU-E-T-272: Direct Verification of a Treatment Planning System Megavoltage Linac Beam Photon Spectra Models, and Analysis of the Effects On Patient Plans

    Energy Technology Data Exchange (ETDEWEB)

    Leheta, D; Shvydka, D; Parsai, E [University of Toledo Medical Center, Toledo, OH (United States)


    Purpose: For the photon dose calculation Philips Pinnacle Treatment Planning System (TPS) uses collapsed cone convolution algorithm, which relies on energy spectrum of the beam in computing the scatter component. The spectrum is modeled based on Linac’s standard commissioning data and typically is not independently verified. We explored a methodology of using transmission measurements in combination with regularization data processing to unfold Linac spectra. The measured spectra were compared to those modeled by the TPS, and the effect on patient plans was evaluated. Methods: Transmission measurements were conducted in narrow-beam geometry using a standard Farmer ionization chamber. Two attenuating materials and two build -up caps, having different atomic numbers, served to enhance discrimination between absorption of low and high-energy portions of the spectra, thus improving the accuracy of the results. The data was analyzed using a regularization technique implemented through spreadsheet-based calculations. Results: The unfolded spectra were found to deviate from the TPS beam models. The effect of such deviations on treatment planning was evaluated for patient plans through dose distribution calculations with either TPS modeled or measured energy spectra. The differences were reviewed through comparison of isodose distributions, and quantified based on maximum dose values for critical structures. While in most cases no drastic differences in the calculated doses were observed, plans with deviations of 4 to 8% in the maximum dose values for critical structures were discovered. The anatomical sites with large scatter contributions are the most vulnerable to inaccuracies in the modeled spectrum. Conclusion: An independent check of the TPS model spectrum is highly desirable and should be included as part of commissioning of a new Linac. The effect is particularly important for dose calculations in high heterogeneity regions. The developed approach makes acquisition of megavoltage Linac beam spectra achievable in a typical radiation oncology clinic.

  12. A single-dose, crossover, placebo- and moxifloxacin-controlled study to assess the effects of neratinib (HKI-272) on cardiac repolarization in healthy adult subjects. (United States)

    Hug, Bruce; Abbas, Richat; Leister, Cathie; Burns, Jaime; Sonnichsen, Daryl


    Neratinib is an orally administered, small-molecule, irreversible pan-ErbB inhibitor in development for the treatment of ErbB2-positive breast cancer. This study assessed the effects of therapeutic and supratherapeutic neratinib concentrations on cardiac repolarization, in accordance with current regulatory guidance. This was a two-part study in healthy subjects. In part 1, subjects were randomized to receive placebo, 400 mg moxifloxacin, or 240 mg neratinib (therapeutic dose) following a high-fat meal. In part 2, after a washout period, subjects received placebo plus 400 mg ketoconazole or 240 mg neratinib plus ketoconazole (supratherapeutic dose). ANOVA was used to compare the baseline-adjusted QTc interval for neratinib with that of placebo (reference), and for neratinib plus ketoconazole with that of placebo plus ketoconazole (reference). Pharmacokinetic/pharmacodynamic analyses and categorical summaries of interval data were done. Assay sensitivity was evaluated by the effect of moxifloxacin on QTc compared with placebo. Sixty healthy subjects were enrolled in this study. The upper bounds of the 90% confidence interval for baseline-adjusted QTcN (population-specific corrected QT) were neratinib. Pharmacokinetic/pharmacodynamic analysis revealed no relationship between neratinib concentrations and QTc interval. No subjects had QTcI, QTcF, or QTcN intervals >450 milliseconds or change from baseline >30 milliseconds. Moxifloxacin produced a significant increase in QTcN compared with placebo (P neratinib do not prolong the QTc interval in healthy subjects. (c) 2010 AACR.

  13. Prevalence of overweight, obesity and hypertension in adolescents attending an art school. DOI: 10.5007/1980-0037.2011v13n4p272

    Directory of Open Access Journals (Sweden)

    Patricia Torres


    Full Text Available A cross-sectional analytical study involving the population of adolescent students attending the Nigelia Soria Public School and Art Institute (n=213, 24% boys, 76% girls in the two career paths (non-physical: visual arts and music, and physical artistic activities: dance was conducted. Anthropometric variables, blood pressure (systolic, SBP, and diastolic, DBP, and heart rate were measured. A semi-structured questionnaire collecting personal data regarding non-communicable chronic diseases, trauma, menstrual cycle, non-school physical activity, inactivity, and sleep duration was administered. The participation rate was 70%. In boys (age 15.6±1.8 years, the prevalence rates of low weight, eutrophy, overweight, and obesity were 0%, 87.5%, 12.5% and 0%, respectively. In girls (age 15.5±1.7 years, these rates were 1.1%, 86%, 8.6%, and 4.3%. Body mass index was significantly associated with waist circumference and brachial circumference in both genders (p<0.001. In the overweight/obesity group, two students were diagnosed with isolated systolic hypertension (SBP 90th percentile. A eutrophic male student with SBP/DBP 90th percentile was confirmed as borderline by 24-h blood pressure measurement. In the group of overweight/obese girls, two students were identified with isolated SBP 90th percentile, one with isolated DBP 90th percentile, and two with SBP/DBP 90th percentile. The nutritional status of students is satisfactory, with a high proportion of young healthy adolescents of both genders. However, the implementation of this protocol permitted to identify adolescents with high blood pressure, overweight, and obesity. These factors may pose a health risk considering the school activity of these students.

  14. ABC 27-2 General bat activity measured with an ultrasound detector in a fragmented tropical landscape in Los Tuxtlas, Mexico

    Directory of Open Access Journals (Sweden)

    Estrada, A.


    Full Text Available Bat tolerance to neotropical forest fragmentation may be related to ability by bats to use available habitats in the modified environmental matrix. This paper presents data on general bat activity (for three hours starting at dusk measured with an ultrasound detector in a fragmented landscape in the region of Los Tuxtlas, Mexico. Bat activity was measured in continuous forests, forests fragments, forest-pasture edges, forest corridors, linear strips of vegetation, citrus groves, pastures and the vegetation present in local villages. The highest bat activity rates were recorded in the villages, in the forest fragments and in linear strips of vegetation. The lowest activity rates were detected in pasture habitats. Data suggest that native and man-made arboreal vegetation may be important for sustaining bat activity in fragmented landscapes.

  15. Molecular modeling of human MT2 melatonin receptor: the role of Val204, Leu272 and Tyr298 in ligand binding

    Czech Academy of Sciences Publication Activity Database

    Mazna, Petr; Obšilová, Veronika; Jelínková, Irena; Balík, Aleš; Berka, K.; Sovová, Žofie; Ettrich, Rüdiger; Svoboda, Petr; Obšil, T.; Teisinger, Jan


    Roč. 91, č. 4 (2004), s. 836-842 ISSN 0022-3042 R&D Projects: GA ČR GA309/02/1479; GA ČR GA309/04/0496; GA ČR GA204/03/0714; GA AV ČR IAA5011103; GA AV ČR IAA5011408; GA AV ČR KJB5011308; GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z5011922; CEZ:MSM 113100001 Keywords : homology modeling * MT2 melatonin receptor * site-directed mutagenesis Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 4.824, year: 2004

  16. Comment on: "Morphotectonic records of neotectonic activity in the vicinity of North Almora Thrust Zone, Central Kumaun Himalaya", by Kothyari et al. 2017, Geomorphology (285), 272-286 (United States)

    Rana, Naresh; Sharma, Shubhra


    The recent paper by Kothyari et al. (2017) suggests that the North Almora Thrust (NAT) and a few subsidiary faults in the central Lesser Himalaya were active during the late Quaternary and Holocene. Considering that in the Indian Summer Monsoon (ISM) dominated and tectonically active central Himalaya, the landscape owes their genesis to a coupling between the tectonics and climate. The present study would have been a good contribution toward improving our understanding on this important topic. Unfortunately, the inferences drawn by the authors are based on inadequate/vague field observations, supported by misquoted references, which reflects their poor understanding of the geomorphic processes. For example, authors implicate tectonics in the landform evolution without providing an argument to negate the role of climate (ISM). In view of this, the above contribution does not add anything substantial in improving our existing knowledge of climate-tectonic interaction in landform evolution. On the contrary, if the above publication is not questioned for its scientific merit, it may create enormous confusion and proliferation of wrong scientific data and inferences.

  17. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.


    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  18. Segio Federowsky. El medioambiente no le importa a nadie. Bestialidades ecológicas en la Argentina: del Riachuelo a las Papeleras : Editorial Planeta, Buenos Aires, 2007, 272 páginas


    Tram[p]as de la Comunicación y la Cultura


    Desde un enfoque más genérico y no abocado exclusivamente a sus vínculos con el proceso comunicacional, el biólogo y periodista Sergio Federovisky publicó El medio ambiente no le importa a nadie. Bestialidades ecológicas en la Argentina: del Riachuelo a las Papeleras. Tras un prólogo del jurista Daniel Sabsay, titular de la Fundación Ambiente y Recursos Naturales (FARN), el autor se interroga: “¿Cómo es posible que todo el mundo diga que hay que cuidar el medio ambiente, que hay que proteger ...

  19. Response: Discussion of 'Morphotectonic records of neotectonic activity in the vicinity of North Almora Thrust Zone, Central Kumaun Himalaya' by Kothyari et al. (2017), Geomorphology (285), 272-286 (United States)

    Kothyari, Girish Ch.; Kandregula, Raj Sunil; Luirei, Khayingshing


    Rana and Sharma (2017) dispute our tectonic interpretation mainly on the basis of what they believe (climate?). However, we welcome their comments, as this gives us a chance to highlight the ambiguity inherent in discriminating the climate-tectonic imprints in morphotectonic records that are prevalent in current research. We should note that the paper published by Kothyari et al. (2017) was reviewed by national/international reviewers. We would like to emphasize the fact that the paper does not rule out the role of climate. However, most importantly, it presents significant features and observations that collection/assemblage points toward the dominant role of tectonics in their shaping, and not solely climate, as postulated by Rana and Sharma (2017). The objective of this paper is to identify tectonic signatures (geomorphology) in a monsoon - dominated, tectonically active terrain like the North Almora Thrust (NAT). These faults are marked by previous workers based on field evidence such as folding and faulting of lithological units; presence of slickensides parallel to the fault; offset of NAT owing to a transverse fault; and offset of drainage, drainage basin analysis, strath terraces, fluviolacustrine terraces, development of scarp, narrow river course, and deeply incised valleys. However, we disagree with the comments raised by Rana and Sharma (2017), because they are highly skewed toward the climate school of thought, and did not perceive the setting as a collection of landforms. Instead, they attempted to view them in isolation. Because these comments are important, we will try to further our research incorporating issues related to isolation of climate and tectonics imprints in the immediate future. We would like to thank Rana and Sharma (2017) for raising some basic questions on our work as this gave us an excellent opportunity to summarize and present the dominance of various processes and related landforms as earlier reported by Kothyari et al. (2017). A point-by-point detailed rebuttal/explanation of their queries is provided below.

  20. Case note to C-272/15 ( Swiss International Air Lines v The Secretary of State for Energy and Climate) applicability of emissions trading to international air transport, particularly in relation to Switserland

    NARCIS (Netherlands)

    Peeters, Marjan; Douma, W.Th.


    Toepasselijkheid van broeikasgasemissiehandel op internationale luchtvaart, in het bijzonder vluchten naar en van Zwitserland: Er bestaat geen verplichting voor de Unie om derde landen gelijk te behandelen, ook in geval van een Europese unilaterale milieumaatregel die op diverse derde landen

  1. ORF Alignment: NC_003076 [GENIUS II[Archive

    Lifescience Database Archive (English)


  2. 75 FR 20387 - Amended Certification Regarding Eligibility To Apply for Worker Adjustment Assistance (United States)


    ..., Meadville, Pennsylvania. TA-W-71,272C, Crucible Materials Corporation, Crucible Service Center, Troy..., Pennsylvania; Troy, Michigan; Butler, Wisconsin; Miamisburg, Ohio; Chicago, Illinois; Minneapolis, Minnesota...); Troy, Michigan (TA-W-71,272C); Butler, Wisconsin (TA-W-71,272D); Miamisburg, Ohio (TA-W-71,272E...

  3. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)


  4. 40 CFR 63.110 - Applicability. (United States)


    ... of 40 CFR parts 260 through 272. The owner or operator shall keep a record of the information used to... 272. (f) Overlap with the Vinyl Chloride NESHAP. (1) After the compliance dates specified in § 63.100...

  5. Light Curve Solution of the Contact Binary AW UMa

    Directory of Open Access Journals (Sweden)

    J. H. Jeong


    Full Text Available A total of 1088 observations (272 in B,272 in V, 272 in R, and 272 in I were made from January to February in 1995 at Chungbuk National University observatory(CbNUO. We constructed BVRI light curves with our data. The photometric solution of these light curves was obtained by means of the Wilson-Devinney method. Our result was compared with those by previous investigators.

  6. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. Comparison of Rapid Malaria Test and Laboratory Microscopy ...

    African Journals Online (AJOL)

    Michael Horsfall

    ABSTRACT: Blood samples collected from 272 volunteers in two communities of Bayelsa State in the Niger. Delta area were investigated for falciparum malaria parasite using the rapid test based on the detection of soluble antigen and laboratory microscopy test. The data showed that out of the 272 samples collected, ...

  8. Mechanisms and timing of replacement dental lamina regression

    Czech Academy of Sciences Publication Activity Database

    Dosedělová, H.; Dumková, J.; Lesot, H.; Glocová, K.; Hampl, A.; Tucker, A.; Buchtová, Marcela


    Roč. 296, special feature (2013), s. 272-272 ISSN 1932-8486. [International Congress of Vertebrate Morphology /10./. 08.07.2013-12.07.2013, Barcelona] Institutional support: RVO:67985904 Keywords : dental lamina Subject RIV: FF - HEENT, Dentistry

  9. Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe. (United States)

    Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix


    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.

  10. Human Betacoronavirus 2c EMC/2012–related Viruses in Bats, Ghana and Europe (United States)

    Annan, Augustina; Baldwin, Heather J.; Corman, Victor Max; Klose, Stefan M.; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K.V.; Lina, Peter H.C.; Godlevska, Elena V.; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian


    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats. PMID:23622767

  11. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | ... us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation ...

  12. Optimal government policies in models with heterogeneous agents

    Czech Academy of Sciences Publication Activity Database

    Boháček, Radim; Kejak, Michal

    -, č. 272 (2005), s. 1-55 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : optimal macroeconomic policy * optimal taxation * distribution of wealth and income Subject RIV: AH - Economics

  13. Aptychi from the Berriasian/Valanginian (France and Spain): New stratigraphical and morphological details

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk; Janssen, N. M. M.; Klein, J.


    Roč. 86, č. 3 (2016), s. 265-272 ISSN 0208-9068 Institutional support: RVO:68145535 Keywords : Lamellaptychi * Berriasian/Valanginian * Vocontian Basin * Betic Cordillera Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.833, year: 2016

  14. Idala: An unnamed Function Peptide Vaccine for Tuberculosis ...

    African Journals Online (AJOL)

    Purpose: To evaluate Myt272 protein antigenicity and immunogenicity by trial vaccination in mice and its in silico analysis as a potential peptide vaccine for tuberculosis. Methods: Myt272 gene, which has 100 % identity with Mycobacterium tuberculosis H37Rv unknown function gene Rv3424c, was ligated by genomic ...

  15. HLA-B27-Homodimer-Specific Antibody Modulates the Expansion of Pro-Inflammatory T-Cells in HLA-B27 Transgenic Rats.

    Directory of Open Access Journals (Sweden)

    Osiris Marroquin Belaunzaran

    Full Text Available HLA-B27 is a common genetic risk factor for the development of Spondyloarthritides (SpA. HLA-B27 can misfold to form cell-surface heavy chain homodimers (B272 and induce pro-inflammatory responses that may lead to SpA pathogenesis. The presence of B272 can be detected on leukocytes of HLA-B27+ Ankylosing spondylitis (AS patients and HLA-B27 transgenic rats. We characterized a novel B272-specific monoclonal antibody to study its therapeutic use in HLA-B27 associated disorders.The monoclonal HD5 antibody was selected from a phage library to target cell-surface B272 homodimers and characterized for affinity, specificity and ligand binding. The immune modulating effect of HD5 was tested in HLA-B27 transgenic rats. Onset and progression of disease profiles were monitored during therapy. Cell-surface B272 and expansion of pro-inflammatory cells from blood, spleen and draining lymph nodes were assessed by flow cytometry.HD5 bound B272 with high specificity and affinity (Kd = 0.32 nM. HD5 blocked cell-surface interaction of B272 with immune regulatory receptors KIR3DL2, LILRB2 and Pirb. In addition, HD5 modulated the production of TNF from CD4+ T-cells by limiting B272 interactions in vitro. In an HLA-B27 transgenic rat model repetitive dosing of HD5 reduced the expansion of pro-inflammatory CD4+ T-cells, and decreased the levels of soluble TNF and number of cell-surface B272 molecules.HD5 predominantly inhibits early TNF production and expansion of pro-inflammatory CD4+ T-cells in HLA-B27 transgenic rats. Monoclonal antibodies targeting cell-surface B272 propose a new concept for the modulation of inflammatory responses in HLA-B27 related disorders.

  16. HLA-B27-Homodimer-Specific Antibody Modulates the Expansion of Pro-Inflammatory T-Cells in HLA-B27 Transgenic Rats (United States)

    Marroquin Belaunzaran, Osiris; Kleber, Sascha; Schauer, Stefan; Hausmann, Martin; Nicholls, Flora; Van den Broek, Maries; Payeli, Sravan; Ciurea, Adrian; Milling, Simon; Stenner, Frank; Shaw, Jackie; Kollnberger, Simon; Bowness, Paul; Petrausch, Ulf; Renner, Christoph


    Objectives HLA-B27 is a common genetic risk factor for the development of Spondyloarthritides (SpA). HLA-B27 can misfold to form cell-surface heavy chain homodimers (B272) and induce pro-inflammatory responses that may lead to SpA pathogenesis. The presence of B272 can be detected on leukocytes of HLA-B27+ Ankylosing spondylitis (AS) patients and HLA-B27 transgenic rats. We characterized a novel B272–specific monoclonal antibody to study its therapeutic use in HLA-B27 associated disorders. Methods The monoclonal HD5 antibody was selected from a phage library to target cell-surface B272 homodimers and characterized for affinity, specificity and ligand binding. The immune modulating effect of HD5 was tested in HLA-B27 transgenic rats. Onset and progression of disease profiles were monitored during therapy. Cell-surface B272 and expansion of pro-inflammatory cells from blood, spleen and draining lymph nodes were assessed by flow cytometry. Results HD5 bound B272 with high specificity and affinity (Kd = 0.32 nM). HD5 blocked cell-surface interaction of B272 with immune regulatory receptors KIR3DL2, LILRB2 and Pirb. In addition, HD5 modulated the production of TNF from CD4+ T-cells by limiting B272 interactions in vitro. In an HLA-B27 transgenic rat model repetitive dosing of HD5 reduced the expansion of pro-inflammatory CD4+ T-cells, and decreased the levels of soluble TNF and number of cell-surface B272 molecules. Conclusion HD5 predominantly inhibits early TNF production and expansion of pro-inflammatory CD4+ T-cells in HLA-B27 transgenic rats. Monoclonal antibodies targeting cell-surface B272 propose a new concept for the modulation of inflammatory responses in HLA-B27 related disorders. PMID:26125554

  17. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia


    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  18. 78 FR 72064 - Request for Comments on Methods for Studying the Diversity of Patent Applicants (United States)


    ..., Expert Advisor, Office of Chief Economist, United States Patent and Trademark Office, Mail Stop External..., Office of Chief Economist, by telephone at (571) 272-6900, or by email at [email protected

  19. The Large Scale Structure: Polarization Aspects R. F. Pizzo

    Indian Academy of Sciences (India)

    ized radio sources in galaxy clusters and at their outskirts, emphasizing the crucial information provided by the polarized signal on the origin and evolution ..... Evrard, A. E., Gioia, I. M. 2002, in Astrophysics and Space Science Library, Vol. 272,.

  20. ggj^artiment of Speech Language Pathology M^oraltv of the ...

