LLW Forum meeting report, October 26--27, 1994
International Nuclear Information System (INIS)
1994-01-01
The Low-Level Radioactive Waste Forum (LLW Forum) is an association of state and compact representatives, appointed by governors and compact commissions, established to facilitate state and compact implementation of the Low-Level Radioactive Waste Policy Act of 1980 and the Low-Level Radioactive Waste Policy Amendments Act of 1985 and to promote the objectives of low-level radioactive waste regional compacts. The LLW Forum provides an opportunity for state and compact officials to share information with one another and to exchange views with officials of federal agencies and other interested parties. This report details activities of the meeting held October 26-27, 1994
LLW Forum meeting report, October 26--27, 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The Low-Level Radioactive Waste Forum (LLW Forum) is an association of state and compact representatives, appointed by governors and compact commissions, established to facilitate state and compact implementation of the Low-Level Radioactive Waste Policy Act of 1980 and the Low-Level Radioactive Waste Policy Amendments Act of 1985 and to promote the objectives of low-level radioactive waste regional compacts. The LLW Forum provides an opportunity for state and compact officials to share information with one another and to exchange views with officials of federal agencies and other interested parties. This report details activities of the meeting held October 26-27, 1994.
Summary of fuel safety research meeting 2005
International Nuclear Information System (INIS)
Fuketa, Toyoshi; Nakamura, Takehiko; Nagase, Fumihisa; Nakamura, Jinichi; Suzuki, Motoe; Sasajima, Hideo; Sugiyama, Tomoyuki; Amaya, Masaki; Kudo, Tamotsu; Chuto, Toshinori; Tomiyasu, Kunihiko; Udagawa, Yutaka; Ikehata, Hisashi; Kida, Mitsuko; Ikatsu, Nobuhiko; Hosoyamada, Ryuji; Hamanishi, Eizou; Iwasaki, Ryo; Ozawa, Masaaki
2006-03-01
Fuel Safety Research Meeting 2005, which was organized by the Japan Atomic Energy Agency (Establishment of the new organization in Oct. 1, 2005 integrated of JAERI and JNC) was held on March 2-3, 2005 at Toshi Center Hotel, Tokyo. The purposes of the meeting are to present and discuss the results of experiments and analyses on reactor fuel safety and to exchange views and experiences among the participants. The technical topics of the meting covered the status of fuel safety research activities, fuel behavior under Reactivity Initiated Accident (RIA) and Loss of coolant accident (LOCA) conditions, high fuel behavior, and radionuclide release under severe accident conditions. This summary contains all the abstracts and sheets of viewgraph presented in the meeting. (author)
International Nuclear Information System (INIS)
Humbert, D.; Wickham, A.J.
2007-06-01
The '9th Meeting of the Technical Steering Committee for the International Database on Irradiated Nuclear Graphite Properties' was held on 26-27 March 2007 at the IAEA Headquarters, Vienna, Austria. All discussions, recommendations and actions of this Consultants' Meeting are recorded in this report. The purposes of the meeting were to review the matters and actions identified in the previous meeting, undertake a review of the current status of the database and make recommendations for actions for the next year. This report contains the current status of the identified actions as well as a summary of the recommendations on enhancements to the database. (author)
27 CFR 6.98 - Advertising service.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Advertising service. 6.98 Section 6.98 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS âTIED-HOUSEâ Exceptions § 6.98 Advertising service. The listing of the names...
Summary records of meetings of INFCE/WG.1 - First to seventh meetings
International Nuclear Information System (INIS)
Seven meetings of INFCE/WG.1 were held in the period of 26 January 1978 to 14 September 1979. The activities of Working Group 1 during this period are presented in 7 Summary Records. The main activity areas are: revision of uranium, heavy water and thorium availability; consideration of special needs of developing countries
'AER Working Group D On WWER Safety Analysis' Report Of The Meeting In Pisa, Italy, 26-27 April 2006
International Nuclear Information System (INIS)
Siltanen, P.
2006-01-01
AER Working Group D on WWER reactor safety analysis held its 15 t h meeting in Grand Hotel Duomo in Pisa, Italy during the period 26-27 April 2006. The meeting was hosted by the University of Pisa following the fourth workshop on the OECD/DOE/CEA WWER-1000 Coolant Transient Benchmark (W1000-CT) held at the same location on 24-25 April. Altogether 15 participants attended the Working Group D meeting, 11 from AER member organizations and 4 guests from non-member organizations. The coordinator for the working group, Mr. P. Siltanen (FNS) served as chairman. In addition to general information exchange on recent activities in the participating organizations, the topics of the meeting included: 1) Code development and benchmarking for reactor dynamics applications. 2) Safety analysis methodology and results. 3) Future activities. A list of participants and a list of handouts distributed at the meeting are attached to the report (Author)
International Nuclear Information System (INIS)
Langley, R.A.
1996-08-01
The proceedings and results of the 2nd IAEA Research Coordination Meeting on ''Collection and Evaluation of Reference Data for Thermo-mechanical Properties of Fusion Reactor Plasma Facing Materials'' held on March 25, 26 and 27, 1996 at the IAEA Headquarters in Vienna are briefly described. This report includes a summary of presentations made by the meeting participants, the results of discussions amongst the participants regarding the status of data, publication of a multi-author review paper and recommendations regarding future work. (author). 1 tab
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental Impact Assessments (EIAs). 26.3 Section 26.3 Money and... DEVELOPMENT BANDS (MDBs) § 26.3 Availability of Environmental Impact Assessment Summaries (EIA Summaries) and...
Holmes, John; Welzel, Julia
OCT is increasingly interesting for non-invasive skin imaging in Dermatology. Due to its resolution and imaging depth, OCT is already routinely established for diagnosis of nonmelanoma skin cancer, whereas for pigmented lesions, the resolution is still not high enough. OCT has also a high value for monitoring of treatment effects, for example to control healing after non-surgical topical treatment of basal cell carcinomas. In summary, there are several indications for applications of OCT to image skin diseases, and its importance will grow in the future due to further technical developments like speckle variance OCT.
International Nuclear Information System (INIS)
Dunaeva, S.; Otsuka, N.; Schwerer, O.
2009-08-01
An IAEA Technical Meeting of the International Network of Nuclear Reaction Data Centres was held at the IAEA Headquarters in Vienna from 25 to 26 May 2009. The meeting was attended by 23 participants from 13 cooperating data centres. A summary of the meeting is given in this report, along with the conclusions, actions, and status report of the participating data centres. (author)
Summary of geologic review group meetings, March 17--18, 1977 and May 26--27, 1977
International Nuclear Information System (INIS)
Frye, J.C.; Crawford, J.H.; Davis, S.N.; Donath, F.A.; Gloyna, E.F.; Krauskopf, K.B.
1977-01-01
As a result of these meetings, the Geologic Review Group made suggestions and recommendations on radioactive waste repository sites, covering priorities for needed data on rock types, retrievable storage, use of Nevada Test Site, non-salt rock types, etc
OCT-4 expression in follicular and luteal phase endometrium: a pilot study
Directory of Open Access Journals (Sweden)
Huber Johannes C
2010-04-01
Full Text Available Abstract Background The stem cell marker Octamer-4 (OCT-4 is expressed in human endometrium. Menstrual cycle-dependency of OCT-4 expression has not been investigated to date. Methods In a prospective, single center cohort study of 98 women undergoing hysteroscopy during the follicular (n = 49 and the luteal (n = 40 phases of the menstrual cycle, we obtained endometrial samples. Specimens were investigated for OCT-4 expression on the mRNA and protein levels using reverse transcriptase polymerase chain reaction (RT-PCR and immunohistochemistry. Expression of OCT-4 was correlated to menstrual cycle phase. Results Of 89 women sampled, 49 were in the follicular phase and 40 were in the luteal phase. OCT-4 mRNA was detected in all samples. Increased OCT-4 mRNA levels in the follicular and luteal phases was found in 35/49 (71% and 27/40 (68% of women, respectively (p = 0.9. Increased expression of OCT-4 protein was identified in 56/89 (63% samples. Increased expression of OCT-4 protein in the follicular and luteal phases was found in 33/49 (67% and 23/40 (58% of women, respectively (p = 0.5. Conclusions On the mRNA and protein levels, OCT-4 is not differentially expressed during the menstrual cycle. Endometrial OCT-4 is not involved in or modulated by hormone-induced cyclical changes of the endometrium.
International Nuclear Information System (INIS)
Humbert, D.; Wickham, A.J.
2009-05-01
The 11th Meeting of the Technical Steering Committee for the International Database on Irradiated Nuclear Graphite Properties was held on 25-26 March 2009 at the IAEA Headquarters, Vienna, Austria. All discussions, recommendations and actions of this Consultants' Meeting are recorded in this report. The purposes of the meeting were to review the matters and actions identified in the previous meeting, undertake a review of the current status of the database, and make recommendations for action over the next year. This report contains the status of the identified actions as well as a summary of the recommendations on enhancements to the database. (author)
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Labels. 26.39 Section 26.39 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... United States From Puerto Rico § 26.39 Labels. All labels affixed to bottles of liquors coming into the...
Energy Technology Data Exchange (ETDEWEB)
Janev, R K
1999-01-01
This report describes briefly the proceedings and the conclusions and recommendations of the 10th Meeting of the Subcommittee on Atomic and Molecular Data for Fusion of the International Fusion Research Council held on May 27-28, 1998 at the IAEA Headquarters in Vienna, Austria. The report includes also the Executive Summary of the Subcommittee from this Meeting which was communicated to the IAEA Director General, and is appended with the Report on Activities of IAEA A+M Data Unit for the period July 1996 - May 1998. (author)
27 CFR 21.98 - Bone oil (Dipple's oil).
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bone oil (Dipple's oil....98 Bone oil (Dipple's oil). (a) Color. The color shall be a deep brown. (b) Distillation range. When... below 90 °C. (c) Pyrrol reaction. Prepare a 1.0 percent solution of bone oil in 95 percent alcohol...
International Nuclear Information System (INIS)
Benamara, S; De Séréville, N; Hammache, F; Stefan, I; Roussel, P; Ancelin, S; Assié, M; Guillot, J; Le Crom, B; Lefebvre, L; Adsley, P; Laird, A M; Barton, C; Diget, C; Fox, S; Coc, A; Deloncle, I; Hamadache, C; Kiener, J; Lefebfre-Schuhl, A
2016-01-01
26 Al was the first cosmic radioactivity ever detected in the galaxy as well as one of the first extinct radioactivity observed in refractory phases of meteorites. Its nucleosynthesis in massive stars is still uncertain mainly due to the lack of nuclear information concerning the 26 Al(n,p) 26 Mg and 26 Al(n,α) 23 Na reactions. We report on a single and coincidence measurement of the 27 Al(p,p') 27 Al(p) 26 Mg and 27 Al(p,p') 27 Al(α) 23 Na reactions performed at the Orsay TANDEM facility aiming at the spectroscopy study of 27 Al above the neutron threshold. Fourteen states are observed for the first time within 350 keV above the 26 Al+n threshold. (paper)
27 CFR 5.26 - Formula requirements.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Formula requirements. 5.26 Section 5.26 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF DISTILLED SPIRITS Formulas § 5.26 Formula...
International Nuclear Information System (INIS)
Clark, R.E.H.
2001-11-01
The proceedings and conclusions of the 2nd Research Co-ordination Meeting on 'Charge Exchange Cross Section Data for Fusion Plasma Studies', held on September 25 and 26, 2000 at the IAEA Headquarters in Vienna, are briefly described. This report includes a summary of the presentations made by the meeting participants and a review of the accomplishments of the Co-ordinated Research Project (CRP). In addition, short summaries from the participants are included indicating the specific research completed in support of this CRP. (author)
International Nuclear Information System (INIS)
Sawan, Mohamed E.
2010-06-01
The second Research Co-ordination Meeting of the Nuclear Data Libraries for Advanced Systems - Fusion Devices (FENDL - 3) was held at the IAEA Headquarters in Vienna from 23 to 26 March 2010. A summary of the meeting is given in this report along with the discussions which took place. An important outcome of the meeting was the decision to provide ENDF data libraries (FENDL-3/T) by April 2011. Finally, a list of task assignments was prepared together with the plan for future CRP activities. (author)
International Nuclear Information System (INIS)
Sicinski, R.R.; Tanaka, Y.; Phelps, M.; Schnoes, H.K.; DeLuca, H.F.
1987-01-01
Synthesis of a C-24-epimeric mixture of 25-hydroxy-[26,27- 3 H]vitamin D2 and a C-24-epimeric mixture of 1,25-dihydroxy-[26,27- 3 H]vitamin D2 by the Grignard reaction of the corresponding 25-keto-27-nor-vitamin D2 and 1 alpha-acetoxy-25-keto-27-nor-vitamin D3 with tritiated methyl magnesium bromide is described. Separation of epimers by high-performance liquid chromatography afforded pure radiolabeled vitamins of high specific activity (80 Ci/mmol). The identities and radiochemical purities of 25-hydroxy-[26,27- 3 H[vitamin D2 and 1,25-dihydroxy-[26,27- 3 H]vitamin D2 D2 were established by cochromatography with synthetic 25-hydroxyvitamin D2 or 1,25-dihydroxyvitamin D2. Biological activity of 25-hydroxy-[26,27- 3 H]vitamin D2 was demonstrated by its binding to the rat plasma binding protein for vitamin D compounds, and by its in vitro conversion to 1,25-dihydroxy-[26,27- 3 H]vitamin D2 by kidney homogenate prepared from vitamin D-deficient chickens. The biological activity of 1,25-dihydroxy-[26,27- 3 H]vitamin D2 was demonstrated by its binding to the chick intestinal receptor for 1,25-dihydroxyvitamin D3
Spasovski, G
2015-01-01
The International Nephrology Days in honor of the 75(th) anniversary of Academician Momir Polenakovic and 50 years of his scientific work were held in the Macedonian Academy of Sciences and Arts (MASA) on 26 and 27 September 2014. Organizers of the meeting were the Macedonian Academy of Sciences and Arts and the Macedonian Society of Nephrology, Dialysis, Transplantation and Artificial Organs (MSNDTAO). The days were programmed with the VII Macedonian-Croatian Nephrology Meeting and the Continuing Medical Education (CME) Course on "Renal Replacement Therapy - when & how - update on the outcome and cost-efficacy" organized by the MSNDTAO in cooperation with the European Renal Association (ERA-EDTA). Prominent academicians, researchers and nephrologists from Europe and neighboring countries contributed with their lectures and discussion at this scientific event. On September 26, 2014 the opening talk was given by Acad. V. Kambovski, President of the MASA, about the Life and Work of Academician Momir Polenakovic. In honor of his anniversary and valuable scientific opus, during the meeting Acad. Momir Polenakovic was awarded with Certificate of the European Renal Association (ERA-EDTA) for his significant role in the development of nephrology in the Balkan region and couple of other diplomas and acknowledgement. Prof. Polenakovic is founder of the MSNDTAO and his lifetime honorary president.
International Nuclear Information System (INIS)
Nichols, A.L.; Tuli, J.K.
2007-09-01
The IAEA Nuclear Data Section convened the 17th meeting of the International Network of Nuclear Structure and Decay Data Evaluators in St. Petersburg, Russian Federation, 11-15 June 2007. This meeting was attended by 27 scientists from 13 Member States concerned with the compilation, evaluation and dissemination of nuclear structure and decay data. A summary of the meeting, recommendations/conclusions, data centre reports, and various proposals considered, modified and agreed by the participants are contained within this document. (author)
Directory of Open Access Journals (Sweden)
Zafar S
2016-11-01
Full Text Available Sidra Zafar,1 MA Rehman Siddiqui,2,3 Rida Shahzad1 1Medical College, Aga Khan University Hospital, 2Department of Ophthalmology, Shahzad Eye Hospital, 3South City Hospital, Karachi, Pakistan Purpose: Sub-foveal choroidal thickness (SFCT is affected in many ocular diseases. The aim of this study was to compare SFCT measurements between Topcon 3D 2000 spectral-domain optical coherence tomography (SD-OCT and Topcon swept-source OCT (SS-OCT, with different laser wavelengths, in normal and diseased populations. Materials and methods: This was a prospective, cross-sectional, noninterventional study including 27 normal volunteers and 27 participants with retinal disease. OCT scans were performed sequentially and under standardized conditions using both SD-OCT and SS-OCT. The OCT scans were evaluated by two independent graders. Paired t-tests and intraclass correlation coefficients (ICCs were used to assess the statistically significant difference between SFCT measurements as measured by the two devices. Results: Mean SFCT measurements for all 54 participants were 264.9±103.1 µm using SD-OCT (range: 47–470 µm and 278.5±110.5 µm using SS-OCT (range: 56–502 µm, with an inter-device ICC of 0.850. Greater variability was noted in the diseased eyes. Inter-device ICCs were 0.870 (95% CI; 0.760–0.924 and 0.840 (95% CI; 0.654–0.930 for normal and diseased eyes, respectively. However, the difference was not statistically significant (P=0.132. Conclusion: Both machines reliably measure SFCT. Larger studies are needed to confirm these findings. Keywords: choroidal imaging, diseased, normal, SD-OCT, SS-OCT
27 CFR 555.127 - Daily summary of magazine transactions.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Daily summary of magazine....127 Daily summary of magazine transactions. In taking the inventory required by §§ 555.122, 555.123... transactions to be kept at each magazine of an approved storage facility; however, these records may be kept at...
26 CFR 2.1-27 - Controlled corporation.
2010-04-01
... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Controlled corporation. 2.1-27 Section 2.1-27...) MARITIME CONSTRUCTION RESERVE FUND § 2.1-27 Controlled corporation. For the purpose of section 511 of the... corporation at a time when the taxpayer owns not less than 95 percent of the total number of shares of each...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Tax on wine. 19.26 Section... THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Taxes Gallonage Taxes § 19.26 Tax on wine. (a) Imposition of tax. A tax is imposed by 26 U.S.C. 5041 or 7652 on wine (including imitation, substandard, or...
Presentations and documents submitted to the 26. meeting, NEA Headquarters
International Nuclear Information System (INIS)
2014-05-01
The NEA's nuclear data evaluation co-operation activities involve the following evaluation projects: ENDF (United States), JENDL (Japan), ROSFOND/BROND (Russia), JEFF (other Data Bank member countries) and CENDL (China) in close co-operation with the Nuclear Data Section of the International Atomic Energy Agency (IAEA). The working party was established to promote the exchange of information on nuclear data evaluations, measurements, nuclear model calculations, validation, and related topics, and to provide a framework for co-operative activities between the participating projects. The working party assesses nuclear data improvement needs and addresses these needs by initiating joint evaluation and/or measurement efforts. This document is a compilation of the available Presentations (slides) and documents (reports) submitted to the 26. WPEC meeting: Summary record of the previous meeting, May 2013; Membership and observers - May 2014 (Participation, Informal discussions on criteria defining an 'evaluation project'); 25. Anniversary of WPEC and brief overview of WPEC history; Reports on experimental activities: Europe, Japan, USA, Russia (no presentation available), China; Brief progress reports from the evaluation projects: ENDF, JEFF, JENDL, BROND/ROSFOND (no presentation available), CENDL, IAEA, TENDL; Status of subgroups: Subgroup 27: Prompt photon production from fission products (no presentation available), Subgroup 28: Processing of covariance data, Subgroup 31: Meeting nuclear data needs for advanced reactors, Subgroup 33: Methods and issues for the combined use of integral experiments and covariance data, Subgroup 34: Coordinated evaluation of Pu-239 in the resonance region, Subgroup 35: Scattering angular distribution in the fast energy range (no presentation available), Subgroup 36: Reporting and usage of experimental data for evaluation in the resolved resonance region, Subgroup 37: Improved fission product yield evaluation methodologies, Subgroup 38: A
International Nuclear Information System (INIS)
Abriola, D.; Tuli, J.K.
2009-10-01
The IAEA Nuclear Data Section convened the 18th meeting of the International Network of Nuclear Structure and Decay Data Evaluators at the IAEA Headquarters, Vienna, 23 to 27 March 2009. This meeting was attended by 22 scientists from 14 Member States, plus IAEA staff, concerned with the compilation, evaluation and dissemination of nuclear structure and decay data. A summary of the meeting, recommendations/conclusions, data centre reports, and various proposals considered, modified and agreed by the participants are contained within this document. (author)
Summary of fuel safety research meeting 2004
International Nuclear Information System (INIS)
Fuketa, Toyoshi; Hidaka, Akihide; Nakamura, Jinichi; Suzuki, Motoe; Nagase, Fumihisa; Sasajima, Hideo; Fujita, Misao; Otomo, Takashi; Kudo, Tamotsu; Amaya, Masaki; Sugiyama, Tomoyuki; Ikehata, Hisashi; Iwasaki, Ryo; Ozawa, Masaaki; Kida, Mitsuko
2004-10-01
Fuel Safety Research Meeting 2004, which was organized by the Japan Atomic Energy Research Institute, was held on March 1-2, 2004 at Toranomon Pastoral, Tokyo. The purposes of the meeting are to present and discuss the results of experiments and analyses on reactor fuel safety and to exchange views and experiences among the participants. The technical topics of the meeting covered the status of fuel safety research activities, fuel behavior under RIA and LOCA conditions, high burnup fuel behavior, and radionuclides release under severe accident conditions. This summary contains all the abstracts and OHP sheets presented in the meeting. (author)
27 CFR 31.160 - Monthly summary report.
2010-04-01
... documents regarding the receipt and disposition of distilled spirits that have a direct role in determining... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Monthly summary report. 31.160 Section 31.160 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU...
International Nuclear Information System (INIS)
Braams, B.J.
2013-12-01
The 18th meeting of the Subcommittee on Atomic and Molecular Data of the International Fusion Research Council (IFRC) was held on 26-27 April 2012 at IAEA Headquarters in Vienna, Austria. Activities of the Atomic and Molecular Data Unit for the period 2010-2012 were reviewed and recommendations were made for continuig activitiees in 2012-2013 and for new projects in the 2014-2015 budget cycle. The proceedings, conclusions and recommendations of the Subcommittee meeting are briefly described in this report. Specific recommendations of the Subcommittee from this meeting, as well as the report on the activities of the IAEA Atomic and Molecular Data Unit for the period May 2010 - April 2012, are also included. (author)
Summary of the 1982 small tokamak users meeting
International Nuclear Information System (INIS)
Sprott, J.C.
1982-11-01
On November 1, 1982, the sixth in a series of approximately annual meetings of the users of small tokamaks was held in conjunction with the APS Division of Plasma Physics meeting at New Orleans. The meeting lasted three hours, with 34 people attending. The interest was on strengthening the ties between the small tokamaks and the large tokamaks. Accordingly, the latest meeting was dedicated to this theme, and in contrast to previous meetings, a few representatives from the large tokamaks were invited to attend and make presentations. Summaries of the various talks are included
27 CFR 26.194 - Detention of articles.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Detention of articles. 26..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Shipment of... Detention of articles. (a) Upon receiving a notification in accordance with § 26.193(b), the appropriate TTB...
International Working Group on Fast Reactors Thirteenth Annual Meeting. Summary Report. Part II
International Nuclear Information System (INIS)
1980-10-01
The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes
International Working Group on Fast Reactors Thirteenth Annual Meeting. Summary Report. Part I
International Nuclear Information System (INIS)
1980-09-01
The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes
International Working Group on Past Reactors Thirteenth Annual Meeting. Summary Report. Part III
International Nuclear Information System (INIS)
1981-04-01
The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes
2011-09-30
On September 26-27, 2011, the FHWA's Office of Planning sponsored a 1.5 day peer exchange focusing on the use of GIS to support transportation related climate change decisions. This report provides overviews of the presentations given at the peer exc...
Proceedings of the 26th annual meeting of the National Council on Radiation Protection Measurements
International Nuclear Information System (INIS)
Richmond, C.R.
1991-01-01
This book reports on the 26th Annual Meeting of the National Council on Radiation Protection and Measurements which addressed the topic Health and Ecological Implications of Radioactively Contaminated Environments, a topic of great current interest and importance. The meeting was divided into five subtopics. The first dealt with the contaminated sites themselves, the second with human health implications, the third on remediation, the fourth (a panel) on lessons learned and issues of the future and finally a summation. The meeting also included progress reports on the work of three NCRP committees, Scientific Committee 1-2 on the Assessment of Risk for Radiation Protection Purposes, Scientific Committee 66 on Biological Effects and Exposure Criteria for Ultrasound and Scientific Committee 83 on Identification of Research Needs for Radiation Protection. Summaries of these reports prepared by their respective chairmen are included in this volume
International Nuclear Information System (INIS)
Henley, E.M.
1998-01-01
One never quite knows what to say in a summary. If you were at the sessions, you heard the same talks I did. Perhaps the purpose is to summarize the parallel sessions, but like you, I can only attend one of these sessions. In addition, the time is short, so that this cannot be a real summary. What I will present are impressions of the past two days, and these will certainly be colored by my own views. Thus at the outset, let me apologize for any and all omissions and distortions. I will cover primarily the plenary session talks, but will organize this summary along the following lines: 1. vector (V) mesons; 2. pseudoscalar mesons, and 3. other subjects, notably with electrons. This afternoon's talks are so close in time to this summary that I shall omit them. (author)
27 CFR 26.67 - Bond, Form 2897-Wine.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bond, Form 2897-Wine. 26... Liquors and Articles in Puerto Rico Bonds § 26.67 Bond, Form 2897—Wine. Where a proprietor intends to withdraw, for purpose of shipment to the United States, wine of Puerto Rican manufacture from bonded...
27 CFR 26.68 - Bond, Form 2898-Beer.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bond, Form 2898-Beer. 26... Liquors and Articles in Puerto Rico Bonds § 26.68 Bond, Form 2898—Beer. Where a brewer intends to withdraw, for purpose of shipment to the United States, beer of Puerto Rican manufacture from bonded storage in...
This presentation was given by Dr. James Johnson at the STAR Human and Ecological Health Impacts Associated with Water Reuse and Conservation Practices Kick-off Meeting and Webinar held on Oct. 26-27, 2016.
2010 Atmospheric System Research (ASR) Science Team Meeting Summary
Energy Technology Data Exchange (ETDEWEB)
Dupont, DL
2011-05-04
This document contains the summaries of papers presented in poster format at the March 2010 Atmospheric System Research Science Team Meeting held in Bethesda, Maryland. More than 260 posters were presented during the Science Team Meeting. Posters were sorted into the following subject areas: aerosol-cloud-radiation interactions, aerosol properties, atmospheric state and surface, cloud properties, field campaigns, infrastructure and outreach, instruments, modeling, and radiation. To put these posters in context, the status of ASR at the time of the meeting is provided here.
Summary records of the meetings of INFCE Working Group 6
International Nuclear Information System (INIS)
These were 6 meetings of Working Group 6 that took place between 8 December 1977 and 7 September 1979. This document consists of the summaries of those meetings and it reports on the objectives of the Working Group, the participants, the guidelines for the study, and the outline of the final report
Landsat Science Team: 2017 Winter Meeting Summary
Schroeder, Todd A.; Loveland, Thomas; Wulder, Michael A.; Irons, James R.
2017-01-01
The summer meeting of the joint U.S. Geological Survey (USGS)-NASA Landsat Science Team (LST) was held July 26-28, 2016, at South Dakota State University (SDSU) in Brookings, SD. LST co-chair Tom Loveland [USGS’s Earth Resources Observation and Science Center (EROS)] and Kevin Kephart [SDSU] welcomed more than 80 participants to the three-day meeting. That attendance at such meetings continues to increase—likely due to the development of new data products and sensor systems—further highlights the growing interest in the Landsat program. The main objectives of this meeting were to provide a status update on Landsat 7 and 8, review team member research activities, and to begin identifying priorities for future Landsat missions.
Presentation: Overview of Water Reuse Challenges and Opportunities
This presentation, Overview of Water Reuse Challenges and Opportunities, was given at the STAR Human and Ecological Health Impacts Associated with Water Reuse and Conservation Practices Kick-off Meeting and Webinar held on Oct. 26-27, 2016.
IAEA Theory Summary 1998 IAEA Meeting, Yokohama, Japan - Oct. 17-24, 1998
International Nuclear Information System (INIS)
Tang, W.M.
2000-01-01
This is a summary of the advances in magnetic fusion energy theory research presented at the 17th International Atomic Energy Agency Fusion Energy Conference from 17--24 October, 1998 in Yokohama, Japan. Theory and simulation results from this conference provided encouraging evidence of significant progress in understanding the physics of thermonuclear plasmas. Indeed, the grand challenge for this field is to acquire the basic understanding that can readily enable the innovations which would make fusion energy practical. In this sense, as depicted in Fig. 1, research in fusion energy is increasingly able to be categorized as fitting well the ''Pasteur's Quadrant'' paradigm, where the research strongly couples basic science (''Bohr's Quadrant'') to technological impact (''Edison's Quadrant''). As supported by some of the work presented at this conference, this trend will be further enhanced by advanced simulations. Eventually, realistic three-dimensional modeling capabilities, when properly combined with rapid and complete data interpretation of results from both experiments and simulations, can contribute to a greatly enhanced cycle of understanding and innovation. Plasma science theory and simulation have provided reliable foundations for this improved modeling capability, and the exciting advances in high-performance computational resources have further accelerated progress
Institute of Education Sciences, 2015
2015-01-01
This meeting summary is organized into two major sections. The first section captures the individual contribution of meeting participants, including both Institute of Education Sciences (IES) staff and the invited technical working group members. The second section captures themes that arose during the group discussions, which were organized…
Summary record of the 33. Meeting of NEA committee on reactor physics
International Nuclear Information System (INIS)
Martinelli, R.
1991-01-01
This paper is the summary record of the thirty-third meeting (Technical session) of the Nuclear Energy Agency Committee on Reactor Physics. A complete list of all the papers presented at this meeting is given in annex 4
26 CFR 601.103 - Summary of general tax procedure.
2010-04-01
... of estimated tax relieves a taxpayer from the duty of filing a return otherwise required. Certain excise taxes are collected by the sale of internal revenue stamps. (b) Examination and determination of... 26 Internal Revenue 20 2010-04-01 2010-04-01 false Summary of general tax procedure. 601.103...