    African Journals Online (AJOL)

    The process of becoming bilingual is complex and there are many different ..... Proficiency of Dual Language Children. Unpublished ... Frames of Mind: The Theory of Multiple. Ijvt^llgences. ... Canadian Journal of Psychology, 13,. |66-272 .

  1. Prožitek architektury

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula


    Roč. 87, č. 4 (2008), s. 270-272 E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z80330511 Keywords : contemporary architecture * Peter Zumthor Subject RIV: AL - Art, Architecture, Cultural Heritage

  2. Over-the-counter pain relievers (United States)

    ... Waltham, MA: Elsevier; 2016:236-272. Dinakar P. Principles of pain management. In: Daroff RB, Jankovic J, Mazziotta JC, Pomeroy SL, eds. Bradley's Neurology in Clinical Practice . 7th ed. Philadelphia, PA: Elsevier; 2016:chap 54.

  3. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...

  4. "Haunting experiences: Ghosts in contemporary folklore," by Diane E. Goldstein et al.

    Directory of Open Access Journals (Sweden)

    Linda Levitt


    Full Text Available Diane E. Goldstein, Sylvia Ann Grider, and Jeannie Banks Thomas. Haunting experiences: Ghosts in contemporary folklore. Logan: Utah State University Press, 2007, paperback, $24.95 (272p ISBN 978-0-87421-636-3.

  5. Vibrační optická aktivita: Experimentální zázemí a počítačové simulace

    Czech Academy of Sciences Publication Activity Database

    Hudecová, Jana; Bouř, Petr


    Roč. 108, č. 4 (2014), s. 285-292 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : vibrational optical activity * circular dichroism * DFT calculations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

  6. Stabat Mater. Chant gregorien / Patric Wiklacz

    Index Scriptorium Estoniae

    Wiklacz, Patric


    Uuest heliplaadist "Stabat Mater. Chant gregorien. Palestrina: Stabat Mater a 8; Pärt: Stabat Mater; Browne: Stabat Mater dolorosa a 6. Fretwork (concort de violes)". Virgin Classics 545 272-2 (CD: 167F)

  7. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find ... Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | About this Site | Privacy Policy | ...

  8. 78 FR 13367 - Extension of Agency Information Collection Activity Under OMB Review: Security Threat Assessment... (United States)


    ... the implementation of sec. 1012 of the USA PATRIOT Act (Pub. L. 107-56, 115 Stat. 272, 396, Oct. 26... history, and criminal history; and fingerprints. In addition, 49 CFR part 1572 requires States to maintain...

  9. San Antonio Bay 1986-1989 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The effect of salinity on utilization of shallow-water nursery habitats by aquatic fauna was assessed in San Antonio Bay, Texas. Overall, 272 samples were collected...

  10. Creutzfeldt-Jakob Disease (United States)

    ... in the chromosome 20 gene coding the biological blueprint for prion protein. People who develop familial CJD ... other dementias, and help you find local support services. Call our 24/7 Helpline at 800.272. ...

  11. Critical Arts

    African Journals Online (AJOL)

    both formal and informal) in culture and social theory. CRITICAL ARTS aims to challenge and ... Book Review: Brian McNair, An Introduction to Political Communication (3rd edition), London: Routledge, 2003, ISBN 0415307082, 272pp. Phil Joffe ...

  12. Modulární laboratorní fluorová linka v ÚOCHB AV ČR

    Czech Academy of Sciences Publication Activity Database

    Valášek, Michal; Šembera, Filip; Janoušek, Zbyněk; Michl, Josef


    Roč. 108, č. 4 (2014), s. 394-397 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : carboranes * fluorine * hydrogen fluoride Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  13. Assessment of Healthcare Waste Generation Rate and Its ...

    African Journals Online (AJOL)


    Mar 1, 2018 ... reliable records of the quantity and nature of healthcare wastes ... construction, and 224 health posts, totally 272 health facilities ..... Procedia - Social and Behavioral. Sciences. 2012 ... Asian Journal Of Applied Science And.

  14. ‘Vanishing cities’: can urban costs explain deindustrialization?

    Czech Academy of Sciences Publication Activity Database

    Goryunov, Maxim; Kokovin, S.


    Roč. 95, č. 3 (2016), s. 633-651 ISSN 1056-8190 Institutional support: RVO:67985998 Keywords : city size * urban hierarchies * agglomeration Subject RIV: AH - Economics Impact factor: 1.272, year: 2016

  15. 7 CFR 273.10 - Determining household eligibility and benefit levels. (United States)


    ... merely because of changes in mailing cycles or pay dates or because weekends or holidays cause additional... for urban, rural I, and rural II Alaska as defined in § 272.7(c). The TFPs for Guam and the Virgin...


    African Journals Online (AJOL)


    the one that enables a lower threshold for finding administrative bias. This ... 9 Rose v Johannesburg Local Road Transportation Board 1947 (4) SA 272 (W). ...... issue of whether buildings erected in the Green Belt could be considered from.

  17. Bilateral synchronous benign ovarian neoplasm: A rare occurrence

    African Journals Online (AJOL)

    right ovarian mass, which revealed a left ovarian benign cystic teratoma and a right ovarian ... Women's reproductive health rights need to be encouraged and possibly legislated in our setting. ..... Med J Armed Forces India 2011;67(3):272-.

  18. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erichia coli CFT073] gb|AAN81970.1| Agmatinase ... [Escherichia coli CFT073] sp|Q8FE36|SPEB_ECOL6 ... Agmatinase (Agmat...ine ureohydrolase) (AUH) ... Length = 272 ... Query: 34 ... DWVITGVPFDMATSGRAGGRHG

  19. Is Rorty a linguistic idealist?

    Czech Academy of Sciences Publication Activity Database

    Marvan, Tomáš


    Roč. 21, č. 3 (2011), s. 272-279 ISSN 1210-3055 Institutional research plan: CEZ:AV0Z90090514 Keywords : Rorty * linguistic idealism * internal realism * intrinsic structure of reality * representation Subject RIV: AA - Philosophy ; Religion

  20. Report: Internal Control Weaknesses under EPA Grant Nos. I004802070 and BG96483308, Awarded to the Eastern Band of Cherokee Indians, Cherokee, North Carolina (United States)

    Report #10-4-0001, October 5, 2009. EBCI does not have a conflict of interest and its SF 272s are correct and prepared in compliance with federal requirements, EPA policies, and grant terms and conditions.

  1. Contribution to the study of external decontamination procedure. Experiments on a new product in the case of radioactive contamination of the teguments

    International Nuclear Information System (INIS)

    Toulet, J.; Tabernat, J.


    General principles of external decontamination with elements of practical organisation in a centre of nuclear studies. Reprint of a paper published in 'Archives des Maladies Professionnelles', Tome 20, n. 3, 1959, p. 272-282

  2. ‘Vanishing cities’: can urban costs explain deindustrialization?

    Czech Academy of Sciences Publication Activity Database

    Goryunov, Maxim; Kokovin, S.


    Roč. 95, č. 3 (2016), s. 633-651 ISSN 1056-8190 Institutional support: PRVOUK-P23 Keywords : city size * urban hierarchies * agglomeration Subject RIV: AH - Economics Impact factor: 1.272, year: 2016

  3. 75 FR 67233 - Federal Motor Vehicle Safety Standards; Head Restraints (United States)


    ... passenger vehicles, and vans). Of these whiplash injuries, 272,464 occurred as a result of rear impacts. For... approximately 18.5 inches with respect to the seat pan * * *. It appeared that an occupant whose sitting...

  4. Caustic addition system operability test procedure

    Energy Technology Data Exchange (ETDEWEB)

    Parazin, R.E.


    This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E).

  5. Caustic addition system operability test procedure

    International Nuclear Information System (INIS)

    Parazin, R.E.


    This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)

  6. Anabaenopsis morphospecies (Cyanobacteria, Nostocales) from Los Patos shallow lake (Province of Buenos Aires, Argentina).

    Czech Academy of Sciences Publication Activity Database

    Aguilera, A.; Komárek, Jiří; Echenique, R. O.


    Roč. 272, č. 3 (2016), s. 173-183 ISSN 1179-3155 Institutional support: RVO:67985939 Keywords : biodiversity * cyanobacterial blooms * Argentine Subject RIV: EA - Cell Biology Impact factor: 1.240, year: 2016

  7. 2012 USACE Post Sandy Topographic LiDAR: Rhode Island and Massachusetts Coast (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This topographic elevation point data derived from multiple return light detection and ranging (LiDAR) represents 354.272 square miles of coastline for Rhode Island...

  8. Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.


    Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK

  9. Nízkomolekulární inhibitory replikace enterovirů

    Czech Academy of Sciences Publication Activity Database

    Nencka, Radim; Hřebabecký, Hubert; Šála, Michal; Dejmek, Milan


    Roč. 108, č. 4 (2014), s. 326-334 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : enteroviruses * antivirals * inhibitors of virus replication Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  10. O použití Einsteinových rovnic v kosmologii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal


    Roč. 60, č. 3 (2015), s. 255-272 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : dark matter * dark energy * Friedmann equation Subject RIV: BA - General Mathematics

  11. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... 272.3900 Donate Alzheimer's & Dementia What Is Alzheimer's? Brain Tour Younger/Early Onset Risk Factors Genetics Myths ... Dementia Korsakoff Syndrome Related Conditions CTE MCI Traumatic Brain Injury Facts and Figures Know the 10 Signs ...

  12. Review: Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity (2013

    Directory of Open Access Journals (Sweden)

    Tinashe Nyamunda


    Full Text Available Review of the monograph:Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity, New York and Oxford: Berghahn Books, 2013, ISBN 978-0-85745-951-0, 272 pages

  13. Fulltext PDF

    Indian Academy of Sciences (India)


    2007 Chemistry Nobel Prize (6) 548 (GA). 2007 Physics Nobel Prize .... Integrated open-ended experiments (1) 54 (GA) ... On the tendency of varieties to depart .... The Scientific Enterprise: Attitudes and ... Undergraduate teaching (3) 272 (CR).

  14. The young and the digital, by S. Craig Watkins [book review


    Melanie E. S. Kohnen


    Review of S. Craig Watkins, The young and the digital: What migration to social-networking sites, games, and anytime, anywhere media means for our future. Boston: Beacon Press, 2009, paperback, $18 (272p) ISBN 978-0807006160.

  15. Recent approaches to the total synthesis of phytoprostanes, isoprostanes and neuroprostanes as important products of lipid oxidative stress and biomarkers of disease

    Czech Academy of Sciences Publication Activity Database

    Jahn, Emanuela; Durand, T.; Galano, J. M.; Jahn, Ullrich


    Roč. 108, č. 4 (2014), s. 301-319 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : lipids * oxidative stress * phytoprostanes * isoprostanes * neuroprostanes * total synthesis Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  16. Význam kapra v rybničním hospodářství

    Czech Academy of Sciences Publication Activity Database

    Matěna, Josef; Flajšhans, Martin


    Roč. 61, č. 6 (2013), s. 272-274 ISSN 0044-4812 Institutional support: RVO:60077344 ; RVO:67985904 Keywords : Cyprinus carpio * fish production * pond ecosystem * Czech Republic Subject RIV: EH - Ecology, Behaviour

  17. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals

  • ORF Alignment: NC_002950 [GENIUS II[Archive

    Lifescience Database Archive (English)


  • ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)


  • Increased presence of the thermophilic mosquitoes and potential vectors Anopheles hyrcanus (Pallas, 1771) and Culex modestus Ficalbi 1889 in Central Europe’s lower Dyje River basin (South Moravia, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Šebesta, O.; Gelbič, Ivan


    Roč. 51, č. 3 (2015), s. 272-280 ISSN 0037-9271 Institutional support: RVO:60077344 Keywords : Anopheles hyrcanus * Culex modestus * vector Subject RIV: EH - Ecology, Behaviour Impact factor: 0.575, year: 2015

    1. (1)H-NMR-based metabolomic analysis of the effect of moderate wine consumption on subjects with cardiovascular risk factors


      Vázquez Fresno, Rosa; Llorach, Rafael; Alcaro, Francesca; Rodríguez Martínez, Miguel Ángel; Vinaixa Crevillent, Maria; Chiva Blanch, Gemma; Estruch Riba, Ramon; Correig Blanchar, Xavier; Andrés Lacueva, Ma. Cristina


      Moderate wine consumption is associated with health-promoting activities. An H-NMR-based metabolomic approach was used to identify urinary metabolomic differences of moderate wine intake in the setting of a prospective, randomized, crossover, and controlled trial. Sixty-one male volunteers with high cardiovascular risk factors followed three dietary interventions (28 days): dealcoholized red wine (RWD) (272mL/day, polyphenol control), alcoholized red wine (RWA) (272mL/day) and gin (GIN) (100m...

    2. Developing a Hybrid Virtualization Platform Design for Cyber Warfare Training and Education (United States)


      25  2.7.2.  Virtual Distributed Ethernet ( VDE ) ...................................................... 26  2.7.3...ability to work with the network independent of the actual underlying physical topology. 26 2.7.2. Virtual Distributed Ethernet ( VDE ) Distributed Ethernet ( VDE ) is an abstraction of the networking components involved in a typical Ethernet network [18]. It allows for virtual

    3. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY83, Part 1 (Adamsville, Alabama - Ferndale, Michigan). (United States)


      PARKIN LOT MAINTENANCE YUIA ARIZONA 82 82 ZILLOENS HEIAN ASSOCIATES YUMA ARIZONA 272 272 20,462 13,094 6,681 60 627 1,359,748 428,327 353,827 545,807...INC MORGANZA LOUISIANA 335 335 1,715 29 1,686 RAYS CONSTRUCTION CO NAIRN LOUISIANA 400 400 400 400 MARY LOU FASHIONS NATCHITOCHES LOUISIANA 193 193 193

    4. Anonymous Agencies, Backstreet Businesses and Covert Collectives

      DEFF Research Database (Denmark)

      Krause Hansen, Hans; Schoeneborn, Dennis


      Book review of: Anonymous Agencies, Backstreet Businesses and Covert Collectives: rethinking Organizations in the 21st Century, C. R. Scott. Stanford, CA: Stanford University Press, 2013. 272 pp. £45.90. ISBN 9780804781381......Book review of: Anonymous Agencies, Backstreet Businesses and Covert Collectives: rethinking Organizations in the 21st Century, C. R. Scott. Stanford, CA: Stanford University Press, 2013. 272 pp. £45.90. ISBN 9780804781381...

    5. Work-family conflict and job burnout among correctional staff. (United States)

      Lambert, Eric G; Hogan, Nancy L


      Work-family conflict and job burnout are both issues for 272 correctional staff (response rate of 68%). The two major forms of work-family conflict are work-on-family conflict and family-on-work conflict. Multivariate analysis of survey data from 272 correctional staff at a state prison indicated work-on-family conflict had a significant positive relation with job burnout, while family-on-work conflict did not.

    6. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

      International Nuclear Information System (INIS)

      Even, Julia


      synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

    7. An essential role of intestinal cell kinase in lung development is linked to the perinatal lethality of human ECO syndrome (United States)

      Tong, Yixin; Park, So Hyun; Wu, Di; Xu, Wenhao; Guillot, Stacey J.; Jin, Li; Li, Xudong; Wang, Yalin; Lin, Chyuan-Sheng; Fu, Zheng


      Human endocrine-cerebro-osteodysplasia (ECO) syndrome, caused by the loss-of-function mutation R272Q in the ICK (intestinal cell kinase) gene, is a neonatal-lethal developmental disorder. To elucidate the molecular basis of ECO syndrome, we constructed an Ick R272Q knock-in mouse model that recapitulates ECO pathological phenotypes. Newborns bearing Ick R272Q homozygous mutations die at birth due to respiratory distress. Ick mutant lungs exhibit not only impaired branching morphogenesis associated with reduced mesenchymal proliferation, but also significant airspace deficiency in primitive alveoli concomitant with abnormal interstitial mesenchymal differentiation. ICK dysfunction induces elongated primary cilia and perturbs ciliary Hedgehog signaling and autophagy during lung sacculation. Our study identifies an essential role for ICK in lung development and advances the mechanistic understanding of ECO syndrome. PMID:28380258

    8. The in vivo phosphorylation sites in multiple isoforms of amphiphysin I from rat brain nerve terminals

      DEFF Research Database (Denmark)

      Craft, George E; Graham, Mark E; Bache, Nicolai


      : serines 250, 252, 262, 268, 272, 276, 285, 293, 496, 514, 539, and 626 and Thr-310. These were distributed into two clusters around the proline-rich domain and the C-terminal Src homology 3 domain. Hierarchical phosphorylation of Ser-262 preceded phosphorylation of Ser-268, -272, -276, and -285. Off......, incorporating 16 and 23% of the 32P. The multiple phosphopeptides containing Ser-268, Ser-276, Ser-272, and Ser-285 had 27% of the 32P. Evidence for a role for at least one proline-directed protein kinase and one non-proline-directed kinase was obtained. Four phosphosites predicted for non-proline...... that are either dynamically turning over or constitutively phosphorylated in nerve terminals and improve understanding of the role of individual amphI sites or phosphosite clusters in synaptic SVE....

    9. Nonlinear current-voltage characteristics of WO3-x nano-/micro-rods (United States)

      Shen, Zhenguang; Peng, Zhijian; Zhao, Zengying; Fu, Xiuli


      A series of crystalline tungsten oxide nano-/micro-rods with different compositions of WO3, WO2.90, W19O55 (WO2.89) and W18O49 (WO2.72) but identical morphology feature were first prepared. Then, various nanoscaled electrical devices were fabricated from them by micro-fabrication through a focused ion beam technique. Interestingly, the devices from the oxygen-deficient WO3-x display significantly nonlinear current-voltage characteristics. The calculated nonlinear coefficients of the WO2.90, WO2.83, and WO2.72 varistors are 2.52, 3.32 and 4.91, respectively. The breakdown voltage of the WO2.90, WO2.83, and WO2.72 varistors are 1.93, 1.28 and 0.93 V, respectively. Such WO3-x nano-varistors might be promising for low-voltage electrical/electronic devices.

    10. NCBI nr-aa BLAST: CBRC-TTRU-01-0021 [SEVENS

      Lifescience Database Archive (English)

      Full Text Available CBRC-TTRU-01-0021 ref|ZP_05556351.1| competence protein ComEC [Lactobacillus jensen...ii 27-2-CHN] ref|ZP_05862090.1| competence protein ComEC [Lactobacillus jensenii 115-3-CHN] gb|EEU21212.1| competence... protein ComEC [Lactobacillus jensenii 27-2-CHN] gb|EEX24089.1| competence protein ComEC [Lactobacillus jensenii 115-3-CHN] ZP_05556351.1 0.18 25% ...

    11. Artificial Boundary Conditions for Finite Element Model Update and Damage Detection (United States)


      otherwise, Equation (2.58), even if it seems overdetermined, can have linear dependent rows and ends up being underdetermined. 2. Methods Using...0i iM    , (2.62) where i and  i are the solutions to Equation (2.5), and  i from (2.6) is mass normalized. Differentiating ...known that:       i iM           , (2.72) where [Λ] is the diagonal eigenvalue matrix. From matrix algebra , the Equation (2.72

    12. Optimization of metals extraction using cyanex series and NaDDC reagents in liquid/supercritical CO{sub 2}

      Energy Technology Data Exchange (ETDEWEB)

      Ko, M. S.; Kim, S. H.; Park, K. H.; Kim, H. D.; Kim, H. W. [Kyunghee Univ., Youngin (Korea, Republic of)


      In this research, extraction of small fraction of radioactive elements from mixed contaminated working dress has been conducted by organic solvent extraction, but use of organic solvents has created secondary wastes. In this study, liquid/supercritical fluid CO{sub 2}, an environmentally friendly solvent, was used to extract five metals(Co, Cu, Pb, Cd, Zn). Using five metals selective ligand Cyanex-272 and NaDDC, the most optimized extraction conditions were founded 20 .deg. C, 100atm and complexed ratio(Cyanex-272: 100mg, NaDDC:5mg). The results suggest the possibility of utilizing supercritical fluid technology for extraction of metals from contaminated working dress.

    13. Tank farms essential drawing plan

      International Nuclear Information System (INIS)

      Domnoske-Rauch, L.A.