Energy Technology Data Exchange (ETDEWEB)
Iliadis, C; Schange, T; Rolfs, C; Schroeder, U; Somorjai, E; Trautvetter, H P; Wolke, K [Muenster Univ. (Germany, F.R.). Inst. fuer Kernphysik; Endt, P M; Kikstra, S W [Rijksuniversiteit Utrecht (Netherlands). Robert van de Graaff Lab.; Champagne, A E [Princeton Univ., NJ (USA). Dept. of Physics; Arnould, M; Paulus, G [Universite Libre de Bruxelles (Belgium). Inst. d' Astronomie et d' Astrophysique
1990-06-11
Gamma-ray decay schemes have been measured with bare and Compton-suppressed Ge detectors at low-energy resonances (E{sub p}<340 keV) in the (p, {gamma}) reactions on {sup 25}Mg, {sup 26}Mg and {sup 27}Al. Althogether 58 new decay branches have been observed and a new {sup 26}Mg(p, {gamma}){sup 27}Al resonance has been found at E{sub p}=154.5{plus minus}1.0 keV. The new branchings lead to J{sup {pi}}; T determinations (or limitations) for two states in {sup 26}Al and four states in {sup 28}Si. The absolute strengths of the {sup 25}Mg(p, {gamma}){sup 26}Al and {sup 26}Mg(p, {gamma}){sup 27}Al resonances have also been obtained, and the uncertainties of the stellar rates, deduced from the available data for both reactions, are significantly reduced. Some astrophysical consequences are discussed. (orig.).
49 CFR 26.27 - What efforts must recipients make concerning DBE financial institutions?
2010-10-01
... financial institutions? 26.27 Section 26.27 Transportation Office of the Secretary of Transportation... efforts must recipients make concerning DBE financial institutions? You must thoroughly investigate the full extent of services offered by financial institutions owned and controlled by socially and...
Staff Association
2012-01-01
MARS PENSIONS CONTRACT POLICY GENERAL INFORMATION PUBLIC MEETINGS COME AND BE INFORMED! Public meetings Monday 15 Oct. 2 pm Amphi IT, 31-3-004 Meyrin Wednesday 17 Oct. 10 am Amphi BE, 864-1-D02 Prévessin Thursday 18 Oct. 10 am Salle du Conseil/ Council Chamber 503-1-001 Meyrin Thursday 18 Oct. 2 pm Filtration Plant, 222-R-001(in English) Meyrin Overview of the topics to be discussed Recognition of Merit – MARS Outcome of last exercise 2007 to 2012 : lessons learned Pension Fund Capital preservation policy : what is it ? Contract policy LC2IC statistics SA proposal General information CVI 2013 Voluntary programmes (PRP, SLS)
The [sup 26]Al(p,[gamma])[sup 27]Si reaction at low stellar temperature
Energy Technology Data Exchange (ETDEWEB)
Champagne, A E [North Carolina Univ., Chapel Hill, NC (United States). Dept. of Physics and Astronomy Duke Univ., Durham, NC (United States). Triangle Universities Nuclear Lab.; Brown, B A [Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy Michigan State Univ., East Lansing, MI (United States). National Superconducting Cyclotron Lab.; Sherr, R [Princeton Univ., NJ (United States). Dept. of Physics
1993-05-03
Shell-model calculations have been used to predict the locations of states in [sup 27]Si which are analogous to well-studied states in [sup 27]Al. From this, we have determined the resonance properties of the known states in [sup 27]Si near the [sup 26]Al+p threshold. The resulting thermonuclear reaction rate is uncertain by about a factor of ten at low temperatures, but it appears that the [sup 26]Al(p, [gamma])[sup 27]Si reaction is too slow to destroy a significant amount of [sup 26]Al at these temperatures. (orig.)
Thirteenth meeting of representatives of RCA Member States
International Nuclear Information System (INIS)
1986-07-01
The 13th Meeting of Member States of RCA (Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology) was held on 26 September 1984 in Vienna. This document constitutes the report of that meeting. It includes the list of participants, agenda, summary of discussions, and 1984 costing table. The Report of Recommendations for the meeting consisted of the Summary Report of the Sixth RCA Working Group Meeting held in Kalpakkam, India, 20-23 March 1984. This Summary Report dealt with such topics as RCA research projects (including nuclear techniques to improve legume and buffalo production, radiosterilization of medical supplies, maintenance of nuclear instruments, isotope applications in hydrology and sedimentology), progress of the RCA/UNDP Industrial Project, and future programmes and budget
40 CFR 27.26 - Form, filing and service of papers.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Form, filing and service of papers. 27... CIVIL REMEDIES § 27.26 Form, filing and service of papers. (a) Form. (1) Documents filed with the hearing clerk shall include an original and two copies. (2) The first page of every pleading and paper...
78 FR 57383 - Human Studies Review Board; Notification of a Public Meeting
2013-09-18
... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-ORD-2013-0626; FRL-9900-98-ORD] Human Studies Review Board; Notification of a Public Meeting AGENCY: U.S. Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Office of the Science Advisor announces a public meeting of the Human Studies Review Board to...
Eleventh annual meeting, Bologna, Italy, 17-20 April 1978. Summary report. Part I
Energy Technology Data Exchange (ETDEWEB)
NONE
1978-06-01
The Summary Report of the Eleventh Annual Meeting of the IAEA International Working Group on Fast Reactors contains the Minutes of the Meeting (Part I); the papers which review the national programmes in the field of LMFBRs and other presentations at the Meeting (Part II); and the discussions on the review of the national programmes (Part III)
27 CFR 26.303 - Customs inspection and release.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Customs inspection and... Customs Custody to Internal Revenue Bond § 26.303 Customs inspection and release. The customs officer.... If the spirits are in a bulk conveyance, the customs officer shall record the elements of his gauge...
27 CFR 26.126 - Taxpayment in Puerto Rico.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Taxpayment in Puerto Rico..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Liquors and Articles Purchased by Tourists in Puerto Rico § 26.126 Taxpayment in Puerto Rico. Liquors upon which all...
Measurement of the {sup 26}Si(p,γ){sup 27}P cross section via the Coulomb dissociation of {sup 27}P
Energy Technology Data Exchange (ETDEWEB)
Marganiec, Justyna [TU Darmstadt (Germany); EMMI-GSI Darmstadt (Germany); GSI Darmstadt (Germany); Beceiro-Novo, Saul; Cortina Gil, Dolores [Universidade de Santiago de Compostela (Spain); Typel, Stefan; Heil, Michael; Suemmerer, Klaus [GSI Darmstadt (Germany); Wimmer, Christine [Goethe-Universitaet, Frankfurt am Main (Germany); Aumann, Thomas [TU Darmstadt (Germany); GSI Darmstadt (Germany); Collaboration: R3B-Collaboration
2015-07-01
The reaction {sup 26}Si(p,γ){sup 27}P can, under certain conditions, be significant in the context of the astrophysical rp process. Since {sup 26}Si has a short half-life, the reaction was investigated via the time-reversed process, the Coulomb dissociation (CD) of {sup 27}P into {sup 26}Si and proton. The differential CD cross sections can be converted to radiative-capture cross sections via virtual-photon theory and detailed balance. The experiment was performed at the LAND/R{sup 3}B setup at GSI Darmstadt. The secondary {sup 27}P beam was produced by fragmentation of {sup 36}Ar and impinged onto a Pb target. The incoming beam particles and outgoing reaction products were identified and tracked event by event. Corrections were applied to select only transitions directly to the {sup 26}Si ground state and to remove contributions from nuclear processes and reactions in layers outside the target. The results are compared to potential-model calculations of the CD of {sup 27}P. Consequences for the astrophysical rp process are discussed.
27 CFR 26.106 - Marking containers of beer.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Marking containers of beer... Liquors and Articles in Puerto Rico Beer § 26.106 Marking containers of beer. Containers of beer of Puerto... brewer; the serial number, capacity, and size of the container; the kind of beer; and the serial number...
27 CFR 26.97 - Marking containers of wine.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Marking containers of wine... Liquors and Articles in Puerto Rico Wine § 26.97 Marking containers of wine. Containers of wine of Puerto... winemaker, the serial number of the container, the kind and taxable grade of the wine, the gallon content...
25 CFR 26.27 - What kind of Job Placement support services can I expect?
2010-04-01
... resume preparation, interview techniques, job retention, and related living skills. ... 25 Indians 1 2010-04-01 2010-04-01 false What kind of Job Placement support services can I expect? 26.27 Section 26.27 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HUMAN SERVICES JOB...
Summary report of technical meeting on neutron cross section covariances
International Nuclear Information System (INIS)
Trkov, A.; Smith, D.L.; Capote Noy, R.
2011-01-01
A summary is given of the Technical Meeting on Neutron Cross Section Covariances. The meeting goal was to assess covariance data needs and recommend appropriate methodologies to address those needs. Discussions on covariance data focused on three general topics: 1) Resonance and unresolved resonance regions; 2) Fast neutron region; and 3) Users' perspective: benchmarks' uncertainty and reactor dosimetry. A number of recommendations for further work were generated and the important work that remains to be done in the field of covariances was identified. (author)
Proton threshold states in sup 27 Si and the destruction of sup 26 Al at low stellar temperatures
Energy Technology Data Exchange (ETDEWEB)
Wang, T F [Yale Univ., New Haven, CT (USA). Wright Nuclear Structure Lab.; Argonne National Lab., IL (USA)); Champagne, A E; Hadden, J D [Princeton Univ., NJ (USA). Dept. of Physics; Magnus, P V; Smith, M S; Howard, A J; Parker, P D [Yale Univ., New Haven, CT (USA). Wright Nuclear Structure Lab.
1989-07-31
Using the {sup 27}Al({sup 3}He,t){sup 27}Si reaction, we have located and measured accurate excitation energies for seven states in {sup 27}Si between the {sup 26}Al+p threshold and the lowest observed {sup 26}Al(p,{gamma}){sup 27}Si resonance. By examining the mirror states in {sup 27}Al via the {sup 26}Mg({sup 3}He, d){sup 27}Al and {sup 26}Mg({alpha},t){sup 27}Al reactions, we find that in the {sup 26}Al+p channel there can be at most only one s-wave resonance that lies below the lowest directly observed resonance; this possible l=0 resonance most probably corresponds to either the 7589, 7557 or 7533 keV state in {sup 27}Si. The remaining six states are most probably formed via l{ge}2 proton capture. Upper limits for the reduced proton widths of these states have been used to estimate an upper limit for the {sup 26}Al(p,{gamma}){sup 27}Si thermonuclear reaction rate. (orig.).
International Nuclear Information System (INIS)
1975-07-01
The Eighth Annual Meeting of the IAEA International Working Group on Past Reactors was held at the IAEA Headquarters in Vienna, Austria, from 15 to 18 April 1975. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programmes in the field of LMPBR’s and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes
A resonant absorption measurement in the reaction 26Mg(p, γ)27Al
Leun, C. van der; Burhoven Jaspers, N.C.
1966-01-01
A resonant absorption measurement at the 1966 keV proton resonance in the reaction 26Mg(p, γ)27Al leads to an absolute determination of the resonance strength, (2J+1)ΓpΓγ/Γ, of 5.6±1.8 eV. Normalization of previously published strengths of 120 resonances in the reaction 26Mg(p, γ)27Al, reduces these
Accuracy of Cirrus HD-OCT and Topcon SP-3000P for measuring central corneal thickness.
Calvo-Sanz, Jorge A; Ruiz-Alcocer, Javier; Sánchez-Tena, Miguel A
2017-02-18
To compare and analyze the interchangeability of three measuring systems, each based on a different technique, for central corneal thickness (CCT) analysis. CCT measurements were measured using optical coherence tomography (OCT), non-contact specular microscopy (NCSM), and ultrasonic pachymetry (USP) in 60 eyes of 60 healthy patients with a mean age of 66.5±15.0 years and a mean spherical equivalent of 0.43±1.14 D. Analysis of variations in measurement concordance and correlation among the three different methods were performed. Comparison of CCT measurements were done using Bland-Altman plots (with bias and 95% confidence intervals), intraclass correlation coefficient (ICC), and paired t-student analysis. Mean CCT values were: 549.20±26.91μm for USP (range 503-618μm), 514.20±27.49μm for NCSM (range 456-586μm) and 542.80±25.56μm for OCT (range 486-605μm). CCT values obtained with NCMS were significantly lower than those obtained with OCT and USP methods. NCMS CCT value was 36.08±10.72μm lower than USP value (p<0.05), and NCMS CCT value was 7.88±8.86μm lower than OCT value (p<0.05). ICC between USP-NCSM pair was 0.488 and 0.909 between USP-OCT pair. OCT and UPS offered highly comparable results, whereas NCSM offered lower mean CCT values compared to the other two methods. Therefore, NCSM should not be considered a reliable method for measuring CCT and should rather be considered for assessing longitudinal changes in the same patient. Copyright © 2017 Spanish General Council of Optometry. Published by Elsevier España, S.L.U. All rights reserved.
Hoesl, Laura Maria; Tornow, Ralf P; Schrems, Wolfgang A; Horn, Folkert K; Mardin, Christian Y; Kruse, Friedrich E; Juenemann, Anselm G M; Laemmer, Robert
2013-01-01
To investigate the impact of typical scan score (TSS) on discriminating glaucomatous and healthy eyes by scanning laser polarimetry and spectral domain optical coherence tomography (SD-OCT) in 32 peripapillary sectors. One hundred two glaucoma patients and 32 healthy controls underwent standard automated perimetry, 24-hour intraocular pressure profile, optic disc photography, GDxVCC, and SD-OCT measurements. For controls, only very typical scans (TSS=100) were accepted. Glaucoma patients were divided into 3 subgroups (very typical: TSS=100; typical: 99≥TSS≥80, atypical: TSS<80). Receiver operating characteristic curves were constructed for mean retinal nerve fiber layer values, sector data, and nerve fiber indicator (NFI). Sensitivity was estimated at ≥90% specificity to compare the discriminating ability of each imaging modality. For discrimination between healthy and glaucomatous eyes with very typical scans, the NFI and inferior sector analyses 26 to 27 demonstrated the highest sensitivity at ≥90% specificity in GDxVCC and SD-OCT, respectively. For the typical and atypical groups, sensitivity at ≥90% specificity decreased for all 32 peripapillary sectors on an average by 10.9% and 17.9% for GDxVCC and by 4.9% and 0.8% for SD-OCT. For GDxVCC, diagnostic performance of peripapillary sectors decreased with lower TSS, especially in temporosuperior and inferotemporal sectors (sensitivity at ≥90% specificity decreased by 55.3% and by 37.8% in the atypical group). Diagnostic accuracy is comparable for SD-OCT and GDxVCC if typical scans (TSS=100) are investigated. Decreasing TSS is associated with a decrease in diagnostic accuracy for discriminating healthy and glaucomatous eyes by scanning laser polarimetry. NFI is less influenced than the global or sector retinal nerve fiber layer thickness. The TSS score should be included in the standard printout. Diagnostic accuracy of SD-OCT is barely influenced by low TSS.
International Nuclear Information System (INIS)
Clark, R.E.H.; Peacock, N.J.
2002-11-01
This report briefly describes the proceedings, conclusions and recommendations of the 13th Meeting of the Subcommittee on Atomic and Molecular Data for Fusion of the International Fusion Research Council held on 24-25 June, 2002 at the IAEA Headquarters in Vienna Austria. The report includes an Executive Summary of the Subcommittee from this Meeting. (author)
27 CFR 26.135 - Containers of distilled spirits to bear closures.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Containers of distilled spirits to bear closures. 26.135 Section 26.135 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO... to bear closures. Containers of 1 gallon (3.785 liters) or less of distilled spirits, upon which all...
27 CFR 26.230 - Containers of distilled spirits to bear closures.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Containers of distilled spirits to bear closures. 26.230 Section 26.230 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO... distilled spirits to bear closures. Containers of 1 gallon (3.785 liters) or less of distilled spirits, upon...
OCT/PS-OCT imaging of brachial plexus neurovascular structures
Raphael, David T.; Zhang, Jun; Zhang, Yaoping; Chen, Zhongping; Miller, Carol; Zhou, Li
2004-07-01
Introduction: Optical coherence tomography (OCT) allows high-resolution imaging (less than 10 microns) of tissue structures. A pilot study with OCT and polarization-sensitive OCT (PS-OCT) was undertaken to image ex-vivo neurovascular structures (vessels, nerves) of the canine brachial plexus. Methods: OCT is an interferometry-based optical analog of B-mode ultrasound, which can image through non-transparent biological tissues. With approval of the USC Animal Care and Use Committee, segments of the supra- and infraclavicular brachial plexus were excised from euthanized adult dogs, and the ex-vivo specimens were placed in cold pH-buffered physiologic solution. An OCT beam, in micrometer translational steps, scanned the fixed-position bisected specimens in transverse and longitudinal views. Two-dimensional images were obtained from identified arteries and nerves, with specific sections of interest stained with hematoxylin-eosin for later imaging through a surgical microscope. Results: with the beam scan direction transverse to arteries, the resulting OCT images showed an identifiable arterial lumen and arterial wall tissue layers. By comparison, transverse beam OCT images of nerves revealed a multitude of smaller nerve bundles contained within larger circular-shaped fascicles. PS-OCT imaging was helpful in showing the characteristic birefringence exhibited by arrayed neural structures. Discussion: High-resolution OCT imaging may be useful in the optical identification of neurovascular structures during attempted regional nerve blockade. If incorporated into a needle-shaped catheter endoscope, such a technology could prevent intraneural and intravascular injections immediately prior to local anesthetic injection. The major limitation of OCT is that it can form a coherent image of tissue structures only to a depth of 1.5 - 2 mm.
International Nuclear Information System (INIS)
Capote Noy, R.
2013-09-01
A summary is given of the Second Research Coordination Meeting on Prompt Fission Neutron Spectra of Actinides. Experimental data and modelling methods on prompt fission neutron spectra were reviewed. Extensive technical discussions held on theoretical methods to calculate prompt fission spectra. Detailed coordinated research proposals have been agreed. Summary reports of selected technical presentations at the meeting are given. The resulting work plan of the Coordinated Research Programme is summarized, along with actions and deadlines. (author)
Tenth annual meeting, Vienna, Austria, 29 March - 1 April 1977. Summary report. Part I
Energy Technology Data Exchange (ETDEWEB)
NONE
1977-05-01
The Summary Report of Tenth Annual Meeting of the IAEA International Working Group on Fast Reactors contains the Minutes of the Meeting (Part I); the papers which review the national programmes in the field of LMFBRs and other presentations at the Meeting (Part II); and the discussions on the review of the national programmes (Part III)
Energy Technology Data Exchange (ETDEWEB)
Abriola, D.; Tuli, J.
2009-03-23
The IAEA Nuclear Data Section convened the 18th meeting of the International Network of Nuclear Structure and Decay Data Evaluators at the IAEA Headquarters, Vienna, 23 to 27 March 2009. This meeting was attended by 22 scientists from 14 Member States, plus IAEA staff, concerned with the compilation, evaluation and dissemination of nuclear structure and decay data. A summary of the meeting, recommendations/conclusions, data centre reports, and various proposals considered, modified and agreed by the participants are contained within this document. The International Network of Nuclear Structure and Decay Data (NSDD) Evaluators holds biennial meetings under the auspices of the IAEA, and consists of evaluation groups and data service centres in several countries. This network has the objective of providing up-to-date nuclear structure and decay data for all known nuclides by evaluating all existing experimental data. Data resulting from this international evaluation collaboration is included in the Evaluated Nuclear Structure Data File (ENSDF) and published in the journals Nuclear Physics A and Nuclear Data Sheets (NDS).
International Nuclear Information System (INIS)
Gunsing, Frank; Otsuka, Naohiko
2010-12-01
The Third Research Co-ordination Meeting of the MANREAD (Minor Actinides Neutron Reaction Data) Coordinated Research Project (CRP) was held at IAEA Headquarters in Vienna from 19 to 22 October 2010. A summary of the presentation, and the discussions which took place during the meeting, are reported here. In addition, a task assignment list of the experimental data assessment activities was agreed, and is provided together with the plan for future CRP activities. The Third Research Co-ordination Meeting of the MANREAD (Minor Actinides Neutron Reaction Data) Coordinated Research Project (CRP) was held at IAEA Headquarters in Vienna from 19 to 22 October 2010. A summary of the presentation, and the discussions which took place during the meeting, are reported here. In addition, a task assignment list of the experimental data assessment activities was agreed, and is provided together with the plan for future CRP activities. (author)
Directory of Open Access Journals (Sweden)
Isola V
2012-02-01
Full Text Available Luisa Pierro1, Elena Zampedri1, Paolo Milani2, Marco Gagliardi1, Vincenzo Isola2, Alfredo Pece21Department of Ophthalmology, University Vita-Salute, Scientific Institute San Raffaele, Milano, Italy, 2Fondazione Retina 3000, Milano, ItalyBackground: The aim of this study was to compare the agreement between spectral domain optical coherence tomography (SD OCT and time domain stratus OCT (TD OCT in evaluating macular morphology alterations in wet age-related macular degeneration (AMD.Methods: This retrospective study was performed on 77 eyes of 77 patients with primary or recurring subfoveal choroidal neovascularization secondary to AMD. All patients underwent OCT examination using Zeiss Stratus OCT 3 (Carl Zeiss Meditec Inc, Dublin, CA and Opko OTI Spectral SLO/OCT (Ophthalmic Technologies Inc, Toronto, Canada. In all radial line scans, the presence of intraretinal edema (IRE, serous pigment epithelium detachment (sPED, neurosensory serous retinal detachment (NSRD, epiretinal membrane (EM, inner limiting membrane thickening (ILMT, and hard exudates (HE were evaluated. The degree of matching was quantified by Kappa measure of agreement.Results: The percentage distribution of TD OCT findings versus SD OCT findings was: IRE 36.3% versus 77.9%, sPED 57.1% versus 85.7%, NSRD 38.9% versus 53.2%, EM 10.5% versus 26.3%, ILMT 3.8% versus 32.4%, and HE 6.4% versus 54.5%. The agreement was as follows: sPED: kappa value 0.15; NSRD: kappa value 0.61; IRE: kappa value 0.18; EM: kappa value 0.41; ILMT: kappa value 0.02; HE: kappa value 0.06.Conclusion: The agreement in the evaluation of macular lesions between the two techniques is poor and depends on the lesion considered. SD OCT allows better detection of the alterations typically related to choroidal neovascularization such as IRE, PED, ILM thickening, and HE. Consequently its use should be strongly considered in patients with wet AMD.Keywords: spectral domain, OCT, time domain, macular degeneration, AMD
27 CFR 26.199d - Customs inspection and release.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Customs inspection and... Shipment of Bulk Distilled Spirits From Puerto Rico, Without Payment of Tax, for Transfer From Customs Custody to Internal Revenue Bond § 26.199d Customs inspection and release. On receipt of a properly...
OCT2 and MATE1 Provide Bi-directional Agmatine Transport
Winter, Tate N.; Elmquist, William F.; Fairbanks, Carolyn A.
2015-01-01
Agmatine is a biogenic amine (l-arginine metabolite) of potential relevance to several central nervous system (CNS) conditions. The identities of transporters underlying agmatine and polyamine disposition in mammalian systems are not well defined. The SLC-family organic cation transporters (OCT) OCT1 and OCT2 and multidrug and toxin extrusion transporter-1 (MATE1) are transport systems that may be of importance for the cellular disposition of agmatine and putrescine. We investigated the transport of [3H]-agmatine and [3H]-putrescine in human embryonic kidney (HEK293) cells stably-transfected with hOCT1-, hOCT2-, and hMATE1. Agmatine transport by hOCT1 and hOCT2 was concentration-dependent, whereas only hOCT2 demonstrated pH-dependent transport. hOCT2 exhibited a greater affinity for agmatine (Km = 1.84 ± 0.38 mM) than did hOCT1 (Km = 18.73 ± 4.86 mM). Putrescine accumulation was pH- and concentration-dependent in hOCT2-HEK cells (Km = 11.29 ± 4.26 mM) but not hOCT1-HEK cells. Agmatine accumulation, in contrast to putrescine, was significantly enhanced by hMATE1 over-expression, and was saturable (Km = 240 ± 31 μM; Vmax = 192 ± 10 pmol/min/mg protein). Intracellular agmatine was also trans-stimulated (effluxed) from hMATE1-HEK cells in the presence of an inward proton-gradient. The hMATE1-mediated transport of agmatine was inhibited by polyamines, the prototypical substrates MPP+ and paraquat, as well as guanidine and arcaine, but not l-arginine. These results suggest that agmatine disposition may be influenced by hOCT2 and hMATE1, two transporters critical in the renal elimination of xenobiotic compounds. PMID:21128598
Report on the IAEA Technical Meeting of the International Network of Nuclear Reaction Data Centres
International Nuclear Information System (INIS)
Forrest, R.; Dunaeva, S.; Otsuka, N.
2010-07-01
This report summarizes the IAEA Technical Meeting of the International Network of Nuclear Reaction Data Centres (biennial Data Centre Heads Meeting), held at the Japan Nuclear Reaction Data Centre, Hokkaido University, Sapporo, Japan, from 20 - 23 April 2010. The meeting was attended by 27 participants from 12 cooperating data centres of seven Member States and two International Organizations. The report contains a summary of the meeting, the conclusions and actions, the lists of working papers and presentations presented at the meeting. This report summarizes the IAEA Technical Meeting of the International Network of Nuclear Reaction Data Centres (biennial Data Centre Heads Meeting), held at the Japan Nuclear Reaction Data Centre, Hokkaido University, Sapporo, Japan, from 20 - 23 April 2010. The meeting was attended by 27 participants from 12 cooperating data centres of seven Member States and two International Organizations. The report contains a summary of the meeting, the conclusions and actions, the lists of working papers and presentations presented at the meeting. (author)
En face OCT in Stargardt disease.
Sodi, Andrea; Mucciolo, Dario Pasquale; Cipollini, Francesca; Murro, Vittoria; Caporossi, Orsola; Virgili, Gianni; Rizzo, Stanislao
2016-09-01
To evaluate the structural features of the macular region by enface OCT imaging in patients with clinical diagnosis of Stargardt disease, confirmed by the detection of ABCA4 mutations. Thirty-two STGD patients were included in the study for a total of 64 eyes. All patients received a comprehensive ophthalmological examination, color fundus photography, fundus auto-fluorescence imaging and OCT. Five OCT scans were considered: ILM and RPE scans (both automatically obtained from the instrument), above-RPE slab, photoreceptor slab and sub-RPE slab (these last three manually obtained). ILM scans showed evident radial folds on the retinal surface in 8/64 eyes (12.5 %). In 6 of the 7 patients, these vitreo-retinal interface abnormalities were unilateral. The photoreceptor slab showed some macular alterations ranging from dis-homogeneous, hypo-reflective abnormalities (7/64 eyes, 11 %) to a homogeneous, well-defined, roundish, hypo-reflective area (17/64 eyes, 27 %) in all the eyes. The sub-RPE slab showed a centrally evident, hyper-reflective abnormality in 58/64 eyes (90.6 %). Superimposing the sub-RPE slab over the images corresponding to the photoreceptor slab, the area of the photoreceptor atrophy sharply exceeded that of the RPE atrophy (44/46 eyes, 96 %). Enface OCT proved to be a clinically useful tool for the management of STGD patients, illustrating in vivo the structural abnormalities of the different retinal layers.
International Nuclear Information System (INIS)
Oblozinsky, P.
1997-09-01
The report contains the summary of the third and the last Research Co-ordination Meeting on ''Development of Reference Input Parameter Library for Nuclear Model Calculations of Nuclear Data (Phase I: Starter File)'', held at the ICTP, Trieste, Italy, from 26 to 29 May 1997. Details are given on the status of the Handbook and the Starter File - two major results of the project. (author)
Summary Report of the Technical Meeting on International Network of Nuclear Reaction Data Centres
International Nuclear Information System (INIS)
Otsuka, Naohiko
2013-07-01
This report summarizes the IAEA Technical Meeting on the International Network of Nuclear Reaction Data Centres, held at the IAEA Headquarters in Vienna, Austria from 23 to 25 April 2013. The meeting was attended by 24 participants representing 13 cooperative centres from 8 Member States and 2 International Organisations. A summary of the meeting is given in this report along with the conclusions and actions. (author)
International Nuclear Information System (INIS)
2013-01-01
and memory and the relationship to confidence (Meritxell Martell); 12: The Concept of Oversight (Claudio Pescatore); 13: Monitoring and Oversight Discussion; 14: Minimal Set of Records; 15: Wrap Up of day 1 discussions; 16: Day 2 Introduction; 17: Exploratory investigation into the loss of memory on conventional landfills and contaminated sites of the past (Marcos Buser); 18: Difficulties in preserving knowledge across generations: Exemplification by the repository 'Asse II mine'; 19: Loss of Records and Memory Discussion; 20: Regulatory Catalogue (Helen Gordon-Smith); 21: Regulatory Catalogue Discussion (Stephan Hotzel); 22: Supranational Mechanisms to support Records, Knowledge and Memory Preservation over the medium term (Thierry Schneider); 23: Supranational Mechanisms Discussion (Jean-Noel Dumont); 24: Bibliography Analysis (Richard Ferch); 25: Bibliography Analysis Discussion (Anne Claudel); 26: Menu Driven Document Wiki (Eelco Kruizinga); 27: Wrap-Up of day 2 discussions; 28-29: Introduction and Review of the Meeting (Claudio Pescatore); 30: September Workshop; 31: Phase II; 32: Wrap-Up of day 3 discussions
2012-01-01
DRAFT Agenda for the meeting to be held on Friday 7 December 2012 at 9:15 a.m. in room 60-6-002. Chairperson's remarks Adoption of the agenda Minutes of the previous meeting News from the CERN Management Report on services from GS department Status of Vidyo Health insurance issues Usage of Gate E for family members and opening times Users’ Office news Matters arising Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairperson in writing or by e-mail to Michael.Hauschild@cern.ch. Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are: Austria M. Jeitler manfred.jeitler@cern.ch Belgium C. Vander Velde (Chairperson) catherine....
2020 Vision Project Summary, FY98
Energy Technology Data Exchange (ETDEWEB)
A Munoz; J. C. Clausen; K. P. Scott; K. W. Gordon
1998-11-01
The 2020 Vision project began in 1996 with two participating teachers and four classes. It has since grown to comprise more than a dozen participating teachers and hundreds of students across the country. Much of this growth took place in FY98, thanks to the accomplishment of several major goals: implementation of a mentor program, enhanced teacher training, a mid-year conference for students, recruitment of distant schools, and the development of an interactive Web site. The first part of this report describes these accomplishments, as well as future directions for 2020 Vision. The second part summarized the scenarios students wrote during the 1997-98 school year. it identifies recurrent themes in the students' scenarios and compares/contrasts them with scenarios written in the first two years of the project.
Eighth annual meeting, Vienna, Austria, 15-18 April 1975. Summary report. Part III
International Nuclear Information System (INIS)
1976-01-01
The Summary Report of the Eighth Annual Meeting of the International Working Group on Fast Reactors contains the minutes of the meeting (Part 1); papers which review the national programmes in the field of LMFBRs (Part 2) and the discussions on the review of national programmes (Part 3). The agenda of the meeting involved design, construction, operating experiences of demonstration fast power reactors, reprocessing of spent fuel from LMFBRs, reliability of decay heat removal systems, fuel failure mechanisms, safety of LMFBRs
Eighth annual meeting, Vienna, Austria, 15-18 April 1975. Summary report. Part III
Energy Technology Data Exchange (ETDEWEB)
NONE
1976-01-01
The Summary Report of the Eighth Annual Meeting of the International Working Group on Fast Reactors contains the minutes of the meeting (Part 1); papers which review the national programmes in the field of LMFBRs (Part 2) and the discussions on the review of national programmes (Part 3). The agenda of the meeting involved design, construction, operating experiences of demonstration fast power reactors, reprocessing of spent fuel from LMFBRs, reliability of decay heat removal systems, fuel failure mechanisms, safety of LMFBRs.