      The purpose of this document is to define criteria for selecting Essential Drawings, Support Drawings, and Controlled Print File (CPF) drawings and documents for facilities that are part of East and West Tank Farms. Also, the drawings and documents that meet the criteria are compiled separate listings. The Essential Drawing list and the Support Drawing list establish a priority for updating technical baseline drawings. The CPF drawings, denoted by an asterisk (*), defined the drawings and documents that Operations is required to maintain per the TWRS Administration Manual. The Routing Boards in Buildings 272-WA and 272-AW are not part of the CPF

    14. Book review: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics by Alexander Lerch

      DEFF Research Database (Denmark)

      Sturm, Bob L.


      A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00......A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00...

    15. Suspension Array for Multiplex Detection of Eight Fungicide-Resistance Related Alleles in Botrytis cinerea


      Zhang, Xin; Xie, Fei; Lv, Baobei; Zhao, Pengxiang; Ma, Xuemei


      A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea. Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension (ASPE) assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene (BenA), H272 and 272Y of the Succinate dehydrogenase iron–sulfur...

    16. Design criteria tank farm storage and staging facility

      International Nuclear Information System (INIS)

      Lott, D.T.


      Tank Farms Operations must store/stage material and equipment until work packages are ready to work. Consumable materials are also required to be stored for routine and emergency work. Safety issues based on poor housekeeping and material deterioration due to weather damage has resulted from inadequate storage space. It has been determined that a storage building in close proximity to the Tank Farm work force would be cost effective. This document provides the design criteria for the design of the storage and staging buildings near 272AW and 272WA buildings

    17. Multiple Nebular Gas Reservoirs Recorded by Oxygen Isotope Variation in a Spinel-rich CAI in CO3 MIL 090019 (United States)

      Simon, J. I.; Simon, S. B.; Nguyen, A. N.; Ross, D. K.; Messenger, S.


      We conducted NanoSIMS O-isotopic imaging of a primitive spinel-rich CAI spherule (27-2) from the MIL 090019 CO3 chondrite. Inclusions such as 27-2 are proposed to record inner nebula processes during an epoch of rapid solar nebula evolution. Mineralogical and textural analyses suggest that this CAI formed by high temperature reactions, partial melting, and condensation. This CAI exhibits radial O-isotopic heterogeneity among multiple occurrences of the same mineral, reflecting interactions with distinct nebular O-isotopic reservoirs.

    18. Agro-Science Journal of Tropical Agriculture, Food, Environment ...

      African Journals Online (AJOL)

      PC USER

      Results on chemical properties showed that the per cent protein in the yoghurt samples were Tito yoghurt. (27.2), Final yoghurt ... The total crude fat of yoghurt was determined by .... be due to the milk used as base raw material and at least due ...

    19. Pb–Pb zircon ages of Archaean metasediments and gneisses from ...

      Indian Academy of Sciences (India)

      eastern parts of the Dharwar craton took place over similar time interval starting in the Mesoarchaean at ca. .... the age of the Bababudan Group between 2.91 and. 2.72 Ga. ..... All the samples were processed using a standard technique to ...

    20. Flow Field Analysis of Fully Coupled Computations of a Flexible Wing undergoing Stall Flutter (United States)


      Actuators for Active Flow Control,” Ann. Rev. Fluid Mech., Vol. 43, 2011, pp. 247–272. 10 Morton, S. A., McDaniel, D. R., Sears , D. R., Tillman, B., and... Sears , D. A., Tillmann, B., and Tuckey, T. R., “Rigid, Maneuvering, and Aeroelastic Results for Kestrel - A CREATE Simulation Tool,” AIAA Paper 2010-1233

    1. Mission Command in the Age of Network-Enabled Operations: Social Network Analysis of Information Sharing and Situation Awareness (United States)


      socio-technical limitations that restrict the free flow of information and communications (e.g., Bateman , 1996). The flow of information among the...networks. Phys. A Stat. Mech. Appl. 272, 173–187. doi: 10.1016/S0378- 4371(99)00291-5 Bateman , R. L. (1996). Force XXI and the death of

    2. The outcome of familial adenomatous polyposis in the absence of a ...

      African Journals Online (AJOL)

      S Afr Med J 1995; 85: 272-276. Familial adenomatous polyposis (FAP) almost always leads to large-bowel cancer unless prophylactic surgery is performed. The results of treating large numbers of patients with FAP are usually reported from polyposis registries. Such registries have two main functions. Firstly they identify,.

    3. 77 FR 4688 - National School Lunch Program: Direct Certification Continuous Improvement Plans Required by the... (United States)


      ... local educational agencies (LEAs) that participate in the NSLP and/or School Breakfast Program to... performance benchmarks for directly certifying for free school meals those children who are members of... requirements, School breakfast and lunch programs. 7 CFR Part 272 Alaska, Civil rights, Claims, Food stamps...

    4. Rainfall simulation experiments in the Southwestern USA using the Walnut Gulch rainfall simulator (United States)

      The dataset contains hydrological, erosion, vegetation, ground cover, and other supplementary information from 272 rainfall simulation experiments conducted on 23 semi-arid rangeland locations in Arizona and Nevada between 2002 and 2013. On 30% of the plots simulations were conducted up to five time...

    5. Anodic Stripping Voltammetry for Arsenic Determination on Composite Gold Electrode

      Czech Academy of Sciences Publication Activity Database

      Navrátil, Tomáš; Kopanica, M.; Krista, J.


      Roč. 48, č. 2 (2003), s. 265-272 ISSN 0009-2223 Grant - others:GIT(AR) 101/02/U111/CZ Institutional research plan: CEZ:AV0Z4040901 Keywords : arsenic determination * stripping voltammetry * composite gold electrode Subject RIV: CG - Electrochemistry Impact factor: 0.415, year: 2003

    6. Manipulating the autolytic pathway of a Bacillus protease

      NARCIS (Netherlands)

      VandenBurg, B; Eijsink, VGH; Vriend, G; Veltman, OR; Venema, G; HopsuHavu, VK; Jarvinen, M; Kirschke, H


      Autolytic degradation of Bacillus subtilis thermolysin-like proteinase (TLP-sub) is responsible for the irreversible inactivation of the enzyme at elevated temperatures. Previously, we reported five autolysis sites in B. subtilis neutral protease (Van den Burg et al., 1990, Biochem. J. 272:93-97).

    7. 75 FR 51392 - New York: Incorporation by Reference of State Hazardous Waste Management Program (United States)


      ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 272 [EPA-R02-RCRA-2010-0249; FRL-9178-8] New York: Incorporation by Reference of State Hazardous Waste Management Program Correction In rule document 2010-18927 beginning on page 45489 in the issue of Tuesday, August 3, 2010, make the following correction: Appendix A...

    8. Burn-out, Circumferential Film Flow Distribution and Pressure Drop for an Eccentric Annulus with Heated Rod

      DEFF Research Database (Denmark)

      Andersen, P. S.; Jensen, A.; Mannov, G.


      Measurements of (1) burn-out, (2) circumferential film flow distribution, and (3) pressure drop in a 17 × 27.2 × 3500 mm concentric and eccentric annulus geometry are presented. The eccentric displacement was varied between 0 and 3 mm. The working fluid was water. Burn-out curves at 70 bar...... flow variation on burn-out is discussed....

    9. 75 FR 24400 - Drawbridge Operation Regulation; CSX Railroad, Trout River, Mile 0.9, Jacksonville, FL (United States)


      ... an assessment of potential costs and benefits under section 6(a)(3) of that Order. The Office of... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272... position, displaying green lights to indicate that vessels may pass. (c) As a train approaches, provided...

    10. 77 FR 19963 - Special Local Regulation and Security Zone: War of 1812 Bicentennial Commemoration, Port of... (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...] RIN 1625-AA00; 1625-AA08 Special Local Regulation and Security Zone: War of 1812 Bicentennial..., and after the War of 1812 Bicentennial Commemoration events in the Port of Boston, Massachusetts, to...

    11. 77 FR 25592 - Safety Zone; Patapsco River, Northwest and Inner Harbors, Baltimore, MD (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... historic sloop-of-war USS CONSTELLATION on May 24, 2012. This action is necessary to provide for the safety...-of-war USS CONSTELLATION in Baltimore, Maryland on May 24, 2012. Planned events include a three- hour...

    12. 77 FR 15323 - Special Local Regulations and Safety Zone; War of 1812 Bicentennial Commemorations, Chesapeake... (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...] RIN 1625-AA08, AA00 Special Local Regulations and Safety Zone; War of 1812 Bicentennial Commemorations... Chesapeake Bay and Port of Baltimore, Maryland for War of 1812 Bicentennial Commemorations activities. This...

    13. Landforms along transverse faults parallel to axial zone of folded ...

      Indian Academy of Sciences (India)

      Himalaya, along the Kali River valley, is defined by folded hanging wall ... role of transverse fault tectonics in the formation of the curvature cannot be ruled out. 1. .... Piedmont surface is made up of gravelliferous and ... made to compute the wedge failure analysis (Hoek .... (∼T2) is at the elevation of ∼272 m asl measured.

    14. Risk factors for type 2 diabetes mellitus in adolescents secondary ...

      African Journals Online (AJOL)

      Background: The prevalence of Type 2 diabetes mellitus (T2 DM) in children and ... had none of the risk factors while 272(30.9%) had at least one risk factor. Using the American Diabetes Association criteria for identification of those at risk for ...

    15. 76 FR 78571 - Approval and Promulgation of State Implementation Plans: Oregon (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...: Rule 0010, What is the Employee Commute Options Program?; Rule 0020, Who is Subject to ECO?; Rule 0030, What Does ECO require?; Rule 0040, How Does the Department Enforce ECO?; Rule 0050, Definitions of...

    16. 77 FR 31728 - Elemental Mercury Used in Barometers, Manometers, Hygrometers, and Psychrometers; Significant New... (United States)


      ..., electronic, and other liquid-based (water or eco-celli) barometers. At least eight States have banned the..., Manometers, Hygrometers, and Psychrometers. Washington, DC. OPPT/Economics, Exposure and Technology Division...) of the National Technology Transfer and Advancement Act (NTTAA), 15 U.S.C. 272 note, does not apply...

    17. The Role of Individuals in the System of the Culture of a Small Ethnographic Region

      Czech Academy of Sciences Publication Activity Database

      Pospíšilová, Jana


      Roč. 65, č. 2 (2017), s. 255-272 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Local culture * bearer * generational transmission * a chronicler Josef Káňa (1929 - 1994) * the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

    18. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil. (United States)

      Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke


      We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.

    19. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil


      Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke


      We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.

    20. Anorexigenní neuropeptid CART v regulaci příjmu potravy

      Czech Academy of Sciences Publication Activity Database

      Nagelová, Veronika; Železná, Blanka; Maletínská, Lenka


      Roč. 108, č. 4 (2014), s. 354-357 ISSN 0009-2770 R&D Projects: GA ČR GAP303/10/1368 Institutional support: RVO:61388963 Keywords : CART * cocaine and amphetamine regulated transcript * anorexigenic neuropeptide Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

    1. Inferring the Presence of Reverse Proxies Through Timing Analysis (United States)


      primary platforms from which Internet attacks are launched today. Attacks such as Distributed Denial of Service (DDoS), spam, phishing , and identity...7,272,642. [23] Google Maps. (2014, August). Planetlabs. [24] vmware. (2015, May). [Online]. Available: microsites

    2. Direct observations of the vacancy and its annealing in germanium

      DEFF Research Database (Denmark)

      Slotte, J.; Kilpeläinen, S.; Tuomisto, F.


      Weakly n-type doped germanium has been irradiated with protons up to a fluence of 3×1014 cm-2 at 35 K and 100 K in a unique experimental setup. Positron annihilation measurements show a defect lifetime component of 272±4 ps at 35 K in in situ positron lifetime measurements after irradiation at 100...

    3. Search Results | Page 26 | IDRC - International Development ...

      International Development Research Centre (IDRC) Digital Library (Canada)

      Results 251 - 260 of 272 ... Urban agriculture could boost food security in Arab countries ... Despite reforms, labour markets in the Middle East and North Africa (MENA) have been unable ... the brand of the bottled water and how it is stored affected its quality. ... Copyright · Open access policy · Privacy policy · Research ethics ...

    4. Review of Raffaele Simone and Francesca Masini: Word classes: Nature, typology and representations

      DEFF Research Database (Denmark)

      Shibuya, Yoshikata; Jensen, Kim Ebensgaard


      Review of Raffaele Simone and Francesca Masini (eds.). Word classes: Nature, typology and representations. Current Issues in Linguistic Theory [CILT] 332. Amsterdam/ Philadelphia: John Benjamins Publishing Company, 2014, 293 + vii pp., ISBN: 1978-90-272-4851-0. Hardback and E-book 99.00 EUR / 149...

    5. The Influence of Work-Related Stressors on Clergy Husbands and Their Wives. (United States)

      Morris, Michael Lane; Blanton, Priscilla White


      Assessed predictive power of 5 work-related stressors identified in clergy family literature on criterion variables of marital, parent, and life satisfaction among 272 clergy husbands and their wives from 6 denominations. Findings supported hypotheses that work-related stressors were inversely related to marital, parental, and life satisfaction…

    6. TJOG Vol 25 No 1.cdr

      African Journals Online (AJOL)

      All the students knew about the disease getting most of their information from television (31.7%) and radio (27.2%).The aetiological agent of HIV/AIDS was known by 76.3% of the students while blood test was correctly identified as the best method of diagnosis. Only 49.8% mentioned the condom as a method of prevention .

    7. Relations of Shyness-Sensitivity and Unsociability with Adjustment in Middle Childhood and Early Adolescence in Suburban Chinese Children (United States)

      Liu, Junsheng; Chen, Xinyin; Zhou, Ying; Li, Dan; Fu, Rui; Coplan, Robert J.


      This study examined how shyness-sensitivity and unsociability were associated with social, school, and psychological adjustment in Chinese children and adolescents. Participants included 564 children (272 boys, M[subscript age] = 9 years) and 462 adolescents (246 boys, M[subscript age] = 13 years) in a suburban region in China. Data were obtained…

    8. Time bound changes (in 24 h in human sperm motility and level of calcium and magnesium in seminal plasma

      Directory of Open Access Journals (Sweden)

      J. Valsa


      Level of calcium (27.2 mg/dl and magnesium (13.54 mg/dl in seminal plasma did not show any significant changes during study period from that of at ½ h. The study concluded that electrolytes under study were not responsible for the decrease in motility during study period.

    9. Psychometric evaluation of the Dutch version of the Subjective Opiate Withdrawal Scale (SOWS)

      NARCIS (Netherlands)

      Dijkstra, B.A.G.; Krabbe, P.F.M.; Riezebos, T.G.M.; Staak, C.P.F. van der; Jong, C.A.J. de


      AIM: To evaluate the psychometric properties of the Dutch version of the 16-item Subjective Opiate Withdrawal Scale (SOWS). The SOWS measures withdrawal symptoms at the time of assessment. METHODS: The Dutch SOWS was repeatedly administered to a sample of 272 opioid-dependent inpatients of four

    10. The presence of Echinococcus multilocularis in the red fox (vulpes vulpes) in the Netherlands

      NARCIS (Netherlands)

      van der Giessen JWB; Rombout Y; Limper L; van der Veen; Moolenbeek C; Franchimont H; Homan W; MGB


      Er zijn onderzoekingen gedaan naar het voorkomen van Echinococcus multilocularis bij vossen in Nederland van 1996 tot 1998. Deze parasiet is de oorzaak van alveolaire echinococcose, een ernstige parasitaire zoonose. Hiervoor zijn eerst 272 vossen onderzocht in het grensgebied met Duitsland en

    11. 78 FR 72020 - Drawbridge Operation Regulation; Passaic River, Kearney and Newark, NJ (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... Proposed Rulemaking Sec. Section Symbol U.S.C. United States Code A. Regulatory History and Information On... rulemaking. The Coast Guard received no comments from the Small Business Administration on this rule. The...

    12. 76 FR 35742 - Superfund Site, New Bedford Harbor, New Bedford, MA: Anchorage Ground and Regulated Navigation Area (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... heavy metals. An extensive history and background of the cleanup project can be found on the EPA's Web... entities'' comprises small businesses, not-for-profit organizations that are independently owned and...

    13. 78 FR 40963 - Regulated Navigation Areas; Bars Along the Coasts of Oregon and Washington (United States)


      ... Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use voluntary... comments and documents C. Privacy Act D. Public meeting II. Abbreviations III. Regulatory History and... individual submitting the comment (or signing the comment, if submitted on behalf of an association, business...

    14. 78 FR 35787 - Safety Zones; Revolution 3 Triathlon, Lake Erie, Sandusky Bay, Cedar Point, OH (United States)


      ... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies... comment, if submitted on behalf of an association, business, labor union, etc.). You may review a Privacy... time and place announced by a later notice in the Federal Register. B. Regulatory History and...

    15. 78 FR 70218 - Drawbridge Operation Regulation; Hackensack River, Kearney and Jersey City, NJ (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use.... United States Code A. Regulatory History and Information On August 28, 2013, we published a notice of... Small Business Administration on this rule. The Coast Guard certifies under 5 U.S.C. 605(b) that this...

    16. 77 FR 37326 - Safety Zone; Grand Hotel 125th Anniversary Fireworks Celebration, Mackinaw Island, MI (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... Rulemaking A. Regulatory History and Information The Coast Guard is issuing this temporary final rule without.... Assistance for Small Entities Under section 213(a) of the Small Business Regulatory Enforcement Fairness Act...

    17. 76 FR 77458 - Amendment to Agency Rules of Practice (United States)


      ... Advancement Act (Technical Standards) The National Technology Transfer and Advancement Act (15 U.S.C. 272 note... forwarders it determines are reincarnations of other entities with a history of failing to comply with..., if submitted on behalf of an association, business, labor union, etc.). You may review the Department...

    18. 78 FR 14444 - Drawbridge Operation Regulation; Lake Champlain, Swanton, VT (United States)


      ... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies.... Regulatory History and Information On November 9, 2012, we published a notice of proposed rulemaking (NPRM... regulations on small entities during rulemaking. The Coast Guard received no comments from the Small Business...

    19. 77 FR 27123 - Safety Zone; Baltimore Air Show, Patapsco River, Baltimore, MD (United States)


      ... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use.... Background and Purpose The U.S. Navy History & Heritage Command, Office of Commemorations, is planning to... businesses, not-for-profit organizations that are independently owned and operated and are not [[Page 27124...

    20. Females solicit sneakers to improve fertilization success in the bitterling fish (Rhodeus sericeus)

      Czech Academy of Sciences Publication Activity Database

      Smith, C.; Reichard, Martin


      Roč. 272, č. 1573 (2005), s. 1683-1688 ISSN 0962-8452 R&D Projects: GA AV ČR(CZ) KJB600930501 Institutional research plan: CEZ:AV0Z60930519 Keywords : extra-pair copulations * bitterling * strategic ejaculation Subject RIV: EG - Zoology Impact factor: 3.510, year: 2005

    1. Phenotype-gene: 791 [Arabidopsis Phenome Database[Archive

      Lifescience Database Archive (English)

      Full Text Available 791 abnormal for trait of morph...):272-84. abnormal for trait of morpholo

    2. Quasistatic normal-compliance contact problem of visco-elastic bodies with Coulomb friction implemented by QP and SGBEM

      Czech Academy of Sciences Publication Activity Database

      Vodička, R.; Mantič, V.; Roubíček, Tomáš


      Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.357, year: 2016

    3. Development of a Novel Therapeutic Paradigm Utilizing a Mammary Gland-Targeted, Bin1-Knockout Mouse Model (United States)


      genes in higher organisms— Homo sapiens gene INDO, encoding indole- amine-pyrrole 2,3 dioxygenase. Available from inhibitors alter the prenylation and growth-stimulating function of RhoB. J Biol Chem 1997; 272:15591–4. 25. Routhier EL , Donover PS

    4. Antimikrobiální peptidy izolované z hmyzu

      Czech Academy of Sciences Publication Activity Database

      Čeřovský, Václav


      Roč. 108, č. 4 (2014), s. 344-353 ISSN 0009-2770 R&D Projects: GA ČR GA203/08/0536 Institutional support: RVO:61388963 Keywords : antimicrobial peptides * analogues * insect * lucifensin Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    5. Pokroky ve studiu interakce inzulinu s jeho receptorem

      Czech Academy of Sciences Publication Activity Database

      Žáková, Lenka; Jiráček, Jiří


      Roč. 108, č. 4 (2014), s. 368-374 ISSN 0009-2770 R&D Projects: GA ČR GPP207/11/P430 Institutional support: RVO:61388963 Keywords : insulin * insulin receptor * crystal structure * NMR structure * complex * diabetes Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

    6. 48 CFR 11.101 - Order of precedence for requirements documents. (United States)


      ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Order of precedence for... A-119, “Federal Participation in the Development and Use of Voluntary Consensus Standards and in... of 1995, Pub. L. 104-113 (15 U.S.C. 272 note), agencies must use voluntary consensus standards, when...