Eighth annual meeting, Vienna, Austria, 15-18 April 1975. Summary report. Part I
Energy Technology Data Exchange (ETDEWEB)
NONE
1975-08-01
The Summary Report of the Eighth Annual Meeting of the International Working Group on Fast Reactors contains the minutes of the meeting (Part 1); papers which review the national programmes in the field of LMFBRs (Part 2) and the discussions on the review of national programmes (Part 3). The agenda of the meeting involved design, construction, operating experiences of demonstration fast power reactors, reprocessing of spent fuel from LMFBRs, reliability of decay heat removal systems, fuel failure mechanisms, safety of LMFBRs.
Eighth annual meeting, Vienna, Austria, 15-18 April 1975. Summary report. Part I
International Nuclear Information System (INIS)
1975-08-01
The Summary Report of the Eighth Annual Meeting of the International Working Group on Fast Reactors contains the minutes of the meeting (Part 1); papers which review the national programmes in the field of LMFBRs (Part 2) and the discussions on the review of national programmes (Part 3). The agenda of the meeting involved design, construction, operating experiences of demonstration fast power reactors, reprocessing of spent fuel from LMFBRs, reliability of decay heat removal systems, fuel failure mechanisms, safety of LMFBRs
26th Annual ESNA/IUR Meeting: Soil-Plant Relationships
International Nuclear Information System (INIS)
Gerzabek, M. H.
1996-11-01
The radioecological session of the 26 th annual meeting of ESNA (in Busteni/Romania) is for INIS interesting. The session was a joint session with the soil-to-plant transfer working group of the IUR. (Botek)
International Nuclear Information System (INIS)
Dupont, Emmeric
2014-01-01
The NEA's nuclear data evaluation co-operation activities involve the following evaluation projects: ENDF (United States), JENDL (Japan), ROSFOND/BROND (Russia), JEFF (other Data Bank member countries) and CENDL (China) in close co-operation with the Nuclear Data Section of the International Atomic Energy Agency (IAEA). The working party was established to promote the exchange of information on nuclear data evaluations, measurements, nuclear model calculations, validation, and related topics, and to provide a framework for co-operative activities between the participating projects. The working party assesses nuclear data improvement needs and addresses these needs by initiating joint evaluation and/or measurement efforts. This document is the executive summary of WPEC's 26. meeting held in 2014. It presents a brief review of the 2 days meeting in particular the Reports on experimental activities in Europe, Japan, USA and China, the Brief progress reports from the evaluation projects (ENDF, JEFF, JENDL, ROSFOND, CENDL, IAEA, TENDL) with the discussion of future plans, the Review of final or near-final subgroup reports, the Status of ongoing subgroups, the Proposals for new subgroups and some information about Conferences and meetings of interest to the nuclear data community. A list of participants and a list of reports presented at this meeting are attached in appendix
IAEA consultants' meeting on benchmark validation of FENDL-1. Summary report
International Nuclear Information System (INIS)
Pashchenko, A.B.
1996-01-01
The present report contains the Summary of the IAEA Consultants' Meeting on ''Benchmark Validation of FENDL-1'', held at Karlsruhe, Germany, from 17 to 19 October 1995. This meeting was organized by the IAEA Nuclear Data Section (NDS) with the co-operation and assistance of local organizers of the Forschungszentrum Karlsruhe, Germany. Summarized are the conclusions and the main results of extensive benchmarking of FENDL-1 by comparing experimental data from numerous number of fusion integral experiments, to analytical predictions based on discrete ordinates as well as Monte Carlo calculations. (author). 4 refs
STANDING CONCERTATION COMMITTEE ORDINARY MEETING ON 26 JANUARY 2000
2000-01-01
Original: EnglishThis meeting was devoted to preparation of the next meeting of TREF, to discussion of Administrative Circulars, and to other main items indicated below:Preparation for TREF in MarchThe SCC discussed several main items on the draft agenda of the next meeting of TREF on 30 March, namely:Long-term care: The Committee debated the outline of a document to be prepared for TREF, which is to comprise an executive summary of the issue, responding to various questions, as well as scenarios for possible cost sharing. A draft document on these lines is to be presented at the next meeting of the SCC in February.Data collection enquiry for the 5-yearly Review: The SCC took note of progress with the enquiry which is expected to provide a series of first results to be presented at TREF in March.Career structure: The external survey on this subject is to progress in parallel with internal discussions between Management and Staff Association. Discussion at TREF in March will be based on working documents from ...
Summary Report of the Technical Meeting on International Network of Nuclear Reaction Data Centres
International Nuclear Information System (INIS)
Otsuka, Naohiko
2012-06-01
This report summarizes the IAEA Technical Meeting on the International Network of Nuclear Reaction Data Centres, held at the OECD Nuclear Energy Agency (NEA) in Issy-les-Moulineaux, France from 16 to 19 April 2012. The meeting was attended by twenty-three participants representing thirteen cooperative centres from eight Member States and two International Organisations. A summary of the meeting is given in this report along with the conclusions and actions. (author)
International Nuclear Information System (INIS)
Otsuka, Naohiko
2011-07-01
This report summarizes the IAEA Technical Meeting of the International Network of Nuclear Reaction Data Centres, held at the IAEA Headquarters in Vienna, Austria from 23 - 24 May 2011. The meeting was attended by 25 participants from 13 cooperating data centres of nine Member States and two International Organizations. The report contains a summary of the meeting, the conclusions and actions, the lists of working papers and presentations presented at the meeting. (author)
Wilder-Smith, Petra; Otis, Linda; Zhang, Jun; Chen, Zhongping
This chapter describes the applications of OCT for imaging in vivo dental and oral tissue. The oral cavity is a diverse environment that includes oral mucosa, gingival tissues, teeth and their supporting structures. Because OCT can image both hard and soft tissues of the oral cavity at high resolution, it offers the unique capacity to identity dental disease before destructive changes have progressed. OCT images depict clinically important anatomical features such as the location of soft tissue attachments, morphological changes in gingival tissue, tooth decay, enamel thickness and decay, as well as the structural integrity of dental restorations. OCT imaging allows for earlier intervention than is possible with current diagnostic modalities.
International Nuclear Information System (INIS)
1998-01-01
This press dossier document reports on the main points presented by the Framatome group at the ENC'98 colloquium which took place in Nice (France) on September 25 1998. The summary comprises 4 main parts: the 1997-98 highlights (nuclear realizations in France, China and Turkey, nuclear services, nuclear fuels), the international activities in the nuclear domain (USA, China, Eastern Europe), the research and development activities (the French-German joint EPR project, the high temperature reactor (HTR) project), and the service and nuclear fuel activities (maintenance, improvements, control and expertise). (J.S.)
Mid Year Meetings | Events | Indian Academy of Sciences
Indian Academy of Sciences (India)
Mid Year Meetings. 28 Mid-Year Meeting, 2017. Dates: 30th June and 1st July 2017. Venue: Faculty Hall, Indian Institute of Science, Bengaluru. 27 Mid-Year Meeting, 2016. Dates: 1 and 2 July 2016. Venue: Faculty Hall, Indian Institute of Science, Bengaluru. 26 Mid-Year Meeting, 2015. Dates: 3 and 4 July 2015. Venue: ...
78 FR 9372 - Gulf of Mexico Fishery Management Council; Public Meeting
2013-02-08
.... SUMMARY: The Gulf of Mexico Fishery Management Council will convene a meeting of the Ad Hoc Private.... on Tuesday, February 26, 2013. ADDRESSES: The meeting will be held at the Gulf of Mexico Fishery... INFORMATION CONTACT: Dr. John Froeschke, Fishery Biologist- Statistician; Gulf of Mexico Fishery Management...
Circumpolar Biodiversity Monitoring Programme: Coastal Expert Workshop meeting summary
Thomson, L.; McLennan, Donald; Anderson, Rebecca D.; Wegeberg, S.; Pettersvik Arvnes, Maria; Sergienko, Liudmila; Behe, Carolina; Moss-Davies, Pitseolak; Fritz, S.; Christensen, T.; Price, C.
2016-01-01
The Coastal Expert Workshop brought together a diverse group of coastal experts with the common goal of developing a biodiversity monitoring program for coastal ecosystems across the circumpolar Arctic. Meeting participants, including northern residents, industry and Non-Governmental Organization (NGO) representatives, scientists, and government regulators from across the circumpolar Arctic, gathered at the Lord Elgin Hotel in Ottawa from March 1 to 3, 2016, to discuss current biodiversity monitoring efforts, understand key issues facing biodiversity in the Arctic coastal areas and suggest monitoring indicators, or Focal Ecosystem Components, for the program. A Traditional Knowledge Holders meeting was held on February 29, 2016 in conjunction with the workshop. The following document provides a summary of the workshop activities and outcomes, and will be followed by a more complete Workshop Report.
Annual Information Meeting of the Pension Fund | 26 October
2016-01-01
All members and beneficiaries of the Pension Fund are invited to attend the Annual Information Meeting of the Pension Fund. Meeting to be held in the Main Auditorium on Wednesday 26 October 2016 from 9:30 a.m. to 11:30 a.m. Following a presentation by the Chief Executive Officer of the Fund there will be a Questions and Answers session. Members and Beneficiaries are welcome to send questions in advance of the meeting by post to: Mr Matthew Eyton-Jones “Annual Information Meeting” CEO CERN Pension Fund Office 5-5-012, Postbox C23800 CH- 1211 Geneva 23 - Switzerland Copies of the 2015 Pension Fund Annual Report & Financial Statements are already available in accessible PDF on the Pension Fund website and will also be distributed at the annual meeting. *Coffee and croissants will be served prior to the meeting as of 9:00 a.m.*
Summary report of 2. research coordination meeting on Minor Actinide Neutron Reaction Data (MANREAD)
International Nuclear Information System (INIS)
Nagai, Y.; Mengoni, A.
2009-07-01
The second Research Co-ordination Meeting of the MANREAD (Minor Actinides Neutron Reaction Data) was held at the IAEA Headquarters in Vienna from 31 March to 3 April 2009. A summary of the discussion which took place at the meeting is reported here together with a list of the main outcomes and recommendations produced by the RCM participants. (author)
International Nuclear Information System (INIS)
Chung, H.K.; Wickham, A.J.
2010-02-01
The 12th Meeting of the Technical Steering Committee for the International Database on Irradiated Nuclear Graphite Properties was held on 12-13 November 2009 at the IAEA Headquarters, Vienna, Austria. All discussions, recommendations and actions of this Consultants' Meeting are recorded in this report. The purposes of the meeting were to review the matters and actions identified in the previous meeting, undertake a review of the current status of the database, and make recommendations for action over the next year. This report contains the status of the identified actions as well as a summary of the recommendations on enhancements to the database. (author)
Transactions of the Twenty-First Water Reactor Safety Information Meeting
International Nuclear Information System (INIS)
Monteleone, S.
1993-10-01
This report contains summaries of papers on reactor safety research to be presented at the 21st Water Reactor Safety Information Meeting at the Bethesda Marriott Hotel, Bethesda, Maryland, October 25--27, 1993. The summaries briefly describe the programs and results of nuclear safety research sponsored by the Office of Nuclear Regulatory Research, US NRC. Summaries of invited papers concerning nuclear safety issues from US government laboratories, the electric utilities, the Electric Power Research Institute (EPRI), the nuclear industry, and from foreign governments and industry are also included. The summaries have been compiled in one report to provide a basis for meaningful discussion and information exchange during the course of the meeting and are given in the order of their presentation in each session
Transactions of the Twenty-First Water Reactor Safety Information Meeting
Energy Technology Data Exchange (ETDEWEB)
Monteleone, S. [comp.
1993-10-01
This report contains summaries of papers on reactor safety research to be presented at the 21st Water Reactor Safety Information Meeting at the Bethesda Marriott Hotel, Bethesda, Maryland, October 25--27, 1993. The summaries briefly describe the programs and results of nuclear safety research sponsored by the Office of Nuclear Regulatory Research, US NRC. Summaries of invited papers concerning nuclear safety issues from US government laboratories, the electric utilities, the Electric Power Research Institute (EPRI), the nuclear industry, and from foreign governments and industry are also included. The summaries have been compiled in one report to provide a basis for meaningful discussion and information exchange during the course of the meeting and are given in the order of their presentation in each session.
621.pdf | Pdf2006Oct | sadha-na | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; sadha-na; Pdf2006Oct; 621.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be ...
International Nuclear Information System (INIS)
Kellett, M.A.
2009-12-01
The third meeting of the Co-ordinated Research Project on 'Reference Database for Neutron Activation Analysis' was held at the IAEA, Vienna from 17-19 November 2008. A summary of presentations made by participants is given, reports on specific tasks and subsequent discussions. With the aim of finalising the work of this CRP and in order to meet initial objectives, outputs were discussed and detailed task assignments agreed upon. (author)
Measurement of the d({sup 26}Al{sup m},p){sup 27}Al reaction for nuclear astrophysics
Energy Technology Data Exchange (ETDEWEB)
Roeder, B.T.; Trache, L.; Iacob, V.E.; McCleskey, M.; Simmons, E.; Spiridon, A.; Tribble, R.E. [Texas A and M Univ., TX (United States); Davinson, T.; Lotay, G.; Woods, P.J. [University of Edinburgh (United Kingdom); La Cognata, M.; Pizzone, R.G.; Rapisarda, G.G.; Sparta, R.; Spitaleri, C. [Istituto Nazionale di Fisica Nucleare (LNS/INFN), Catania (Italy). Lab. Nazionali del Sud
2012-07-01
Full text: The detection of gamma rays from the decay of the {sup 26}Al ground state in the galaxy gives evidence that nucleosynthesis is occurring in present-day stars, but its origin is not yet clear. This implies that reactions involving {sup 26}Al are important for astrophysical processes. In a recent experiment at the Cyclotron Institute at Texas A and M University, reactions with the ground state and isomeric state of {sup 26}Al were investigated with the Texas A and M-Edinburgh-Catania Silicon detector Array (TECSA). TECSA is a collaborative effort to build a high-efficiency detector Si array useful for measuring reactions of interest for nuclear astrophysics and nuclear structure. The array consists of up to 16 Micron Semiconductor YY1 detectors that are each 300 μm thick. Each detector has 16 annular ring sectors to measure the energy and the scattering angle of the detected particles. Using TECSA, we measured d({sup 26}Al{sup g},p){sup 27}Al and d({sup 26}Al{sup m},p){sup 27}Al with a {sup 26}Al secondary beam prepared in-flight with the MARS spectrometer. First, the composition of the {sup 26}Al beam was determined by measuring the ratio of beta-decays to {sup 26}Al ions produced. It was found that at different spectrometer rigidities, beams of 2/3 isomer to ground state ratio or vice-versa could be obtained. Then, in the second part of the experiment, angular distributions were measured for both reactions at backward angles with TECSA. The protons were measured in TECSA in coincidence with timing signals from the beam detected by a scintillator and with the cyclotron radio-frequency. Details of the experiment and preliminary results from the analysis of the d({sup 26}Al{sup m},p){sup 27}Al and d({sup 26}Al{sup g},p){sup 27}Al data will be presented. They will give information about the proton capture reactions {sup 26}Al{sup m}(p,γ){sup 27}Si and {sup 26}Al{sup g}(p,γ){sup 27}Si taking place in stars. (author)
Transactions of the twenty-second water reactor safety information meeting
International Nuclear Information System (INIS)
1994-10-01
This report contains summaries of papers on reactor safety research to be presented at the 22nd Water Reactor Safety Information Meeting at the Bethesda Marriott Hotel, Bethesda, Maryland, October 24--26, 1994. The summaries briefly describe the programs and results of nuclear safety research sponsored by the Office of Nuclear Regulatory Research, US NRC. Summaries of invited papers concerning nuclear safety issues from US government laboratories, the electric utilities, the nuclear industry, and from foreign governments and industry are also included. The summaries have been compiled in one report to provide a basis for meaningful discussion and information exchange during the course of the meeting and are given in the order of their presentation in each session. Individual papers have been cataloged separately
Staff Association
2013-01-01
MARS SURVEY 5YR 2015 GENERAL INFORMATION ELECTIONS 2013 COME AND BE INFORMED! Public meetings Tuesday 1st Oct. 10 am Amphi IT, 31-3-004 Meyrin Tuesday 1st Oct. 2 pm Council Chamber, 503-1-001 Meyrin Friday 4 Oct. 10 am Amphi BE, 864-1-D02 Prévessin Monday 7 Oct. 2 pm Council Chamber, 503-1-001 (in English) Meyrin Tuesday 8 Oct. 10 am Amphi Kjell Johnsen, 30-7-018 Meyrin Overview of the topics to be discussed Recognition of Merit – MARS Outcome of last exercise 2007 to 2013: lessons learned Survey: five-yearly review, give us your opinion General information CVI 2014 Voluntary programmes (PRP, SLS) Elections 2013 Renewal of the Staff Council 2014 - 2015
2013-09-09
... GENERAL SERVICES ADMINISTRATION [Notice-MK-2013-08; Docket No. 2013-0002; Sequence 27] The Presidential Commission on Election Administration (PCEA); Upcoming Public Advisory Meetings AGENCY: Office of Government-wide Policy, U.S. General Services Administration (GSA). ACTION: Meeting notice. SUMMARY: The...
Proceedings of the KNS 2016 Autumn Meeting
Energy Technology Data Exchange (ETDEWEB)
NONE
2016-10-15
This proceedings contains articles of 2016 autumn meeting of the Korean Nuclear Society. It was held on Oct. 26-28 in Kyungju, Korea. This proceedings is comprised of 11 sessions. The main subject titles of session are as follows: Reactor system technology, Reactor physics and computational science, Radioactive waste management, Nuclear fuel and materials, Thermal hydraulics and safety, Radiation utilization and protection, Quantum engineering and nuclear fusion, Nuclear power plant construction and operation technology, Nuclear policy, human resources and cooperation, Nuclear I and C, human factors and automatic remote systems, Competition Session. (Yi, J. H.)
Energy Technology Data Exchange (ETDEWEB)
Bogale, Nigussie, E-mail: nigussie.bogale@lyse.net [Stavanger University Hospital, Stavanger (Norway); Vancouver General Hospital, Vancouver, BC (Canada); Lempereur, Mathieu; Sheikh, Imran; Wood, David; Saw, Jacqueline; Fung, Anthony [Vancouver General Hospital, Vancouver, BC (Canada)
2016-03-15
Introduction: Coronary angiography is commonly performed following non-ST segment elevation myocardial infarction (NSTEMI) to assess the need for revascularization. Some of these patients have myocardial infarction (MI) with no obstructive coronary atherosclerosis (MINOCA). Patients without severe obstructive lesions are usually treated conservatively. However, coronary angiography has known limitations in the assessment of lesion severity. We report our experience of using coronary Optical Coherence Tomography (OCT) in a series of patients without severe obstructive coronary lesions. Methods: 165 patients underwent coronary OCT at Vancouver General Hospital. NSTEMI was the clinical presentation in 70 patients and 26 had angiographically intermediate lesions with 40%–69% diameter stenosis. Prior to OCT image acquisition, intracoronary nitroglycerin 100–200 μg was administered. Blood in the vessel was displaced using contrast media by manual injections. Results: OCT of the angiographically intermediate lesions showed larger minimal luminal area (MLA) than the angiographically severe lesions (MLA 3.3 mm{sup 2} ± 1.8 mm{sup 2} vs. 1.6 mm{sup 2} ± 0.6 mm{sup 2}, p < 0.001) and less severe % lumen area stenosis (54.2% ± 11.4% vs. 70.9% ± 6.8%, p = 0.001). Plaque rupture or intracoronary thrombus was detected in 8/26 (31%) patients. PCI with stent deployment was performed in 16 patients (62%). Conclusion: In stabilized patients with NSTEMI and angiographically intermediate disease, OCT examination confirmed the lack of severe anatomical stenosis in most patients. However, OCT also identified coronary lesions with unstable features. Further research is needed to help guide management of this subgroup of patients.
First IAEA research co-ordination meeting on 'Tritium inventory in fusion reactors'. Summary report
International Nuclear Information System (INIS)
Clark, R.E.H.
2003-02-01
The proceedings and conclusions of the first Research Co-ordination Meeting on 'Tritium Inventory in Fusion Reactors', held on November 4-6, 2002 at the IAEA Headquarters in Vienna are briefly described. This report includes a summary of the presentations made by the meeting participants and the specific goals set by the participants of the Co-ordinated Research Project (CRP). (author)
Investigation of the 26Mg(d, p)27Mg reaction
Meurders, F.; Steld, A. van der
1974-01-01
The angular distributions of 31 protons groups from the 26Mg(d, p)27Mg reaction have been measured at Ed = 12.0 MeV with a split-pole magnetic spectrograph. Excitation energies have been determined for 29 bound states. Three new levels have been found. A DWBA analysis yields ln values for 19 levels;
International Nuclear Information System (INIS)
Noy, Roberto Capote; Chung, Hyun Kyung; Bartschat, Klaus; Dong, Chenzhong; Jonsson, Per; Kibedi, Tibor; Kondev, Filip G.; Nikjoo, Hooshang; Palffy, Adriana
2013-11-01
A summary is given of a Consultants' Meeting on 'Auger Electron Emission Data Needs for Medical Applications'. Participants assessed and reviewed detailed atomic and nuclear data needs for a number of Auger emitters deemed as potentially suitable for applications in nuclear medicine and radiotherapy. Technical discussions are described in this report, along with recommendations for future work, along with recommendations for future work. Presentations by the consultants at the meeting are available at http://www-nds.iaea.org/index-meeting-crp/CM-Auger-2013/. (author)
15,17-Di-2-propenylcalix[4]arene-25,26,27,28-tetrol: self-complexation and C-H...O interactions
Harkema, Sybolt; van Loon, Jan-Dirk; van Loon, Jan-Dirk; Verboom, Willem; Reinhoudt, David
1998-01-01
The crystal structure of 15,17-di-2-propenylcalix[4]arene-25,26,27,28-tetrol [systematic name: 15,17-di-2-propenylpentacyclo[19.3.1.13,7.19,13.115,19]octacosa-1(25), 3,5,7(26),9,11,13 (27),15,17,19 (28),21,23-dodecaene-25,26,27,28-tetrol], C34H32O4, was determined. The calix[4]arene molecule shows a
International Nuclear Information System (INIS)
Humbert, D.; Wickham, A.J.
2006-05-01
The '8th Meeting of the Technical Steering Committee for the International Database on Irradiated Nuclear Graphite Properties' was held on 15-16 March 2006 at the IAEA Headquarters, Vienna, Austria. All discussions, recommendations and actions of this Consultants' Meeting are recorded in this report. The purposes of the meeting were to review the matters and actions identified in the previous meeting, undertake a review of the current status of the database and make recommendations for actions for the next year. This report contains the current status of the identified actions as well as a summary of the recommendations on enhancements to the database. (author)
Energy Technology Data Exchange (ETDEWEB)
NONE
1983-06-01
At its fourth Annual Meeting, the IAEA International Working Group on Water Reactor Fuel Performance and Technology (IWGFPT) recommended that the Agency should hold a second Specialists' Meeting on 'Power Ramping and Cycling Behaviour of Water Reactor Fuel'. As research activities related to power ramping and cycling of water reactor fuel have been pursued vigorously, it was the objective of this meeting to review and discuss today's State of the Art and current understanding of water reactor fuel behaviour related to this these. Emphasis should be on practical experience and experimental investigations. The meeting was organised in five sessions: Power ramping and power cycling programs in power and and research reactors; Experimental methods; Power ramping and cycling results; Investigations and results of separate effects, especially related to PCI, defect mechanism, mechanical response, fuel design, and specially related to fission gas release; Operational strategies, recommendations and economic implications. The session chairmen, together with the speakers, prepared and presented reports with summary, conclusions and recommendations of the individual sessions. These reports are added to this summary report.
International Nuclear Information System (INIS)
1983-06-01
At its fourth Annual Meeting, the IAEA International Working Group on Water Reactor Fuel Performance and Technology (IWGFPT) recommended that the Agency should hold a second Specialists' Meeting on 'Power Ramping and Cycling Behaviour of Water Reactor Fuel'. As research activities related to power ramping and cycling of water reactor fuel have been pursued vigorously, it was the objective of this meeting to review and discuss today's State of the Art and current understanding of water reactor fuel behaviour related to this these. Emphasis should be on practical experience and experimental investigations. The meeting was organised in five sessions: Power ramping and power cycling programs in power and and research reactors; Experimental methods; Power ramping and cycling results; Investigations and results of separate effects, especially related to PCI, defect mechanism, mechanical response, fuel design, and specially related to fission gas release; Operational strategies, recommendations and economic implications. The session chairmen, together with the speakers, prepared and presented reports with summary, conclusions and recommendations of the individual sessions. These reports are added to this summary report
26{sup th} Annual ESNA/IUR Meeting: Soil-Plant Relationships
Energy Technology Data Exchange (ETDEWEB)
Gerzabek, M H [ed.; Oesterreichisches Forschungszentrum Seibersdorf, 2444 Seibersdorf (Austria)
1996-11-01
The radioecological session of the 26{sup th} annual meeting of ESNA (in Busteni/Romania) is for INIS interesting. The session was a joint session with the soil-to-plant transfer working group of the IUR. (Botek)
Summary Report of the Technical Meeting on International Network of Nuclear Reaction Data Centres
International Nuclear Information System (INIS)
Otuka, Naohiko; Herman, Michal
2016-07-01
This report summarizes the IAEA Technical Meeting on the International Network of Nuclear Reaction Data Centres held at the China Hall of Science and Technology in Beijing, China from 7 to 10 June 2016. The meeting was attended by 23 participants representing 13 cooperative Centres from 8 Member States (China, Hungary, India, Japan, Korea, Russia, Ukraine and USA) and 2 International Organisations (NEA, IAEA) as well as two participants from Kazakhstan. A summary of the meeting is given in this report along with the conclusions and actions. (author)
International Nuclear Information System (INIS)
Kaeppeler, F.; Mengoni, A.
2008-09-01
The first Research Co-ordination Meeting of the MANREAD (Minor Actinides Neutron Reaction Data) was held at the IAEA Headquarters in Vienna from 19 to 23 November 2007. A summary of the discussion which took place at the meeting is reported here. In addition, a task assignment list of the experimental data assessment activities was agreed, and is provided together with the plan for future CRP activities. (author)
Directory of Open Access Journals (Sweden)
Geng Wang
2015-12-01
Full Text Available AIM: To investigate the difference of macular thickness measurements between stratus optical coherence tomography (OCT and Cirrus OCT (Carl Zeiss Meditec, Dublin, CA, USA in the same myopic patient and to develop a conversion equation to interchange macular thickness obtained with these two OCT devices. METHODS: Eighty-nine healthy Chinese adults with spherical equivalent (SE ranging from -1.13 D to -9.63 D were recruited. The macular thickness was measured by Cirrus OCT and Stratus OCT. The correlation between macular thickness and axial length and the agreement between two OCT measurements were evaluated. A formula was generated to interchange macular thickness obtained with two OCT devices. RESULTS: Average macular thickness measured with Stratus OCT (r=-0.280, P=0.008 and Cirrus OCT (r=-0.224, P=0.034 were found to be negatively correlated with axial length. No statistically significant correlation was found between axial length and central subfield macular thickness (CMT measured with Stratus OCT (r=0.191, P=0.073 and Cirrus OCT (r=0.169, P=0.113. The mean CMT measured with Cirrus OCT was 53.63±7.94 μm thicker than with Stratus OCT. The formula CMTCirrus OCT=78.328+0.874×CMTStratus OCT was generated to interchange macular thickness obtained with two OCT devices. CONCLUSION: Macular thickness measured with Cirrus OCT were thicker than with Stratus OCT in myopic eyes. A formula can be used to interchange macular thickness measured with two OCT devices in myopic eyes. Studies with different OCT devices and larger samples are warranted to enable the comparison of macular values measured with different OCT devices.
IRIS Bimonthly Public Meeting (Oct 2014)
The meeting was held to obtain input from the scientific community and the public on studies and data that will be used in the assessments of Diisononyl Phthalate (DINP) and Hexavalent Chromium (Cr(VI)) that are under IRIS development.
Davies, Will
2017-01-01
The Worldwide Innovative Networking (WIN) symposium brings together representatives from academic institutions, pharmaceutical partners, technology companies and charitable organisations from across the globe for an annual summit, discussing ongoing research and the latest developments in precision medicine. Now, in its seventh year, the aims of the WIN consortium's annual meeting, to foster communication and collaboration between members and deliver clinical trial results that improve the care and outcomes of patients are presented in open dialogue to encourage debate and discussion. This year, the meeting was held in Paris, France from 26-27 June and consisted of six plenary sessions, two debates, and poster presentations from attendees. In keeping with the consortium's goals, presentations and posters focused on the development and integration of new therapies and updates in genome-based medicine. Among the presentations at this year's meeting, much of the focus fell on design and implementation of new designs of clinical trials, moving away from decades-long assessments of thousands of patients towards a nimble, adaptive design fitting the edicts of personalised medicine and delving into greater depths within genomic data, ranging beyond genome analysis to chart new targets in ligandomics, proteogenomics and more.