    7. 76 FR 53072 - Certification; Importation of Vehicles and Equipment Subject to Federal Safety, Bumper, and Theft... (United States)


      ... discovers that an applicant submitted false or inaccurate information, the application may be denied. 49 CFR... information submitted in its annual renewal statement is true and correct. Any RI making a false or inaccurate... U.S.C. 272) directs NHTSA to use voluntary consensus standards in its regulatory activities unless...

    8. 75 FR 63791 - Fisheries of the Northeastern United States; Atlantic Herring Fishery; Amendment 4 (United States)


      ... submit Confidential Business Information or otherwise sensitive or protected information. NMFS will..., uncertainty related to expected catch of herring in the New Brunswick weir fishery and discard [[Page 63793... vessels issued Limited Access Incidental Catch Permits, and 2,272 vessels issued Open Access Permits...

    9. Maternal and Paternal Parenting Styles in Adolescents: Associations with Self-Esteem, Depression and Life-Satisfaction (United States)

      Milevsky, Avidan; Schlechter, Melissa; Netter, Sarah; Keehn, Danielle


      Our study examined variations in adolescent adjustment as a function of maternal and paternal parenting styles. Participants included 272 students in grades 9 and 11 from a public high school in a metropolitan area of the Northeastern US. Participants completed measures of maternal and paternal parenting styles and indices of psychological…

    10. Sadhana | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Home; Journals; Sadhana. C L Bauer. Articles written in Sadhana. Volume 33 Issue 3 June 2008 pp 261-272. The extrinsic influence of carbon fibre reinforced plastic laminates to strengthen steel structures · A K Patnaik C L Bauer T S Srivatsan · More Details Abstract Fulltext PDF. The intrinsic advantages of strengthening ...

    11. Pyogenic liver abscess mimicking pleural effusion

      African Journals Online (AJOL)


      Jul 2, 2011 ... the liver.2 The annual incidence of liver abscess in children varies widely in different regions of the world, occurring more commonly in .... 103/µl (27.2%), monocytes 0.9 x 103/µl(7.6%), eosinophil. 0.5 x 103/µl (4.0%).

    12. 77 FR 34386 - Implementation of Federal Financial Report-Upcoming Mandatory Use of the Federal Financial Report... (United States)


      ... of cumulative data only. Background The Office of Management and Budget has consolidated the Financial Status Report (FSR or SF-269/SF-269A) and the Federal Cash Transaction Report (FCTR or SF-272/SF..., 2010, CDC grantees have been required to report cash transaction data via the Payment Management System...

    13. Elektrochemická oxidace přírodních barviv používaných na uměleckých památkách

      Czech Academy of Sciences Publication Activity Database

      Ramešová, Šárka; Sokolová, Romana


      Roč. 108, č. 5 (2014), s. 507-512 ISSN 0009-2770 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR M200401201 Program:M Institutional support: RVO:61388955 Keywords : flavonoids * spectroelectrochemistry * oxidation Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

    14. Book Review: Evolutionary Ecology of Birds: Life Histories, Mating ...

      African Journals Online (AJOL)

      Abstract. Book Title: Evolutionary Ecology of Birds: Life Histories, Mating Systems and Extinction. Book Authors: P.M. Bennett & I.P.F. Owens. Oxford University. Press. 2002. Pp. 272. Price £24.95 (paperback). ISBN 0 19 851089 6.

    15. Warburg effect—damping of electromagnetic oscillations

      Czech Academy of Sciences Publication Activity Database

      Pokorný, Jiří; Pokorný, Jan; Borodavka, Fedir


      Roč. 36, č. 3 (2017), s. 270-278 ISSN 1536-8378 R&D Projects: GA ČR GA16-12757S Institutional support: RVO:68378271 Keywords : Warburg effect * mitochondrial dysfunction * water ordering * mitochondrial membrane potential * biological electromagnetic activity * cancer Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 1.272, year: 2016

    16. Influence of anticancer drugs on interactions of tumor suppressor protein p53 with DNA

      Czech Academy of Sciences Publication Activity Database

      Pivoňková, Hana; Němcová, Kateřina; Brázdová, Marie; Kašpárková, Jana; Brabec, Viktor; Fojta, Miroslav


      Roč. 272, Suppl. 1 (2005), s. 562 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] R&D Projects: GA MZd(CZ) NC7574 Institutional research plan: CEZ:AV0Z50040507 Keywords : tumour suppressor protein p53 * anticancer drugs * interaction with DNA Subject RIV: BO - Biophysics

    17. Complete mitochondrial genome of the fennec fox (Vulpes zerda). (United States)

      Yang, Xiufeng; Zhao, Chao; Zhang, Honghai; Zhang, Jin; Chen, Lei; Sha, Weilai; Liu, Guangshuai


      In this study, the complete mitochondrial genome of the fennec fox (Vulpes zerda) was sequenced using blood samples obtained from a female individual in Shanghai wildlife Park. Sequence analysis showed that the content of T (26.7%) in total composition was no more than C (27.2%), which is different from most of Canide individuals sequenced previously.

    18. Longitudinal Modeling of Adolescent Normative Beliefs and Substance Initiation (United States)

      Lillehoj, Catherine J.; Trudeau, Linda; Spoth, Richard


      Pstudy investigated the effects of baseline levels of academic achievement and longitudinal trends in normative beliefs on adolescent substance initiation across a 42-month time period. Participants were 272 rural adolescents who were an average of 12.3 years old at the baseline assessment. Academic achievement positively predicted the intercept…

    19. Study of Laminar Flame 2-D Scalar Values at Various Fuel to Air Ratios Using an Imaging Fourier-Transform Spectrometer and 2-D CFD Analysis (United States)


      Role of flow visualization in the development of UNICORN , Journal of Visualization 2000, Vol. 2, 257-272. [10] Gross, K. C.; Tremblay, P.; Bradley...NASA- Glenn’s Chemical Equilibrium with Applications (CEA) program. UNICORN CFD predictions were in excellent agreement with CEA calculations at...49 Appendix A – UNICORN CFD Inputs and Instruction .....................................................50 Appendix B – NASA-Glenn

    20. Direct Detection of the Asteroidal YORP Effect

      Czech Academy of Sciences Publication Activity Database

      Lowry, S.C.; Fitzsimmons, A.; Pravec, Petr; Vokrouhlický, D.; Boehnhardt, H.; Taylor, P.A.; Margot, J. L.; Galád, Adrián; Irwin, M.; Irwin, J.; Kušnirák, Peter


      Roč. 316, č. 5822 (2007), s. 272-274 ISSN 0036-8075 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids rotation * near- Earth objects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 26.372, year: 2007

    1. Transnational System Building Across Geopolitical Shifts. The Danube-Oder-Elbe Canal, 1901-2015

      Czech Academy of Sciences Publication Activity Database

      Janáč, Jiří; van der Vleuten, E.


      Roč. 9, č. 2 (2016), s. 272-291 ISSN 1965-0175 R&D Projects: GA ČR GA15-04902S Institutional support: RVO:68378114 Keywords : large technical systems * water politics * environmental history Subject RIV: AB - History Impact factor: 2.500, year: 2016

    2. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

      DEFF Research Database (Denmark)

      Ehret, Georg B; Ferreira, Teresa; Chasman, Daniel I


      To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified ...

    3. Level of Farmers' Participation In The International Institute Of ...

      African Journals Online (AJOL)


      ( X =2.68), while consumers had link with farmers ( X =2.72). The major ... objectives, motivation, extension approaches and sources of funding. This means ... actors and the organizational and institutional learning behaviors and practices .... more the consumers rice preference is satisfied, the stronger their link with farmers ...

    4. Magnetic, magnetoelastic and other electronic properties of a UIrAl single crystal

      Czech Academy of Sciences Publication Activity Database

      Andreev, Alexander V.; Mushnikov, N. V.; Honda, F.; Sechovyský, V.; Javorský, P.; Goto, T.

      272-276, - (2004), e337-e339 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943 Institutional research plan: CEZ:AV0Z1010914 Keywords : uranium intermetallics * UIrAl * UPtAl * ferromagnetism * pressure effects Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    5. Bulk study of a DyNiAl single crystal

      Czech Academy of Sciences Publication Activity Database

      Prchal, J.; Andreev, Alexander V.; Javorský, P.; Honda, F.; Jurek, Karel

      272-276, - (2004), e419-e420 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943 Keywords : rare-earth * DyNiAl * magnetic anisotropy * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    6. Ethical Judgments Concerning Email Use in the Workplace: University Students' Perceptions. (United States)

      Keith, Nancy; Perreault, Heidi; Sutliff, Kris


      A survey of 1,272 college students showed that most believed it appropriate to use company e-mail accounts for personal messages, but inappropriate to read others' e-mail or send messages with ethnic, racial, or sexual content. Students who participated in ethics discussions were less likely to rate certain behaviors as appropriate. (Contains 22…

    7. Multiculturalism in Schools: The Professional Absorption of Immigrant Teachers from the Former USSR into the Education System in Israel (United States)

      Michael, Orly


      The purpose of this research was to determine the professional absorption of immigrant teachers from the Former Soviet Union in comparison to veteran teachers working in the same schools in Israel. Findings are based on data from 272 questionnaires. The sample included 117 teachers working in Israeli schools who immigrated from the Former Soviet…

    8. Tvarohomakový koláč

      Czech Academy of Sciences Publication Activity Database

      Svobodová, Ivana


      Roč. 89, č. 5 (2006), s. 270-272 ISSN 0027-8203 R&D Projects: GA AV ČR 1ET200610406 Institutional research plan: CEZ:AV0Z90610518 Keywords : adjectives * word formation * orthography Subject RIV: AI - Linguistics

    9. Sigmund Freud a první aplikace psychoanalýzy na literární dílo

      Czech Academy of Sciences Publication Activity Database

      Švanda, Martin


      Roč. 49, č. 3 (2005), s. 272-279 ISSN 0009-062X R&D Projects: GA AV ČR IAA7025402 Keywords : psychology of literature * author * literary work Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

    10. Journal for Language Teaching - Vol 36, No 3-4 (2002)

      African Journals Online (AJOL)

      Shortcomings of the written survey questionnaire for discovering language learner perceptions: reflections of a researcher · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gary P. Barkhuizen, 259-272. ...

    11. Journal of Earth System Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Home; Journals; Journal of Earth System Science; Volume 121; Issue 2. Impact of continental meteorology and atmospheric circulation in the modulation of Aerosol Optical Depth over the Arabian Sea. Sandhya K Nair S Sijikumar S S Prijith. Volume 121 Issue 2 April 2012 pp 263-272 ...

    12. Dicty_cDB: Contig-U05606-1 [Dicty_cDB

      Lifescience Database Archive (English)

      Full Text Available odium falciparum 3D7 chromosome 13. 34 8.3 17 ( FG295791 ) 1108770741540 New World Screwworm Larvae 9387 EST...... 42 8.3 2 ( FG293345 ) 1108770669958 New World Screwworm Larvae 9387 EST... 42 8.3 2 ( GO218251 ) CAGB272

    13. Pengaruh Green Marketing Hotel Terhadap Green Consumer Behavior


      Yo Fernandez, Eunike Christe; Tjoanda, Evelyn


      Penelitian ini dilakukan untuk mengetahui pengaruh dari green marketing hotel terhadap green consumer behavior. Green marketing memiliki 3 dimensi, yaitu green product, green price, dan green promotion. Penelitian ini melibatkan 272 responden masyarakat Surabaya dan menggunakan metode regresi linear berganda. Hasil penelitian menunjukkan bahwa green product dan green price berpengaruh secara positif dan signifikan sedangkan green promotion berpengaruh namun tidak signifikan terhadap green con...

    14. Nanodiamanty - fluorescenční a zobrazovací nanosondy

      Czech Academy of Sciences Publication Activity Database

      Šlegerová, Jitka; Cígler, Petr


      Roč. 108, č. 4 (2014), s. 387-393 ISSN 0009-2770 R&D Projects: GA ČR GAP108/12/0640; GA MŠk(CZ) LH11027 Institutional support: RVO:61388963 Keywords : nanodiamond * fluorescence * biocompatibility Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    15. A novel one-pot synthesis of spirooxindole derivatives catalyzed by ...

      African Journals Online (AJOL)

      Nano zinc oxide was explored as a heterogeneous and reusable catalyst for the one-pot synthesis of spirooxindoles via three-component reaction between urea, isatin, and 1,3-dicarbonyl compounds. KEY WORDS: Nano-ZnO, Spirooxindoles, Isatin. Bull. Chem. Soc. Ethiop. 2013, 27(2), 309-314.

    16. 75 FR 73972 - Medicaid Program; Cost Limit for Providers Operated by Units of Government and Provisions To... (United States)


      ... District Court for the District of Columbia on May 23, 2008 in Alameda County Medical Center, et al. v... limit on reimbursement. On May 23, 2008, the United States District Court for the District of Columbia...), DHHS is removing the word ``nursing facilities'' replacing it with ``NFs.'' In Sec. 447.272(a)(1), DHHS...

    17. The Speargrass (Imperata cylindrica (L) Beauv.) menace in Ghana ...

      African Journals Online (AJOL)

      Farmers perceived average yield losses of 30–80% ha–1 due to speargrass interference, implying a national average crop loss ha-1 of $31–$84, $155–$414 and $272–$727 for maize, cassava and yam systems, respectively. Reductions in food quality due to the piercing nature of the rhizomes was also paramount.

    18. 78 FR 57171 - Experimental Removal of Barred Owls To Benefit Threatened Northern Spotted Owls; Record of... (United States)


      ... spotted owls in many portions of the northern spotted owl's range (Pearson and Livezey 2003, p. 272... populations. Barred owls displace spotted owls from high-quality habitat (Kelley et al. 2003, p. 51; Pearson... management intervention, it is reasonable to expect that competition from barred owls may cause extirpation...

    19. CLIMODE Subsurface Mooring Report: November 2005 - November 2007 (United States)


      from magnetic north to true north using a geomagnetic model. Each point was converted individually to correct for the temporal change in magnetic...OPTIONAL FORM 272 (4-77) (Formerly NTIS-35) Department of Commerce (See ANSI-Z39.18) See Instructions on Reverse UNCLASSIFIED WHOI-2013-03 CLIMODE

    20. Gebed en die vorming van Christelike identiteit in Openbaring

      African Journals Online (AJOL)

      31 Jul 2015 ... 111.3 – Johns 2003). Deur die ... David Aune (2006:107) merk tereg op dat ... Stevenson 1995:257–272). ... sien Stevenson (2001:234). 6. ...... McKinnon, J., 1987, Music in early chrisfian worship, Cambridge University Press,.

    1. The Effects of Hydrodynamic Stretch on the Flame Propagation Enhancement of Ethylene by Addition of Ozone (United States)


      dimensional simulations were performed using the unsteady ignition and combustion with reactions ( UNICORN ) model [28,33–36]. UNICORN only requires the inflow...Katta VR. 1998 Role of flow visualization in the development of UNICORN . J. Vis. 2, 257–272. (doi:10.1007/BF03181442) 34. Katta VR, Goss LP, Roquemore WM

    2. Point-contact properties of cubic YbCu .sub.5./sub. prepared by melt spinning technique

      Czech Academy of Sciences Publication Activity Database

      Reiffers, M.; Idzikowski, B.; Ilkovič, S.; Zorkovská, A.; Šebek, Josef; Müller, K. H.

      272-276, - (2004), s. 209-210 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z1010914 Keywords : heavy-fermion * pont-contact * YbCu 5 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    3. Erratum: Erratum to: A Novel Approach to Determination of Threshold for Stress Corrosion Cracking (KISCC) using Round Tensile Specimens (United States)

      Singh Raman, R. K.; Rihan, R.; Ibrahim, R. N.


      Due to an error by the authors, the reference R. Rihan, R.K. Singh Raman, and R.N. Ibrahim: Materials Science and Engineering A, 2006, vol. 425, pp. 272-77 should have been included in the list of references as well as cited as a source of the data in Figures 11, 12 and 16.

    4. Browse Title Index

      African Journals Online (AJOL)

      Items 101 - 150 of 272 ... Vol 14, No 4 (2008), Evaluation of primary mental health care in North West ... disorder symptoms) in undergraduate university students from 26 low-, ... Vol 10, No 1 (2004), Factor analysis of the Children's Behaviour ...

    5. Chromosomal study in newborn infants with congenital anomalies in ...

      African Journals Online (AJOL)

      Congenital anomalies were found in 103 cases with a prevalence of 2.06% with male to female ratio of 1.7:1. Skeletal system anomalies had the highestfrequency (37.9%), followed in descending order by chromosomal abnormalities (27.2%), circulatory system anomalies (22.3%), central nervous system (CNS) anomalies ...

    6. Self-Efficacy Beliefs as Shapers of Children's Aspirations and Career Trajectories. (United States)

      Bandura, Albert; Barbaranelli, Claudio; Caprara, Gian Vittorio; Pastorelli, Concetta


      Tested a structural model of the network of sociocognitive influences shaping children's career aspirations and trajectories among 272 early adolescents. Found that subjects' perceived efficacy rather than their actual academic achievement was the key determinant of their perceived occupational self-efficacy and preferred choice of worklife.…

    7. Management of Chest Drains: A National Survey on Surgeons‑in ...

      African Journals Online (AJOL)

      triangle of safety [Figure 1]. Just above a quarter of respondents (27.2%) always utilized different sizes of tubes for different pathologies and the same proportion of respondents always positioned the tip of the tube apically to drain pneumothorax and basally to drain pleural effusion. In contrast, 9.9% and 6.2% of respondents.

    8. Influence of stress on the permeability of coal and sedimentary rocks of the Upper Silesian Basin

      Czech Academy of Sciences Publication Activity Database

      Konečný, Pavel; Kožušníková, Alena


      Roč. 48, č. 2 (2011), s. 347-352 ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : permeability * triaxial test * coal and sedimentary rocks Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 1.272, year: 2011

    9. Dysmorphic features and developmental outcome of 2-year-old children

      NARCIS (Netherlands)

      Seggers, Jorien; Haadsma, Maaike L.; Bos, Arend F.; Heineman, Maas Jan; Middelburg, Karin J.; Van den Heuvel, Edwin R.; Hadders-Algra, Mijna


      AimThe aim of this study was to assess the associations between dysmorphic features and neurological, mental, psychomotor, and behavioural development in order to improve our understanding of aetiological pathways leading to minor developmental problems. MethodIn our cross-sectional study, 272

    10. Dysmorphic features and developmental outcome of 2-year-old children

      NARCIS (Netherlands)

      Seggers, Jorien; Haadsma, Maaike L.; Bos, Arend F.; Heineman, Maas Jan; Middelburg, Karin J.; van den Heuvel, Edwin R.; Hadders-Algra, Mijna


      The aim of this study was to assess the associations between dysmorphic features and neurological, mental, psychomotor, and behavioural development in order to improve our understanding of aetiological pathways leading to minor developmental problems. In our cross-sectional study, 272 generally

    11. 41 CFR 101-27.207-3 - Marking material to show extended shelf life. (United States)


      ... extended shelf life. 101-27.207-3 Section 101-27.207-3 Public Contracts and Property Management Federal...-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.207-3 Marking material to show extended shelf life. When the shelf-life period of Type II material (except for critical end-use items as...

    12. 41 CFR 101-27.209 - Utilization and distribution of shelf-life items. (United States)


      ... distribution of shelf-life items. 101-27.209 Section 101-27.209 Public Contracts and Property Management... PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.209 Utilization and distribution of shelf-life items. Where it is determined that specified quantities of both Type I and Type II...

    13. 41 CFR 101-27.206 - Procurement of shelf-life materials. (United States)


      ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Procurement of shelf-life materials. 101-27.206 Section 101-27.206 Public Contracts and Property Management Federal Property... MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.206 Procurement of shelf-life materials. ...