International Nuclear Information System (INIS)
1975-10-01
The Specialists Meeting on Reliability of Decay Heat Removal Systems proposed for Fast Reactors was sponsored by the UKAEA Safety & Reliability Directorate and held at Harwell between 28th April and 1st May, 1975. The meeting was attended by delegates from six countries - (USA, Federal Republic of Germany, France, Japan, USSR and the UK). A list of participants is included in an Appendix to this report. The subject matter of the meeting was concerned with the degree to which the ability to maintain decay heat removal from a fast reactor after shutdown in normal and abnormal circumstances could be guaranteed by design provisions and substantiated by reliability analysis techniques, operational testing etc. Consideration of conditions prevailing after a hypothetical core melt down incident were not included in the subject matter. The deliberations of the meeting were focussed at each working session on a defined theme and its dependant topics as shown in the detailed Agenda included in this report. Although provision had been made in the Agenda for a limited amount of discussion of the decay heat rejection problems of Gas Cooled Fast Reactors, delegates had no contributions to offer on this subject. During each session a Recording Secretary prepared a summary of the main points made by national delegates and of the resulting recommendations and conclusions. These draft summaries were made available to delegates during subsequent sessions of the meeting and approved by them for inclusion in the Summary, General Conclusions and Recommendations provided under Table of Contents (item 3 and 4)
Directory of Open Access Journals (Sweden)
You Na Kim
2016-01-01
Full Text Available Purpose. To quantify whole lens and nuclear lens densities using anterior-segment optical coherence tomography (OCT with a liquid optics interface and evaluate their correlation with Lens Opacities Classification System III (LOCS III lens grading and corrected distance visual acuity (BCVA. Methods. OCT images of the whole lens and lens nucleus of eyes with age-related nuclear cataract were analyzed using ImageJ software. The lens grade and nuclear density were represented in pixel intensity units (PIU and correlations between PIU, BCVA, and LOCS III were assessed. Results. Forty-seven eyes were analyzed. The mean whole lens and lens nuclear densities were 26.99 ± 5.23 and 19.43 ± 6.15 PIU, respectively. A positive linear correlation was observed between lens opacities (R2 = 0.187, p<0.01 and nuclear density (R2 = 0.316, p<0.01 obtained from OCT images and LOCS III. Preoperative BCVA and LOCS III were also positively correlated (R2 = 0.454, p<0.01. Conclusions. Whole lens and lens nuclear densities obtained from OCT correlated with LOCS III. Nuclear density showed a higher positive correlation with LOCS III than whole lens density. OCT with a liquid optics interface is a potential quantitative method for lens grading and can aid in monitoring and managing age-related cataracts.
International Nuclear Information System (INIS)
Janev, R.K.
1999-05-01
Brief description of the proceedings, conclusions and recommendations of the 11th Meeting of the Subcommittee on Atomic, Molecular (A+M) and Plasma-Material Interaction (PMI) Data for Fusion of the IAEA International Fusion Research Council (IFRC), held on May 3-4, 1999, at the IAEA Headquarters in Vienna, Austria, is provided. The report includes also the Executive Summary from the meeting and is appended with the Report on Activities of IAEA A+M/PMI Data Unit for the period May 1998 - May 1999. (author)
Energy Technology Data Exchange (ETDEWEB)
Clark, R E.H. [International Atomic Energy Agency, Vienna (Austria)
2000-12-01
This report briefly describes the proceedings, conclusions and recommendations of the 12th Meeting of the Subcommittee on Atomic and Molecular Data for Fusion of the International Fusion Research Council held on May 8-9, 2000 at the IAEA Headquarters in Vienna Austria. The report includes the Executive Summary of the Subcommittee from this Meeting which was communicated to the IAEA Director General as well as the report on the activities of the IAEA Atomic and Molecular Data Unit for the period June 1999 - May 2000. (author)
Study of the 27Al(n,2,)26Al reaction via accelerator mass spectrometry
International Nuclear Information System (INIS)
Wallner, A.
2000-06-01
The excitation function for the 27 Al(n,2n) 26 Al reaction is expected to show a strongly non-linear behavior in the neutron-energy region around 14 MeV, the neutron energy in D-T plasmas; thus the production rate of 26 Al (t 1/2 =7.2*10 5 a) in D-T fusion environments can in principle be used to measure the temperature of such plasmas. Existing measurements, however, are strongly discordant. Therefore, a new accurate measurement of the 27 Al(n,2n) 26 Al cross sections in the near threshold region (E n =13.5-14.8 MeV) was performed with the goal to achieve relative cross sections with the highest accuracy possible. In addition, the measurements were also designed to provide good absolute cross-section values, as absolute cross sections are important for radioactive waste predictions. Samples of Al metal were irradiated with neutrons in the energy range near threshold (E th =13.55 MeV) at the Radiuminstitutes of both Vienna and St. Petersburg, and in Tokai-mura, Japan. In Tuebingen irradiations with neutrons of higher energies (17 and 19 MeV) were performed. The amount of 26 Al produced during the irradiations was measured via accelerator mass spectrometry (AMS) at the Vienna Environmental Research Accelerator (VERA). This work represents the first 26 Al measurements for this new facility. With this system, a background as low as 3*10 -15 for 26 Al/ 27 Al isotope ratios was obtained, corresponding to a (n,2n) cross section of 0.04 mb. Utilizing AMS, cross sections with much higher precision and considerably closer to the threshold than in previous investigations could be measured. The prerequisite for its application as a temperature monitor, namely a very well known shape of the excitation function was met. A quantitative prediction of the sensitivity of this method for monitoring the temperature in a D-T fusion plasma was therefore possible. For thermal plasmas temperature changes in the order of 5 to 15 % should be detectable. An even higher sensitivity was found
Materials Characterization Center meeting on impact testing of waste forms. Summary report
International Nuclear Information System (INIS)
Merz, M.D.; Atteridge, D.; Dudder, G.
1981-10-01
A meeting was held on March 25-26, 1981 to discuss impact test methods for waste form materials to be used in nuclear waste repositories. The purpose of the meeting was to obtain guidance for the Materials Characterization Center (MCC) in preparing the MCC-10 Impact Test Method to be approved by the Materials Review Board. The meeting focused on two essential aspects of the test method, namely the mechanical process, or impact, used to effect rapid fracture of a waste form and the analysis technique(s) used to characterize particulates generated by the impact
International Nuclear Information System (INIS)
1981-03-01
The Specialists' Meeting on ''Demonstration of Structural Integrity under Normal and Faulted Conditions'' was held at Chester, United Kingdom on 3-5 June 1980. The meeting was sponsored by the International Atomic Energy Agency (IAEA) on the recommendation of the International Working Group on Past Reactors (IWGFR). Twenty-one participants from France, the Federal Republic of Germany, Italy, Japan, the Netherlands, the United Kingdom, the United States of America and two international organizations, CEC and IAEA, attended. The purpose of the meeting was to review and discuss methods for assessing the integrity of the LMFBR safety-related structures during normal and abnormal operation, especially in the presence of defects, and to recommend future development. The technical sessions were divided into four topical sessions as follows: 1. National Review Presentations on Demonstration of Structural Integrity; 2. Material Properties; 3. Structural Analysis; 4. Design Approaches and Assessment Experience. During the meeting papers were presented by the participants on behalf of their countries or organizations. Each presentation was followed by an open discussion in the subject covered by the paper and subsequently, session summaries were drafted. After the formal sessions were completed, a final discussion session was held and general conclusions and recommendations were reached by consensus. Session summaries, general conclusions and recommendations, national review papers presented during the first session as well as the agenda of the meeting and the list of participants are given
The image of God (Gen. 1:26-27) in the Pentateuch : a biblical-theological approach / Daniel Simango
Simango, Daniel
2006-01-01
This dissertation focuses on how the theme of the image of God (Gen 1 :26-27) is seen and developed in the Pentateuch. The image of God in man (Gen 1 :26-27) has been interpreted in various ways. Predominant opinions have changed over time from the Early Jewish interpretation to the present period. Today there is a wider range of opinion regarding the image of God than ever. This dissertation follows a biblical-theological approach from a Reformed tradition of Genesis 1 :26-...
Phases of QCD: Summary of the Rutgers Long Range Plan Town Meeting, January 12-14, 2007
International Nuclear Information System (INIS)
Jacobs, Peter; Kharzeev, Dmitri; Muller, Berndt; Nagle, Jamie; Rajagopal, Krishna; Vigdor, Steve
2007-01-01
This White Paper summarizes the outcome of the Town Meeting on Phases of QCD that took place January 12-14, 2007 at Rutgers University, as part of the NSAC 2007 Long Range Planning process. The meeting was held in conjunction with the Town Meeting on Hadron Structure, including a full day of joint plenary sessions of the two meetings. Appendix A.1 contains the meeting agenda. This Executive Summary presents the prioritized recommendations that were determined at the meeting. Subsequent chapters present the essential background to the recommendations. While this White Paper is not a scholarly article and contains few references, it is intended to provide the non-expert reader
Phases of QCD: Summary of the Rutgers Long Range Plan Town Meeting, January 12-14, 2007
Energy Technology Data Exchange (ETDEWEB)
Jacobs, Peter; Kharzeev, Dmitri; Muller, Berndt; Nagle, Jamie; Rajagopal, Krishna; Vigdor, Steve
2007-05-14
This White Paper summarizes the outcome of the Town Meeting on Phases of QCD that took place January 12-14, 2007 at Rutgers University, as part of the NSAC 2007 Long Range Planning process. The meeting was held in conjunction with the Town Meeting on Hadron Structure, including a full day of joint plenary sessions of the two meetings. Appendix A.1 contains the meeting agenda. This Executive Summary presents the prioritized recommendations that were determined at the meeting. Subsequent chapters present the essential background to the recommendations. While this White Paper is not a scholarly article and contains few references, it is intended to provide the non-expert reader
Correction of rotational distortion for catheter-based en face OCT and OCT angiography
Ahsen, Osman O.; Lee, Hsiang-Chieh; Giacomelli, Michael G.; Wang, Zhao; Liang, Kaicheng; Tsai, Tsung-Han; Potsaid, Benjamin; Mashimo, Hiroshi; Fujimoto, James G.
2015-01-01
We demonstrate a computationally efficient method for correcting the nonuniform rotational distortion (NURD) in catheter-based imaging systems to improve endoscopic en face optical coherence tomography (OCT) and OCT angiography. The method performs nonrigid registration using fiducial markers on the catheter to correct rotational speed variations. Algorithm performance is investigated with an ultrahigh-speed endoscopic OCT system and micromotor catheter. Scan nonuniformity is quantitatively characterized, and artifacts from rotational speed variations are significantly reduced. Furthermore, we present endoscopic en face OCT and OCT angiography images of human gastrointestinal tract in vivo to demonstrate the image quality improvement using the correction algorithm. PMID:25361133
OCT for industrial applications
Song, Guiju; Harding, Kevin
2012-11-01
Optical coherence tomography (OCT), as an interferometric method, has been studied as a distance ranger. As a technology capable of producing high-resolution, depth-resolved images of biological tissue, OCT had been widely used for the application of ophthalmology and has been commercialized in the market today. Enlightened by the emerging research interest in biomedical domain, the applications of OCT in industrial inspection were rejuvenated by a few groups to explore its potential for characterizing new materials, imaging or inspecting industrial parts as a service solution[3]. Benefiting from novel photonics components and devices, the industrial application of the older concepts in OCT can be re-visited with respect to the unique performance and availability. Commercial OCT developers such as Michelson Diagnostics (MDL; Orpington, U.K.) and Thorlabs (Newton, NJ) are actively exploring the application of OCT to industrial applications and they have outlined meaningful path toward the metrology application in emerging industry[3]. In this chapter, we will introduce the fundamental concepts of OCT and discuss its current and potential industrial applications.
Phase-space database for external beam radiotherapy. Summary report of a consultants' meeting
International Nuclear Information System (INIS)
Capote, R.; Jeraj, R.; Ma, C.M.; Rogers, D.W.O.; Sanchez-Doblado, F.; Sempau, J.; Seuntjens, J.; Siebers, J.V.
2006-01-01
A summary is given of a Consultants' Meeting assembled to discuss and recommend actions and activities to prepare a Phase-space Database for External Beam Radiotherapy. The new database should serve to disseminate phase-space data of those accelerators and 60 Co units used in radiotherapy through the compilation of existing data that have been properly validated. Both the technical discussions and the resulting work plan are described, along with the detailed recommendations for implementation. The meeting was jointly organized by NAPC-Nuclear Data Section and NAHU-Dosimetry and Medical Radiation Physics Section. (author)
Villarreal, Jennifer
2014-01-01
The Visual Impairment/Intracranial Pressure (VIIP) Research and Clinical Advisory Panel convened on December 1, 2014 at the ISS Conference Facility in Houston. The panel members were provided updates to the current clinical cases and treatment plans along with the latest research activities (http://humanresearchroadmap.nasa.gov/Risks/?i=105) and preliminary study results. The following is a summary of this meeting.
Topics raised by the summary report of the first review meeting
International Nuclear Information System (INIS)
2001-01-01
This document presents the fulfilling of the Brazilian obligations under the Convention on Nuclear Safety. The Chapter 7 of the document contains topics raised by the summary report of the first review meeting. The chapter covers status and position of the regulatory body, collective doses, effluents release trends, adoption of the ICRP 60 and basic safety standards, regulatory strategy, quality assurance, monitoring safety management, international cooperation, probabilistic safety assessment and safety improvement programmes
International Nuclear Information System (INIS)
Vickridge, I.; Schwerer, O.
2006-01-01
A summary is given of the First Research Coordination Meeting on the Development of a Reference Database for Ion Beam Analysis, including background information, objectives, recommendations for measurements, and a list of tasks assigned to participants. The next research co-ordination meeting will be held in May 2007. (author)
ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ch_oct10_gene_aa_db Chro.60303 >1wicA 11 152 1 150 4e-26 ... gb|EAL37012.1| conserverd MSP-domain transme...mbrane protein [Cryptosporidium ... hominis] ... Length = 150 ... Query: 1 ... MSME...GAKLVRVHPEKALEFPLVLYSSVTTPLILENITSSTVAFKIKTTAPRGYLVRPSSG 60 ... MSMEGAKLVRVHPEKALEFPLVLYSSVTTPLIL...ENITSSTVAFKIKTTAPRGYLVRPSSG Sbjct: 1 ... MSMEGAKLVRVHPEKALEFPLVLYSSVTTPLILENITSSTVA
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Settlement. 962.26 Section 962.26 Postal Service... CIVIL REMEDIES ACT § 962.26 Settlement. (a) Either party may make offers of settlement or proposals of... settlement terms to the Attorney General, as appropriate. [59 FR 51860, Oct. 13, 1994] ...
76 FR 27744 - Eighty-Fifth Meeting: RTCA Special Committee 159: Global Positioning System (GPS)
2011-05-12
... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is... System (GPS). DATES: The meeting will be held May 26, 2011, from 9 a.m. to 11:45 a.m. ADDRESSES: The...
[OCT and neovascular glaucoma].
Bellotti, A; Labbé, A; Fayol, N; El Mahtoufi, A; Baudouin, C
2007-06-01
Neovascular glaucoma is a chronic and sight-threatening disease. Four different grades have been described. Anterior chamber optical coherence tomography (OCT) is a new imaging technique allowing the visualization of the anterior segment. The purpose of our study was to describe the appearance of the different neovascular glaucoma grades with the OCT in order to refine the clinical analysis of this disease. Eleven patients (nine men and two women) with different grades of neovascular glaucoma were analyzed in this study. Neovascular glaucoma complicated central retinal vein occlusion in seven patients and diabetic retinopathy in four patients. All patients had bilateral biomicroscopical examination and OCT analysis. OCT images and clinical examination were then compared. No modifications could be observed using OCT in patients with grade 1 neovascular glaucoma. For grade 2, a slightly hyper-reflective linear iris secondary to neovascularization was observed. For grade 3, OCT images showed a thickened hyper-reflective iridocorneal angle with possible iridocorneal synechiae. For grade 4, the iridocorneal angle was closed and associated with iris contraction and uveae ectropion. OCT is a new promising technique for the precise analysis of different grades of neovascular glaucoma. It certainly helps in the management of such cases.
77 FR 18271 - Notice of Sunshine Act Meeting
2012-03-27
... 26, April 2, 9, 16, 23, 30, 2012. PLACE: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of March 26, 2012 Tuesday, March 27, 2012 8:55 a.m... meeting will be webcast live at the Web address--www.nrc.gov. 9 a.m. Briefing on License Renewal for...
40 CFR 98.411 - Reporting threshold.
2010-07-01
...) MANDATORY GREENHOUSE GAS REPORTING Suppliers of Industrial Greenhouse Gases § 98.411 Reporting threshold. Any supplier of industrial greenhouse gases who meets the requirements of § 98.2(a)(4) must report GHG...
76 FR 45006 - Open Meeting of the Taxpayer Advocacy Panel Earned Income Tax Credit Project Committee
2011-07-27
... Earned Income Tax Credit Project Committee AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice of meeting. SUMMARY: An open meeting of the Taxpayer Advocacy Panel Earned Income Tax Credit... Panel Earned Income Tax Credit Project Committee will be held Monday, September 26, 2011, at 3 p.m...
The Fusion Evaluated Nuclear Data Library (FENDL). Summary Report of an IAEA Consultants’ Meeting
International Nuclear Information System (INIS)
Fleming, Michael; Trkov, Andrej
2016-08-01
The Consultants’ Meeting on the Fusion Evaluated Nuclear Data Library (FENDL) was held at the IAEA Headquarters in Vienna from 1 to 4 August 2016. A summary of the presentations, discussions, actions and strategies for the future library versions and distributions are provided in this report. (author)
75 FR 55406 - Open Meeting of the Taxpayer Advocacy Panel Earned Income Tax Credit Project Committee
2010-09-10
... Earned Income Tax Credit Project Committee AGENCY: Internal Revenue Service (IRS) Treasury. ACTION: Notice of meeting. SUMMARY: An open meeting of the Taxpayer Advocacy Panel Earned Income Tax Credit... Income Tax Credit Project Committee will be held Wednesday, October 27, 2010, at 1:00 p.m. Eastern Time...
Xue, Kang; Wang, Min; Chen, Junyi; Huang, Xin; Xu, Gezhi
2013-01-01
To measure the thickness of the retinal nerve fiber layer (RNFL) of patients with retinitis pigmentosa (RP) and that of normal controls by scanning laser polarimetry with enhanced corneal compensation (GDxECC) and RTVue-optical coherence tomography (OCT). Fifty-two eyes of 26 patients were included. All patients underwent complete ophthalmological examinations and testing with GDxECC. Twenty-eight of 52 eyes of RP patients underwent RTVue-OCT measurements. A group of 50 eyes of 25 normal subjects (controls) was also included. GDxECC measured RNFL thickness in the peripapillary area in all subjects as well as temporal-superior-nasal-inferior-temporal (TSNIT) parameters, including TSNIT means, superior and inferior region means, TSNIT standard deviation (SD), inter-eye symmetry and nerve fiber indicator (NFI). RTVue-OCT measured the mean, superior, inferior, temporal and nasal quadrant RNFL thickness. In RP patients and controls, TSNIT means by GDxECC were, respectively, 65.00 ± 7.35 and 55.32 ± 5.20. Mean superior quadrant thicknesses were 80.56 ± 10.93 and 69.54 ± 7.45. Mean inferior thicknesses were 80.58 ± 9.34 and 69.12 ± 7.78. SDs were 27.92 ± 5.21 and 28.23 ± 4.01. Inter-eye symmetries were 0.82 ± 0.17 and 0.87 ± 0.09. NFIs were 9.74 ± 8.73 and 16.81 ± 8.13. The differences between mean TSNIT, mean superior and mean inferior quadrant thicknesses and NFIs were statistically significant (p < 0.001). In RTVue-OCT measurements, the differences between mean, superior, inferior and temporal quadrant RNFL thicknesses were statistically significant (p = 0.0322, 0.0213, 0.0387, 0.0005). The RNFL measured by GDxECC was significantly thicker in RP patients than in controls. RNFL thickness measured by RTVue-OCT was significantly greater in RP patients than in controls in the superior, inferior and temporal regions. This contribution provides information on RNFL thickness and discusses the mechanism underlying this phenomenon. Copyright © 2012 S. Karger AG
Report on the IAEA technical meeting on network of nuclear reaction data centres
International Nuclear Information System (INIS)
Pronyaev, V.G.; Schwerer, O.; Nichols, A.L.
2002-08-01
An IAEA Technical Meeting on the Network of Nuclear Reaction Data Centres (and the biennial Data Centre Heads' Meeting) was held at the OECD Nuclear Energy Agency, Issy-les-Moulineaux (near Paris), France, from 27 to 30 May 2002. The meeting was attended by 21 participants from 12 co-operating data centres of six Member States and two international organizations. This report contains the meeting summary, conclusions and actions, status reports of the participating data centres, and working papers considered. (author)
International Working Group on Fast Reactors Sixth Annual Meeting. Summary Report
International Nuclear Information System (INIS)
1973-01-01
The Agenda of the Meeting was as follows: 1. Review of IWGFR Activities - 1a. Approval of the minutes of the Fifth IWGFR Meeting. 1b. Report by Scientific Secretary regarding the activities of the Group. 2. Comments on National Programmes on Fast Breeder Reactors. 3. International Coordination of the Schedule for Major Fast Reactor Meetings and other major international meetings having a predominant fast reactor interest. 4. Consideration of Conferences on Fast Reactors. 4a. IAEA Symposium on Fuel and Fuel Elements for Fast Reactors, Brussels, Belgium 2-6 July 1973. 4b. International Symposium on Physics of Fast Reactors, Tokyo, Japan, 16 to 23 October 1973. 4c. International Conference on Fast Reactor Power Stations, London, UK, 11 to 14 March 1974 . 4d. Suggestions of the IWGFR members on other conferences. 5. Consideration of a Schedule for Specialists' Meetings in 1973-74. 6. Other Business - 6a. First-aid in Sodium Burns. 6b. Principles of Good Practice for Safe Operation of Sodium Circuits. 6c. Bibliography on Fast Reactors. 7. The Date and Place of the Seventh Annual Meeting of the IWGFR
Directory of Open Access Journals (Sweden)
Hiroshi Kunikata
2015-07-01
Full Text Available Objective: To report intraoperative optical coherence tomography (iOCT-assisted 27-gauge microincision vitrectomy surgery (MIVS in eyes with vitreoretinal disease. Methods: A retrospective, interventional case series performed at a single center, including 6 eyes with retinal disease that underwent iOCT-assisted 27-gauge MIVS. Results: The advantages of iOCT were most notable when it was used to evaluate, in real time, different macular areas: the pre-macula, in vitreomacular traction or epiretinal membrane; the intra-macula, in macular edema or macular hole; and the sub-macula, in macular detachment. Real-time imaging and the minimization of shadows cast on the underlying tissues by the 27-gauge instrumentation made it possible to quickly select the best procedure at each critical juncture of the surgery. No patients experienced any complications. Conclusion: Real-time iOCT imaging during 27-gauge MIVS provided excellent intraoperative visualization of retinal tissues without causing significant obstructions to the surgeon. The positive feedback from the system allowed the surgeon to better judge the necessity of additional surgical procedures.
117th Annual Meeting, Medical Library Association, Inc., Seattle, WA, May 26–31, 2017
Directory of Open Access Journals (Sweden)
Nicole Mitchell
2018-01-01
Full Text Available The Medical Library Association (MLA held its 117th annual meeting in Seattle, Washington, May 26–31, 2017, at the Washington State Convention Center. The meeting theme was “Dream, Dare, Do.”
75 FR 54221 - Government/Industry Aeronautical Charting Forum Meeting
2010-09-03
... Aeronautical Navigation Services (AeroNav Services) Group, Regulatory Support and Coordination Team, AJW-372...: The ACF is separated into two distinct groups. The Instrument Procedures Group (IPG) will meet October 26, 2010 from 8:30 a.m. to 5 p.m. The Charting Group will meet October 27 and 28, 2010 from 8:30 a.m...
76 FR 12211 - Government/Industry Aeronautical Charting Forum Meeting
2011-03-04
... Aeronautical Navigation Products Group (AeroNav Products), Regulatory Support and Coordination Team, AJV-3B...: The ACF is separated into two distinct groups. The Instrument Procedures Group (IPG) will meet April 26, 2011 from 8:30 a.m. to 5 p.m. The Charting Group will meet April 27 and 28, 2011 from 8:30 a.m...
RRDF-98. Russian reactor dosimetry file. Summary documentation
International Nuclear Information System (INIS)
Pashchenko, A.B.
1999-01-01
This document summarizes the contents and documentation of the new version of tile Russian Reactor Dosimetry File (RRDF-98) released in December 1998 by the Russian Center on Nuclear Data (CJD) at the Institute of Physics and Power Engineering, Russian Federation. This file contains the original evaluations of cross section data and covariance matrixes for 22 reactions which are used for neutron flux dosimetry by foil activation. The majority of the evaluations included in previous versions of the Russian Reactor Dosimetry Files (BOSPOR-80, RRGF-94 and RRDF-96) have been superseded by new evaluations. The evaluated cross sections of RRDF-98 averaged over 252-Cf and 235-U fission spectra are compared with relevant integral data. The data file is available from the IAEA Nuclear Data Section on diskette, cost free. (author)
VISIT OF HUNGARIAN FIRMS AT CERN 26 - 27 MARCH 2002
C.L. Jullien-Woringer
2002-01-01
26 March: The companies will contact directly potential users interested in their products. 27 March: 09h00 to 17h30 The firms will be in the Main Building - Pas Perdus List of Companies: EGI Contracting Engineering Co. Ltd. SILEX Industrial Automation Ltd. CAT-SCIENCE Bt. MTA ITA LAI Cerntech Ltd. Meditor Ltd. Euronet Rt. Detailed information on the companies is also available on the Web. For further information please contact Mrs C.L. Jullien-Woringer (tel. 73722-76360).
77 FR 1779 - Meeting and Webinar on Integrated Dynamic Transit Operations; Notice of Public Meeting
2012-01-11
... of Public Meeting AGENCY: Research and Innovative Technology Administration, U.S. Department of... on concepts, opportunities, and needs for the Integrated Dynamic Transit Operations (IDTO) operational concept on January 26, 2012 from 1:30-4:30 p.m. and January 27, 2012 from 8:30 a.m. to 12:30 p.m...
International Nuclear Information System (INIS)
Clark, R.E.H.; Peacock, N.J.
2006-01-01
The 14th Meeting of the Subcommittee on Atomic and Molecular Data for Fusion of the International Fusion Research Council was held on 24-25 June 2004, at the IAEA Headquarters in Vienna, Austria. Subcommittee members reviewed the work of the Atomic and Molecular Data Unit over the two-year period from June 2002 to June 2004, and made recommendations that covered the 2005-2006 budget cycle. The proceedings, conclusions and recommendations of the meeting are briefly described in this report, along with a short summary of the activities of the IAEA Atomic and Molecular Data Unit of the Nuclear Data Section from June 2002 to June 2004. (author)
Specialists' meeting on theoretical modelling of LMFBR fuel pin behaviour. Summary report
Energy Technology Data Exchange (ETDEWEB)
NONE
1979-12-01
The purpose of the meeting was to provide an opportunity for exchanging views of theoretical modelling of LMFBR fuel pin behaviour and to summarise the IWGFR member countries' knowledge in this field. The special emphasis was placed on normal operating conditions. The technical part of the meeting was divided into six sessions, as follows: An overview of fuel modelling studies; Key factors and basic phenomena relevant to fuel pin behaviour modelling; Application to steady state operation and normal transients; Experimental validation through pins in service and specific irradiation experiments; Advanced fuels; and Brief review of existing codes. During the meeting, papers were presented by the delegates on behalf of their countries or organization. The papers, which are included in this report, were either in the form of a general survey of the subject, or on specific technical subjects. In each subject area presentations appropriate to the subject were made from the submitted papers. The presentations were followed by discussions of the questions raised and summary is made.
Specialists' meeting on theoretical modelling of LMFBR fuel pin behaviour. Summary report
International Nuclear Information System (INIS)
1979-12-01
The purpose of the meeting was to provide an opportunity for exchanging views of theoretical modelling of LMFBR fuel pin behaviour and to summarise the IWGFR member countries' knowledge in this field. The special emphasis was placed on normal operating conditions. The technical part of the meeting was divided into six sessions, as follows: An overview of fuel modelling studies; Key factors and basic phenomena relevant to fuel pin behaviour modelling; Application to steady state operation and normal transients; Experimental validation through pins in service and specific irradiation experiments; Advanced fuels; and Brief review of existing codes. During the meeting, papers were presented by the delegates on behalf of their countries or organization. The papers, which are included in this report, were either in the form of a general survey of the subject, or on specific technical subjects. In each subject area presentations appropriate to the subject were made from the submitted papers. The presentations were followed by discussions of the questions raised and summary is made
African Journals Online (AJOL)
chifaou.amzat
2011-10-19
Oct 19, 2011 ... rural hometowns, where they unite with their rural-based colleagues for ... extent have they empowered the women-folk in the public sphere? ...... It would be safe, therefore, for one to conceptualise the 'August Meeting'.
The orphan nuclear receptor GCNF recruits DNA methyltransferase for Oct-3/4 silencing
International Nuclear Information System (INIS)
Sato, Noriko; Kondo, Mitsumasa; Arai, Ken-ichi
2006-01-01
Somatic DNA methylation patterns are determined in part by the de novo methylation that occurs after early embryonic demethylation. Oct-3/4, a pluripotency gene, is unmethylated in the blastocyst, but undergoes de novo methylation and silencing during gastrulation. Here we show that the transcriptional repressor GCNF recruits DNA methyltransferase to the Oct-3/4 promoter and facilitates its methylation. Although acetylation of histone H3 at lysine 9 (K9) and/or 14 (K14) and methylation of H3 at lysine 4 (K4) decrease during this period, as do Oct-3/4 transcript levels, H3K9 and H3K27 methylation levels remain constant, indicating that DNA methylation does not require repressive histone modifications. We found that GCNF interacts directly with Dnmt3 molecule(s) and verified that this interaction induces the methylation of the Oct-3/4 promoter. Our finding suggests a model in which differentiation-induced GCNF recruits de novo DNA methyltransferase and facilitates the silencing of a pluripotency gene
RRDF-98. Russian reactor dosimetry file. Summary documentation
Energy Technology Data Exchange (ETDEWEB)
Pashchenko, A B
1999-03-01
This document summarizes the contents and documentation of the new version of tile Russian Reactor Dosimetry File (RRDF-98) released in December 1998 by the Russian Center on Nuclear Data (CJD) at the Institute of Physics and Power Engineering, Russian Federation. This file contains the original evaluations of cross section data and covariance matrixes for 22 reactions which are used for neutron flux dosimetry by foil activation. The majority of the evaluations included in previous versions of the Russian Reactor Dosimetry Files (BOSPOR-80, RRGF-94 and RRDF-96) have been superseded by new evaluations. The evaluated cross sections of RRDF-98 averaged over 252-Cf and 235-U fission spectra are compared with relevant integral data. The data file is available from the IAEA Nuclear Data Section on diskette, cost free. (author) 9 refs, 22 figs, 2 tabs
Eleventh annual meeting, Bologna, Italy, 17-20 April 1978. Summary report. Part II
Energy Technology Data Exchange (ETDEWEB)
NONE
1978-07-01
The Summary Report - Part II of the Eleventh Annual Meeting of the IAEA International Working Group on Fast Reactors - includes reports on development of fast reactors in France from 1977 to 1978; review of the activities related to fast reactors in Germany; status of fast breeder reactors development in Belgium and Netherlands; status of activities related to fast reactors in USSR, Japan USA, UK and Italy.
Eleventh annual meeting, Bologna, Italy, 17-20 April 1978. Summary report. Part II
International Nuclear Information System (INIS)
1978-07-01
The Summary Report - Part II of the Eleventh Annual Meeting of the IAEA International Working Group on Fast Reactors - includes reports on development of fast reactors in France from 1977 to 1978; review of the activities related to fast reactors in Germany; status of fast breeder reactors development in Belgium and Netherlands; status of activities related to fast reactors in USSR, Japan USA, UK and Italy
International Nuclear Information System (INIS)
Gunsing, F.; Schillebeeckx, P.; Semkova, V.