    14. Organizational Structures, Processes, and Problems: A Literature Review and Taxonomy (United States)


      and the reserves system in Israel." Archives Europeennes de Sociologie , 1974, 15 (2), 262-272. Ruber, G. P., Ullman, J., & Leifer, R. "Optimum...34 Archives Europeennes de Sociologie , 1977, 18 (1), 29-54. Maynard, C. D., & Blalock, A. B. "The welfare-state within the military." Journal of

    15. Sociolinguistic Bibliography of European Countries for 2008: CZ

      Czech Academy of Sciences Publication Activity Database

      Kaderka, Petr


      Roč. 24, č. 1 (2010), s. 267-272 ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistics * bibliography * Czech Republic Subject RIV: AI - Linguistics

    16. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

      NARCIS (Netherlands)

      Ehret, Georg B.; Ferreira, Teresa; Chasman, Daniel I.; Jackson, Anne U.; Schmidt, Ellen M.; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Louise A.; Kanoni, Stavroula; Petersen, Ann-Kristin; Pihur, Vasyl; Strawbridge, Rona J.; Shungin, Dmitry; Hughes, Maria F.; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E.; Guo, Xiuqing; Lyytikäinen, Leo-Pekka; Fava, Cristiano; Eriksson, Niclas; Nolte, Ilja M.; Magnusson, Patrik K.; Salfati, Elias L.; Rallidis, Loukianos S.; Theusch, Elizabeth; Smith, Andrew J. P.; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H.; Joehanes, Roby; Kim, Stuart K.; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D.; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O.; Bochud, Murielle; Absher, Devin; Adair, Linda S.; Amin, Najaf; Arking, Dan E.; Axelsson, Tomas; Baldassarre, Damiano; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R.; Barroso, Inês; Bevan, Stephen; Bis, Joshua C.; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L.; Boomsma, Dorret I.; Bornstein, Stefan R.; Brown, Morris J.; Burnier, Michel; Cabrera, Claudia P.; Chambers, John C.; Chang, I.-Shou; Cheng, Ching-Yu; Chines, Peter S.; Chung, Ren-Hua; Collins, Francis S.; Connell, John M.; Döring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F.; Doney, Alex S. F.; Drenos, Fotios; Edkins, Sarah; Eicher, John D.; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fall, Tove; Farrall, Martin; Felix, Janine F.; Ferrières, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschini, Nora; Franco, Oscar H.; Franco-Cereceda, Anders; Fraser, Ross M.; Ganesh, Santhi K.; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goel, Anuj; Goodall, Alison H.; Goodarzi, Mark O.; Gorski, Mathias; Gräßler, Jürgen; Groves, Christopher J.; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Göran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S.; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A.; Hingorani, Aroon D.; Hirschhorn, Joel N.; Hofman, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A.; Hunt, Steven C.; Ikram, M. Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A.; Kähönen, Mika; Kang, Hyun Min; Kathiresan, Sekar; Keating, Brendan J.; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S.; Kosova, Gulum; Krauss, Ronald M.; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaløy, Kirsti; Lakka, Timo A.; Lee, Nanette R.; Lee, I.-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindström, Jaana; Lobbens, Stéphane; Männistö, Satu; Müller, Gabriele; Müller-Nurasyid, Martina; Mach, François; Markus, Hugh S.; Marouli, Eirini; McCarthy, Mark I.; McKenzie, Colin A.; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E.; Morris, Andrew D.; Morrison, Alanna C.; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J.; O'Reilly, Paul F.; Ong, Ken K.; Paccaud, Fred; Palmer, Cameron D.; Parsa, Afshin; Pedersen, Nancy L.; Penninx, Brenda W.; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P.; Psaty, Bruce M.; Quertermous, Thomas; Rao, Dabeeru C.; Rasheed, Asif; Rayner, N. William; Renström, Frida; Rettig, Rainer; Rice, Kenneth M.; Roberts, Robert; Rose, Lynda M.; Rossouw, Jacques; Samani, Nilesh J.; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H.-H.; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H.; Smith, Albert V.; Sosa, Maria X.; Spector, Tim D.; Stančáková, Alena; Stanton, Alice V.; Stirrups, Kathleen E.; Stringham, Heather M.; Sundstrom, Johan; Swift, Amy J.; Syvänen, Ann-Christine; Tai, E.-Shyong; Tanaka, Toshiko; Tarasov, Kirill V.; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D.; Tremoli, Elena; Uitterlinden, Andre G.; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M.; van Iperen, Erik P. A.; Vasan, Ramachandran S.; Verwoert, Germaine C.; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F.; Vollenweider, Peter; Wagner, Aline; Wain, Louise V.; Wareham, Nicholas J.; Watkins, Hugh; Weder, Alan B.; Westra, Harm-Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F.; Wong, Tien Y.; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S.; Mohlke, Karen L.; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J.; Willer, Cristen J.; Franke, Lude; Hovingh, G. Kees; Taylor, Kent D.; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L.; Njølstad, Inger; Schwarz, Peter E. H.; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J.; Melander, Olle; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimäki, Terho; Hveem, Kristian; Palmas, Walter; März, Winfried; Kumari, Meena; Salomaa, Veikko; Chen, Yii-der I.; Rotter, Jerome I.; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G.; Kuulasmaa, Kari; Franks, Paul W.; Hamsten, Anders; Wichmann, H.-Erich; Palmer, Colin N. A.; Stefansson, Kari; Ridker, Paul M.; Loos, Ruth J. F.; Chakravarti, Aravinda; Deloukas, Panos; Morris, Andrew P.; Newton-Cheh, Christopher; Munroe, Patricia B.


      To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified 66

    17. Effect of female genital mutilation on female sexual function ...

      African Journals Online (AJOL)

      Manal Ibrahim Hanafi Mahmoud


      Apr 22, 2015 ... FGM act) and female sexual function index (a 19-item self-reported questionnaire for assessing ... married educated women had FGM with their 272 matched controls (their matching was .... Urine retention. 73. 30.6 ... strata.14 This was also proved by the current work (39.3% of ... It is a single author paper.

    18. Correction to Hilton et al. (2004) (United States)

      Hilton, N. Zoe; Harris, Grant T.; Rice, Marnie E.; Lang, Carol; Cormier, Catherine A.; Lines, Kathryn J.


      This paper reports errors in the article "A Brief Actuarial Assessment for the Prediction of Wife Assault Recidivism: The Ontario Domestic Assault Risk Assessment," by N. Zoe Hilton, Grant T. Harris, Marnie E. Rice, Carol Lang, Catherine A. Cormier, and Kathryn J. Lines (Psychological Assessment, 2004, Vol. 16, No. 3, pp. 267-275). On page 272,…

    19. Browse Title Index - African Journals Online

      African Journals Online (AJOL)

      ... 7 (2016), Protein expression of Myt272-3 recombinant clone and in silico prediction of a possible vaccine candidate against Mycobacterium tuberculosis, Abstract PDF .... Vol 17, No 1 (2018), Regulation of MicroRNA-378 expression in mature human adipose tissue cells by adiponectin, free fatty acids and dexamethasone ...

    20. A retrospective analysis of acute organophosphorus poisoning ...

      African Journals Online (AJOL)

      A retrospective analysis of acute organophosphorus poisoning cases admitted to the tertiary care teaching hospital in South India. ... Young adult males were more commonly involved than females (M:F 2.5:1). The mean age of the patients was 28 years (range 2-72 years, SD ± 14.3 years). Mean time to receive treatment ...

    1. Does smoking increase sick-leaves? Evidence using register data on Swedish workers

      NARCIS (Netherlands)

      Lundborg, N.


      Objective: To examine the effect of smoking on sick leave. Methods: Nationally representative data on 14 272 workers aged 16-65 years from the 1988-91 waves of the Swedish Survey of Living Conditions were used for the analyses. The data are linked to register-based data, on the annual number of

    2. Subjective vs objective predictors of functional knee joint performance in anterior cruciate ligament-reconstructed patients

      DEFF Research Database (Denmark)

      Holsgaard-Larsen, Anders; Jensen, Carsten; Aagaard, Per


      ) subscales (Sport/Rec and QOL) in ACL-reconstructed patients. METHODS: 23 hamstring auto-graft ACL-reconstructed men (mean age: 27.2 standard deviation 7.5years, BMI: 25.4 standard deviation 3.2 time since surgery: 27 standard deviation 7months) completed KOOS-questionnaire and an objective test-battery: (i...


      Czech Academy of Sciences Publication Activity Database

      Čopíková, J.; Wimmer, Zdeněk; Lapčík, O.; Cahlíková, L.; Opletal, L.; Moravcová, J.; Drašar, P.


      Roč. 108, č. 11 (2014), s. 1053-1057 ISSN 0009-2770 Institutional support: RVO:61389030 Keywords : OBJECTIVE EVALUATION * PHENOLIC-COMPOUNDS * TASTE INTENSITIES Subject RIV: GM - Food Processing Impact factor: 0.272, year: 2014

    4. Questioning territorial cohesion: (Un)equal access to services of general interest

      Czech Academy of Sciences Publication Activity Database

      Malý, Jiří

      -, August 2016 (2016), s. 1-21 ISSN 1056-8190 Institutional support: RVO:68145535 Keywords : territorial cohesion * services of general interest * accessibility * spatial justice * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.272, year: 2016

    5. Výuka chemie pro nechemické obory na vysokých školách

      Czech Academy of Sciences Publication Activity Database

      Jaklová Dytrtová, Jana; Dytrtová, R.; Jakl, M.; Navrátil, Tomáš; Petr, M.; Šteffl, M.


      Roč. 108, č. 12 (2014), s. 1172-1178 ISSN 0009-2770 Institutional support: RVO:61388963 ; RVO:61388955 Keywords : teaching methods * study forms * syllabus * attention * efficiency Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

    6. Fish diversity in the Niokolo Koba National Park, middle Gambia River basin, Senegal

      Czech Academy of Sciences Publication Activity Database

      Blažek, Radim; Ondračková, Markéta; Vošlajerová Bímová, Barbora; Vetešník, Lukáš; Petrášová, Ivona; Reichard, Martin


      Roč. 23, č. 3 (2012), s. 263-272 ISSN 0936-9902 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : West Africa * estuary * assemblages Subject RIV: EH - Ecology, Behaviour Impact factor: 1.648, year: 2012

    7. Burnout and health of primary school educators in the North West ...

      African Journals Online (AJOL)

      Burnout and health of primary school educators in the North West Province. Amanda Montgomery, Karina Mostert, Leon Jackson. Abstract. No Abstract. South African journal of Education Vol. 25(4) 2005: 266-272. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...

    8. Some ecological and biochemical observations on Caloglossa lepreiurii (Harvey) from Zuri estuary, Goa

      Digital Repository Service at National Institute of Oceanography (India)

      Jagtap, T.G.; Untawale, A.G.

      January and February to nil. The alga prefers diffused light, fairly high temperatures, high nutrients and optimum salinity ranging between 10 ppt to 20 ppt. Major metabolites showed 272.75 mg/g dry weight was recorded in September. Organic carbon ranged...

    9. National Heart, Lung, and Blood Institute National Asthma Education and Prevention Program (United States)

      ... American Academy of Allergy, Asthma & Immunology 414–272–6071 American Academy ... American College of Allergy, Asthma & Immunology 847–427–1200 American Lung ...

    10. Cerebrospinal fluid markers for differential dementia diagnosis in a large memory clinic cohort.

      NARCIS (Netherlands)

      Schoonenboom, N.S.M.; Reesink, F.E.; Verwey, N.A.; Kester, M.I.; Teunissen, C.E.; van de Ven, P.M.; Pijnenburg, Y.A.L.; Blankenstein, M.A.; Rozemuller, J.M.; Scheltens, P.; van der Flier, W.M.


      Objective: To determine how amyloid β 42 (Aβ42), total tau (t-tau), and phosphorylated tau (p-tau) levels in CSF behave in a large cohort of patients with different types of dementia. Methods: Baseline CSF was collected from 512 patients with Alzheimer disease (AD) and 272 patients with other types

    11. Solid Waste Management: Abstracts From the Literature - 1964. (United States)

      Connolly, John A.; Stainback, Sandra E.

      The Solid Waste Disposal Act of 1965 (Public Law 89-272, Title II) and its amending legislation, the Resource Recovery Act of 1970 (Public Law 91-512, Title I), authorize collection, storage, and retrieval of information relevant to all aspects of solid-waste management. As part of this effort, the U.S. Environmental Protection Agency's…

    12. Trichomonas vaginalis infection among adolescent girls in some ...

      African Journals Online (AJOL)

      Trichomonasvaginalisis the most common non-viral sexually transmitted disease (STD) and one of the neglected parasitic infections. This study aimed to determine the prevalence of T. vaginalisinfection among adolescent girls in some secondary schools in Edo State, Nigeria. A total of 272 girls were recruited in this study.

    13. Solid-State Field-Assisted Ag Diffusion in Ge-Ga-Sb-S Glasses

      Czech Academy of Sciences Publication Activity Database

      Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.


      Roč. 94, č. 6 (2011), s. 1756-1760 ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Ag diffusion * Diffusion method * Diffusion temperature Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011

    14. Solid State Field-Assisted Diffusion of Copper in Multi-Component Tellurite Glass

      Czech Academy of Sciences Publication Activity Database

      Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.; Chigirinsky, Y.


      Roč. 94, č. 7 (2011), 1986-1988 ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Solid state diffusion * Secondary Ion Mass Spectrometry * Tellurite glass Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011

    15. Bjudzhet obrazovanija na novõi god / Mailis Reps

      Index Scriptorium Estoniae

      Reps, Mailis, 1975-


      Ülevaade haridus- ja teadusministeeriumi 2007. aasta eelarvest. Kokku on haridus- ja teadustegevusele riigieelarvest eraldatud 8,272 miljardit krooni, mis on 1,45 miljardit krooni rohkem kui 2006. aastal. Tabel: Haridus- ja teadusministeeriumi finantseerimine aastate lõikes

    16. Chemie fosfonátových analogů nukleotidů a oligonukleotidů - stručná reminiscence a současnost

      Czech Academy of Sciences Publication Activity Database

      Rosenberg, Ivan


      Roč. 108, č. 4 (2014), s. 375-386 ISSN 0009-2770 R&D Projects: GA ČR GA13-26526S Institutional support: RVO:61388963 Keywords : oligonucleotides * phosphonates * RNase H * RNase L Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    17. Nton and Ekom (17)

      African Journals Online (AJOL)


      soluble organic matter (SOM) and genetic potential (GP) values ranged from 0.52 – 0.82wt%, 455.64 – 1003.04 ppm and ... These values suggested organic matter deposited under anoxic to suboxic conditions. ...... Dayo Sonibare of Chemistry Department, ... Nature Vol. 272, No. ... Molecular organic geochemistry of the.

    18. Effects of Text Illustration on Children's Learning of a School Science Topic. (United States)

      Reid, D. J.; Beveridge, M.


      This study of 272 13-year-old science students in England focuses on the effect of varied text and picture content on learning. A criterion-referenced objective items test was used to measure the effect of pictures on students of varying abilities and compare the effectiveness of traditional worksheet presentation and microcomputer presentation.…

    19. 75 FR 409 - Privacy Act of 1974; United States Citizenship and Immigration Services-010 Asylum Information... (United States)


      ... 1974; United States Citizenship and Immigration Services--010 Asylum Information and Pre-Screening... system of records to the Department of Homeland Security's inventory, entitled Unites States Citizenship... Citizenship and Immigration Services (202-272-1663), 20 Massachusetts Avenue, NW., 3rd Floor, Washington, DC...

    20. Katepsinové proteasy v patologii

      Czech Academy of Sciences Publication Activity Database

      Horn, Martin; Jílková, Adéla; Mareš, Michael


      Roč. 108, č. 4 (2014), s. 358-363 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP302/11/1481 Institutional support: RVO:61388963 Keywords : cathepsins * proteases * proteolysis Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

    1. Laserový systém pro odměřování reliéfu MIEMS vytvářeného metodou hlubokého reaktivního leptání

      Czech Academy of Sciences Publication Activity Database

      Maňka, Tadeáš; Šerý, Mojmír; Lazar, Josef; Číp, Ondřej; Krátký, Stanislav; Zemánek, Pavel


      Roč. 62, č. 10 (2017), s. 270-272 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : laser interferometry * reactive ion etching * micro electro-mechanical system Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

    2. 75 FR 10552 - Sixth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping... (United States)


      ...) Applications Data Quality--Non-Numeric Requirements Data Quality--Numeric Requirements Guidance Materials... Applications Numerical Requirements Guidance Materials Data Quality Wednesday, April 14 Continuation of... Planning SC-214 Requirements Review and Response Planning Thursday, April 15 Document Agreements DO-272...

    3. Mental Health in Danish Domestic and International Adoptees as Young Adults

      DEFF Research Database (Denmark)

      Olsen, Rikke Fuglsang

      This study examines psychiatric contacts and a range of psychiatric disorders among domestic and international adoptees in Denmark using register data on all non-kin adoptees from the birth cohorts of 1989–1994 (N=3.180) and their non-adopted peers (N=418,272). The odds of an adoptee having a psy...

    4. Efektivita přeměn energie - Možnosti dokonalejší přeměny

      Czech Academy of Sciences Publication Activity Database

      Luxa, Martin; Synáč, J.


      Roč. 92, č. 5 (2013), s. 272-275 ISSN 0042-4544 Institutional support: RVO:61388998 Keywords : steam turbine * long blade * aerodynamic laboratory * CFD * interferometry Subject RIV: BK - Fluid Dynamics

    5. Journal of Genetics | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Home; Journals; Journal of Genetics. P. V. Ramchander. Articles written in Journal of Genetics. Volume 88 Issue 3 December 2009 pp 267-272 Research Article. GJB2 and GJB6 gene mutations found in Indian probands with congenital hearing impairment · G. Padma P. V. Ramchander U. V. Nandur T. Padma.

    6. Odkaz díla Václava Machka soudobé slavistice

      Czech Academy of Sciences Publication Activity Database

      Janyšková, Ilona; Karlíková, Helena


      Roč. 50, č. 4 (2014), s. 63-69 ISSN 0557-272X. [Zilele culturilor slave in Romania . Bucuresti, 02.10.2014-04.10.2014] R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Slavistics * Slavonic languages * etymology * Václav Machek Subject RIV: AI - Linguistics

    7. Assignment of the porcine SKI and GABRD genes to chromosome 6q22-q23

      Czech Academy of Sciences Publication Activity Database

      Stratil, Antonín; Knorr, C.; Knoll, Aleš; Kubíčková, S.; Musilová, P.; Van Poucke, M.; Rubeš, J.; Brenig, B.; Peelman, L. J.


      Roč. 36, - (2005), s. 272-273 ISSN 0268-9146 R&D Projects: GA ČR GA523/03/0858 Institutional research plan: CEZ:AV0Z50450515 Keywords : SKI gene * GABRD gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.437, year: 2005

    8. Self-Oriented Perfectionism and Self-Assessment as Predictors of Adolescents? Subjective Well-Being (United States)

      Çelik, Eyüp


      The aim of the present study is to examine whether subjective well-being is predicted by self-oriented perfectionism and self-assessment. The self-oriented perfectionism scale, self-assessment scale and subjective well-being scale (SWB) were administrated to a sample of voluntary 272 eight-grade students from three secondary schools in Sultangazi,…

    9. Arbuscular mycorrhiza decreases cadmium phytoextraction by transgenic tobacco with inserted metallothionein

      Czech Academy of Sciences Publication Activity Database

      Janoušková, Martina; Pavlíková, D.; Macek, Tomáš; Vosátka, Miroslav


      Roč. 272, - (2005), s. 29-40 ISSN 0032-079X R&D Projects: GA ČR(CZ) GA526/02/0293 Institutional research plan: CEZ:AV0Z60050516 Keywords : CUP1 gene * heavy metals * soil microflora Subject RIV: EF - Botanics Impact factor: 1.703, year: 2005

    10. Sex Differences in Occupational Choice, Pay, and Worth: A Supply-Side Approach to Understanding the Male-Female Wage Gap. (United States)

      Hollenbeck, John R.; And Others


      Explored utility of adopting supply-side approach to understanding the nature of wage differentials between men and women using job applicants (N=272) as subjects. Results suggested much of the wage gap can be explained by evaluations of outcomes other than pay, and gender-related differences in expectancies, instrumentalities, and valences with…

    11. Subsidiary divestiture and acquisition in a financial crisis: operational focus, financial constraints, and ownership

      Czech Academy of Sciences Publication Activity Database

      Zhou, Y. M.; Li, X.; Švejnar, Jan


      Roč. 17, č. 2 (2011), s. 272-287 ISSN 0929-1199 R&D Projects: GA ČR GAP402/10/2130; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : divestiture * corporate restructuring * financial constraints Subject RIV: AH - Economics Impact factor: 1.447, year: 2011

    12. Impurity identification and characterization by electrical optical and nuclear methods. The ZnTe: Au case

      International Nuclear Information System (INIS)

      Magnea, N.; Pautrat, J.L.; Saminadayar, K.; Martin, P.; Bontemps, A.


      Gold is characterized in pure ZnTe by capacitance, luminescence and infra-red absorption experiments. The position of gold in the lattice is analysed by channeling of charged particles. We show that gold is principally introduced in substitutional position (Ausub(Zn)) and give a simple acceptor level at Esub(V) + 272 meV

    13. Modeling Ballistic Response of Ultra-High-Molecular-Weight Polyethylene (UHMWPE) (United States)


      in high-speed penetration problems , the material would fail and erode, and the regular contact algorithm cannot update the contact surfaces...High velocity impact and armour design. Express Polymer Letters. 2011;5(3):262–272. 14. Chocron S, King N, Walker JD, Heisserer U, Werff H

    14. Nanovýroba v přírodovědném vzdělávání

      Czech Academy of Sciences Publication Activity Database

      Hájková, Zdeňka; Šmejkal, P.


      Roč. 108, MAR (2014), s. 892-896 ISSN 0009-2770 Institutional support: RVO:68378271 Keywords : nanotechnology * nanofabrication * nanocar * top-down * bottom-up * demonstration * education Subject RIV: AM - Education Impact factor: 0.272, year: 2014

    15. Differential immunodominance hierarchy of CD8+ T-cell responses in HLA-B*27

      DEFF Research Database (Denmark)

      Adland, Emily; Hill, Matilda; Lavandier, Nora


      The well-characterized association between HLA-B*27:05 and protection against HIV disease progression has been linked to immunodominant HLA-B*27:05- restricted CD8+ T-cell responses toward the conserved Gag KK10 (residues 263 to 272) and polymerase (Pol) KY9 (residues 901 to 909) epitopes. We stu...

    16. Civil-Military Relations: A Selected Bibliography (United States)


      Society 29, no. 3 (Spring 2003): 373-391. Sage Rosen , Frederik. "Third-Generation Civil-Military Relations: Moving Beyond the Security- Development Nexus... Barak , Oren. The Lebanese Army: A National Institution in a Divided Society. Albany: State University of New York Press, 2009. 272pp. (UA853 .L4B37

    17. Acute effects of ghrelin administration on glucose and lipid metabolism

      DEFF Research Database (Denmark)

      Vestergaard, Esben Thyssen; Djurhuus, Christian Born; Gjedsted, Jakob


      -blind, placebo-controlled two-period crossover study. SETTING: The study was performed in a university clinical research laboratory. PARTICIPANTS: Eight healthy men aged 27.2 +/- 0.9 yr with a body mass index of 23.4 +/- 0.5 kg/m(2) were included in the study. INTERVENTION: Subjects received infusion of ghrelin...

    18. NtGNL1a ARF-GEF acts in endocytosis in tobacco cells

      Czech Academy of Sciences Publication Activity Database

      Jelínková, Adriana; Müller, Karel; Pařezová, Markéta; Petrášek, Jan


      Roč. 15, NOV 5 (2015), s. 272 ISSN 1471-2229 R&D Projects: GA ČR GPP305/11/P797 Institutional support: RVO:61389030 Keywords : Endocytosis * PIN1 protein trafficking * Inhibitors of endomembrane trafficking Subject RIV: EA - Cell Biology Impact factor: 3.631, year: 2015

    19. Photoinduced centers in PbZr.sub.1-x./sub.Ti.sub.x./sub.O.sub.3./sub. single crystals

      Czech Academy of Sciences Publication Activity Database

      Bykov, I. P.; Glinchuk, M. D.; Laguta, V. V.; Nokhrin, S. N.; Jastrabík, Lubomír; Smotrakov, V.; Hrabovský, Miroslav; Eremkin, V.


      Roč. 272, - (2002), s. 167-172 ISSN 0015-0193 R&D Projects: GA MŠk LN00A015 Institutional research plan: CEZ:AV0Z1010914 Keywords : sinle-crystal * g-tensor * paramagnetic ions * UV illumination Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.408, year: 2002

    20. Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

      Lifescience Database Archive (English)


    1. mos114_0402b.tif -- Side scan sonar image from survey effort HMPR-114-2004-02b in the Olympic Coast National Marine Sanctuary. (United States)

      National Oceanic and Atmospheric Administration, Department of Commerce — This side scan sonar image of the sea floor was mosaiced from data collected in August 2004 onboard the NOAA vesselTatoosh. An EG&G 272 side scan system was used...

    2. Medical Students' Satisfaction and Academic Performance with Problem-Based Learning in Practice-Based Exercises for Epidemiology and Health Demographics (United States)

      Jiménez-Mejías, E.; Amezcua-Prieto, C.; Martínez-Ruiz, V.; Olvera-Porcel, M. C.; Jiménez-Moleón, J. J.; Lardelli Claret, P.


      The aim of this study was to evaluate the effect of problem-based learning (PBL) on university students' satisfaction with and academic performance in a course on epidemiology and social and demographic health. The participants in this interventional study were 529 students (272 in the intervention group and 257 in the control group) enrolled in a…

    3. 76 FR 70531 - Tenth Meeting: RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases (United States)


      .... Discussion the differences between AIXM and the Modeling Effort for Terrain and Obstacles within the... structure'' in DO-272. Determine if and how to re-write Appendix E. Review work on Temporality. ASRN V&V... to space availability. With the approval of the chairman, members of the public may present oral...

    4. 77 FR 14584 - Eleventh Meeting: RTCA Special Committee 217, Joint With EUROCAE Working Group-44, Terrain and... (United States)


      ... Modeling Effort for Terrain and Obstacles within the Committee [ssquf] Decided on a method for addressing the use of the term ``obstacle'' in DO-276 and ``vertical structure'' in DO-272. [ssquf] Determine if... Meeting Adjourn Attendance is open to the interested public but limited to space availability. With the...

    5. Thermodynamic study of selected monoterpenes II

      Czech Academy of Sciences Publication Activity Database

      Štejfa, V.; Fulem, Michal; Růžička, K.; Červinka, C.


      Roč. 79, Dec (2014), 272-279 ISSN 0021-9614 Institutional support: RVO:68378271 Keywords : monoterpenes * vapor pressure * heat capacity * ideal - gas thermodynamic properties * vaporization and sublimation enthalpy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.679, year: 2014

    6. AJDAS vol 9 No 1.indd

      African Journals Online (AJOL)

      Caffeine was extracted from 19 different types of non-alcoholic beverages and prepared teas sampled from supermarkets in ... use of HPLC-UV detector at the wavelength of 272nm, Supelco HS C18 .... tor (Shimadzu Corporation, Kyoto Japan) was ... for the analysis of caffeine content in non- .... Diabetes Technology and.

    7. Cloning and functional analysis in transgenic tobacco of a tapetum ...

      African Journals Online (AJOL)



      Oct 11, 2010 ... “anther-box”, have been already used for genetic engineering of ... tabacum var. NC89) was used for transformation in Murashige and ..... 265-272. Koltunow AM, Truettner T, Cox KH, Wallroth M, Goldberg RB (1990). Different ...

    8. Test Procedure - pumping system for caustic addition project

      International Nuclear Information System (INIS)

      Leshikar, G.A.


      This test procedure provides the requirements for sub-system testing and integrated operational testing of the submersible mixer pump and caustic addition equipment by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)

    9. Role acyklických nukleosidfosfonátů jako potenciálních antimalarik

      Czech Academy of Sciences Publication Activity Database

      Janeba, Zlatko; Hocková, Dana


      Roč. 108, č. 4 (2014), s. 335-343 ISSN 0009-2770 R&D Projects: GA ČR GAP207/11/0108 Institutional support: RVO:61388963 Keywords : acyclic nucleoside phosphonates * prodrugs * antivirals * antimalarials Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    10. Biology as an Integrating Natural Science Domain

      Indian Academy of Sciences (India)

      Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Biology as an Integrating Natural Science Domain: A Proposal for BSc (Hons) in Integrated Biology. Kambadur Muralidhar. Classroom Volume 13 Issue 3 March 2008 pp 272-276 ...

    11. Results of Using the Take-Away Technique on Students' Achievements and Attitudes in High School Physics and Physical Science Courses (United States)

      Carifio, James; Doherty, Michael


      The Take-away Technique was used in High School Physics and Physical Science courses for the unit on Newtonian mechanics in a teacher (6) by grade level (4) partially crossed design (N = 272). All classes received the same IE instructional treatment. The experimental group (classrooms) did a short Take-away after each class summarizing the key…

    12. Molekuly a ionty v pohybu: Počítačové simulace biochemických a biofyzikálních procesů

      Czech Academy of Sciences Publication Activity Database

      Jungwirth, Pavel


      Roč. 108, č. 4 (2014), s. 278-284 ISSN 0009-2770 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388963 Keywords : molecular dynamics * proteins * ions * membranes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

    13. 76 FR 13987 - Submissions Regarding Correspondence and Regarding Attorney Representation (Trademarks) (United States)


      ... owner's address forms requesting that the USPTO amend the record of an application or registration by... Permission to Withdraw as Attorney of Record 12 4,500 900 (PTO Form 2201) Change of Owner's Address (Paper) 10 1,600 272 TEAS Change of Owner's Address (PTO Form 2197) 5 32,000 2,560 Change of Domestic...

    14. 76 FR 61261 - Safety Zone; IJSBA World Finals; Lower Colorado River, Lake Havasu, AZ (United States)


      ... navigable waters of Lake Havasu on the lower Colorado River in support of the International Jet Sports... The International Jet Sports Boating Association is sponsoring the IJSBA World Finals. The event will... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...

    15. 75 FR 61619 - Safety Zone; IJSBA World Finals, Lower Colorado River, Lake Havasu, AZ (United States)


      ... Sports Boating Association (IJSBA) World Finals. This temporary safety zone is necessary to provide for... International Jet Sports Boating Association (IJSBA) is sponsoring the IJSBA World Finals. The event will... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272...

    16. Boundary singularity of Poisson and harmonic Bergman kernels

      Czech Academy of Sciences Publication Activity Database

      Engliš, Miroslav


      Roč. 429, č. 1 (2015), s. 233-272 ISSN 0022-247X R&D Projects: GA AV ČR IAA100190802 Institutional support: RVO:67985840 Keywords : harmonic Bergman kernel * Poisson kernel * pseudodifferential boundary operators Subject RIV: BA - General Mathematics Impact factor: 1.014, year: 2015

    17. 76 FR 32988 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Grain... (United States)


      ... for OMB Review; Comment Request; Grain Handling Facilities ACTION: Notice. SUMMARY: The Department of... collection request (ICR) titled, ``Grain Handling Facilities (29 CFR 1910.272),'' to the Office of Management... directed toward assuring the safety of workers in grain handling through development of a housekeeping plan...

    18. Fundamental relations of mineral specific magnetic carriers for paleointensity determination

      Czech Academy of Sciences Publication Activity Database

      Kletetschka, Günther; Wieczorek, M. A.


      Roč. 272, November 2017 (2017), s. 44-49 ISSN 0031-9201 Institutional support: RVO:67985831 Keywords : Paleofield determination * TRM * Planetary magnetic anomalies * Néel’s theory of magnetism * Magnetic acquisition * Moon * Mars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Particles and field physics Impact factor: 2.075, year: 2016

    19. Differential operators admitting various rates of spectral projection growth

      Czech Academy of Sciences Publication Activity Database

      Mityagin, B.; Siegl, Petr; Viola, J.


      Roč. 272, č. 8 (2017), s. 3129-3175 ISSN 0022-1236 Institutional support: RVO:61389005 Keywords : harmonic and anharmonic oscillators * Hennite functions * spectral projections * Riesz basis Subject RIV: BE - Theoretical Physics OBOR OECD: Pure mathematics Impact factor: 1.254, year: 2016

    20. Human MT2 melatonin receptor and its melatonin recognition site: a structural model

      Czech Academy of Sciences Publication Activity Database

      Luley, Ladislav; Stockner, T; Sovová, Žofie; Mazna, Petr; Ettrich, Rüdiger; Teisinger, Jan

      Roč.272, č.S1 (2005), s. 222-223 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z60870520 Keywords : melatonin receptor * model * structure Subject RIV: BO - Biophysics

    1. South African Journal of Higher Education - Vol 18, No 1 (2004)

      African Journals Online (AJOL)

      Selection for the Science Foundation Programme (University of Natal): the development of a selection instrument · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Grussendorff, M Liebenberg, J Houston, 265-272. ...

    2. Is questionnaire-based sitting time inaccurate and can it be improved? A cross-sectional investigation using accelerometer-based sitting time

      DEFF Research Database (Denmark)

      Gupta, Nidhi; Christiansen, Caroline Stordal; Hanisch, Christiana


      with questionnaire-based siting time and other self-reported predictors to predict accelerometer-based sitting time. Results Questionnaire-based and accelerometer-based average sitting times were ≈272 and ≈476min/day, respectively. A low Pearson correlation (r=0.32), high mean bias (204.1min) and wide limits...

    3. Processing-improved properties and morphology of PP/COC blends

      Czech Academy of Sciences Publication Activity Database

      Vacková, Taťana; Šlouf, Miroslav; Nevoralová, Martina; Kaprálková, Ludmila


      Roč. 122, č. 2 (2011), s. 1168-1175 ISSN 0021-8995 R&D Projects: GA ČR GP106/09/P272 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blend * phase morphology * fiber Subject RIV: JI - Composite Materials Impact factor: 1.289, year: 2011

    4. International study on inter-reader variability for circulating tumor cells in breast cancer

      NARCIS (Netherlands)

      Ignatiadis, Michail; Riethdorf, Sabine; Bidard, François-Clement; Vaucher, Isabelle; Khazour, Mustapha; Rothe, Francoise; Metallo, Jessica; Rouas, Ghizlane; Payne, Rachel E.; Coombes, Raoul Charles; Teufel, Ingrid; Andergassen, Ulrich; Apostolaki, Stella; Politaki, Eleni; Mavroudis, Dimitris; Bessi, Silvia; Pestrin, Martta; di Leo, Angelo; Campion, Michael; Reinholz, Monica; Perez, Edith; Piccart, Martine; Borgen, Elin; Naume, Bjorn; Jimenez, Jose; Aura, Claudia Monica; Zorzino, Laura; Cassatella, Maria Cristina; Sandri, Maria Teresa; Mostert, Bianca; Sleijfer, Stefan; Kraan, Jaco; Janni, Wolfgang; Fehm, Tanja; Rack, Brigitte; Terstappen, Leonardus Wendelinus Mathias Marie; Repollet, Madeline; Pierga, Jean-Yves; Miller, Craig; Sotiriou, Christos; Michiels, Stefan; Pantel, Klaus


      IntroductionCirculating tumor cells (CTCs) have been studied in breast cancer with the CellSearch® system. Given the low CTC counts in non-metastatic breast cancer, it is important to evaluate the inter-reader agreement. MethodsCellSearch® images (N = 272) of either CTCs or white blood cells or

    5. Global Journal of Pure and Applied Sciences - Vol 9, No 2 (2003)

      African Journals Online (AJOL)

      Geothermal gradients in the Niger Delta basin from continuous temperature logs · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I. O. Akpabio, J. E. Ejedawe, J. O. Ebeniro, E. D. Uko, 265-272. ...

    6. Unwrapping ADMM: Efficient Distributed Computing via Transpose Reduction (United States)


      applications of the Split Bregman method: Segmen- tation and surface reconstruction. J. Sci. Comput., 45:272– 293, October 2010. [17] Stephen Boyd and...Garcia, Gretchen Greene, Fabrizia Guglielmetti, Christopher Hanley, George Hawkins , et al. The second-generation guide star cata- log: description

    7. Archivace sociálněvědních dat: principy, technologie, standardy

      Czech Academy of Sciences Publication Activity Database

      Krejčí, Jindřich; Vávra, Martin; Čížek, Tomáš


      Roč. 61, č. 3 (2011), s. 245-272 ISSN 0004-0398 R&D Projects: GA MŠk LA09010 Institutional research plan: CEZ:AV0Z70280505 Keywords : archiving social science data * data management * Nesstar software Subject RIV: AO - Sociology, Demography

    8. Protective double-layer coatings prepared by plasma enhanced chemical vapor deposition on tool steel

      Czech Academy of Sciences Publication Activity Database

      Muresan, M.; Charvátová Campbell, A.; Ondračka, P.; Buršíková, V.; Peřina, Vratislav; Polcar, T.; Reuter, S.; Hammer, M. U.; Valtr, M.; Zajíčková, L.


      Roč. 272, JUN (2015), s. 229-238 ISSN 0257-8972 R&D Projects: GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : PECVD * DLC * amorphous carbon * hardness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.139, year: 2015

    9. Knowledge, Attitude and Practice of Emergency Contraceptives ...

      African Journals Online (AJOL)

      About 309 (46.8%) of the students had heard about emergency contraceptives and from those who heard emergency contraceptives, 27.2% had good knowledge. Majority, four hundred fifteen (62.9%) of the students had positive attitude towards it. However, only 31(4.7%) had used emergency contraceptive methods.

    10. Browse Title Index

      African Journals Online (AJOL)

      Items 101 - 150 of 272 ... Vol 7, No 2 (2008), Haematology of dogs infected with canine distemper virus, Abstract PDF. MCO Ezeibe, RI Udegbunam. Vol 15, No 3 (2017), Haemogram and hormonal profile of WAD bucks treated with leaf ethanolic extract of Spondias mombin, Abstract PDF. AA Oloye, OE Ola-Davies, MO ...

    11. Fen Bilimlerinde ve Beşeri bilimlerde öykülerin rolü

      Czech Academy of Sciences Publication Activity Database

      Sládek, Ondřej; Dervişcemaloğlu, B.


      Roč. 2011, č. 20 (2011), s. 263-272 ISSN 1300-5715 R&D Projects: GA ČR GAP406/10/1911 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * science * humanities Subject RIV: AJ - Letters, Mass-media, Audiovision

    12. Increasing selectivity of a heterogeneous ion-exchange membrane

      Czech Academy of Sciences Publication Activity Database

      Křivčík, J.; Neděla, D.; Hadrava, J.; Brožová, Libuše


      Roč. 56, č. 12 (2015), s. 3160-3166 ISSN 1944-3994. [International Conference on Membrane and Electromembrane Processes - MELPRO 2014. Prague, 18.05.2014-21.05.2014] Institutional support: RVO:61389013 Keywords : ion-exchange membrane * selectivity * permselectivity Subject RIV: JP - Industrial Processing Impact factor: 1.272, year: 2015

    13. 76 FR 5078 - Approval and Promulgation of Air Quality Implementation Plans: Tennessee; Approval of Section 110... (United States)


      ... adverse comments on this action during the public comment period. However, EPA is making note of two... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... notes that it will not impose substantial direct costs on tribal governments or preempt tribal law. The...

    14. The efficient physiological strategy of a tomato landrace in response to short-term salinity stress

      Czech Academy of Sciences Publication Activity Database

      Moles, T. M.; Pompeiano, Antonio; Reyes, T. H.; Scartazza, A.; Guglielminetti, L.