2013-12-01
The Consultants' Meeting 'EXFOR Data in Resonance Region and Spectrometer Response Function' was held at the IAEA Headquarters in Vienna from 8 to 10 October 2013. A summary of the presentations and discussions that took place during the meeting is reported here. The participants have agreed on recommendations on data reporting for EXFOR and on the need of documenting spectrometer response functions. Recommendations are given for experimentalists, for compilers, and for evaluators. (author)
American Academy of Ophthalmology
... location. Phaco at 50: The Challenge of Innovation Charles D. Kelman, MD, introduced phacoemulsification for cataract surgery ... Oct. 27 – 30 for AAO 2018. Subspecialty Day will take place Oct. 26 and 27. In response ...
Schütze, Christopher; Teleky, Katharina; Baumann, Bernhard; Pircher, Michael; Götzinger, Erich; Hitzenberger, Christoph K; Schmidt-Erfurth, Ursula
2016-03-01
To examine the reproducibility of lesion dimensions of the retinal pigment epithelium (RPE) in neovascular age-related macular degeneration (AMD) with polarisation-sensitive optical coherence tomography (PS-OCT), specifically imaging the RPE. Twenty-six patients (28 eyes) with neovascular AMD were included in this study, and examined by a PS-OCT prototype. Each patient was scanned five times at a 1-day visit. The PS-OCT B-scan located closest to the macular centre presenting with RPE atrophy was identified, and the longitudinal diameter of the lesion was quantified manually using AutoCAD 2008. This procedure was followed for the identical B-scan position in all five scans per eye and patient. Reproducibility of qualitative changes in PS-OCT was evaluated. Interobserver variability was assessed. Results were compared with intensity-based spectral-domain OCT (SD-OCT) imaging. Mean variability of all atrophy lesion dimensions was 0.10 mm (SD±=0.06 mm). Coefficient of variation (SD±/mean) was 0.06 on average (SD±=0.03). Interobserver variability assessment showed a mean difference of 0.02 mm across all patients regarding RPE lesion size evaluation (paired t test: p=0.38). Spearman correlation coefficient was r=0.98, p<0.001. Results revealed a good overall reproducibility of ∼90%. PS-OCT specifically detected the RPE in all eyes compared with conventional intensity-based SD-OCT that was not capable to clearly identify RPE atrophy in 25 eyes (89.3%, p<0.01). PS-OCT offers good reproducibility of RPE atrophy assessment in neovascular AMD, and may be suitable for precise RPE evaluation in clinical practice. PS-OCT unambiguously identifies RPE changes in choroidal neovascularisation compared with intensity-based SD-OCT that does not identify the RPE status reliably. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Standing Concertation Commmittee - Ordinary meeting on 27 March 2007
HR Department
2007-01-01
The main items discussed at the meeting of the Standing Concertation Committee on 27 March 2007 included: Merit Recognition Guidelines In the context of the new Merit Appraisal and Recognition Scheme (MARS), the committee took note of the documents entitled 'MARS Guidelines 2007' and the 'Guidelines for Senior Staff Advancement 2007'. Follow-up of Finance Committee and Council meetings The Committee took note of the information provided by S. Lettow, the Director for Finance and Human Resources, including the possibility for a phased increase in Member State contributions from 2008. Registered partnerships It was agreed that staff members with registered partners should be reminded of the social cover available to their partners. Cover is limited to the CERN Health Insurance Scheme and partners may be covered by the Scheme only while the staff member is working. On the staff member's retirement or other change in status, or death, partners are no longer eligible for CHIS cover. Retirement semi...
Standing Concertation Commmittee - Ordinary meeting on 27 March 2007
HR Department
2007-01-01
The main items discussed at the meeting of the Standing Concertation Committee on 27 March 2007 included: Merit Recognition Guidelines : in the context of the new Merit Appraisal and Recognition Scheme (MARS), the committee took note of the documents entitled MARS Guidelines 2007 and the Guidelines for Senior Staff Advancement 2007. Follow-up of Finance Committee and Council meetings The Committee took note of the information provided by S. Lettow, the Director for Finance and Human Resources, including the possibility for a phased increase in Member State contributions from 2008. Registered partnerships It was agreed that staff members with registered partners should be reminded of the social cover available to their partners. Cover is limited to the CERN Health Insurance Scheme and partners may be covered by the Scheme only while the staff member is working. On the staff members retirement or other change in status, or death, partners are no longer eligible for CHIS cover. Retirement seminars It...
Phase sensitive multichannel OCT
International Nuclear Information System (INIS)
Trasischker, W.
2015-01-01
The main aim of this thesis was to develop and improve phase sensitive, multichannel methods for optical coherence tomography (OCT) using light in the 840 nm and 1040 nm regime. Conventional OCT provides purely structural information by illuminating the sample by one beam and recording the backscattered signal with one detection channel. Combination of this approach with a raster scan enables the acquisition of 2D and 3D structural information with a resolution in the micrometer regime. However, sometimes additional image contrast or information is desired. Amongst other approaches, this can be provided by a phase sensitive analysis of the interference pattern. Combining phase sensitivity with the illumination of the sample by more than one beam and/or by recording the data using more than one data acquisition channel allows for even more enhanced imaging. While phase sensitive OCT gives access to additional contrast and information, multichannel OCT can provide higher imaging speed, scan eld size and exible dierential measurements. Amongst the dierential, phase sensitive approaches, Doppler OCT (DOCT) and polarization sensitive OCT (PS-OCT) are two of the most promising OCT modalities. While the former targets information on the movement of backscattering particles, the latter measures alterations of the polarization state of the light induced by the sample. Both techniques provide additional image contrast and are, due to the non-invasive and fast character of OCT, well suited for in vivo imaging of the human eye. In the course of this thesis, two dierent multichannel, phase sensitive OCT systems will be presented. First, a D-OCT system with three dierent sampling beams is described. With a central wavelength of 840 nm these three beams are emitted by three individual laser sources. This eectively eliminates any cross talk and provides the full depth range for each channel. Furthermore, by illuminating the sample from three dierent directions, the absolute
Eighth ITER technical meeting on safety and environment
International Nuclear Information System (INIS)
Gordon, C.; Raeder, J.
2000-01-01
From November 27 to 30, 2000 the Eighth ITER Technical Meeting on Safety and Environment was held by the ITER Joint Central Team (JCT) at the Garching Joint Work Site, which also hosts the ITER Safety, Environment and Health Group (SEHG). At this meeting, safety experts from the Home Teams (HT) worked together with the SEHG members towards the following main objectives: review of Generic Site Safety Report (GSSR) results and drafts; review of the Plant Design Description (PDD) summary of safety; update on the status of the R and D tasks contributing to GSSR
Summary Record of the Sixth Meeting of Records, Knowledge and Memory (RK and M) Across Generations
International Nuclear Information System (INIS)
2014-01-01
Preservation of Records, Knowledge and Memory (RK and M) across Generations is an initiative under the RWMC in the area of knowledge consolidation and transfer. Disposal in engineered facilities built in stable, deep geological formations is the reference means for permanently isolating long-lived radioactive waste from the biosphere. However, there is no intention to forgo, at any time, knowledge and awareness either of the repository or of the waste that it contains. The cultural dimension of preserving RK and M is an important subject. Overall, long-term preservation of RK and M is a multidisciplinary work area in which much learning is expected over the coming years. This is the task of the RWMC's RK and M initiative. A major outcome will be a menu-driven document that - the RK and M Wiki - that will allow people to identify the elements of a strategic action plan for RK and M preservation. This document is a summary record of the Sixth Meeting of Records, Knowledge and Memory (RK and M) Across Generations. The summary is made of 8 items: 1 - Introduction (C. Pescatore): Welcome and opening remarks, Review and adoption of the agenda, Aim of this meeting, Status report, Report from RepMet meeting; 2 - Finalising Phase-II: Updating the Set of Essential Records (SER) proposal (C. Mays), Updates to the Bibliography (A. Claudel), Additions to the Glossary (S. Hotzel); 3 - Internal Wiki Workshop: The RK and M Wiki (P. Maupai), Updating your own country, organisation and regulatory requirement page, General discussion on the wiki; 4 - Strategic Articles: Presentation on Tsunami Stones paper (R. Botez); 5 - Constructing Memory: Verdun 2014 Conference; 6 - Phase-II: Discussion and final approval of Phase-II Proposal (C. Pescatore), Proposal for RWMC collective statement - Flyer on guiding principles, Calendar; 7 - Additional aspects; 8 - Review of Decisions and Closure of the Meeting, Summary of Decision and actions
Specialists' meeting on maintenance and repair of LMFBR steam generators. Summary report
International Nuclear Information System (INIS)
2002-01-01
The purpose of the meeting was to review and discuss the experience accumulated in various countries on the general design philosophy of LMFBR steam generators from the view point of maintenance and repair, in-service inspection of steam generator tube bundles, identification and inspection of failed tubes and the cleaning and repairing of failed steam generators. The following main topic areas were discussed by participants: National review presentations on maintenance and repair of LMFBR steam generators - design philosophy for maintenance and repair; Research and Development work on maintenance and repair; Experience on steam generator maintenance and repair. During the meeting papers were presented by the participants on behalf of their countries and organizations. A final discussion session was held and summaries, general conclusions and recommendations were approved by consensus
International Nuclear Information System (INIS)
1989-12-01
The Eighth Meeting of the IAEA International Working Group on Gas-Cooled Reactors was held in Vienna, Austria, from 30 January - 1 February, 1989. The Summary Report (Part I) contains the Minutes of the Meeting
Energy Technology Data Exchange (ETDEWEB)
Janev, R K
1988-09-01
The Summary Report of the IAEA Consultants` Meeting on the ``Atomic Data Base and Fusion Applications Interface`` held at the IAEA Headquarters in Vienna on May 9-13, 1988, is provided. The Report contains a brief review of the meeting proceedings, and the reports of the Working Groups on the A and M dictionary (labelling/indexing system) and on the data storage and exchange system. The conclusions and recommendations of the meeting are also summarized. (author). Figs and tabs.
International Nuclear Information System (INIS)
Oblozinsky, P.
1996-12-01
The present report contains the summary of the Second Research Co-ordination Meeting on ''Measurement, Calculation and Evaluation of Photon Production Data'', held in Vienna, Austria, from 21 to 24 May 1996. Summarized are conclusions and recommendations of the meeting together with a detailed list of actions and deadlines, including procedures to prepare the final document of the project. Attached is the agenda of the meeting, list of participants and extended abstracts of their presentations. (author). Refs, figs, tabs
Energy Technology Data Exchange (ETDEWEB)
2012-02-01
This report summarizes key findings and outcomes from the U.S. Department of Energy's Building America Residential Energy Efficiency Research Planning meeting, held on October 28-29, 2011, in Washington, D.C.
International Nuclear Information System (INIS)
Sublet, J.-Ch.; Capote Noy, R.
2006-08-01
A summary is given of the Third Research Coordination Meeting on Nuclear Data for the Production of Therapeutic Radionuclides. The new library of evaluated cross-section will cover reactor and accelerator production of therapeutic radionuclides to appropriate specific activities and purity, along with the relevant decay data. A few new reactions were added at this meeting. Technical discussions and the resulting work plan to conclude the data evaluation activities are summarized for every reaction path. Timescales and agreed actions to deliver the database and Technical Report are also given. (author)
Sadda, Srinivas R; Guymer, Robyn; Holz, Frank G; Schmitz-Valckenberg, Steffen; Curcio, Christine A; Bird, Alan C; Blodi, Barbara A; Bottoni, Ferdinando; Chakravarthy, Usha; Chew, Emily Y; Csaky, Karl; Danis, Ronald P; Fleckenstein, Monika; Freund, K Bailey; Grunwald, Juan; Hoyng, Carel B; Jaffe, Glenn J; Liakopoulos, Sandra; Monés, Jordi M; Pauleikhoff, Daniel; Rosenfeld, Philip J; Sarraf, David; Spaide, Richard F; Tadayoni, Ramin; Tufail, Adnan; Wolf, Sebastian; Staurenghi, Giovanni
2018-04-01
To develop consensus terminology and criteria for defining atrophy based on OCT findings in the setting of age-related macular degeneration (AMD). Consensus meeting. Panel of retina specialists, image reading center experts, retinal histologists, and optics engineers. As part of the Classification of Atrophy Meetings (CAM) program, an international group of experts surveyed the existing literature, performed a masked analysis of longitudinal multimodal imaging for a series of eyes with AMD, and reviewed the results of this analysis to define areas of agreement and disagreement. Through consensus discussions at 3 meetings over 12 months, a classification system based on OCT was proposed for atrophy secondary to AMD. Specific criteria were defined to establish the presence of atrophy. A consensus classification system for atrophy and OCT-based criteria to identify atrophy. OCT was proposed as the reference standard or base imaging method to diagnose and stage atrophy. Other methods, including fundus autofluorescence, near-infrared reflectance, and color imaging, provided complementary and confirmatory information. Recognizing that photoreceptor atrophy can occur without retinal pigment epithelium (RPE) atrophy and that atrophy can undergo an evolution of different stages, 4 terms and histologic candidates were proposed: complete RPE and outer retinal atrophy (cRORA), incomplete RPE and outer retinal atrophy, complete outer retinal atrophy, and incomplete outer retinal atrophy. Specific OCT criteria to diagnose cRORA were proposed: (1) a region of hypertransmission of at least 250 μm in diameter, (2) a zone of attenuation or disruption of the RPE of at least 250 μm in diameter, (3) evidence of overlying photoreceptor degeneration, and (4) absence of scrolled RPE or other signs of an RPE tear. A classification system and criteria for OCT-defined atrophy in the setting of AMD has been proposed based on an international consensus. This classification is a more complete
CERN Technical Training 2006: Introduction à Dreamweaver MX (26-27 juillet 2006)
2006-01-01
CERN Enseignement technique 2006: Introduction à Dreamweaver MX (26-27 juillet 2006) Learning for the LHC! Une nouvelle session du cours pratique Introduction à Dreamweaver MX est proposée à l'ensemble du personnel par le service de l'Enseignement technique. Cette session aura lieu en français mercredi 26 et jeudi 27 juillet 2006. Objectifs: Maîtriser les différentes fonctions de base de Dreamweaver MX pour créer et gérer des pages ou des sites web. Programme: L'interface Dreamweaver MX. Images, couleurs et fonds. Ajouter des liens. Présenter des données en tables. Utiliser les tables pour la mise en page. L'Interface mise en page. L'image réactive. Les tags META et les moteurs de recherche. Les formulaires. Les éléments dynamiques. Boutons dynamiques. Boutons flash et texte. La barre de navigation. Les styles HTML. Feuilles de style. Positionnement par couches. Gestion du site. Révision générale et évaluation. Durée: 2 jours. Coût estimé: entre 750.- et 350.- CHF par personne, se...
Energy Technology Data Exchange (ETDEWEB)
NONE
1977-01-01
The papers presented at the LMFBR meeting on aerosol formation covered the following four main topics: theoretical studies on aerosol behaviour and comparison with experimental results; techniques for measurement of aerosols; techniques for trapping sodium vapour and aerosols in gas circuits; design of components having to cope with aerosol deposits. The resulting summaries, conclusions and recommendations which were were agreed upon are presented.
International Nuclear Information System (INIS)
1977-01-01
The papers presented at the LMFBR meeting on aerosol formation covered the following four main topics: theoretical studies on aerosol behaviour and comparison with experimental results; techniques for measurement of aerosols; techniques for trapping sodium vapour and aerosols in gas circuits; design of components having to cope with aerosol deposits. The resulting summaries, conclusions and recommendations which were were agreed upon are presented
Pérez-Merino, Pablo; Ortiz, Sergio; Alejandre, Nicolas; Jiménez-Alfaro, Ignacio; Marcos, Susana
2013-09-09
To characterize the geometrical properties of keratoconic corneas upon intracorneal ring segments (ICRS) implantation, using custom-developed optical coherence tomography (OCT). Ten keratoconic corneas were measured pre- and post-ICRS surgery (7, 30, and 90 days). Corneal topographic and pachymetric maps were obtained from three-dimensional (3D) images acquired with OCT, provided with custom algorithms for image analysis, distortion correction, and quantification. The 3D positioning of the ICRS was also estimated longitudinally, relative to the pupil center and iris plane. Preoperatively, the average corneal radii of curvature were 7.02 ± 0.54 mm (anterior) and 5.40 ± 0.77 mm (posterior), and the minimum corneal thickness was 384 ± 60 μm. At 90 days, the average corneal radii of curvature were 7.26 ± 0.53 mm (anterior) and 5.44 ± 0.71 mm (posterior), and the minimum corneal thickness was 396 ± 46 μm. ICRS implantation produced a significant decrease of corneal power (by 1.71 ± 1.83 diopters [D] at 90 days). Corneal irregularities (defined by high order Zernike terms of the corneal elevation maps) and the corneal thickness distribution decreased in some patients and increased in others. The 3D ICRS depth matched the planned ICRS depth well (within 23.93 ± 23.49 μm). On average, ICRS showed an overall tilt of -6.8 ± 2.6° (temporal) and -2.1 ± 0.8° (superior) at 7 days. Spectral OCT (sOCT) provided with distortion correction and analysis tools, is an excellent instrument for evaluating the changes produced by ICRS in keratoconic corneas, and for analyzing the 3D ICRS position during the follow up. ICRS produced flattening on the anterior corneal surface, although the benefit for corneal surface regularization varied across patients.
International Nuclear Information System (INIS)
Trkov, A.; Forrest, R.; Mengoni, A.
2009-03-01
The first Research Co-ordination Meeting of the Nuclear Data Libraries for Advance Systems - Fusion Devices (FENDL - 3) was held at the IAEA Headquarters in Vienna from 2 to 5 December 2008. A summary of the meeting is given in this report along with discussions which took place. An important outcome of the meeting was the agreement to create a new FENDL-3.0 Starter Library. Finally, a list of task assignments was prepared together with the plan for future CRP activities. (author)
Indian Academy of Sciences (India)
1994-10-01
Oct 1, 1994 ... Science, Bangalore, the Diamond Jubilee Annual. Meeting will be held in ... "The fascination of statistics" .... on post Hartree-Fock methods, highly correlated systems ..... Gold Medal of the National Institute of Social. Sciences ...
Structure of 26Al studied by one - nucleon transfer reaction 27Al(d,t
Directory of Open Access Journals (Sweden)
Srivastava Vishal
2015-01-01
Full Text Available The excited states of 26Al have been produced and studied using 27Al(d,t reaction with 25 MeV deuteron as projectile. Optical model potential parameters were extracted from the measured elastic scattering angular distribution. Zero range distorted wave Born approximation analysis for the ground and 0.223 MeV states of 26Al have been done. The spectroscopic factors calculated for these states are found to be in good agreement with the previously reported values.
Statistical model for OCT image denoising
Li, Muxingzi
2017-08-01
Optical coherence tomography (OCT) is a non-invasive technique with a large array of applications in clinical imaging and biological tissue visualization. However, the presence of speckle noise affects the analysis of OCT images and their diagnostic utility. In this article, we introduce a new OCT denoising algorithm. The proposed method is founded on a numerical optimization framework based on maximum-a-posteriori estimate of the noise-free OCT image. It combines a novel speckle noise model, derived from local statistics of empirical spectral domain OCT (SD-OCT) data, with a Huber variant of total variation regularization for edge preservation. The proposed approach exhibits satisfying results in terms of speckle noise reduction as well as edge preservation, at reduced computational cost.
International Nuclear Information System (INIS)
Janev, R.K.; Federici, G.; Roth, J.
1999-07-01
The proceedings, conclusions and recommendations of the IAEA Advisory Group Meeting on 'Critical Assessment of Tritium Retention in Fusion Reactor Materials', held on June 7-8, 1999 at the IAEA Headquarters in Vienna, Austria, are briefly described. The report contains a summary of the presentations of meeting participants, a review of the data status (availability and needs) for the fusion most relevant bulk and mixed materials, and recommendations to the IAEA regarding its future activity in this data area. (author)
Summary of meeting on disposal of LET ampersand D HEPA filters
International Nuclear Information System (INIS)
1991-01-01
This report is a compilation of correspondence between Westinghouse Idaho Nuclear Company and the US EPA over a period of time from 1988 to 1992 (most from 1991-92) regarding waste management compliance with EPA regulations. Typical subjects include: compliance with satellite accumulation requirements; usage of ''Sure Shot'' containers in place of aerosol cans; notice of upcoming recyclable battery shipments; disposition of batteries; HEPA filter leach sampling and permit impacts; functional and operation requirements for the spent filter handling system; summary of meeting on disposal of LET and D HEPA filters; solvent substitution database report; and mercury vapor light analytical testing
Bound states of 27Al studied at selected 26Mg(p,γ)27Al resonances, ch. 1
International Nuclear Information System (INIS)
Maas, J.W.; Holvast, A.J.C.D.; Baghus, A.; Endt, P.M.
1976-01-01
Measurements of the γ-ray decay and angular distributions at eight low-energy (Esub(P) 26 Mg (p,γ) 27 Al resonances lead to the spin and parity assignments Jsup(π) = 3/2 + , 1/2 - , 3/2 - , 5/2 + , 5/2, 3/2 - , 9/2 - and 7/2 for the bound states at Esub(x) = 3.96, 4.05, 5.15, 5.25, 5.44, 6.16, 6.99, 7.23 and 7.47 MeV, respectively. For other levels, spin and parity limitations are set. Also reported are precise excitation energies, branching and mixing ratios and lifetime limits. For the resonances, additional information is given on energies, strengths and widths. The reaction Q-value is Q = 8267.2 +- 0.7 keV. The level scheme of 27 Al, complemented with these new data, is compared with the results from recent shell-model calculations
LLW Forum meeting report, April 25--27, 1994
International Nuclear Information System (INIS)
1994-01-01
The Low-Level radioactive Waste Forum is an association of representatives of states and compacts established to facilitate state and compact commission implementation of the Low-Level Radioactive Waste Policy Act of 1980 and the Low-Level Radioactive Waste Policy Amendments Act of 1985 and to promote the objectives of low-level radioactive waste regional compacts. The Forum provides an opportunity for states and compacts to share information with one another and to exchange views with officials of federal agencies. LLW Forum participants include representatives from regional compacts, designated host states, unaffiliated states, and states with currently-operating low-level radioactive waste facilities. This quarterly meeting was held April 25-27, 1994 and activities during the first quarter of 1994 are detailed
LLW Forum meeting report, April 25--27, 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The Low-Level radioactive Waste Forum is an association of representatives of states and compacts established to facilitate state and compact commission implementation of the Low-Level Radioactive Waste Policy Act of 1980 and the Low-Level Radioactive Waste Policy Amendments Act of 1985 and to promote the objectives of low-level radioactive waste regional compacts. The Forum provides an opportunity for states and compacts to share information with one another and to exchange views with officials of federal agencies. LLW Forum participants include representatives from regional compacts, designated host states, unaffiliated states, and states with currently-operating low-level radioactive waste facilities. This quarterly meeting was held April 25-27, 1994 and activities during the first quarter of 1994 are detailed..
Outline of Summary Meeting on Nuclear Fusion Research by Grant-in-Aid (1986-1989) by Monbusho
International Nuclear Information System (INIS)
Ishino, Shiori; Nakazawa, Masaharu; Iguchi, Tetsuo
1990-01-01
The Summary Meeting on Nuclear Fusion Research by Grant-in-Aid (1986∼1989) of Monbusho was held on Jan. 30∼Feb. 1, 1989 at Gakushi-kaikan in Tokyo. About 300 papers were presented on the research activities as well as some special topics. (author)
International Nuclear Information System (INIS)
Braams, B.J.
2012-06-01
The 17th meeting of the Subcommittee on Atomic and Molecular Data of the International Fusion Research Council (IFRC) was held on 27-28 April 2010 at IAEA Headquarters in Vienna, Austria. Activities of the Atomic and Molecular Data Unit for the period 2006-2008 were reviewed, and recommendations were made for the 2010-2011 budget cycle. The proceedings, conclusions and recommendations of the Subcommittee meeting are briefly described in this report. Specific recommendations of the Subcommittee from this meeting, as well as the report on the activities of the IAEA Atomic and Molecular Data Unit for the period May 2006 - March 2008, are also included. (author)
International Nuclear Information System (INIS)
Oblozinsky, P.
1998-01-01
The present report contains the account of the last meeting of the Co-ordinated Research Project on ''Measurement, Calculation and Evaluation of Photon Production Data''. In addition to the summary of the meeting, the overall results achieved under the project in 1994-1997 are summarized, including the list of publications. The status of work on the Final Report of the project is also given. (author)
40 CFR 264.259 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.
2010-07-01
... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Waste Piles § 264.259 Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27. (a) Hazardous Wastes FO20, FO21, FO22, FO23, FO26... requirements are necessary for piles managing hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27 in order...
International Nuclear Information System (INIS)
Capote Noy, R.; Vatnitskiy, S.
2007-01-01
A summary is given of a Consultants' Meeting assembled to assess the viability of a new IAEA Co-ordinated Research Project (CRP) on Charged-Particle Interaction Data for Radiotherapy. The need for a programme to compile and evaluate charged-particle nuclear data for therapeutic applications was strongly agreed. Both the technical discussions and the expected outcomes of such a project are described, along with detailed recommendations for implementation. The meeting was jointly organized by NAPC/Nuclear Data Section and NAHU/Dosimetry and Medical Radiation Physics Section. (author)
Experiment list: SRX977378 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available 23908,98.7,9.6,43208 GSM1648629: total Oct4 ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 11days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-
Experiment list: SRX977377 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available 40719,98.1,13.8,57202 GSM1648628: total Oct4 ChipSeq day7; Mus musculus; ChIP-Seq source_name=reprogramming ...intermediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M
A Status Report on Hunger and Homelessness in America's Cities: 1988. A 27-City Survey.
Waxman, Laura DeKoven; Reyes, Lilia M.
In 1988 officials in 27 major cities were surveyed on the following topics: (1) ability to meet demand for emergency food assistance and shelter; (2) causes and demographics of hunger and homelessness; (3) status of low-income housing; and (4) outlook for 1989. Summary findings included the following: (1) demand for emergency food assistance…
International Nuclear Information System (INIS)
Chadwick, Mark; ); Danon, Yaron; Herman, Mike; ); Dunn, Mike; ); Kahler, Albert Skip; ); Jacqmin, Robert; ); Plompen, Arjan; ); Fukahori, Tokio; ); Harada, Hideo; ); Iwamoto, Osamu; Yokoyama, Kenji; ); Grudzevich, Oleg; ); Ge, Zhigang; Ruan, Xichao; Wu, Haicheng; Koning, Arjan; ); Mills, Robert; ); Mcnabb, Dennis; ); Palmiotti, Giuseppe; ); Noguere, Gilles; ); Leal, Luiz; ); Cabellos, Oscar; )
2016-01-01
The NEA's nuclear data evaluation co-operation activities involve the following evaluation projects: ENDF (United States), JENDL (Japan), ROSFOND/BROND (Russia), JEFF (other Data Bank member countries) and CENDL (China) in close co-operation with the Nuclear Data Section of the International Atomic Energy Agency (IAEA). The working party was established to promote the exchange of information on nuclear data evaluations, measurements, nuclear model calculations, validation, and related topics, and to provide a framework for cooperative activities between the participating projects. The working party assesses nuclear data improvement needs and addresses these needs by initiating joint evaluation and/or measurement efforts. The 28. Meeting of the WPEC was the occasion to review the experimental activities, the evaluation projects and the Status of subgroups. This document is the summary record of the meeting. It presents: 1 - The reports on experimental activities: Experimental nuclear data activities of relevance to the evaluation projects were reviewed. Detailed information about the experimental activities is given in the reports and view-graphs presented at the meeting. 2 - The review of final or near-final subgroup reports. Results and conclusions of completed or near-completed subgroups were discussed. A summary table of all subgroup status is given in Annex 3. 3 - The status of ongoing subgroups. Activities of ongoing subgroups were presented. A summary table of all subgroup status is given in Annex 3. 4 - The proposals for new subgroups. The subgroup proposal was reviewed by WPEC. Detailed information about this proposal is given in the document. 5 - The forthcoming meetings of interest. The documents presented at the twenty-eight WPEC meeting are presented in the annex 2: Annex 2.1 Working Party on International Nuclear Data Evaluation Co-operation - WPEC; Annex 2.2 WPEC Long-term mandate (updated and extended) on a 'Expert Group on the High Priority Request
Eleventh annual meeting, Bologna, Italy, 17-20 April 1978. Summary report. Part III
International Nuclear Information System (INIS)
1978-09-01
The Summary Report - Part III of the Eleventh Annual Meeting of the IAEA International Working Group on Fast Reactors - contains the discussions on the commercialization LMFBRs according to national plans, mostly related to technology of fuel fabrication, PHENIX fuel pins testing, heterogeneous cores, in service inspection of fuel elements, regulations and licensing, and related OECD activities. Most of the discussions were related to the existing reactors: BR-10, BN-600, BN-350, BN-1600, RAPSODIE and PHENIX
Eleventh annual meeting, Bologna, Italy, 17-20 April 1978. Summary report. Part III
Energy Technology Data Exchange (ETDEWEB)
NONE
1978-09-01
The Summary Report - Part III of the Eleventh Annual Meeting of the IAEA International Working Group on Fast Reactors - contains the discussions on the commercialization LMFBRs according to national plans, mostly related to technology of fuel fabrication, PHENIX fuel pins testing, heterogeneous cores, in service inspection of fuel elements, regulations and licensing, and related OECD activities. Most of the discussions were related to the existing reactors: BR-10, BN-600, BN-350, BN-1600, RAPSODIE and PHENIX.
For information MANAGEMENT BOARD MEETING OF 26 APRIL 2001
2001-01-01
The Management Board's meeting on 26 April was essentially devoted to discussion of the Organization's medium-term plan, to be set out in the document 'Scientific Activities of CERN and Budget Estimates for the Years 2002-2005' and presented to the Council and its committees for approval in June, after submission of a preliminary draft to the Scientific Policy Committee (SPC) at its meeting on 7 May. The Director-General reviewed the main changes with respect to last year's plan and indicated that the document would take into account a number of significant developments over the past twelve months, which had enabled the Management to build up a much clearer picture of the Laboratory's medium-term future. These included the final closure of LEP, the completion of the Five-Yearly Remuneration Review, the elaboration of a LHC final machine and detector commissioning schedule, and, more recently, the completion of the LHC Computing Review. The conclusions and recommendations of the latter review would be presente...
STANDING CONCERTATION COMMITTEE ORDINARY MEETING HELD ON 26 MAY AND 2 JUNE 1999
1999-01-01
Original: FrenchThe meeting was devoted essentially to examining the various items listed below:TREF meeting on 28 May 1999The items on this meeting's agenda were: a status report on the voluntary programmes, the Forum's work planning and in particular preparation for the five-yearly review of financial conditions, and the scope of application of Article R IV 1.25 of the Staff Regulations concerning the reimbursement of taxes to certain categories of students and associates.At the SCC's meeting on 26 May, the Committee members finalised the documents to be submitted to TREF, in particular the Forum's work planning and preparation for the five-yearly review.At its meeting on 2 June, the SCC took note of the results of TREF's meeting and the preparations for the next Finance Committee meeting and Council session in June:Status report on the voluntary programmesThe Forum had regarded the results of these programmes as very positive, especially those of the RSL Programme, which had made it possible to open 36 pos...
2011-03-30
...: Participants will present summary data, and discuss data needs and treatments. Special Accommodations The... the South Atlantic; Southeast Data, Assessment, and Review; Public Meeting AGENCY: National Marine... of Southeast Data and Review (SEDAR) 26 data webinar for Caribbean Silk snapper, Queen snapper, and...
Summary Report of Consultants' Meeting on Beta-Delayed Neutron Emission Evaluation
International Nuclear Information System (INIS)
Abriola, Daniel; Singh, Balraj; Dillmann, Iris
2011-12-01
A summary is given of a Consultants' Meeting assembled to assess the viability of a new IAEA Co-ordinated Research Project (CRP) on Beta-delayed neutron emission evaluation. The current status of the field was reviewed, cases in which new measurements are needed were identified and the current theoretical models were examined. The best known cases were selected as standards and were assessed and preliminary best values of the emission probabilities were obtained. The need of such a CRP was strongly agreed. Both the technical discussions and the expected outcome of such a project are described, along with detailed recommendations for its implementation. (author)
Vector Fields European user group meeting
2007-01-01
The "Vector Fields European user group meeting" will take place at CERN on 26 and 27 September 2007. Within this framework two workshops are organized at the CERN Training Centre: 24 September 2007 Modelling Magnets with Opera 25 September 2007 Modelling of Charged Particle Beam Devices with Opera If you are interested in attending the workshop or the user group meeting please contact Julie Shepherd (Vector Fields) or Pierre Baehler (CERN) directly at: Julie.Shepherd@vectorfields.co.uk, +44 (0) 1865 854933 or +44 (0) 1865 370151 Pierre.Baehler@cern.ch, 75016 / 160156.
Experiment list: SRX977374 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available 16864,98.6,9.4,51198 GSM1648625: total Oct4 ChipSeq day1; Mus musculus; ChIP-Seq source_name=reprogramming i...ntermediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M
76 FR 72009 - Sunshine Act Notice-December 8, 2011 Board of Directors Meeting
2011-11-21
.... 2. Insurance Project--Middle East and Africa. 3. Finance Project--Maghreb and North Africa. 4... Closed Session of the October 27, 2011 Board of Directors Meeting. 6. Pending Major Projects. Written summaries of the projects to be presented will be posted on OPIC's Web site on or about November 17, 2011...
International Nuclear Information System (INIS)
Napoli, J.L.; Mellon, W.S.; Fivizzani, M.A.; Schnoes, H.K.; DeLuca, H.F.
1980-01-01
The first direct chemical synthesis of radiolabeled 1 alpha, 25-dihydroxyvitamin D3 is reported. Unlike all previous syntheses, the new approach does not rely on enzymatic 1 alpha-hydroxylation of radiolabeled precursors. Rather, isotope is introduced in the last synthetic step by reaction of [3H] -methylmagnesium bromide with methyl 1 alpha-hydroxy-26,27-dinorvitamin D3-25-carboxylate to give 1 alpha,25-dihydroxy-[26,27-3H] vitamin D3 with a specific activity of 160 Ci/mmol. Mass spectroscopy confirmed that the radiohormone consists of a single isomer with six tritium atoms bound to carbons 26 and 27. Synthetically produced 1 alpha,25-dihydroxy [26,27-3H] vitamin D3 is indistinguishable from 1 alpha,25-dihydroxy-[26,27-3H] vitamin D3 obtained from the enzymatic 1 alpha-hydroxylation of 25-hydroxy[26,27-3H] vitamin D3 (160 Ci/mmol) by high-pressure liquid chromatography analysis and in the competitive binding assay using chick intestinal cytosol as the receptor source. Equilibrium dissociation constant measurements with the high specific activity radiohormone indicate a Kd of 8.2 x 10(-11) M for the chick intestinal cytosol 1 alpha,25-dihydroxyvitamin D3 receptor--a value considerably lower than the constants in the range of (1-5) x 10(-9) M previously reported
2010-03-02
... EXPORT-IMPORT BANK OF THE UNITED STATES Notice of Open Meeting of the Advisory Committee of the Export- Import Bank of the United States (Ex-Im Bank) SUMMARY: The Advisory Committee was established by Public Law 98-181, November 30, 1983, to advise the Export-Import Bank on its programs and to provide...
2010-11-29
... EXPORT-IMPORT BANK OF THE UNITED STATES Notice of Open Meeting of the Advisory Committee of the Export- Import Bank of the United States (Ex-Im Bank) SUMMARY: The Advisory Committee was established by Public Law 98-181, November 30, 1983, to advise the Export-Import Bank on its programs and to provide...
2010-09-09
... EXPORT-IMPORT BANK OF THE UNITED STATES Notice of Open Meeting of the Advisory Committee of the Export- Import Bank of the United States (Ex-Im Bank) SUMMARY: The Advisory Committee was established by Public Law 98-181, November 30, 1983, to advise the Export-Import Bank on its programs and to provide...
International Nuclear Information System (INIS)
Langley, R.A.
1995-12-01
The proceedings and results of the 1st IAEA research Coordination Meeting on ''Tritium Retention in Fusion Reactor Plasma Facing Components'' held on October 5 and 6, 1995 at the IAEA Headquarters in Vienna are briefly described. This report includes a summary of presentations made by the meeting participants, the results of a data survey and needs assessment for the retention, release and removal of tritium from plasma facing components, a summary of data evaluation, and recommendations regarding future work. (author). 4 tabs
2010-04-01
... United States From the Virgin Islands § 26.291 General. (a) Industrial spirits may be shipped into the... spirits may be shipped into the United States to the holder of a permit under part 20 of this chapter, in...) Completely denatured alcohol may be shipped to anyone in the United States in accordance with §§ 26.295...
International Nuclear Information System (INIS)
Palmans, H.; Noy, R.C.
2008-04-01
A summary is given of the First Research Coordination Meeting on Heavy Charged-Particle Interaction Data for Radiotherapy. A programme to compile and evaluate charged-particle nuclear data for therapeutic applications was proposed. Detailed coordinated research proposals were also agreed. Technical discussions and the resulting work plan of the Coordinated Research Project are summarized, along with actions and deadlines. (author)
Meeting staff representatives of the European Agencies
Staff Association
2014-01-01
The AASC (Assembly of Agency Staff Committee) held its 27th Meeting of the specialized European Agencies on 26 and 27 May on the premises of the OHIM (Office for Harmonization in the Internal Market) in Alicante, Spain. Two representatives of the CERN Staff Association, in charge of External Relations, attended as observers. This participation is a useful complement to regular contacts we have with FICSA (Federation of International Civil Servants' Associations), which groups staff associations of the UN Agencies, and the annual CSAIO conferences (Conference of Staff Associations of International Organizations), where each Autumn representatives of international organizations based in Europe meet to discuss themes of common interest to better promote and defend the rights of the international civil servants. All these meetings allow us to remain informed on items that are directly or indirectly related to employment and social conditions of our colleagues in other international and Europ...
Posterior Vitreous Detachment as Observed by Wide-Angle OCT Imaging.
Tsukahara, Mayuka; Mori, Keiko; Gehlbach, Peter L; Mori, Keisuke
2018-04-06
Posterior vitreous detachment (PVD) plays an important role in vitreoretinal interface disorders. Historically, observations of PVD using OCT have been limited to the macular region. The purpose of this study is to image the wide-angle vitreoretinal interface after PVD in normal subjects using montaged OCT images. An observational cross-sectional study. A total of 144 healthy eyes of 98 normal subjects aged 21 to 95 years (51.4±22.0 [mean ± standard deviation]). Montaged images of horizontal and vertical OCT scans through the fovea were obtained in each subject. Montaged OCT images. By using wide-angle OCT, we imaged the vitreoretinal interface from the macula to the periphery. PVD was classified into 5 stages: stage 0, no PVD (2 eyes, both aged 21 years); stage 1, peripheral PVD limited to paramacular to peripheral zones (88 eyes, mean age 38.9±16.2 years, mean ± standard deviation); stage 2, perifoveal PVD extending to the periphery (12 eyes, mean age 67.9±8.4 years); stage 3, peripapillary PVD with persistent vitreopapillary adhesion alone (7 eyes, mean age 70.9±11.9 years); stage 4, complete PVD (35 eyes, mean age 75.1±10.1 years). All stage 1 PVDs (100%) were observed in the paramacular to peripheral region where the vitreous gel adheres directly to the cortical vitreous and retinal surface. After progression to stage 2 PVD, the area of PVD extends posteriorly to the perifovea and anteriorly to the periphery. Vitreoschisis was observed in 41.2% at PVD initiation (stage 1a). Whereas prior work suggests that PVD originates in the perifoveal region and after the sixth decade, our observations demonstrate that (1) PVD first appears even in the third decade of life and gradually appears more extensively throughout life; (2) more than 40% of eyes without fundus diseases at their PVD initiation are associated with vitreoschisis; and (3) PVD is first noted primarily in the paramacular-peripheral region where vitreous gel adheres to the retinal surface and is
76 FR 37114 - Federal Open Market Committee; Domestic Policy Directive of April 26-27, 2011
2011-06-24
... Report. The Federal Open Market Committee seeks monetary and financial conditions that will foster price... Market Account Manager and the Secretary will keep the Committee informed of ongoing developments... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of April 26-27...
Czech Academy of Sciences Publication Activity Database
Kala, P.; Červinka, P.; Jakl, M.; Kanovský, J.; Kupec, A.; Špaček, R.; Kvasnak, M.; Poloczek, M.; Červinková, M.; Bezerra, H.; Valenta, Zdeněk; Attizzani, G.; Schnell, A.; Hong, L.; Costa, M.
2018-01-01
Roč. 250, 1 January (2018), s. 98-103 ISSN 0167-5273 Institutional support: RVO:67985807 Keywords : optical coherence tomography * OCT * primary PCI * ST-segment elevation myocardial infarction * drug-eluting stents Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 6.189, year: 2016
Screening retinal transplants with Fourier-domain OCT
Rao, Bin
2009-02-01
Transplant technologies have been studied for the recovery of vision loss from retinitis pigmentosa (RP) and age-related macular degeneration (AMD). In several rodent retinal degeneration models and in patients, retinal progenitor cells transplanted as layers to the subretinal space have been shown to restore or preserve vision. The methods for evaluation of transplants are expensive considering the large amount of animals. Alternatively, time-domain Stratus OCT was previously shown to be able to image the morphological structure of transplants to some extent, but could not clearly identify laminated transplants. The efficacy of screening retinal transplants with Fourier-domain OCT was studied on 37 S334ter line 3 rats with retinal degeneration 6-67 days after transplant surgery. The transplants were morphologically categorized as no transplant, detachment, rosettes, small laminated area and larger laminated area with both Fourier-domain OCT and histology. The efficacy of Fourier-domain OCT in screening retinal transplants was evaluated by comparing the categorization results with OCT and histology. Additionally, 4 rats were randomly selected for multiple OCT examinations (1, 5, 9, 14 and 21days post surgery) in order to determine the earliest image time of OCT examination since the transplanted tissue may need some time to show its tendency of growing. Finally, we demonstrated the efficacy of Fourier-domain OCT in screening retinal transplants in early stages and determined the earliest imaging time for OCT. Fourier-domain OCT makes itself valuable in saving resource spent on animals with unsuccessful transplants.
International Nuclear Information System (INIS)
Clark, R.E.H.
2001-11-01
The proceedings and conclusions of the 2nd Research Co-ordination Meeting on 'Plasma-Material Interaction Data for Mixed Plasma Facing Materials in Fusion Reactors', held on October 16 and 17, 2000 at the IAEA Headquarters in Vienna, are briefly described. This report includes a summary of the presentations made by the meeting participants and a review of the accomplishments of the Co-ordinated Research Project (CRP). In addition, short summaries from the participants are included indicating the specific research completed in support of this CRP. (author)
Tenth annual meeting, Vienna, Austria, 29 March - 1 April 1977. Summary report. Part III
Energy Technology Data Exchange (ETDEWEB)
NONE
1977-11-01
The Summary Report - Part III of the Tenth Annual Meeting of the IAEA International Working Group on Fast Reactors - contains the discussions on the commercial development of FBRs according to national plans, mostly related to technology problems of containment design, fuel fabrication, fuel failures, sodium pressure, fuel-sodium interaction, computer codes needed for licensing. Most of the discussions were related to the existing reactors: BN-600, BN-350, BN-1600, BOR-60, RAPSODIE, PHENIX.
Tenth annual meeting, Vienna, Austria, 29 March - 1 April 1977. Summary report. Part III
International Nuclear Information System (INIS)
1977-11-01
The Summary Report - Part III of the Tenth Annual Meeting of the IAEA International Working Group on Fast Reactors - contains the discussions on the commercial development of FBRs according to national plans, mostly related to technology problems of containment design, fuel fabrication, fuel failures, sodium pressure, fuel-sodium interaction, computer codes needed for licensing. Most of the discussions were related to the existing reactors: BN-600, BN-350, BN-1600, BOR-60, RAPSODIE, PHENIX
International Nuclear Information System (INIS)
1997-04-01
The present report contains the summary of the first Research Co-ordination Meeting on ''Compilation and Evaluation of Photonuclear Data for Applications'', held in Obninsk, Russia, from 3 to 6 December 1996. The project aims to produce a Technical Document on Photonuclear Data Library for Applications and to develop an IAEA Photonuclear Data Library. Summarized are the conclusions and recommendations of the meeting together with a detailed list of actions. Attached is the information sheet on the project, the agenda of the meeting and the list of participants along with extended abstracts of their presentations. Refs, figs, tabs
International Nuclear Information System (INIS)
Griffin, P.J.; Sjöstrand, H.; Simakov, S.P.
2016-08-01
This Meeting was organized to implement the recommendation of the second Research Coordinated Meeting (RCM) of the International Atomic Energy Agency (IAEA) Coordinated Research Project (CRP) “Primary Radiation Damage Cross Sections” to analyse the accuracy and consistency of the radiation damage-relevant nuclear data in the major nuclear data evaluations with the eventual goal of identifying the most reliable data and providing quantitative uncertainty estimates. Participants have considered the status of the primary nuclear data, such as reaction recoils spectra in the latest releases of ENDF, JEFF, JENDL, FENDL, ROSFOND and TENDL nuclear data libraries, and the ways of deriving the damage quantities KERMA, NRT- or arc-dpa and gas production cross sections as well as the recipes for an assessment of their uncertainties. This report contains the contemporary view of the Meeting participants on these issues in the form of a consolidated set of statements, recommendations and individual summaries. (author)
En-face Flying Spot OCT/Ophthalmoscope
Rosen, Richard B.; Garcia, Patricia; Podoleanu, Adrian Gh.; Cucu, Radu; Dobre, George; Trifanov, Irina; van Velthoven, Mirjam E. J.; de Smet, Marc D.; Rogers, John A.; Hathaway, Mark; Pedro, Justin; Weitz, Rishard
This is a review of a technique for high-resolution imaging of the eye that allows multiple sample sectioning perspectives with different axial resolutions. The technique involves the flying spot approach employed in confocal scanning laser ophthalmoscopy which is extended to OCT imaging via time domain en face fast lateral scanning. The ability of imaging with multiple axial resolutions stimulated the development of the dual en face OCT-confocal imaging technology. Dual imaging also allows various other imaging combinations, such as OCT with confocal microscopy for imaging the eye anterior segment and OCT with fluorescence angiography imaging.
International Nuclear Information System (INIS)
ElBaradei, M.
1998-01-01
The document reproduces the text of the conference given by the Director General of the IAEA at the joint Opening Session of the European Nuclear Congress'98 (ENC) and RECOD in Nice, France, on 26 october 1998. The conference emphasized the importance of strengthened international co-operation in all areas relevant to the safe and peaceful use of nuclear energy, especially for power generation. As the only intergovernmental global organization dedicated to nuclear science and technology, the role of the IAEA is to serve as the international focal point for standard setting, independent analysis, technology transfer and oversight and verification
The U.S. Nuclear Data Network: Summary of the twentieth meeting
International Nuclear Information System (INIS)
1994-01-01
Topics discussed at this meeting were: assessment of the nuclear data program from the perspective of the funding agency; status of high spin evaluations for ENSDF; recommendation for name change of master file from Nuclear Structure Reference to Nuclear Science Reference; status of ENSDF, Table of Isotopes, VuENSDF, on-line system at the NNDC, and Nuclear Data Sheets; summary of the discussion of the Formats and Procedures Subcommittee; long range plan for nuclear structure data; a description of methods of optimization of nuclear structure evaluations and how to evolve this activity into the forefront of research such as high-spin physics; code development which includes improvements in the databases and evaluator tools; and future means of data dissemination
Transcriptional regulation of the HMGA1 gene by octamer-binding proteins Oct-1 and Oct-2.
Directory of Open Access Journals (Sweden)
Eusebio Chiefari
Full Text Available The High-Mobility Group AT-Hook 1 (HMGA1 protein is an architectural transcription factor that binds to AT-rich sequences in the promoter region of DNA and functions as a specific cofactor for gene activation. Previously, we demonstrated that HMGA1 is a key regulator of the insulin receptor (INSR gene and an important downstream target of the INSR signaling cascade. Moreover, from a pathogenic point of view, overexpression of HMGA1 has been associated with human cancer, whereas functional variants of the HMGA1 gene have been recently linked to type 2 diabetes mellitus and metabolic syndrome. However, despite of this biological and pathological relevance, the mechanisms that control HMGA1 gene expression remain unknown. In this study, to define the molecular mechanism(s that regulate HMGA1 gene expression, the HMGA1 gene promoter was investigated by transient transfection of different cell lines, either before or after DNA and siRNA cotransfections. An octamer motif was identified as an important element of transcriptional regulation of this gene, the interaction of which with the octamer transcription factors Oct-1 and Oct-2 is crucial in modulating HMGA1 gene and protein expression. Additionally, we demonstrate that HMGA1 binds its own promoter and contributes to its transactivation by Oct-2 (but not Oct-1, supporting its role in an auto-regulatory circuit. Overall, our results provide insight into the transcriptional regulation of the HMGA1 gene, revealing a differential control exerted by both Oct-1 and Oct-2. Furthermore, they consistently support the hypothesis that a putative defect in Oct-1 and/or Oct-2, by affecting HMGA1 expression, may cause INSR dysfunction, leading to defects of the INSR signaling pathway.
OCT for Examination of Artwork
Targowski, Piotr; Iwanicka, Magdalena; Rouba, Bogumiła J.; Frosinini, Cecilia
In this chapter the application of OCT to examination of objects of cultural heritage is given. The knowledge about the structure of the object of art is necessary both for inventory purposes and planning/monitoring of conservation-restoration treatments. Due to its noninvasiveness OCT is well suited for such applications. The major limitation is in the lack of transparency of certain structures. Specific requirements, advantages and limitations of use of the OCT technique in this area are discussed first. Then the overview of applications to easel paintings, historic glass, and craftsmanship is given, followed by two examples of monitoring the laser ablation with OCT: very local in case of Laser Induced Breakdown Spectroscopy (LIBS), and more general in case of laser ablation of the varnish layer. Then the examples of application of OCT to examination of paintings are given: investigation of deterioration of the varnish layer in the "Adoration of the Magi" by Leonardo da Vinci (Uffizi, Italy), imaging of overpaintings on two 17th and 18th c. oil paintings on canvas, and visualization of specific case of retouching located between two layers of varnish in the "Madonna with Yarnwinder" (attributed to L. da Vinci, private property).
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Containers. 27.121 Section... Spirits In Bulk § 27.121 Containers. Imported distilled spirits may be bottled in either domestic or imported containers conforming to the provisions of subpart N of this part. (72 Stat. 1374; 26 U.S.C. 5301...
International Nuclear Information System (INIS)
2002-01-01
This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of
Energy Technology Data Exchange (ETDEWEB)
NNSA/NV
2002-09-16
This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of
Energy Technology Data Exchange (ETDEWEB)
Pronyaev, V G
2001-02-01
The IAEA Nuclear Data Section convened the fourteenth meeting of the International Nuclear Structure and Decay Data Evaluators Network at IAEA Headquarters, Vienna, 4-7 December 2000. The meeting was attended by 22 scientists from 7 Member States and 1 international organization concerned with compilation, evaluation, and dissemination of nuclear structure and decay data. The present document contains a meeting summary, the recommendations, the data center reports and proposals considered by the participants. (author)
International Nuclear Information System (INIS)
2000-01-01
The international workshop on 'Nuclear Power Plant Life Management in a Changing Business World' was held in Washington, DC, on 26-27 June 2000. This workshop was attended by more than 50 experts from 12 countries and three international organisations. The workshop included a series of presentations to a plenary session of all participants. A spectrum of experiences in plant life extension activities as well as experiences in operating a nuclear power plant (NPP) in a 'free-market' electricity environment were presented: The workshop also included three working groups in which major issues facing PLIM activities for NPPs were identified and discussed. The three working groups covered technology, regulation and business. The following sections of this report consist of summaries of the discussions that took place in each of the three working groups. (author)
International Nuclear Information System (INIS)
1989-12-01
The Eighth Meeting of the IAEA International Working Group on Gas-Cooled Reactors was held in Vienna, Austria, from 30 January - 1 February, 1989. The Summary Report (Part II) contains the papers which review the national programmes in the field of Gas-Cooled Reactors and other presentations at the Meeting. Refs, figs and tabs
40 CFR 264.231 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.
2010-07-01
... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Surface Impoundments § 264.231 Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27. (a) Hazardous Wastes FO20, FO21, FO22... surface impoundments managing hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27 in order to reduce...
Energy Technology Data Exchange (ETDEWEB)
2011-05-01
This summary report outlines needs and issues for increasing energy efficiency of new and existing U.S homes, as identified at the U.S Department of Energy Building America program Spring 2011 stakeholder meeting in Atlanta, Georgia.
Ehlers, Justis P; Han, Jaehong; Petkovsek, Daniel; Kaiser, Peter K; Singh, Rishi P; Srivastava, Sunil K
2015-11-01
To assess retinal architectural alterations that occur following membrane peeling procedures and the impact of peel technique on these alterations utilizing intraoperative optical coherence tomography (iOCT). This is a subanalysis of the prospective PIONEER iOCT study of eyes undergoing a membrane peeling for a vitreomacular interface (VMI) disorder. Intraoperative scanning was performed with a microscope-mounted OCT system. Macroarchitectural alterations (e.g., full-thickness retinal elevations) and microarchitectural alterations (e.g., relative layer thickness alterations) were analyzed. Video/iOCT correlation was performed to identify instrument-tissue manipulations resulting in macroarchitectural alterations. One hundred sixty-three eyes were included in the macroarchitectural analysis. Instrumentation utilized for membrane peeling included forceps alone for 73 eyes (45%), combined diamond-dusted membrane scraper (DDMS) and forceps for 87 eyes (53%), and other techniques in three eyes (2%). Focal retinal elevations were identified in 45 of 163 eyes (28%). Video/iOCT correlation identified 69% of alterations involved forceps compared to 26% due to DDMS. Sixteen percent of retinal alterations persisted 1 month following surgery. The microarchitectural analysis included 134 eyes. Immediately following membrane peeling, there was a significant increase in the ellipsoid zone to retinal pigment epithelium height (+20%, P peeling for VMI conditions. Differences in surgical instruments may impact these architectural alterations.
Energy Technology Data Exchange (ETDEWEB)
Nichols, A L; Tuli, J K [International Atomic Energy Agency, Nuclear Data Section, Vienna (Austria)
2005-09-15
The IAEA Nuclear Data Section convened the 16th meeting of the International Network of Nuclear Structure and Decay Data Evaluators at the Department of Physics and Astronomy, McMaster University, Hamilton, Canada, 6-10 June 2005. This meeting was attended by 33 scientists from 12 Member States concerned with the compilation, evaluation and dissemination of nuclear structure and decay data. A summary of the meeting, recommendations/conclusions, data centre reports, and various proposals considered, modified and agreed by the participants are contained within this document. (author)
International Nuclear Information System (INIS)
Mizoshiri, N.; Kishida, T.; Yamamoto, K.; Shirai, T.; Terauchi, R.; Tsuchida, S.; Mori, Y.; Ejima, A.; Sato, Y.; Arai, Y.; Fujiwara, H.; Yamamoto, T.; Kanamura, N.; Mazda, O.; Kubo, T.
2015-01-01
Introduction: Osteoblasts play essential roles in bone formation and regeneration, while they have low proliferation potential. Recently we established a procedure to directly convert human fibroblasts into osteoblasts (dOBs). Transduction of Runx2 (R), Osterix (X), Oct3/4 (O) and L-myc (L) genes followed by culturing under osteogenic conditions induced normal human fibroblasts to express osteoblast-specific genes and produce calcified bone matrix both in vitro and in vivo Intriguingly, a combination of only two factors, Oct3/4 and L-myc, significantly induced osteoblast-like phenotype in fibroblasts, but the mechanisms underlying the direct conversion remains to be unveiled. Materials and Methods: We examined which Oct family genes and Myc family genes are capable of inducing osteoblast-like phenotypic conversion. Results: As result Oct3/4, Oct6 and Oct9, among other Oct family members, had the capability, while N-myc was the most effective Myc family gene. The Oct9 plus N-myc was the best combination to induce direct conversion of human fibroblasts into osteoblast-like cells. Discussion: The present findings may greatly contribute to the elucidation of the roles of the Oct and Myc proteins in osteoblast direct reprogramming. The results may also lead to establishment of novel regenerative therapy for various bone resorption diseases. - Highlights: • Introducing L-myc in a combination with either Oct3/4, Oct6 or Oct9 enables the conversion of fibroblasts to osteoblasts. • A combination of L-myc with Oct3/4 or Oct9 can induce the cells to a phenotype closer to normal osteoblasts. • N-myc was considered the most appropriate Myc family gene for induction of osteoblast-like phenotype in fibroblasts. • The combination of Oct9 plus N-myc has the strongest capability of inducing osteoblast-like phenotype.
Energy Technology Data Exchange (ETDEWEB)
Mizoshiri, N. [Department of Immunology, Kyoto Prefectural University of Medicine, Kyoto (Japan); Department of Orthopaedics, Kyoto Prefectural University of Medicine, Kyoto (Japan); Kishida, T. [Department of Immunology, Kyoto Prefectural University of Medicine, Kyoto (Japan); Yamamoto, K. [Department of Immunology, Kyoto Prefectural University of Medicine, Kyoto (Japan); Department of Dental Medicine, Kyoto Prefectural University of Medicine, Kyoto (Japan); Shirai, T.; Terauchi, R.; Tsuchida, S. [Department of Orthopaedics, Kyoto Prefectural University of Medicine, Kyoto (Japan); Mori, Y. [Department of Immunology, Kyoto Prefectural University of Medicine, Kyoto (Japan); Department of Orthopaedics, Kyoto Prefectural University of Medicine, Kyoto (Japan); Ejima, A. [Department of Immunology, Kyoto Prefectural University of Medicine, Kyoto (Japan); Sato, Y. [Department of Immunology, Kyoto Prefectural University of Medicine, Kyoto (Japan); Department of Dental Medicine, Kyoto Prefectural University of Medicine, Kyoto (Japan); Arai, Y.; Fujiwara, H. [Department of Orthopaedics, Kyoto Prefectural University of Medicine, Kyoto (Japan); Yamamoto, T.; Kanamura, N. [Department of Dental Medicine, Kyoto Prefectural University of Medicine, Kyoto (Japan); Mazda, O., E-mail: mazda@koto.kpu-m.ac.jp [Department of Immunology, Kyoto Prefectural University of Medicine, Kyoto (Japan); Kubo, T. [Department of Orthopaedics, Kyoto Prefectural University of Medicine, Kyoto (Japan)
2015-11-27
Introduction: Osteoblasts play essential roles in bone formation and regeneration, while they have low proliferation potential. Recently we established a procedure to directly convert human fibroblasts into osteoblasts (dOBs). Transduction of Runx2 (R), Osterix (X), Oct3/4 (O) and L-myc (L) genes followed by culturing under osteogenic conditions induced normal human fibroblasts to express osteoblast-specific genes and produce calcified bone matrix both in vitro and in vivo Intriguingly, a combination of only two factors, Oct3/4 and L-myc, significantly induced osteoblast-like phenotype in fibroblasts, but the mechanisms underlying the direct conversion remains to be unveiled. Materials and Methods: We examined which Oct family genes and Myc family genes are capable of inducing osteoblast-like phenotypic conversion. Results: As result Oct3/4, Oct6 and Oct9, among other Oct family members, had the capability, while N-myc was the most effective Myc family gene. The Oct9 plus N-myc was the best combination to induce direct conversion of human fibroblasts into osteoblast-like cells. Discussion: The present findings may greatly contribute to the elucidation of the roles of the Oct and Myc proteins in osteoblast direct reprogramming. The results may also lead to establishment of novel regenerative therapy for various bone resorption diseases. - Highlights: • Introducing L-myc in a combination with either Oct3/4, Oct6 or Oct9 enables the conversion of fibroblasts to osteoblasts. • A combination of L-myc with Oct3/4 or Oct9 can induce the cells to a phenotype closer to normal osteoblasts. • N-myc was considered the most appropriate Myc family gene for induction of osteoblast-like phenotype in fibroblasts. • The combination of Oct9 plus N-myc has the strongest capability of inducing osteoblast-like phenotype.