      Roč. 109, dec (2016), s. 262-272 ISSN 0981-9428 Institutional support: RVO:67179843 Keywords : Salt tolerance * Tomato landrace * Chlorophyll a fluorescence * Gas exchange * Soluble sugars * Antioxidants Subject RIV: EH - Ecology, Behaviour Impact factor: 2.724, year: 2016

    15. Rendering one autolysis site in Bacillus subtilis neutral protease resistant to cleavage reveals a new fission

      NARCIS (Netherlands)

      Van den Burg, B; Eijsink, VGH; Vriend, G; Veltman, OR; Venema, G

      Autolytic degradation of the thermolysin-like proteinase of Bacillus subtilis (TLP-sub) is responsible for the irreversible inactivation of the enzyme at elevated temperatures. Previously we have reported five cleavage sites in Tip-sub [Van den Burg et al, (1990) Biochem. J. 272, 93-97]. In an

    16. The influence of activation of heterogeneous ion-exchange membranes on their electrochemical properties

      Czech Academy of Sciences Publication Activity Database

      Brožová, Libuše; Křivčík, J.; Neděla, D.; Kysela, V.; Žitka, Jan


      Roč. 56, č. 12 (2015), s. 3228-3232 ISSN 1944-3994. [International Conference on Membrane and Electromembrane Processes - MELPRO 2014. Prague, 18.05.2014-21.05.2014] Institutional support: RVO:61389013 Keywords : heterogeneous ion-exchange membranes * electrochemical properties * activation Subject RIV: JP - Industrial Processing Impact factor: 1.272, year: 2015

    17. 75 FR 6223 - PSEG Nuclear LLC; Hope Creek Generating Station and Salem Nuclear Generating Station, Unit Nos. 1... (United States)


      ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-272, 50-311 and 50-354; NRC-2010-0043] PSEG Nuclear LLC; Hope Creek Generating Station and Salem Nuclear Generating Station, Unit Nos. 1 and 2...-70, and DPR-75, issued to PSEG Nuclear LLC (PSEG, the licensee), for operation of the Hope Creek...

    18. 76 FR 19148 - PSEG Nuclear, LLC, Hope Creek Generating Station and Salem Nuclear Generating Station, Units 1... (United States)


      ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-272, 50-311, 50-354; NRC-2009-0390 and NRC-2009-0391] PSEG Nuclear, LLC, Hope Creek Generating Station and Salem Nuclear Generating Station, Units 1 and 2..., DPR-70, and DPR-75 for an additional 20 years of operation for the Hope Creek Generating Station (HCGS...

    19. Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array

      DEFF Research Database (Denmark)

      Eeles, Rosalind A; Olama, Ali Amin Al; Benlloch, Sara


      Prostate cancer is the most frequently diagnosed cancer in males in developed countries. To identify common prostate cancer susceptibility alleles, we genotyped 211,155 SNPs on a custom Illumina array (iCOGS) in blood DNA from 25,074 prostate cancer cases and 24,272 controls from the internationa...

    20. Metody zápisu nanostruktur rastrovací sondou

      Czech Academy of Sciences Publication Activity Database

      Urbánek, Michal; Krátký, Stanislav; Matějka, Milan; Kolařík, Vladimír; Horáček, Miroslav


      Roč. 108, č. 10 (2014), s. 937-941 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LO1212 Keywords : scanning probe lithography * local anodic oxidation * nanoscratching * atomic force microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.272, year: 2014


      Czech Academy of Sciences Publication Activity Database

      Nováková, Kateřina; Navrátil, Tomáš; Šestáková, Ivana; Mareček, Vladimír; Chýlková, J.


      Roč. 108, č. 3 (2014), s. 219-225 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP208/12/1645; GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : lecitine * cholesterol * biological membranes Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

    2. Stability of Language and Literacy Profiles of Children with Language Impairment in the Public Schools (United States)

      Tambyraja, Sherine R.; Schmitt, Mary Beth; Farquharson, Kelly; Justice, Laura M.


      Purpose: The present study focused on the identification and stability of language and literacy profiles of primary school children receiving school-based language therapy over the course of one academic year. Method: Participants included 272 early elementary school-age children (144 boys, 128 girls) who had been clinically identified as having a…

    3. 75 FR 33694 - Safety Zone; Delta Independence Day Foundation Celebration, Mandeville Island, CA (United States)


      ... Mandeville Island, CA. The fireworks display is meant for entertainment purposes. This safety zone is issued... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... (34)(g), of the Instruction. This rule involves establishing, disestablishing, or changing Regulated...

    4. 75 FR 34376 - Safety Zone; City of Pittsburg Independence Day Celebration, Pittsburg, CA (United States)


      ... display is meant for entertainment purposes. This safety zone is issued to establish a temporary... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272..., disestablishing, or changing Regulated Navigation Areas and security or safety zones. An environmental analysis...

    5. 75 FR 81854 - Safety Zone; New Year's Celebration for the City of San Francisco, Fireworks Display, San... (United States)


      ... display is for entertainment purposes. From 11 a.m. until 11 p.m. on December 31, 2010, pyrotechnics will... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies... changing Regulated Navigation Areas and security or safety zones. An environmental analysis checklist and a...

    6. 76 FR 37012 - Safety Zone; Independence Day Fireworks Celebration for the City of Richmond, Richmond, CA (United States)


      ... Park, Richmond, California. The fireworks display is meant for entertainment purposes. This temporary... 13211. Technical Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272..., disestablishing, or changing Regulated Navigation Areas and security or safety zones. An environmental analysis...

    7. 75 FR 39166 - Safety Zone; San Francisco Giants Baseball Game Promotion, San Francisco, CA (United States)


      ... San Francisco, CA. The fireworks display is meant for entertainment purposes. This safety zone is... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...), of the Instruction. This rule involves establishing, disestablishing, or changing Regulated...

    8. 75 FR 34374 - Safety Zone; Stockton Ports Baseball Club/City of Stockton, 4th of July Fireworks Display... (United States)


      ... entertainment purposes. The purpose of the safety zone is to establish a temporary restricted area on the waters... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... changing Regulated Navigation Areas and security or safety zones. An environmental analysis checklist and a...

    9. 76 FR 61259 - Safety Zone; Monte Foundation Fireworks Extravaganza, Aptos, CA (United States)


      ... meant for entertainment purposes. This safety zone is issued to establish a temporary [[Page 61260... Standards The National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies... changing Regulated Navigation Areas and security or safety zones. An environmental analysis checklist and a...


      African Journals Online (AJOL)

      Dr Kazungu

      African Journal of Economic Review, Volume IV, Issue 2, July 2016. 92. Reaching the ..... children in AIDS. Clinical AIDS identified through home- ..... 0.11. Bilharzias. 0.68 pregnancy related problems. 2.72. Dental. 0.89 intentional injury. 0.61 ..... international in collaboration with: research triangle institute (rti), the centre for.

    11. High-resolution magnetic measurements of HTSC

      Czech Academy of Sciences Publication Activity Database

      Janů, Zdeněk; Novák, Miloslav; Tsoi, G.

      272-276, - (2004), e1099-e1101 ISSN 0304-8853 R&D Projects: GA ČR GA102/02/0994; GA AV ČR IAA1010104 Institutional research plan: CEZ:AV0Z1010914 Keywords : superconductivity * low-dimensional systems * resonance scattering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    12. 77 FR 72742 - Approval and Promulgation of State Implementation Plans: State of Washington; Regional Haze State... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Best Available Retrofit Technology (BART) determination for NO X for the TransAlta Centralia Generation... Business Information or other information whose disclosure is restricted by statute. Certain other material...

    13. 76 FR 11404 - Oregon: Tentative Approval of State Underground Storage Tank Program (United States)


      ... Order 12866. 9. National Technology Transfer and Advancement Act Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (``NTTAA''), Public Law 104-113, section 12(d) (15 U.S.C. 272... Confidential Business Information (CBI) or other information whose disclosure is restricted by statute. Do not...

    14. 76 FR 64020 - Approval and Promulgation of Air Quality Implementation Plans; Maryland; Adoption of Control... (United States)


      ... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Plastic Parts and Business Machines Coatings AGENCY: Environmental Protection Agency (EPA). ACTION: Final....19.07-2, Plastic Parts and Business Machines Coating. Maryland's SIP revision meets the requirement...

    15. 76 FR 70886 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution... (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...-volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...

    16. 78 FR 6740 - Revisions to the California State Implementation Plan, San Joaquin Valley United Air Pollution... (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272..., multi- volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...

    17. 76 FR 62002 - Revisions to the California State Implementation Plan (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... Confidential Business Information (CBI) or other information whose disclosure is restricted by statute... normal business hours with the contact listed in the FOR FURTHER INFORMATION CONTACT section. FOR FURTHER...

    18. 77 FR 58312 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...-volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...

    19. 76 FR 53640 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution... (United States)


      ... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR...

    20. 76 FR 51922 - Approval and Promulgation of Air Quality Implementation Plans; Maryland; Adoption of Plastic... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Promulgation of Air Quality Implementation Plans; Maryland; Adoption of Plastic Parts and Business Machines..., Plastic Parts and Business Machines Coating. Maryland's SIP revision meets the requirement to adopt...

    1. 77 FR 67322 - Revisions to the California State Implementation Plan, Placer County Air Pollution Control District (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... includes Confidential Business Information (CBI) or other information whose disclosure is restricted by... appointment during normal business hours with the contact listed in the FOR FURTHER INFORMATION CONTACT...

    2. 76 FR 67369 - Revisions to the California State Implementation Plan, Joaquin Valley Unified Air Pollution... (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR...

    3. 77 FR 71109 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR FURTHER...

    4. 77 FR 22224 - Approval and Promulgation of Air Quality Implementation Plans; Delaware; Amendments to the... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... reasonably available control technology (RACT) controls on emission sources covered by EPA's control..., i.e., confidential business information (CBI) or other information whose disclosure is restricted by...

    5. 77 FR 25109 - Revisions to the California State Implementation Plan, Imperial County Air Pollution Control... (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... information provided, unless the comment includes Confidential Business Information (CBI) or other information... the hard copy materials, please schedule an appointment during normal business hours with the contact...

    6. 78 FR 53249 - Revisions to the California State Implementation Plan, Placer County Air Pollution Control District (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with...

    7. 77 FR 7536 - Revisions to the California State Implementation Plan, Joaquin Valley Unified Air Pollution... (United States)


      ... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the...

    8. 78 FR 20035 - Adequacy of Oregon Municipal Solid Waste Landfill Permit Program (United States)


      ... Executive Order 12866. 9. National Technology Transfer and Advancement Act Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (``NTTAA''), Public Law 104-113, section 12(d) (15 U.S.C. 272... information claimed to be Confidential Business Information (CBI) or claimed to be other information whose...

    9. 77 FR 25384 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution... (United States)


      ... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those..., unless the comment includes Confidential Business Information (CBI) or other information whose disclosure... during normal business hours with the contact listed in the FOR FURTHER INFORMATION CONTACT section. FOR...

    10. 77 FR 5709 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business hours with the contact listed in the FOR FURTHER...

    11. 77 FR 28336 - Approval and Promulgation of Air Quality Implementation Plans; Maryland; Offset Lithographic... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... Technology (RACT) for sources covered by EPA's Control Techniques Guidelines (CTG) for offset lithographic..., unless the comment includes information claimed to be Confidential Business Information (CBI) or other...

    12. 78 FR 896 - Revisions to the California State Implementation Plan, Imperial County Air Pollution Control... (United States)


      ... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...-volume reports), and some may not be available in either location (e.g., confidential business information (CBI)). To inspect the hard copy materials, please schedule an appointment during normal business...

    13. 40 CFR 721.10094 - Decene, branched and linear. (United States)


      ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Decene, branched and linear. 721.10094... Substances § 721.10094 Decene, branched and linear. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as decene, branched and linear (PMN P-03-272; CAS...

    14. Superoxide dismutase type 1 in monocytes of chronic kidney disease patients

      DEFF Research Database (Denmark)

      Scholze, Alexandra; Krueger, Katharina; Diedrich, Madeleine


      chronic hemodialysis (HD) and 211 CKD patients, and 34 control subjects. Furthermore, we showed that different SOD1 protein species exist in human monocytes. SOD1 protein amount was significantly lower in HD (normalized SOD1 protein, 27.2 ± 2.8) compared to CKD patients (34.3 ± 2.8), or control subjects...

    15. The Role of Academic Self-Efficacy as a Mediator Variable between Perceived Academic Climate and Academic Performance (United States)

      Abd-Elmotaleb, Moustafa; Saha, Sudhir K.


      This study examines the mediating influence of academic self-efficacy on the link between perceived academic climate and academic performance among university students. The participants in the study consist of 272 undergraduate students at the University of Assiut, Assiut, Egypt. A scale to measure perceived academic climate, was developed. To…

    16. 77 FR 23130 - Revisions to the California State Implementation Plan, Northern Sierra and Sacramento... (United States)


      .../08 08/14/08 NSAQMD Large Appliance Coatings 05/19/08 08/14/08 NSAQMD Metal Furniture Coatings 05/19... consistent with Clean Air Act requirements for Reasonably Available Control Technology (RACT) (see section... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

    17. Commentary on "identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array." COGS-Cancer Research UK GWAS-ELLIPSE (part of GAME-ON) Initiative; Australian Prostate Cancer Bioresource; UK Genetic Prostate Cancer Study Collaborators/British Association

      DEFF Research Database (Denmark)

      Olumi, Aria F; Nordestgaard, Børge G.


      Prostate cancer is the most frequently diagnosed cancer in males in developed countries. To identify common prostate cancer susceptibility alleles, we genotyped 211,155 SNPs on a custom Illumina array (iCOGS) in blood DNA from 25,074 prostate cancer cases and 24,272 controls from the internationa...

    18. 78 FR 78315 - Revision to the Idaho State Implementation Plan; Approval of Fine Particulate Matter Control... (United States)


      ... overall mobile source emissions from cars and trucks and generally small area source contributions in the... solid fuel burning device is the sole source of heat. Because the residential woodstove burn ban program... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

    19. Detection Performance of an Operator Using Lofar (United States)


      Blur on Perimetric Thresholds," Aroh. of Opthalmology , 68:2, pp. 240-51 (1962). 15. Ferree, C.E., Rand, G., Hardy, C, "Refraction for the...Static Perimetric Technique Believed to Test Receptive Field Properties III Clinical Trials," Am. Jour. Opthalmology , 70:2, pp. 244-272 (Aug. 1970

    20. Prevalence of Neonatal Jaundice on Central Hospital, Warri, Delta ...

      African Journals Online (AJOL)

      Methods: 272 babies (aged 1 – 30 days) the Neonatal Clinic of the Department of Child Health, Central Hospital, Warri, Delta State between June 2009 and June 2010 were examined daily for evidence of jaundice. Those with serum bilirubin ³15mg/100ml were subjected to additional clinical and laboratory investigations to ...

    1. Routine pre-admission screening for a medical illness in aggressive ...

      African Journals Online (AJOL)


      Oct 3, 2009 ... can be a symptom of a psychiatric illness or a medical illness.2,3. Psychiatric .... reported a 27.2% prevalence of physical illness in psychiatric inpatients in Nigeria, Janse ..... Results in a state mental health system. Arch Gen ...

    2. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

      NARCIS (Netherlands)

      G.B. Ehret (Georg); T. Ferreira (Teresa); D.I. Chasman (Daniel); A.U. Jackson (Anne); E.M. Schmidt (Ellen); T. Johnson (Toby); G. Thorleifsson (Gudmar); J. Luan (Jian'An); L.A. Donnelly (Louise); S. Kanoni (Stavroula); A.K. Petersen; V. Pihur (Vasyl); R.J. Strawbridge (Rona); D. Shungin (Dmitry); Hughes, M.F. (Maria F.); O. Meirelles; M. Kaakinen (Marika); N. Bouatia-Naji (Nabila); K. Kristiansson (Kati); S. Shah (Sonia); M.E. Kleber (Marcus); X. Guo (Xiuqing); L.-P. Lyytikäinen (Leo-Pekka); C. Fava (Cristiano); N. Eriksson (Niclas); I.M. Nolte (Ilja); P.K. Magnusson (Patrik); E. Salfati (Elias); L.S. Rallidis (Loukianos); Theusch, E. (Elizabeth); A.J.P. Smith; L. Folkersen (Lasse); H.E. Witkowska (Ewa); T.H. Pers (Tune); R. Joehanes (Roby); Kim, S.K. (Stuart K.); L. Lataniotis (Lazaros); R. Jansen; A.D. Johnson (Andrew); H. Warren (Helen); Y.J. Kim; Zhao, W. (Wei); Y. Wu (Ying); B. Tayo (Bamidele); M. Bochud (Murielle); D. Absher (Devin); L.S. Adair (Linda); N. Amin (Najaf); D.E. Arking (Dan); T. Axelsson (Tomas); D. Baldassarre (Damiano); B. Balkau (Beverley); S. Bandinelli (Stefania); M.J. Barnes (Michael); I.E. Barroso (Inês); Bevan, S. (Stephen); J.C. Bis (Joshua); Bjornsdottir, G. (Gyda); M. Boehnke (Michael); E.A. Boerwinkle (Eric); L.L. Bonnycastle (Lori); D.I. Boomsma (Dorret); S.R. Bornstein (Stefan); M.J. Brown (Morris); M. Burnier (Michel); Cabrera, C.P. (Claudia P.); J.C. Chambers (John); Chang, I.-S. (I-Shou); Cheng, C.-Y. (Ching-Yu); P.S. Chines (Peter); Chung, R.-H. (Ren-Hua); F.S. Collins (Francis); Connell, J.M. (John M.); A. Döring (Angela); J. Dallongeville; J. Danesh (John); U. de Faire (Ulf); G. Delgado; A. Dominiczak (Anna); A.S.F. Doney (Alex); F. Drenos (Fotios); T. Edkins (Ted); Eicher, J.D. (John D.); R. Elosua (Roberto); S. Enroth (Stefan); J. Erdmann (Jeanette); P. Eriksson (Per); T. Esko (Tõnu); E. Evangelou (Evangelos); A. Evans (Alun); M. Fall (Magnus); M. Farrall (Martin); J.F. Felix (Janine); J. Ferrieres (Jean); L. Ferrucci (Luigi); M. Fornage (Myriam); T. Forrester (Terrence); N. Franceschini (Nora); O.H. Franco (Oscar); A. Franco-Cereceda (Anders); R.M. Fraser (Ross); S.K. Ganesh (Santhi); Gao, H. (He); K. Gertow (Karl); F. Gianfagna (Francesco); B. Gigante (Bruna); F. Giulianini (Franco); A. Goel (Anuj); A.H. Goodall (Alison); M. Goodarzi (Mark); M. Gorski (Mathias); J. Gräßler (Jürgen); C.J. Groves (Christopher); V. Gudnason (Vilmundur); U. Gyllensten (Ulf); G. Hallmans (Göran); A.L. Hartikainen; Hassinen, M. (Maija); A.S. Havulinna (Aki); C. Hayward (Caroline); S. Hercberg (Serge); K.H. Herzig; A.A. Hicks (Andrew); A. Hingorani (Aroon); J.N. Hirschhorn (Joel); Hofman, A. (Albert); Holmen, J. (Jostein); O.L. Holmen (Oddgeir); J.J. Hottenga (Jouke Jan); P. Howard (Philip); Hsiung, C.A. (Chao A.); S.C. Hunt (Steven); M.K. Ikram (Kamran); T. Illig (Thomas); C. Iribarren (Carlos); Jensen, R.A. (Richard A.); M. Kähönen (Mika); H.M. Kang (Hyun Min); S. Kathiresan (Sekar); J. Keating (John); K.T. Khaw; Y.K. Kim (Yun Kyoung); E. Kim (Eric); M. Kivimaki (Mika); N. Klopp (Norman); Kolovou, G. (Genovefa); P. Komulainen (Pirjo); J.S. Kooner (Jaspal S.); Kosova, G. (Gulum); R.M. Krauss (Ronald); D. Kuh (Diana); Z. Kutalik (Zoltán); J. Kuusisto (Johanna); K. Kvaløy (Kirsti); T.A. Lakka (Timo); N.R. Lee (Nanette); I.T. Lee; W.-J. Lee (Wen-Jane); D. Levy (Daniel); X. Li (Xiaohui); Liang, K.-W. (Kae-Woei); Lin, H. (Honghuang); Lin, L. (Li); J. Lindström (Jaana); S. Lobbens (Stéphane); S. Männistö (Satu); G. Müller (Gabriele); M. Müller-Nurasyid (Martina); F. MacH (François); H.S. Markus (Hugh); E. Marouli (Eirini); M.I. McCarthy (Mark); C.A. McKenzie (Colin); P. Meneton (Pierre); C. Menni (Cristina); A. Metspalu (Andres); Mijatovic, V. (Vladan); L. Moilanen (Leena); M.E. Montasser (May E.); A.D. Morris (Andrew); A.C. Morrison (Alanna); Mulas, A. (Antonella); R. Nagaraja (Ramaiah); N. Narisu (Narisu); K. Nikus (Kjell); C.J. O'Donnell (Christopher); P.F. O'Reilly (Paul); K.K. Ong (Ken); Paccaud, F. (Fred); C. Palmer (Cameron); A. Parsa (Afshin); N.L. Pedersen (Nancy); B.W.J.H. Penninx (Brenda); M. Perola (Markus); A. Peters (Annette); N.R. Poulter (Neil); P.P. Pramstaller (Peter Paul); B.M. Psaty (Bruce); T. Quertermous (Thomas); D.C. Rao (Dabeeru C.); A. Rasheed (Asif); N.W. Rayner (Nigel William); F. Renström (Frida); R. Rettig (Rainer); K.M. Rice (Kenneth); R. Roberts (Robert); L.M. Rose (Lynda); Rossouw, J. (Jacques); N.J. Samani (Nilesh); S. Sanna (Serena); J. Saramies (Jouko); H. Schunkert (Heribert); S. Sebert (Sylvain); Sheu, W.H.-H. (Wayne H.-H.); Shin, Y.-A. (Young-Ah); X. Sim (Xueling); G.D. Smith; A.V. Smith (Albert Vernon); M.X. Sosa (Maria X.); T.D. Spector (Timothy); A. Stancáková (Alena); A. Stanton (Alice); K. Stirrups (Kathy); H.M. Stringham (Heather); Sundstrom, J. (Johan); A.J. Swift (Amy); A.C. Syvänen; Tai, E.-S. (E-Shyong); T. Tanaka (Toshiko); K.V. Tarasov (Kirill); A. Teumer (Alexander); U. Thorsteinsdottir (Unnur); M.D. Tobin (Martin); E. Tremoli (Elena); Uitterlinden, A.G. (Andre G.); M. Uusitupa (Matti); A. Vaez (Ahmad); D. Vaidya (Dhananjay); Van Duijn, C.M. (Cornelia M.); E.P.A. van Iperen (Erik); Vasan, R.S. (Ramachandran S.); G.C. Verwoert (Germaine); J. Virtamo (Jarmo); Vitart, V. (Veronique); B.F. Voight (Benjamin); P. Vollenweider (Peter); Wagner, A. (Aline); Wain, L.V. (Louise V.); N.J. Wareham (Nick); H. Watkins (Hugh); A.B. Weder (Alan); H.J. Westra (Harm-Jan); Wilks, R. (Rainford); T. Wilsgaard (Tom); J.F. Wilson (James F.); Wong, T.Y. (Tien Y.); T.-P. Yang (Tsun-Po); J. Yao (Jiefen); L. Yengo (Loic); W. Zhang (Weihua); J.H. Zhao (Jing Hua); X. Zhu (Xiaofeng); P. Bovet (Pascal); Cooper, R.S. (Richard S.); K.L. Mohlke (Karen); Saleheen, D. (Danish); J.-Y. Lee (Jong-Young); P. Elliott (Paul); L.M. Gierman (Lobke); C.J. Willer (Cristen); L. Franke (Lude); G. Kees Hovingh; K.D. Taylor (Kent); G.V. Dedoussis (George); P. Sever (Peter); A. Wong (Andrew); W.H.L. Kao (Wen); T.L. Assimes (Themistocles); I. Njølstad (Inger); P.E.H. Schwarz (Peter); C. Langenberg (Claudia); H. Snieder (Harold); M. Caulfield (Mark); O. Melander (Olle); M. Laakso (Markku); J. Saltevo (Juha); R. Rauramaa (Rainer); J. Tuomilehto (Jaakko); Ingelsson, E. (Erik); T. Lehtimäki (Terho); K. Hveem (Kristian); W. Palmas (Walter); W. März (Winfried); M. Kumari (Meena); V. Salomaa (Veikko); Y.D. Chen (Y.); Rotter, J.I. (Jerome I.); P. Froguel (Philippe); M.-R. Jarvelin (Marjo-Riitta); E. Lakatta (Edward); K. Kuulasmaa (Kari); P.W. Franks (Paul); A. Hamsten (Anders); H.E. Wichmann (Heinz Erich); C.N.A. Palmer (Colin); Stefansson, K. (Kari); P.M. Ridker (Paul); R.J.F. Loos (Ruth); A. Chakravarti (Aravinda); P. Deloukas (Panagiotis); A.P. Morris (Andrew); C. Newton-Cheh (C.); P. Munroe (Patricia)


      textabstractTo dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We

    3. Collective motion in hot superheavy nuclei

      NARCIS (Netherlands)

      Tveter, TS; Gaardhoje, JJ; Maj, A; Ramsoy, T; Atac, A; Bacelar, J; Bracco, A; Buda, A; Camera, F; Herskind, B; Korten, W; Krolas, W; Menthe, A; Million, B; Nifenecker, H; Pignanelli, M; Pinston, JA; vanderPloeg, H; Schussler, F; Sletten, G


      The superheavy nucleus (272)(108)Hs and its evaporation daughters have been produced using the reaction Th-232(Ar-40,gamma xn) with beam energies 10.5 and 15.0 MeV/A. The Giant Dipole Resonance gamma-radiation from the hot conglomerate system prior to fission has been isolated using a differential

    4. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency

      NARCIS (Netherlands)

      Prins, M.; van Leeuwen, M.W.; Teske, E.


      Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.

    5. A Comparison of the Social Context for Alcohol Consumption of College Students and Convicted DWI Offenders (United States)

      Beck, Kenneth H.; Summons, Terry G.


      Surveyed college students (N=272) and convicted DWI offenders (N=261). The results revealed that DWI offenders tend to drink in their own home, alone, and to relieve stress; whereas college students are more likely to drink at a party, for the enjoyment of taste, and to get drunk. (JAC)

    6. Browse Title Index

      African Journals Online (AJOL)

      Items 1 - 50 of 272 ... Vol 12, No 2 (2014), Cryptosporidium infection in cattle in Ogun state, ... Vol 7, No 1 (2008), An overview of mastitis in Sokoto red goat, Nigeria ... trypanosoma brucei brucei infection, treatment and re-infection, Abstract PDF.

    7. Effect of Mahogany (Khaya senegalensis L) Leaf Extract on Root ...

      African Journals Online (AJOL)


      Available online at Nigerian Journal of Basic and Applied Science (2010), 18(2): 272-276. ISSN 0794-5698. Effect of Mahogany (Khaya senegalensis L) Leaf Extract on Root-Knot Nematode of. Tomatoes (Lycopersicum esculentum L.) B. Liman. 1. , M. Ibrahim. 1. , N.T. Ibrahim. 1.

    8. Gang Membership, School Violence, and the Mediating Effects of Risk and Protective Behaviors in California High Schools (United States)

      Estrada, Joey Nuñez, Jr.; Gilreath, Tamika D.; Astor, Ron Avi; Benbenishty, Rami


      There is insufficient empirical evidence exploring associations between gang membership and school violence behaviors. Using a sample of 272,863 high school students, this study employs a structural equation model to examine how school risk and protective behaviors and attitudes mediate effects of gang members' involvement with school violence…

    9. Photoacoustic Detection of Terahertz Radiation for Chemical Sensing and Imaging Applications (United States)


      ISSN 2229-5518 [39] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic emission through terahertz-field driven electron...materials,” Journal of Electroceramics, vol. 2: p. 257-272, 2009. [47] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic

    10. Children's and Adolescents' Developing Perceptions of Gender Inequality (United States)

      Neff, Kristin D.; Cooper, Carey E.; Woodruff, Althea L.


      Two studies examined children's and adolescents' developing perceptions of gender inequality. The first study examined perceptions of inequality among 272 early, middle, and late adolescents, focusing on the spheres of politics, business, and the home. Results indicated an age-related increase in perceptions of male dominance. Men were seen to…

    11. Use of Sindbis virus-mediated RNA interference to demonstrate a conserved role of Broad-Complex in insect metamorphosis

      Czech Academy of Sciences Publication Activity Database

      Uhlířová, Miroslava; Foy, B. D.; Beaty, B. J.; Olson, K. E.; Riddiford, L. M.; Jindra, Marek


      Roč. 100, č. 26 (2003), s. 15607-15612 ISSN 0027-8424 R&D Projects: GA AV ČR IAA5007305 Institutional research plan: CEZ:AV0Z5007907 Keywords : Green fluorescent protein-steroid-hormone ecdysone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 10.272, year: 2003

    12. Vzájemný vztah maximálního uzávěrového tlaku uretry a Valsalva Leak-Point Pressure u žen se stresovým typem inkontince moči

      Czech Academy of Sciences Publication Activity Database

      Martan, A.; Mašata, J.; Švabík, K.; Drahorádová, P.; Halaška, M.; Voigt, R.; Pavlíková, Markéta


      Roč. 69, č. 4 (2004), s. 267-272 ISSN 1210-7832 R&D Projects: GA MZd NH7378 Keywords : inkontinence moči u žen * maximální uzávěrový tlak uretry * Valsalva leak -point pressure Subject RIV: FK - Gynaecology, Childbirth

    13. Diode array pumped, non-linear mirror Q-switched and mode-locked ...

      Indian Academy of Sciences (India)

      A non-linear mirror consisting of a lithium triborate crystal and a dichroic ... effects such as all-optical switching [7,8], nearly degenerate four-wave mixing [9,10], .... is driven by a radio frequency signal of 27.2MHz with a modulation available in.

    14. The young and the digital, by S. Craig Watkins [book review

      Directory of Open Access Journals (Sweden)

      Melanie E. S. Kohnen


      Full Text Available Review of S. Craig Watkins, The young and the digital: What migration to social-networking sites, games, and anytime, anywhere media means for our future. Boston: Beacon Press, 2009, paperback, $18 (272p ISBN 978-0807006160.

    15. Relationship Between Perception And Role Of Local Leaders In ...

      African Journals Online (AJOL)

      The study examined the relationship between perception of local leaders and their role in rural development in Delta State, Nigeria. A multi-stage sampling technique was used to collect data from 272 respondents in 30 communities. Means and simple regression were used to analyze data collected. Findings revealed that ...

    16. After the First Shots: Managing Escalation in Northeast Asia (United States)


      Control: A Pro- posed Strategy for an Unlikely Conflict, INSS Strategic Forum No. 278 (Washington, DC: NDU Press, June 2012). 7 On North Korean...Cross-Domain Operations: Where Do Space and Cyber Fit? INSS Strategic Forum No. 272 (Washington, DC: NDU Press, December 2011). 33 For a discussion of

    17. Alzheimer's Disease Facts and Figures

      Medline Plus

      Full Text Available ... date on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...

    18. Brain Health (United States)

      ... is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation to fight Alz Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | ...

    19. Teacher Judgment, Student Motivation, and the Mediating Effect of Attributions (United States)

      Zhou, Ji; Urhahne, Detlef


      Based on Weiner's attributional theory of intrapersonal motivation, the mediating effect of attributions between teacher judgment and student motivation was examined. In two studies, 144 German and 272 Chinese fourth-grade elementary school students were tested on their mathematical achievement, causal ascriptions for success and failure,…

    20. Not a Pound for Air-To-Ground: A Historiographical Analysis on the Genesis of the Multi-Role Fighter (United States)


      Robert M. Quadrennial Defense Review Report. Washington D.C.: Department of Defense, 2010. (accessed 2 Dec 2014) Stevens, Donald, Bruce Davis, William Stanley, Daniel Norton, Rae Starr, Dnaiel Raymer , John Gibson

    1. Mothers' Perception of Fever Management in Children

      African Journals Online (AJOL)

      Alasia Datonye

      range 19 years to 54 years with mean of 31.4±5.7SD. .... unemployed, 41 (27.2%) were traders, 7 (4.6%) were fashion designers and 7 (4.6%) were undergraduates. Fifty eight. (38.4%) mothers had one child each, 38 (25.2%) had two children ...

    2. a panacea to food crisis among women farmers in imo state

      African Journals Online (AJOL)


      holder farmers on marginal soils of Aba Agricultural zone, Abia State. Five blocks were randomly selected out of ... The soil-types of this zone are inherently low in major soil nutrients and trace elements to support arable crop production .... your vegetable and garden egg farm. Overall Mean. 2.72. As seen from Table 5, the ...

    3. Integrase of Mason-Pfizer monkey virus

      Czech Academy of Sciences Publication Activity Database

      Snášel, Jan; Krejčík, Zdeněk; Jenčová, Věra; Rosenberg, Ivan; Ruml, Tomáš; Alexandratos, J.; Gustchina, A.; Pichová, Iva


      Roč. 272, č. 1 (2005), s. 203-216 ISSN 1742-464X R&D Projects: GA AV ČR(CZ) IAA4055304 Institutional research plan: CEZ:AV0Z4055905 Keywords : integrase * Mason-Pfizer monkey virus * HIV-1 Subject RIV: CE - Biochemistry

    4. EST Table: FS913950 [KAIKOcDNA[Archive

      Lifescience Database Archive (English)

      Full Text Available FS913950 E_FL_fufe_30M22_F_0 10/09/28 87 %/272 aa ref|NP_001098702.1| nanos-like pr...otein [Bombyx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09

    5. Dispersal in Mastomys natalensis mice

      DEFF Research Database (Denmark)

      Van Hooft, Pim; Cosson, J F; Vibe-Petersen, Solveig


      Mastomys natalensis is the major pest rodent in sub-Saharan Africa. In this study, population genetic techniques were used to gain new insights into its dispersal behaviour, a critical parameter in pest management. Using 11 microsatellites, 272 individuals from a 300 ha area in Tanzania were geno...

    6. An evaluation of palaeogeography and palaeoecology in the Most Basin (Czech Republic) and Saxony (Germany) from the late Oligocene to the early Miocene

      Czech Academy of Sciences Publication Activity Database

      Mach, K.; Teodoridis, V.; Matys Grygar, Tomáš; Kvaček, Z.; Suhr, P.; Standke, G.


      Roč. 272, č. 1 (2014), s. 13-45 ISSN 0077-7749 R&D Projects: GA ČR(CZ) GAP210/11/1357 Institutional support: RVO:61388980 Keywords : palaeogeography * geochemistry * floras * Most Basin Subject RIV: DD - Geochemistry Impact factor: 0.519, year: 2014

    7. Environmental Resource Management Issues in Agronomy: A Lecture/Laboratory Course (United States)

      Munn, D. A.


      Environmental Sciences Technology T272 is a course with a laboratory addressing problems in soil and water quality and organic wastes utilization to serve students from associate degree programs in laboratory science and environmental resources management at a 2-year technical college. Goals are to build basic lab skills and understand the role…

    8. Nucleotide binding to Na+/K+-ATPase

      Czech Academy of Sciences Publication Activity Database

      Kubala, Martin; Lánský, Zdeněk; Ettrich, R.; Plášek, J.; Teisinger, Jan; Amler, Evžen


      Roč. 272, č. S1 (2005), s. 191-191 E-ISSN 1742-4658. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Keywords : Na+/K+- ATPase * ATP binding * TNP-ATP Subject RIV: BO - Biophysics

    9. Phase competition in Pr.sub.0.8 - x./sub.La.sub.x./sub.Na.sub.0.2./sub.Mn.sub.1 - y./sub.Me.sub.y./sub.O.sub.3./sub..

      Czech Academy of Sciences Publication Activity Database

      Hejtmánek, Jiří; Jirák, Zdeněk; Knížek, Karel; Pollert, Emil; Martin, C.; Maignan, A.

      272-276, - (2004), e287-e288 ISSN 0304-8853 R&D Projects: GA AV ČR IAA1010202; GA ČR GA203/03/0924 Institutional research plan: CEZ:AV0Z1010914 Keywords : phase separation * colossal magnetoresistance Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    10. Quality Control for Ordnance (United States)


      R. H. Morgan, "Screen Intensification Systems and Their Lirnita- tions," Amtvican J w n u l of Roenlgenology and Radizcm Therapy , Vol. LXII, No...443. (1 10) Kurt Matthaes, " Magneto -Inductive Testing of Stcel," Zeitschrgt filr Melnll- kunde, Vol. 39, September, 1948, p]). 257- 272. (1 11

    11. Redbank and Fancher Creeks, California: General Design Memorandum (United States)


      48.1/ 6.5-8.52/ 4 feet!/ Phytoplankton Analysis Biomass on the surface Dominate genus mg/L 272 Anacystis 104 < 1.5 Anacystis preclude the Government from pursuing any other remedy at law or equity to assure faithful performance pursuant to this agreement. ARTICLE 7

    12. 77 FR 15263 - Approval and Promulgation of Implementation Plans; New Jersey; Motor Vehicle Enhanced Inspection... (United States)


      ... 2500 Revolutions per Minute (RPM) tests. The TSI test is a tailpipe test which checks the vehicle's... of the program and technology changes that were implemented in the years following the 80 percent... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

    13. Spheroidal models of the exterior gravitational field of Asteroids Bennu and Castalia

      Czech Academy of Sciences Publication Activity Database

      Sebera, Josef; Bezděk, Aleš; Pešek, I.; Henych, Tomáš


      Roč. 272, July (2016), s. 70-79 ISSN 0019-1035 R&D Projects: GA MŠk LH13071 Institutional support: RVO:67985815 Keywords : asteroids surfaces * near-Earth objects * geophysics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.131, year: 2016

    14. Heat shock protein (Hsp) 40 mutants inhibit Hsp70 in mammalian cells

      NARCIS (Netherlands)

      Michels, AA; Kanon, B; Bensaude, O; Kampinga, HH


      Heat shock protein (Hsp) 70 and Hsp40 expressed in mammalian cells had been previously shown to cooperate in accelerating the reactivation of heat-denatured firefly luciferase (Michels, A. A., Kanon, B., Konings, A. W. T., Ohtsuka, K,, Bensaude, O., and Kampinga, H. H. (1997) J. Biol. Chem. 272,

    15. 2-D Water Quality Modelling of a Drinking Water Reservoir

      Czech Academy of Sciences Publication Activity Database

      Růžička, Martin; Hejzlar, J.; Mikešová, P.; Cole, T. M.


      Roč. 50, č. 3 (2002), s. 258-272 ISSN 0042-790X R&D Projects: GA ČR GA103/98/0281; GA AV ČR IAA3042903 Grant - others:USARGD-UK(USA) N68171-99-M-6754 Keywords : CE-QUAL-W2 * Dimictic stratified reservoir * Sensitivity analysis Subject RIV: DA - Hydrology ; Limnology

    16. 78 FR 12245 - Supplemental Nutrition Assistance Program: Suspension of SNAP Benefit Payments to Retailers (United States)


      ..., national origin, gender, age, disability, marital or family status. Regulations at 7 CFR 272.6.... Discrimination in any aspect of the program administration is prohibited by these regulations, according to the... SNAP benefits at the location, store inventory, and the SNAP history of the store owners. For example...

    17. Browse Title Index

      African Journals Online (AJOL)

      Items 51 - 100 of 272 ... Vol 12, No 1 (2014), Cultural and molecular detection of zoonotic tuberculosis and ... and antigens in poultry and some wild birds in Kogi state, Nigeria, Abstract PDF .... humidity on the egg laying pattern of Rhipicephalus sanguineus ... Vol 9, No 1 (2011), Effects of time of meat purchase on the level of ...

    18. Study of fluid flow in baffled vessels stirred by a Rushton standard impeller

      Czech Academy of Sciences Publication Activity Database

      Chára, Zdeněk; Kysela, Bohuš; Konfršt, Jiří; Fořt, I.


      Roč. 272, č. 3 (2016), s. 614-628 ISSN 0096-3003 R&D Projects: GA ČR GAP101/12/2274 Institutional support: RVO:67985874 Keywords : trailing vortices * rushton impeller * PIV measurements * DES * numerical simulation Subject RIV: BK - Fluid Dynamics Impact factor: 1.738, year: 2016

    19. Understanding Oral Reading Fluency among Adults with Low Literacy: Dominance Analysis of Contributing Component Skills (United States)

      Mellard, Daryl F.; Anthony, Jason L.; Woods, Kari L.


      This study extends the literature on the component skills involved in oral reading fluency. Dominance analysis was applied to assess the relative importance of seven reading-related component skills in the prediction of the oral reading fluency of 272 adult literacy learners. The best predictors of oral reading fluency when text difficulty was…

    20. 78 FR 78838 - Grant of Interim Extension of the Term of U.S. Patent No. 5,496,801; Recombinant Human... (United States)


      ...] Grant of Interim Extension of the Term of U.S. Patent No. 5,496,801; Recombinant Human Parathyroid...,801. FOR FURTHER INFORMATION CONTACT: Mary C. Till by telephone at (571) 272-7755; by mail marked to... No. 5,496,801. The patent claims the human biological product recombinant human parathyroid hormone...