Directory of Open Access Journals (Sweden)
Nicolás eCuenca
2014-12-01
Full Text Available Purpose: The P23H rhodopsin mutation is an autosomal dominant cause of retinitis pigmentosa. The degeneration can be tracked using different anatomical and functional methods. In our case, we evaluated the anatomical changes using Spectral-Domain Optical Coherence Tomography (SD-OCT and correlated the findings with retinal thickness values determined by immunocytochemistry.Methods: Pigmented rats heterozygous for the P23H mutation, with ages between P18 and P180 were studied. Function was assessed by means of optomotor testing and ERGs. Retinal thicknesses measurements, autofluorescence and fluorescein angiography were performed using Spectralis OCT. Retinas were studied by means of immunohistochemistry. Results: Between P30 and P180, visual acuity decreased from 0.500 to 0.182 cycles per degree (cyc/deg and contrast sensitivity decreased from 54.56 to 2.98 for a spatial frequency of 0.089 cyc/deg. Only cone-driven b-wave responses reached developmental maturity. Flicker fusions were also comparable at P29 (42 Hz. Double flash-isolated rod-driven responses were already affected at P29. Photopic responses revealed deterioration after P29.A reduction in retinal thicknesses and morphological modifications were seen in OCT sections. Statistically significant differences were found in all evaluated thicknesses. Autofluorescence was seen in P23H rats as sparse dots. Immunocytochemistry showed a progressive decrease in the outer nuclear layer, and morphological changes. Although anatomical thickness measures were significantly lower than OCT values, there was a very strong correlation between the values measured by both techniques.Conclusions: In pigmented P23H rats, a progressive deterioration occurs in both retinal function and anatomy. Anatomical changes can be effectively evaluated using SD-OCT and immunocytochemistry, with a good correlation between their values, thus making SD-OCT an important tool for research in retinal degeneration.
International Nuclear Information System (INIS)
Pronyaev, V.G.
1999-03-01
The IAEA Nuclear Data Section convened the thirteenth meeting of the International Nuclear Structure and Decay Data Evaluators Network at the IAEA Headquarters, Vienna, 14-17 December 1998. The meeting was attended by 30 scientists from 10 Member States and 2 international organizations concerned with compilation, evaluation, and dissemination of nuclear structure and decay data. The present document contains a meeting summary, the conclusions and recommendations, the data center reports and proposals considered by the participants. (author)
Summary of the BioLINK SIG 2013 meeting at ISMB/ECCB 2013.
Verspoor, Karin; Shatkay, Hagit; Hirschman, Lynette; Blaschke, Christian; Valencia, Alfonso
2015-01-15
The ISMB Special Interest Group on Linking Literature, Information and Knowledge for Biology (BioLINK) organized a one-day workshop at ISMB/ECCB 2013 in Berlin, Germany. The theme of the workshop was 'Roles for text mining in biomedical knowledge discovery and translational medicine'. This summary reviews the outcomes of the workshop. Meeting themes included concept annotation methods and applications, extraction of biological relationships and the use of text-mined data for biological data analysis. All articles are available at http://biolinksig.org/proceedings-online/. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Strontium-90 and cesium-137 in total diet (from Oct. 1981 to Jul. 1982)
International Nuclear Information System (INIS)
1982-01-01
Strontium-90 and cesium-137 in total diet (from Oct. 1981 to Jul. 1982) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 26 sampling locations. The results are shown in a table. (Namekawa, K.)
2011-12-27
... Diabetes and Digestive and Kidney Disorders; Notice of Closed Meeting Pursuant to section 10(d) of the... Digestive and Kidney Diseases. Date: January 26, 2012. Time: 3 p.m.-5 p.m. Agenda: To evaluate requests for...; 93.848, Digestive Diseases and Nutrition Research; 98.849, Kidney Diseases, Urology and Hematology...
Summary Report of the First Research Coordination Meeting on Primary Radiation Damage Cross Sections
International Nuclear Information System (INIS)
Stoller, R.E.; Greenwood, L.R.; Simakov, S.P.
2013-12-01
The Nuclear Data Section of IAEA has initiated a new Coordinated Research Project with the main goal of reviewing and recommending primary damage response functions for neutron and ion irradiations of materials. The output of this CRP will be a database of recommended damage response functions for selected materials with corresponding documentation. It will serve the needs of the fission, fusion and accelerator neutron source communities. The first Research Coordination Meeting (RCM) was held 4 to 8 November 2013 at the IAEA. At this meeting, the attendees discussed the objectives of the whole CRP, presented their contributions and elaborated on consolidated recommendations and actions for implementation over the next 1.5 year period. This Summary Report documents the individual contributions and joint decisions made during this meeting. The identified research needs were refined through extensive discussion, and a consensus was developed which defined the CRP objectives in two broad categories. The first addresses the underlying physics-related research relevant to nuclear reactions and ion stopping powers, while the second task will address the development of new materials damage response functions. (author)
27 CFR 70.26 - Third-party recordkeepers.
2010-04-01
.... 70.26 Section 70.26 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU...) Definitions—(1) Accountant. A person is an “accountant” under 26 U.S.C. 7609(a)(3)(F) for purposes of... certified under State law as an accountant. (2) Attorney. A person is an “attorney” under 26 U.S.C. 7609(a...
Gilbert, Jack A.; Meyer, Folker; Knight, Rob; Field, Dawn; Kyrpides, Nikos; Yilmaz, Pelin; Wooley, John
2010-01-01
This report summarizes the proceedings of the Metagenomics, Metadata, Metaanalysis, Models and Metainfrastructure (M5) Roundtable at the 13th International Society for Microbial Ecology Meeting in Seattle, WA, USA August 22-27, 2010. The Genomic Standards Consortium (GSC) hosted this meeting as a community engagement exercise to describe the GSC to the microbial ecology community during this important international meeting. The roundtable included five talks given by members of the GSC, and was followed by audience participation in the form of a roundtable discussion. This report summarizes this event. Further information on the GSC and its range of activities can be found at http://www.gensc.org. PMID:21304725
Gilbert, Jack A; Meyer, Folker; Knight, Rob; Field, Dawn; Kyrpides, Nikos; Yilmaz, Pelin; Wooley, John
2010-12-15
This report summarizes the proceedings of the Metagenomics, Metadata, Metaanalysis, Models and Metainfrastructure (M5) Roundtable at the 13th International Society for Microbial Ecology Meeting in Seattle, WA, USA August 22-27, 2010. The Genomic Standards Consortium (GSC) hosted this meeting as a community engagement exercise to describe the GSC to the microbial ecology community during this important international meeting. The roundtable included five talks given by members of the GSC, and was followed by audience participation in the form of a roundtable discussion. This report summarizes this event. Further information on the GSC and its range of activities can be found at http://www.gensc.org.
International Nuclear Information System (INIS)
Sawan, Mohamed E.
2012-03-01
The third Research Co-ordination Meeting of the Nuclear Data Libraries for Advanced Systems - Fusion Devices (FENDL-3) was held at IAEA Headquarters in Vienna from 6 to 9 December 2011. A summary of the presentations given during meeting is given in this report along with the discussions that took place. A list of actions necessary to complete the library production, processing and testing are given. Details of the documents arising from the CRP were agreed. (author)
OCT in the field of laryngology: further perspectives
Just, T.; Pau, H. W.; Lankenau, E.; Hüttmann, G.
2011-03-01
Early detection of cancerous lesions of the larynx may be the best method of improving patient quality of life and survival rates. New in-vivo technologies may be of great clinical relevance in improving the accuracy of sampling during microlaryngeal surgery. Optical coherence tomography (OCT) is an optical imaging technique that clearly identifies basement membrane violation caused by laryngeal cancer. With a microscope-based spectral domain OCT (SD-OCT) we reached in vivo a fairly accurate assessment of benign and dysplastic laryngeal lesions. Recent improvements in OCT technology have led to the development of high-speed OCT systems displaying millions of pixels per second. These systems allow non-contact real-time imaging of large sections of laryngeal tissue. Polarization contrast OCT (PS-OCT) may provide additional information about the lamina propria of the true vocal cord because of the birefringence of connective tissue. We present microscope-based high-speed SD-OCT images with and without polarization contrast and 3D volumes of selected laryngeal pathologies in order to demonstrate our current concepts for the intended intraoperative application. High-speed SD-OCT and polarization contrast can also be complemented by our recently developed rigid confocal endoscopic system to obtain cellular and sub-cellular information about the tissue. Further perspectives will be presented.
Twelfth annual meeting of the International Working Group on Fast Reactors. Summary report. Part I
Energy Technology Data Exchange (ETDEWEB)
NONE
1979-05-01
The Twelfth Annual Meeting of the IWGFR was held in accordance with the recommendation of the previous AGM,in Vienna from 27 to 30 March 1979. The meeting was attended by the Member States of the group: France, the Federal Republic of Germany, Italy, Japan, the United Kingdom, and the USA, as well as by representatives from CEC, IAEA and OECD and observer from the USSR. This document includes: review of the IWGFR Activities for the period since the Eleventh Annual Meeting of the Group; preliminary programme of international conference on breeder reactors as a world energy resource and the breeder fuel cycle; list of meetings on atomic energy which may be of interest to the IWGFR Members; IWGFR criteria for supporting some of the international conferences; list of proposed topics for the IWGFR Specialists' Meetings; list of topics for review articles on LMFBR recommended for publication by the IAEA; list of meetings sponsored by the IWGFR; a list of members of the International Working Group on Fast Reactors.
Twelfth annual meeting of the International Working Group on Fast Reactors. Summary report. Part I
International Nuclear Information System (INIS)
1979-05-01
The Twelfth Annual Meeting of the IWGFR was held in accordance with the recommendation of the previous AGM,in Vienna from 27 to 30 March 1979. The meeting was attended by the Member States of the group: France, the Federal Republic of Germany, Italy, Japan, the United Kingdom, and the USA, as well as by representatives from CEC, IAEA and OECD and observer from the USSR. This document includes: review of the IWGFR Activities for the period since the Eleventh Annual Meeting of the Group; preliminary programme of international conference on breeder reactors as a world energy resource and the breeder fuel cycle; list of meetings on atomic energy which may be of interest to the IWGFR Members; IWGFR criteria for supporting some of the international conferences; list of proposed topics for the IWGFR Specialists' Meetings; list of topics for review articles on LMFBR recommended for publication by the IAEA; list of meetings sponsored by the IWGFR; a list of members of the International Working Group on Fast Reactors
Summary report of third research coordination meeting on updated decay data library for actinides
International Nuclear Information System (INIS)
Kellett, M.A.
2009-07-01
The third meeting of the Coordinated Research Project on 'Updated Decay Data Library for Actinides' was held at the IAEA, Vienna on 8-10 October 2008. A summary of the presentations made by each participant is given, along with subsequent discussions. The evaluation procedure was reviewed, and a short tutorial session was given on the use of software adopted from the Decay Data Evaluation Project (DDEP). The list of radionuclides under review and evaluation was updated, along with their agreed allocation amongst participants. (author)
Energy Technology Data Exchange (ETDEWEB)
FULLER, R.K.
1999-02-23
This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.
International Nuclear Information System (INIS)
FULLER, R.K.
1999-01-01
This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document
IGF1 stimulates differentiation of primary follicles and their growth in ...
Indian Academy of Sciences (India)
Pancharatna A Katti
2017-10-31
Oct 31, 2017 ... Adult (body size: 27 ± 1 mm; body mass: 160 ± 15 mg) female zebrafish (wild ... used for histology were purchased from Hi media, India. 2.7 Tissue preparation for ..... oocyte-follicle cell communication. Biol. Reprod. 85 97–98.
Polymeric nanoparticles as OCT contrast agents
Energy Technology Data Exchange (ETDEWEB)
Al Rawashdeh, Wa' el [RWTH Aachen University, Experimental Molecular Imaging (Germany); Kray, Stefan [RWTH Aachen University, Institute for Semiconductor Electronics (Germany); Pich, Andrij; Pargen, Sascha; Balaceanu, Andreea [RWTH Aachen University, Interactive Material Research (DWI) (Germany); Lenz, Markus; Spoeler, Felix [RWTH Aachen University, Institute for Semiconductor Electronics (Germany); Kiessling, Fabian, E-mail: fkiessling@ukaachen.de; Lederle, Wiltrud [RWTH Aachen University, Experimental Molecular Imaging (Germany)
2012-12-15
In this study, the optical properties of two nano-sized polymer colloids in optical coherence tomography (OCT) were compared in vitro with respect to their potential use as contrast agents. We used two types of particles: compact hydrophobic spherical polystyrene (PS) particles and soft water-swollen nanogel (NG) particles both with grafted hydrophilic shell, both prepared at two different sizes (PS at 300 and 150 nm, NG at 300 and 200 nm). The OCT backscattering signals of the particles in a vessel-mimicking highly scattering agar/TiO{sub 2} phantom were compared on either number of particles or weight percent. Larger particles and higher concentrations produced higher OCT contrast. At each concentration tested, a markedly higher contrast was achieved by PS particles than NG particles. PS particles generated a markedly higher OCT contrast than the phantom at concentrations of at least 1 Multiplication-Sign 10{sup 10} or 0.1 % for PS 300 nm and at least 3 Multiplication-Sign 10{sup 11} particles/mL or 0.4 % for PS 150 nm. The contrast generated by NG 300 nm was above the phantom contrast at concentrations of at least 3 Multiplication-Sign 10{sup 11} particles/mL or 1 %, whereas NG 200 nm only at 4 %. At any given weight percent, the differences in OCT contrast between differently sized particles were much less evident than in the comparison based on particle number. PS 300 nm generated also a good contrast ex vivo on chicken muscle tissue. These results strongly suggest that PS spheres have strong potential as intravascular OCT contrast agent, while NG particles need further contrast enhancer for being used as OCT contrast agent.
Administrative Circular No. 26 (Rev. 9) – Recognition of Merit
2012-01-01
Administrative Circular No. 26 (Rev. 9) entitled "Recognition of Merit”, approved by the Director-General following discussion in the Standing Concertation Committee meeting on 27 September 2011 is available on the intranet site of the Human Resources Department: https://cern.ch/hr-docs/admincirc/admincirc.asp The circular was above all revised in order to integrate the new CERN Competency Model into the annual procedure of performance appraisal. It cancels and replaces Administrative Circular No. 26 (Rev. 8) entitled "Recognition of merit” of September 2008. Department Head Office HR Department
United Nations Economic and Social Council, New York, NY.
The report is organized into three sections. Section 1, "Attendance and Organization of Work," is a general summary giving information on place and date, attendance, election of officers, and agenda, and summarizing the opening meeting, the consideration and adoption of the final report, and the closing meeting. Section 2, "Summary…
International Nuclear Information System (INIS)
Miley, G.H.
1973-01-01
The following six topics were discussed at the meeting: (1) energy forms available from the plasma, (2) materials processing, (3) hydrogen production, (4) plasma chemistry/radiation processing, (5) coherent radiation/broad-band radiation, and (6) neutron applications. Summaries are given for each topic. (U.S.)
Use of Convexity in Ostomy Care: Results of an International Consensus Meeting.
Hoeflok, Jo; Salvadalena, Ginger; Pridham, Sue; Droste, Werner; McNichol, Laurie; Gray, Mikel
Ostomy skin barriers that incorporate a convexity feature have been available in the marketplace for decades, but limited resources are available to guide clinicians in selection and use of convex products. Given the widespread use of convexity, and the need to provide practical guidelines for appropriate use of pouching systems with convex features, an international consensus panel was convened to provide consensus-based guidance for this aspect of ostomy practice. Panelists were provided with a summary of relevant literature in advance of the meeting; these articles were used to generate and reach consensus on 26 statements during a 1-day meeting. Consensus was achieved when 80% of panelists agreed on a statement using an anonymous electronic response system. The 26 statements provide guidance for convex product characteristics, patient assessment, convexity use, and outcomes.
Measurement of the Ec.m.=184 keV Resonance Strength in the 26gAl(p,γ)27Si Reaction
International Nuclear Information System (INIS)
Ruiz, C.; Buchmann, L.; Caggiano, J. A.; Davids, B.; Davis, C.; Hutcheon, D.A.; Olin, A.; Ottewell, D.F.; Ruprecht, G.; Trinczek, M.; Vockenhuber, C.; Parikh, A.; Clark, J.A.; Deibel, C.; Lewis, R.; Parker, P.; Wrede, C.; Jose, J.; Chen, A.A.; Ouellet, C.V.
2006-01-01
The strength of the E c.m. =184 keV resonance in the 26g Al(p,γ) 27 Si reaction has been measured in inverse kinematics using the DRAGON recoil separator at TRIUMF's ISAC facility. We measure a value of ωγ=35±7 μeV and a resonance energy of E c.m. =184±1 keV, consistent with p-wave proton capture into the 7652(3) keV state in 27 Si, and discuss the implications of these values for 26g Al nucleosynthesis in typical oxygen-neon white-dwarf novae
Statistical model for OCT image denoising
Li, Muxingzi; Idoughi, Ramzi; Choudhury, Biswarup; Heidrich, Wolfgang
2017-01-01
Optical coherence tomography (OCT) is a non-invasive technique with a large array of applications in clinical imaging and biological tissue visualization. However, the presence of speckle noise affects the analysis of OCT images and their diagnostic
Energy Technology Data Exchange (ETDEWEB)
None, None
2014-06-01
This report is based on the proceedings of the U.S. Department of Energy’s Office of Energy Efficiency and Renewable Energy’s Bioenergy Technologies Office’s Algal Biofuel Strategy Workshop on March 26-27, 2014, in Charleston, South Carolina. The workshop objective was to convene stakeholders to engage in discussion on strategies over the next 5 to 10 years to achieve affordable, scalable, and sustainable algal biofuels.
Post-translational regulation of Oct4 transcriptional activity.
Directory of Open Access Journals (Sweden)
Jonathan P Saxe
Full Text Available Oct4 is a key component of the molecular circuitry which regulates embryonic stem cell proliferation and differentiation. It is essential for maintenance of undifferentiated, pluripotent cell populations, and accomplishes these tasks by binding DNA in multiple heterodimer and homodimer configurations. Very little is known about how formation of these complexes is regulated, or the mechanisms through which Oct4 proteins respond to complex extracellular stimuli which regulate pluripotency. Here, we provide evidence for a phosphorylation-based mechanism which regulates specific Oct4 homodimer conformations. Point mutations of a putative phosphorylation site can specifically abrogate transcriptional activity of a specific homodimer assembly, with little effect on other configurations. Moreover, we performed bioinformatic predictions to identify a subset of Oct4 target genes which may be regulated by this specific assembly, and show that altering Oct4 protein levels affects transcription of Oct4 target genes which are regulated by this assembly but not others. Finally, we identified several signaling pathways which may mediate this phosphorylation and act in combination to regulate Oct4 transcriptional activity and protein stability. These results provide a mechanism for rapid and reversible alteration of Oct4 transactivation potential in response to extracellular signals.
Sharma, Ashish; Oakley, Jonathan D; Schiffman, Joyce C; Budenz, Donald L; Anderson, Douglas R
2011-07-01
To evaluate a new automated analysis of optic disc images obtained by spectral-domain optical coherence tomography (SD OCT). Areas of the optic disc, cup, and neural rim in SD OCT images were compared with these areas from stereoscopic photographs to represent the current traditional optic nerve evaluation. The repeatability of measurements by each method was determined and compared. Evaluation of diagnostic technology. One hundred nineteen healthy eyes, 23 eyes with glaucoma, and 7 glaucoma suspect eyes. Optic disc and cup margins were traced from stereoscopic photographs by 3 individuals independently. Optic disc margins and rim widths were determined automatically in SD OCT. A subset of photographs was examined and traced a second time, and duplicate SD OCT images also were analyzed. Agreement among photograph readers, between duplicate readings, and between SD OCT and photographs were quantified by the intraclass correlation coefficient (ICC), by the root mean square, and by the standard deviation of the differences. Optic disc areas tended to be slightly larger when judged in photographs than by SD OCT, whereas cup areas were similar. Cup and optic disc areas showed good correlation (0.8) between the average photographic reading and SD OCT, but only fair correlation of rim areas (0.4). The SD OCT was highly reproducible (ICC, 0.96-0.99). Each reader also was consistent with himself on duplicate readings of 21 photographs (ICC, 0.80-0.88 for rim area and 0.95-0.98 for all other measurements), but reproducibility was not as good as SD OCT. Measurements derived from SD OCT did not differ from photographic readings more than the readings of photographs by different readers differed from each other. Designation of the cup and optic disc boundaries by an automated analysis of SD OCT was within the range of variable designations by different readers from color stereoscopic photographs, but use of different landmarks typically made the designation of the optic disc
IAEA consultants' meeting on selection of basic evaluations for the FENDL-2 library. Summary report
International Nuclear Information System (INIS)
Pashchenko, A.B.
1996-09-01
FENDL-1 is the international reference nuclear data library for fusion design applications, available from the IAEA Nuclear Data Section. FENDL/E is the sublibrary for evaluated neutron reaction data. An updated version, FENDL-2, is being developed. The present report contains the Summary of the IAEA Consultants' Meeting on ''Selection of Basic Evaluations for the FENDL-2 Library'', held at Karlsruhe, Germany, from 24 to 28 June 1996. This meeting was organized by the IAEA Nuclear Data Section (NDS) with the co-operation and assistance of local organizers of the Forschungszentrum Karlsruhe, Germany. Summarized are the conclusions and recommendations for the selection of basic evaluations from candidates submitted by five national projects (JENDL-FF, BROND, EFF, ENDF/B-VI and CENDL) for FENDL/E-2.0 international reference data library. (author). 1 tab
ACPSEM (NZ Branch) annual meeting
International Nuclear Information System (INIS)
McEwan, A.C.
1999-01-01
The 1998 annual meeting of the New Zealand Branch of the Australasian College of Physical Scientists and Engineers in Medicine was held at the Christchurch School of Medicine over 26-27 November 1998, and attracted a record number of around 45 registrations. The meeting serves a number of purposes but one of the primary ones is to bring together scientists in medicine from around the country to compare notes on practices and advances, particularly in radiotherapy and diagnostic radiology physics. Following the meeting format established over recent years, separate workshops were devoted to radiotherapy physics and developments in the regional centres represented, and to practical issues relating to medical physics in diagnostic radiology. The workshops were held in parallel with presentations of scientific papers covering a wide range of topics, but with about half relating to engineering applications in medicine. (author)
Towards increase of diagnostic efficacy in gynecologic OCT
Kirillin, Mikhail; Panteleeva, Olga; Eliseeva, Darya; Kachalina, Olga; Sergeeva, Ekaterina; Dubasova, Lyubov; Agrba, Pavel; Mikailova, Gyular; Prudnikov, Maxim; Shakhova, Natalia
2013-06-01
Gynecologic applications of optical coherence tomography (OCT) are usually performed in combination with routine diagnostic procedures: laparoscopy and colposcopy. In combination with laparoscopy OCT is employed for inspection of fallopian tubes in cases of unrecognized infertility while in colposcopy it is used to identify cervix pathologies including cancer. In this paper we discuss methods for increasing diagnostic efficacy of OCT application in these procedures. For OCT-laparoscopy we demonstrate independent criteria for pathology recognition which allow to increase accuracy of diagnostics. For OCT-colposcopy we report on application of device for controlled compression allowing to sense the elasticity of the inspected cervix area and distinguish between neoplasia and inflammatory processes.
Kuznetsova, Irina A.; Gladkova, Natalia D.; Gelikonov, Valentin M.; Belinson, Jerome L.; Shakhova, Natalia M.; Feldchtein, Felix I.
Timely and efficient diagnosis of diseases of the female reproductivesystem is very important from the social viewpoint [1, 2]. Diagnosticefficacy of the existing techniques still needs improvement sincemalignant neoplasms of the female reproductive system organs are stableleaders among causes of death (over 35.9 %) [3]. Each year, 851.9 thousand genital cancer cases are recorded worldwide [1, 2]. However, the diagnostic efficacy of the visual examination with biopsy is limited. Correct interpretation of colposcopic features requires high skills and long-term clinical experience, which makes colposcopy very subjective and limits interobserver agreement [8-10]. OCT is known to visualize in vivo and noninvasively tissue microstructure with spatial resolution approaching the histologic level and therefore can be expected to guide biopsies and to provide real-time tissue structure information when biopsies are contraindicated or impractical. Although thorough clinical studies are required to determine if OCT can be suitable for this purpose in gynecology in general and for cervical cancer in particular, the early results look encouraging. In this chapter, we present a wide spectrum of the OCT studies of different partsof the female reproductive system and demonstrate the potential of the clinical use of this new visualization method in gynecological practice.
Energy Technology Data Exchange (ETDEWEB)
Abriola, D [IAEA Nuclear Data Section, Vienna (Austria); Nichols, A L [Departments of Physics, University of Surrey, Guildford (United Kingdom); Tuli, J K [Brookhaven National Laboratory, Brookhaven, Upton, NY (United States)
2011-10-15
The 19th meeting of the International Network of Nuclear Structure and Decay Data Evaluators was convened at the IAEA Headquarters, Vienna, from 4 to 8 April 2011, by the staff members of IAEA, Nuclear Data Section. This meeting was attended by 35 scientists from 20 Member States, plus IAEA staff, concerned with the compilation, evaluation and dissemination of nuclear structure and decay data. A summary of the meeting, data centre reports, various proposals considered, modified and agreed by the participants, and recommendations/conclusions are presented within this document. (author)
International Nuclear Information System (INIS)
Abriola, D.; Nichols, A.L.; Tuli, J.K.
2011-10-01
The 19th meeting of the International Network of Nuclear Structure and Decay Data Evaluators was convened at the IAEA Headquarters, Vienna, from 4 to 8 April 2011, by the staff members of IAEA, Nuclear Data Section. This meeting was attended by 35 scientists from 20 Member States, plus IAEA staff, concerned with the compilation, evaluation and dissemination of nuclear structure and decay data. A summary of the meeting, data centre reports, various proposals considered, modified and agreed by the participants, and recommendations/conclusions are presented within this document. (author)
Human organic cation transporter 2 (hOCT2): Inhibitor studies using S2-hOCT2 cells
International Nuclear Information System (INIS)
Chiba, Shoetsu; Ikawa, Toru; Takeshita, Hiroshi; Kanno, Sanae; Nagai, Tomonori; Takada, Meri; Mukai, Toshiji; Wempe, Michael F.
2013-01-01
Highly expressed in kidney and located on the basolateral membrane, human organic cation transporter 2 (hOCT2) can transport various compounds (i.e. drugs and toxins) into the proximal tubular cell. Using cultured proximal tubule cells stably expressing hOCT2 (i.e. S2-hOCT2 cells), we sought to probe different compound classes (e.g. analgesics, anti-depressants, anti-psychotics, disinfectant, herbicides, insecticides, local anesthetic, muscarinic acetylcholine receptor antagonist, sedatives, steroid hormone, stimulants and toxins) for their ability to inhibit 14 C-TEA uptake, a prototypical OCT2 substrate. Aconitine, amitriptyline, atropine, chlorpyrifos, diazepam, fenitrothion, haloperidol, lidocaine, malathion, mianserin, nicotine and triazolam significantly inhibited 14 C-TEA uptake; IC 50 values were 59.2, 2.4, 2.0, 20.7, 32.3, 13.2, 32.5, 104.6, 71.1, 17.7, 52.8 and 65.5 μM, respectively. In addition, aconitine, amitriptyline, atropine, chlorpyrifos, fenitrothion, haloperidol, lidocaine, and nicotine displayed competitive inhibition with K i values of 145.6, 2.5, 2.4, 24.8, 16.9, 51.6, 86.8 and 57.7 μM, respectively. These in vitro data support the notion that compounds pertaining to a wide variety of different drug classes have the potential to decrease renal clearance of drugs transported via hOCT2. Consequently, these data warrant additional studies to probe hOCT2 and its role to influence drug pharmacokinetics
2013-09-24
... ENVIRONMENTAL PROTECTION AGENCY [FRL--9901-26-OA] Notification of a Public Meeting of the Science Advisory Board Panel for the Review of the EPA Water Body Connectivity Report AGENCY: Environmental Protection Agency (EPA). ACTION: Notice. SUMMARY: The EPA Science Advisory Board (SAB) Staff Office announces...
Energy Technology Data Exchange (ETDEWEB)
Gedeon, A.K.; Connor, J.M.; Mulley, J.C. [Univ. of Adelaide (Australia); Connor, J.M. [Duncan Guthrie Inst. of Medical Genetics, Yorkhill (United Kingdom); Glass, I.A. [Univ. of California, San Franciso, CA (United States)
1996-07-12
A large family with non-specific X-linked mental retardation (MRX) was first described in 1991, with a suggestion of linkage to Xq26-27. The maximum lod score was 1.60 ({theta} = 0.10) with the F9 locus. The localization of this MRX gene has now been established by linkage to microsatellite markers. Peak pairwise lod scores of 4.02 and 4.01 ({theta} = 0.00) were attained at the DXS1114 and DXS994 loci respectively. This MRX gene is now designated MRX27 and is localized to Xq24-26 by recombination events detected by DXS424 and DXS102. This regional localization spans 26.2 cM on the genetic background map and defines another distinct MRX interval by linkage to a specific region of the X chromosome. 25 refs., 1 fig., 1 tab.
49 CFR 26.47 - Can recipients be penalized for failing to meet overall goals?
2010-10-01
... Goals, Good Faith Efforts, and Counting § 26.47 Can recipients be penalized for failing to meet overall... administer your program in good faith. (b) If you do not have an approved DBE program or overall goal, or if you fail to implement your program in good faith, you are in noncompliance with this part. ...
Steady-state pharmacokinetics of metformin is independent of the OCT1 genotype in healthy volunteers
DEFF Research Database (Denmark)
Christensen, Mette Marie Hougaard; Højlund, Kurt; Hother-Nielsen, Ole
2015-01-01
PURPOSE: The aim of the study was to determine the steady-state pharmacokinetics of metformin in healthy volunteers with different numbers of reduced-function alleles in the organic cation transporter 1 gene (OCT1). METHODS: The study was conducted as part of a randomized cross-over trial. Thirty......-four healthy volunteers with known OCT1 genotypes (12 with two wild-type alleles, 13 with one and 9 with two reduced-function alleles) were included. In one of the study periods, they were titrated to steady-state with 1 g metformin twice daily. RESULTS: Neither AUC(0-12), C(max) nor Cl(renal) were...... statistically significantly affected by the number of reduced-function alleles (0, 1 or 2) in OCT1: (AUC(0-12): 0, 1, 2: 14, 13 and 14 h ng/L (P = 0.61)); (C(max): 0, 1, 2: 2192, 1934 and 2233 ng/mL, (P = 0.26)) and (Cl(renal): 0, 1, 2: 31, 28 and 30 L/h (P = 0.57)) CONCLUSIONS: In a cohort of healthy...
Review and summary of RERTR '98
International Nuclear Information System (INIS)
Gruber, Gerhard J.
1999-01-01
The RERTR program started in 1978 and had its last annual international meeting in Sao Paulo, Brazil in October 1998. The target of this program is to eliminate the risk of proliferation and misuse of the HEU by converting research reactors from using HEU to LEU. 36 research reactors are in the process of conversion (8) or fully converted (28) on the basis oft the existing U 3 Si 2 (4.8 gU/cc) fuel. Higher density fuels up to 8-9 gU/cc on a U-Mo basis are being developed to also achieve the conversion of high performance research reactors. The U.S. spent nuclear fuel return program is under good progress. Efforts are being made to establish similar RERTR and spent fuel return programs in Russia. Concerns about missing global or regional back-end solutions mainly for countries without a nuclear program were raised. (author)
OCT4: A penetrant pluripotency inducer.
Wang, Xuecong; Jauch, Ralf
2014-01-01
Native OCT4 protein has the intrinsic ability of crossing cellular membranes to enter cells. This finding could revive efforts to induce pluripotency with proteins replacing nucleic acid-based approaches, and raises the intriguing question as to whether OCT4 can act non-cell-autonomously.
OCT4: A penetrant pluripotency inducer
Wang, Xuecong; Jauch, Ralf
2014-01-01
Native OCT4 protein has the intrinsic ability of crossing cellular membranes to enter cells. This finding could revive efforts to induce pluripotency with proteins replacing nucleic acid-based approaches, and raises the intriguing question as to whether OCT4 can act non-cell-autonomously.
Mizoshiri, N; Kishida, T; Yamamoto, K; Shirai, T; Terauchi, R; Tsuchida, S; Mori, Y; Ejima, A; Sato, Y; Arai, Y; Fujiwara, H; Yamamoto, T; Kanamura, N; Mazda, O; Kubo, T
2015-11-27
Osteoblasts play essential roles in bone formation and regeneration, while they have low proliferation potential. Recently we established a procedure to directly convert human fibroblasts into osteoblasts (dOBs). Transduction of Runx2 (R), Osterix (X), Oct3/4 (O) and L-myc (L) genes followed by culturing under osteogenic conditions induced normal human fibroblasts to express osteoblast-specific genes and produce calcified bone matrix both in vitro and in vivo Intriguingly, a combination of only two factors, Oct3/4 and L-myc, significantly induced osteoblast-like phenotype in fibroblasts, but the mechanisms underlying the direct conversion remains to be unveiled. We examined which Oct family genes and Myc family genes are capable of inducing osteoblast-like phenotypic conversion. As result Oct3/4, Oct6 and Oct9, among other Oct family members, had the capability, while N-myc was the most effective Myc family gene. The Oct9 plus N-myc was the best combination to induce direct conversion of human fibroblasts into osteoblast-like cells. The present findings may greatly contribute to the elucidation of the roles of the Oct and Myc proteins in osteoblast direct reprogramming. The results may also lead to establishment of novel regenerative therapy for various bone resorption diseases. Copyright © 2015 Elsevier Inc. All rights reserved.
OCT for diagnosis of periodontal disease
Colston, Bill W., Jr.; Everett, Matthew J.; Da Silva, Luiz B.; Otis, Linda L.
1998-04-01
We have developed a hand-held in vivo scanning device for use in the oral cavity. We produced, using this scanning device, in vivo OCT images of dental tissues in human volunteers. All the OCT images were analyzed for the presence of clinically relevant anatomical structures. The gingival margin, periodontal sulcus, and dento-enamel junction were visible in all the images. The cemento-enamel junction was discernible in 64% of the images and the alveolar bone presumptively identified for 71% of the images. These images represent, to our knowledge, the first in vivo OCT images of human dental tissue.
OCT for diagnosis of periodontal disease
Energy Technology Data Exchange (ETDEWEB)
Colston, B.W., LLNL
1998-01-01
We have developed a hand-held in vivo scanning device for use in the oral cavity. We produced, using this scanning device, in vivo OCT images of dental tissues in human volunteers. All the OCT images were analyzed for the presence of clinically relevant anatomical structures. The gingival margin, periodontal sulcus, and dento-enamel junction were visible in all the images. The cemento-enamel junction was discernible in 64% of the images and the alveolar bone presumptively identified for 71% of the images. These images represent, to our knowledge, the first in vivo OCT images of human dental tissue.
International Nuclear Information System (INIS)
Colombo, D.; Ronchetti, F.; Toma, L.
1990-01-01
Through analysis of the 13 C NMR spectra of (25S)-[27- 2 H]campesterol (1) and (25R)-[26- 2 H]dihydrobrassicasterol (2), the C-26 and C-27 resonances have been unambiguously assigned; the biosynthetic applications are discussed. (author)
48 CFR 52.232-26 - Prompt payment for fixed-price architect-engineer contracts.
2010-10-01
...-price architect-engineer contracts. 52.232-26 Section 52.232-26 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.232-26 Prompt payment for fixed-price architect-engineer contracts...-Engineer Contracts (OCT 2008) Notwithstanding any other payment terms in this contract, the Government will...
Summary record of the experts meeting on the proposed OECD-IRSN STLOC project
International Nuclear Information System (INIS)
2004-01-01
The purpose of this meeting was to determine the interest in member countries for the types of LOCA tests envisaged in the STLOC programme proposed by IRSN. The IRSN proposal was circulated among this Group in advance of the meeting. After the presentations and discussions, the Group recommendations were as follows: different views were expressed as to the need to perform the LOCA integral tests; there was an understanding that the results of separate effect tests (ANL, JAERI, Halden) would need to be obtained before deciding on the intended LOCA tests proposed in STLOC; IRSN and the OECD-NEA should explore the possibility to run the first ST test with air ingress (STLOC1), for which partial funding already exists (this test is foreseen for 2008); the need of LOCA tests as envisaged in STLOC should be re-assessed in about three years time (2006); analytical and experimental progress on LOCA tests should be monitored until then, through for instance the SEGFSM. An executive summary of the IRSN Source term LOCA program LOCA part is given in an appendix
2010-04-01
... following information: (1) The name and address of the consignee. (2) The kind and brand name. (3) The... to the product and the elements necessary to compute the effective tax rate in accordance with § 26...
International Nuclear Information System (INIS)
Goriely, S.; Dimitriou, P.
2016-07-01
A summary is given of the 1 st Research Coordination Meeting of the new IAEA Co-ordinated Research Project (CRP) on Updating the Photonuclear Data Library and Generating a Reference Database for Photon Strength Functions. Participants presented their work, reviewed the current status of the field with regards to measurements, theoretical models and evaluations, discussed the scope of the work to be undertaken and agreed on a list of priorities and task assignments necessary to achieve the goals of the CRP. A summary of the presentations and discussions is presented in this report. (author)
DEFF Research Database (Denmark)
These proceedings contain approximately 100 papers presented at the 1st International Operational Modal Conference, Copenhagen, Denmark, April 26 - 27, 2005. The conference is jointly organised by Structural Vibration Systems (SVS), Aalborg, Brüel & Kjær Sound and Vibration Measurement A/S and th......These proceedings contain approximately 100 papers presented at the 1st International Operational Modal Conference, Copenhagen, Denmark, April 26 - 27, 2005. The conference is jointly organised by Structural Vibration Systems (SVS), Aalborg, Brüel & Kjær Sound and Vibration Measurement A....../S and the Department of Building Technology and Structural Engineering at Aalborg University. It is the first conference ever to focus solely on experimental modal analysis for cases where only the responses are measured. It was decided to hold the conference to generate interest in operational modal analysis (also...... effort and higher versatility. However, because the mathematical background was initially weak, computer power was insufficient and the equipment not sensitive enough for this kind of testing, the technology has only become popular during the last 3 - 4 years. For this reason, the first conference...
International Nuclear Information System (INIS)
2013-01-01
This paper gives the summary record of the past 24. Meeting of the Working Party on International Nuclear Data Evaluation Co-operation: review of the experimental nuclear data activities of relevance to the evaluation projects (NEA Data Bank member countries, Japan, USA, China, Russia), brief progress reports from the evaluation projects and discussion of future plans (ENDF, JEFF, JENDL, TENDL, BROND, CENDL, IAEA), review of final or near-final subgroup reports (subgroups 27 (Prompt photon production from fission products), 28 (Processing of covariance data), 29 (U-235 capture cross-section in the keV to MeV energy region), 31 (Meeting nuclear data needs for advanced reactor systems)), status of ongoing subgroups (subgroups C (High priority request list for nuclear data), 33 (Methods and issues for the combined use of integral experiments and covariance), 34 (Coordinated evaluation of 239 Pu in the resonance region), 35 (Scattering angular distribution in the fast energy range), 36 (Reporting and usage of experimental data for evaluation in the resolved resonance region)), proposals for new subgroups, discussions on the opportunity to create a World Wide Evaluated Nuclear Data File/Library, information on conferences and meetings of interest to the nuclear data community
OCT4: A penetrant pluripotency inducer
Directory of Open Access Journals (Sweden)
Xuecong Wang
2014-01-01
Full Text Available Native OCT4 protein has the intrinsic ability of crossing cellular membranes to enter cells. This finding could revive efforts to induce pluripotency with proteins replacing nucleic acid-based approaches, and raises the intriguing question as to whether OCT4 can act non-cell-autonomously.
International Nuclear Information System (INIS)
Charles, M.W.
1979-03-01
In October 1978 the Fourteenth Annual Meeting of the European Society of Radiation Biology (ESRB) and a symposium of the European Late Effects Project Group (EULEP) were held consecutively at the Kernforchungsanlage (KFA), Julich, FDR. The EULEP meeting was convened to specifically discuss the biological basis of the recommendations of publication 26 of the International Commission on Radiological Protection (ICRP). The programme of the ESRB Meeting also reflected the present interest in radiological protection. A short summary of these meetings is presented. Details of the two meetings are given in appendices which should form an introduction to, and resume of, recent developments in this field. (author)
Brautaset, Rune; Birkeldh, Ulrika; Rosén, Rebecka; Ramsay, Marika Wahlberg; Nilsson, Maria
2014-01-01
In a clinical setting, the usefulness of optical coherence tomography (OCT) is strongly dependent on reproducibility of the measurement. The aim of the present study was to evaluate macula and optic disc measurement reproducibility with the new spectral-domain OCT (SD-OCT) from Canon (Canon OCT-HS100) and to compare reproducibility and obtained measurements with the Zeiss Cirrus HD-OCT. Macula and optic disc parameters from the right eyes of 31 subjects were obtained twice with both instruments. Interoperator reproducibility was evaluated by use of the coefficient of repeatability (CR), and the obtained measurements were compared between the instruments. No difference in interoperator reproducibility could be found when comparing the 2 instruments and reproducibility ranged from 3.94% to 12.77% for optic disc parameters and from 1.19% to 3.54% for macula parameters. The lowest reproducibility was found for cup volume and vertical cup/disc ratio with both instruments. For all macula and retinal nerve fiber layer (RNFL) thickness measurements, there was a statistical difference when comparing the 2 instruments, except for RFNL measurements of the superior quadrant, with the Canon OCT-HS100 always evaluating the thickness to be thicker; however, the 2 instruments correlated well. The Canon OCT-HS100 is a reproducible instrument that matches the Zeiss Cirrus HD-OCT well. It remains to be evaluated how sensitive the Canon OCT-HS100 is to detect small subtle changes in optic disc parameters and macular nerve fiber layer thickness. Furthermore, due to the differences in thickness estimation, it is important to emphasize that SD-OCTs are not interchangeable.
Changing POU dimerization preferences converts Oct6 into a pluripotency inducer.
Jerabek, Stepan; Ng, Calista Kl; Wu, Guangming; Arauzo-Bravo, Marcos J; Kim, Kee-Pyo; Esch, Daniel; Malik, Vikas; Chen, Yanpu; Velychko, Sergiy; MacCarthy, Caitlin M; Yang, Xiaoxiao; Cojocaru, Vlad; Schöler, Hans R; Jauch, Ralf
2017-02-01
The transcription factor Oct4 is a core component of molecular cocktails inducing pluripotent stem cells (iPSCs), while other members of the POU family cannot replace Oct4 with comparable efficiency. Rather, group III POU factors such as Oct6 induce neural lineages. Here, we sought to identify molecular features determining the differential DNA-binding and reprogramming activity of Oct4 and Oct6. In enhancers of pluripotency genes, Oct4 cooperates with Sox2 on heterodimeric SoxOct elements. By re-analyzing ChIP-Seq data and performing dimerization assays, we found that Oct6 homodimerizes on palindromic OctOct more cooperatively and more stably than Oct4. Using structural and biochemical analyses, we identified a single amino acid directing binding to the respective DNA elements. A change in this amino acid decreases the ability of Oct4 to generate iPSCs, while the reverse mutation in Oct6 does not augment its reprogramming activity. Yet, with two additional amino acid exchanges, Oct6 acquires the ability to generate iPSCs and maintain pluripotency. Together, we demonstrate that cell type-specific POU factor function is determined by select residues that affect DNA-dependent dimerization. © 2016 The Authors. Published under the terms of the CC BY 4.0 license.
IAEA advisory group meeting on completion of FENDL-1 and start of FENDL-2. Summary report
International Nuclear Information System (INIS)
Pashchenko, A.B.
1996-03-01
The present report contains the summary of the IAEA Advisory Group Meeting on ''Completion of FENDL-1 and Start of FENDL-2'', held in Del Mar, California, USA, from 5 to 9 December 1995. The meeting was organized by the IAEA Nuclear Data Section with the cooperation and assistance of local organizers from TSI Research and the ITER Joint Central Team at San Diego. The FENDL library is a comprehensive collection of high-quality nuclear data, selected from the various existing national data libraries, covering the necessary nuclear input data for all physics and engineering aspects of the material development, design, operation and safety of the International Thermonuclear Experimental Reactor (ITER) project in its current Engineering Design Activities (EDA) phase and other fusion-related development projects. Summarized are results of the comprehensive integral data tests of FENDL-1 working libraries against available benchmark experiments performed in the framework of an international coordinated effort. Included are meeting conclusions and recommendations adopted for selection of evaluations for FENDL-2 together with a list of actions and time schedule. Attached are a detailed meeting agenda and a list of attendees. (author). Tabs
27 CFR 19.98 - Conveyance of untaxpaid spirits or wines within a distilled spirits plant.
2010-04-01
... spirits or wines within a distilled spirits plant. 19.98 Section 19.98 Alcohol, Tobacco Products and... PLANTS Administrative and Miscellaneous Provisions Conveyance of Spirits Or Wines on Plant Premises § 19.98 Conveyance of untaxpaid spirits or wines within a distilled spirits plant. Untaxpaid spirits or...
International Nuclear Information System (INIS)
Janev, R.K.; Longhurst, G.
1998-12-01
The proceedings and conclusions of the 1st IAEA Research Co-ordination Meeting on 'Plasma-Material Interaction Data for Mixed Plasma Facing Materials in Fusion Reactors', held on December 19 and 20, 1998 at the IAEA Headquarters in Vienna, are briefly described. This report includes a summary of the presentations made by meeting participants, a review of the data availability and data needs in the areas from the scope of the Co-ordinated Research Project (CRP) on the subject of the meeting, and recommendations regarding the future work within this CRP. (author)
Water Cluster Leaders Meeting Summary Report 2016
As part of its efforts to support environmental technology innovation clusters, U.S. EPA hosted a Water Technology Innovation Cluster Leaders Meeting on September 25, 2016, in New Orleans, Louisiana. The meeting was an opportunity for cluster leaders from across the globe to meet...
OCT imaging of skin cancer and other dermatological diseases
DEFF Research Database (Denmark)
Mogensen, Mette; Thrane, Lars; Jørgensen, Thomas Martini
2009-01-01
Optical coherence tomography (OCT) provides clinicians and researchers with micrometer-resolution, in vivo, cross-sectional images of human skin up to several millimeter depth. This review of OCT imaging applied within dermatology covers the application of OCT to normal skin, and reports on a lar...... number of applications in the fields of non-melanoma skin cancer, malignant melanomas, psoriasis and dermatitis, infestations, bullous skin diseases, tattoos, nails, haemangiomas, and other skin diseases. (© 2009 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim)......Optical coherence tomography (OCT) provides clinicians and researchers with micrometer-resolution, in vivo, cross-sectional images of human skin up to several millimeter depth. This review of OCT imaging applied within dermatology covers the application of OCT to normal skin, and reports on a large...
75 FR 16149 - Medicaid and CHIP Programs; Meeting of the CHIP Working Group-April 26, 2010
2010-03-31
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Medicare & Medicaid Services [CMS-2312-N] DEPARTMENT OF LABOR Employee Benefits Security Administration Medicaid and CHIP Programs; Meeting of the CHIP Working Group-- April 26, 2010 AGENCIES: Centers for Medicare & Medicaid Services (CMS), Department of...
CERN Technical training: Available places in forthcoming courses
HR Department
2010-01-01
The following course sessions are scheduled in the framework of the 2010 CERN Technical Training Programme and places are still available. You can find the full updated Technical Training course programme in our web catalogue. Software and system technologies Business Objects Basic\t18-Oct-10\t19-Oct-10\ttbc\t2 days Business Objects Advanced\t20-Oct-10\t20-Oct-10\tEnglish\t1 day CERN openlab/Intel Computer Architecture and Performance Tuning Workshop\t22-Sep-10\t23-Sep-10\tEnglish\t2 days ITIL Foundations (version 3) EXAMINATION\t28-Oct-10\t28-Oct-10\tEnglish\t1 hour JAVA 2 Entreprise Edition - Part 1: Web Applications\t27-Oct-10\t29-Oct-10\tEnglish\t2 days JCOP - Joint PVSS-JCOP Framework\t11-Oct-10\t15-Oct-10\tEnglish\t4,5 days Oracle Database SQL Tuning\t25-Oct-10\t27-Oct-10\tEnglish\t3 days Oracle Databases: Advanced PL/SQL Programming\t27-Sep-10\t29-Sep-10\tEnglish\t3 days PERL 5 - Introduction 25-Oct-10\t26-Oct-10\tEnglish\t2 days Python - Hands-on Introduction\t18-Oct-10\t21-Oct-10\tEnglish\t4 days Secure coding in C/C++\t12-Oct-10\t13-Oct-...
26 CFR 1.857-4 - Tax imposed by reason of the failure to meet certain source-of-income requirements.
2010-04-01
..., DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Real Estate Investment Trusts § 1.857-4 Tax imposed by reason of the failure to meet certain source-of-income requirements. Section 857... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Tax imposed by reason of the failure to meet...
WANTO 32: Proceedings of the 32nd Weapons Agencies Nondestructive Testing Organization meeting
International Nuclear Information System (INIS)
Majzlik, E.J. Jr.
1991-02-01
The Thirty-Second Weapons Agencies Nondestructive Testing Organization (WANTO) meeting was held at the Savannah River Site (SRS) on November 27--29, 1990. The meeting was hosted by Edward J. Majzlik, Jr., Savannah River Laboratory, Westinghouse Savannah River Company (WSRC). The Chairman of the WANTO Steering Committee is L.E. (Larry) Bryant, Los Alamos National Laboratory. This report is the sole proceedings of the meeting and includes the agenda, attendance, steering committee report, interim reports and technical presentation summaries. This report is the first to present the meeting proceedings in an unclassified form. The reader should contact individual authors directly for any additional information desired. The meeting was organized to provide coverage of a wide variety of NDE subjects relevant to the Department of Energy (DOE) Nuclear Weapons Complex (NWC). Approximately 60 technical experts and managers representing 11 DOE weapons agencies and 3 DOE offices attended. A total of 56 technical presentations and 3 special NDE workshops were included in the agenda along with two tours of the SRS Reactor Mock-up Facility. Invited presentations included five speakers who reported on the DOE sponsored conference Concurrent Engineering and the NDE Role held at Sandia National Laboratory, Albuquerque, New Mexico, October 30-November 1, 1990 and X-ray Film Retention and Disposal presented by Orville R. Pratt, DOE/AL-Martin Marietta. The WANTO Steering Committee report for the Thirty-Second Meeting immediately follows this section. The meeting Agenda and Attendance are presented in Appendices A and B, respectively. Technical presentation summaries and abstracts are presented in Appendix C. For cases in which a summary was not provided, a telephone number is offered for direct contact with the author/presenter. Interim Activity Reports are compiled in Appendix D. Special Workshop reports are presented in Appendix E. (JF)
International Nuclear Information System (INIS)
1992-01-01
The CSNI Specialist meeting on severe accident management programme development was held in Rome and about seventy experts from thirteen countries attended the meeting. A total of 27 papers were presented in four sessions, covering specific aspects of accident management programme development. It purposely focused on the programmatic aspects of accident management rather than on some of the more complex technical issues associated with accident management strategies. Some of the major observations and conclusions from the meeting are that severe accident management is the ultimate part of the defense in depth concept within the plant. It is function and success oriented, not event oriented, as the aim is to prevent or minimize consequences of severe accidents. There is no guarantee it will always be successful but experts agree that it can reduce the risks significantly. It has to be exercised and the importance of emergency drills has been underlined. The basic structure and major elements of accident management programmes appear to be similar among OECD member countries. Dealing with significant phenomenological uncertainties in establishing accident management programmes continues to be an important issue, especially in confirming the appropriateness of specific accident management strategies
2013 Building America Research Planning Meeting Summary
Energy Technology Data Exchange (ETDEWEB)
Metzger, C. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Hunt, S. [Confluence Communications, Missoula, MT (united States)
2014-02-01
The Building America Research Planning Meeting was held October 28-30, 2013, in Washington, DC. This meeting provides one opportunity each year for the research teams, national laboratories and Department of Energy (DOE) managers to meet in person to share the most pertinent information and collaboration updates. This report documents the presentations, highlights key program updates, and outlines next steps for the program.
45 CFR 98.16 - Plan provisions.
2010-10-01
... in the TANF work requirement applicable to a single custodial parent caring for a child under age six... for purposes of child care eligibility; and whether respite care is provided to custodial parents of... meet the needs of certain families specified at § 98.50(e). (5) Any additional eligibility criteria...
Summary and outlook for KEKTC5
International Nuclear Information System (INIS)
Quinn, Helen
2002-01-01
This is the summary talk of a meeting held at the KEK, Tsukuba, Japan, November 20-22, 2001. I give a brief summary of the talks we heard, and a few comments of my own on various points that have been made. Other talks given at this meeting are referred to by the speakers last name; these talks will appear in the same proceedings. See these talks for the detailed references for each subject
293--26 October 2009 [ Final version].indd
African Journals Online (AJOL)
2009-10-26
Oct 26, 2009 ... This article underlines particularly those aspects of Romanian theology that distinguish it from .... world, but first of all with the divine nature common to all the three Persons. ... Religious scepticism (1912), Fighting church (1910), The ecclesiastic problem in .... We have never initiated confessional wars,.
Automatic anterior chamber angle assessment for HD-OCT images.
Tian, Jing; Marziliano, Pina; Baskaran, Mani; Wong, Hong-Tym; Aung, Tin
2011-11-01
Angle-closure glaucoma is a major blinding eye disease and could be detected by measuring the anterior chamber angle in the human eyes. High-definition OCT (Cirrus HD-OCT) is an emerging noninvasive, high-speed, and high-resolution imaging modality for the anterior segment of the eye. Here, we propose a novel algorithm which automatically detects a new landmark, Schwalbe's line, and measures the anterior chamber angle in the HD-OCT images. The distortion caused by refraction is corrected by dewarping the HD-OCT images, and three biometric measurements are defined to quantitatively assess the anterior chamber angle. The proposed algorithm was tested on 40 HD-OCT images of the eye and provided accurate measurements in about 1 second.
Directory of Open Access Journals (Sweden)
Yung-Che Kuo
2018-02-01
Full Text Available Summary: Hypoxia cooperates with endocrine signaling to maintain the symmetric self-renewal proliferation and migration of embryonic germline stem cells (GSCs. However, the lack of an appropriate in vitro cell model has dramatically hindered the understanding of the mechanism underlying this cooperation. Here, using a serum-free system, we demonstrated that hypoxia significantly induced the GSC mesenchymal transition, increased the expression levels of the pluripotent transcription factor OCT4 and migration-associated proteins (SDF-1, CXCR4, IGF-1, and IGF-1R, and activated the cellular expression and translocalization of the CXCR4-downstream proteins ARP3/pFAK. The underlying mechanism involved significant IGF-1/IGF-1R activation of OCT4/CXCR4 expression through HIF-2α regulation. Picropodophyllin-induced inhibition of IGF-1R phosphorylation significantly suppressed hypoxia-induced SDF-1/CXCR4 expression and cell migration. Furthermore, transactivation between IGF-1R and CXCR4 was involved. In summary, we demonstrated that niche hypoxia synergistically cooperates with its associated IGF-1R signaling to regulate the symmetric division (self-renewal proliferation and cell migration of alkaline phosphatase-positive GSCs through HIF-2α-OCT4/CXCR4 during embryogenesis. : In this article, Huang and colleagues demonstrate that niche hypoxia promotes symmetric self-renewal proliferation and migration of PGC-like CD49f+AP+GSCs through IGF-IR regulation. Using a serum-free culture system, the crosstalk between IGF-1R and CXCR4 signaling was discovered. This work demonstrated that embryonic hypoxia synergistically cooperated with IGF-1R signaling to regulate the symmetric self-renewal and migration of PGC-like GSCs through a HIF-2α–OCT4/CXCR4 loop. Keywords: hypoxia, niche, germline stem cells, self-renewal, migration, IGF-1R, HIF-2α, OCT4, SDF-1, CXCR4
Depth-encoded all-fiber swept source polarization sensitive OCT
Wang, Zhao; Lee, Hsiang-Chieh; Ahsen, Osman Oguz; Lee, ByungKun; Choi, WooJhon; Potsaid, Benjamin; Liu, Jonathan; Jayaraman, Vijaysekhar; Cable, Alex; Kraus, Martin F.; Liang, Kaicheng; Hornegger, Joachim; Fujimoto, James G.
2014-01-01
Polarization sensitive optical coherence tomography (PS-OCT) is a functional extension of conventional OCT and can assess depth-resolved tissue birefringence in addition to intensity. Most existing PS-OCT systems are relatively complex and their clinical translation remains difficult. We present a simple and robust all-fiber PS-OCT system based on swept source technology and polarization depth-encoding. Polarization multiplexing was achieved using a polarization maintaining fiber. Polarization sensitive signals were detected using fiber based polarization beam splitters and polarization controllers were used to remove the polarization ambiguity. A simplified post-processing algorithm was proposed for speckle noise reduction relaxing the demand for phase stability. We demonstrated systems design for both ophthalmic and catheter-based PS-OCT. For ophthalmic imaging, we used an optical clock frequency doubling method to extend the imaging range of a commercially available short cavity light source to improve polarization depth-encoding. For catheter based imaging, we demonstrated 200 kHz PS-OCT imaging using a MEMS-tunable vertical cavity surface emitting laser (VCSEL) and a high speed micromotor imaging catheter. The system was demonstrated in human retina, finger and lip imaging, as well as ex vivo swine esophagus and cardiovascular imaging. The all-fiber PS-OCT is easier to implement and maintain compared to previous PS-OCT systems and can be more easily translated to clinical applications due to its robust design. PMID:25401008
2013 Building America Research Planning Meeting Summary
Energy Technology Data Exchange (ETDEWEB)
Metzger, Cheryn E. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Hunt, Stacy [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2014-02-01
The Building America (BA) Research Planning Meeting was held October 28-30, 2013, in Washington, DC. This meeting provides one opportunity each year for the research teams, national laboratories and Department of Energy (DOE) managers to meet in person to share the most pertinent information and collaboration updates. This report documents the presentations, highlights key program updates, and outlines next steps for the program.
International Nuclear Information System (INIS)
Herman, M.; Nichols, A.
1999-07-01
The discussions and conclusions of the First Research Co-ordination Meeting to Update X- and γ-ray Decay Data Standards for Detector Calibration are described in this summary report. The agreed list of radionuclides to be evaluated is given, along with the evaluation procedures and assignment of tasks among participants of the CRP. 14 presentations given at the meeting were indexed separately
The 14th European Immunology Meeting--EFIS 2000. 23-27 September 2000, Poznañ, Poland.
Wysocki, P J; Nawrocki, S; Mackiewicz, A
2001-01-01
The 14th European Immunology Meeting--EFIS 2000, held in Poznan, Poland on 23-27 September 2000, was the last major meeting of European immunologists in the second millennium. This conference was intended to summarise past achievements and to present future prospects in immunology. The philosophy of the scientific program was to fuse fundamental and clinical immunology and give a chance for basic scientists and clinicians to discuss mutual topics in a general view. There were eight state-of-art lectures, 12 'meet an expert' sessions, 20 plenary sessions and 46 workshops. More than 900 works were presented. Significant interest was focused on several aspects of cancer immunology and immunotherapy. EFIS 2000 was accompanied by six pre-congress satellite symposia held in various Polish cities. The topics were, 'Heat shock proteins: immune, stress response and apoptosis' (Gdansk), 'Infectious immunity and vaccines' (Kazimierz Dolny), 'Mononuclear phagocytes in basic and clinical immunology' (Cracow), 'Immunology of reproduction' (Poznan), 'Primary immunodeficiencies' (Warsaw) and 'Glycoimmunology' (Wroclaw).
Heartbeat OCT: in vivo intravascular megahertz-optical coherence tomography
Wang, Tianshi; Pfeiffer, Tom; Regar, Evelyn; Wieser, Wolfgang; van Beusekom, Heleen; Lancee, Charles T.; Springeling, Geert; Krabbendam, Ilona; van der Steen, Antonius F.W.; Huber, Robert; van Soest, Gijs
2015-01-01
Cardiac motion artifacts, non-uniform rotational distortion and undersampling affect the image quality and the diagnostic impact of intravascular optical coherence tomography (IV-OCT). In this study we demonstrate how these limitations of IV-OCT can be addressed by using an imaging system that we called “Heartbeat OCT”, combining a fast Fourier Domain Mode Locked laser, fast pullback, and a micromotor actuated catheter, designed to examine a coronary vessel in less than one cardiac cycle. We acquired in vivo data sets of two coronary arteries in a porcine heart with both Heartbeat OCT, working at 2.88 MHz A-line rate, 4000 frames/s and 100 mm/s pullback speed, and with a commercial system. The in vivo results show that Heartbeat OCT provides faithfully rendered, motion-artifact free, fully sampled vessel wall architecture, unlike the conventional IV-OCT data. We present the Heartbeat OCT system in full technical detail and discuss the steps needed for clinical translation of the technology. PMID:26713214
Tritium inventory in fusion reactors. Summary report of the final research coordination meeting
International Nuclear Information System (INIS)
Clark, R.E.H.
2007-11-01
Detailed discussions were held during the final Research Coordination Meeting (RCM) at IAEA Headquarters on 25-27 September 2006, with the aim of reviewing the work accomplished by the Coordinated Research Project (CRP) on 'Tritium Inventory in Fusion Reactors'. Participants summarized the specific results obtained during the final phase of the CRP, and considered the impact of the data generated on the design of fusion devices. Conclusions were formulated and several specific recommendations for future fusion machines were agreed. The discussions, conclusions and recommendations of the RCM are briefly described in this report. (author)
76 FR 30942 - Meeting of the Presidential Advisory Council on HIV/AIDS; Correction
2011-05-27
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Meeting of the Presidential Advisory Council on HIV/AIDS... Presidential Advisory Council on HIV/AIDS that will be held on Thursday, May 26, 2011, and Friday, May 27, 2011..., Presidential Advisory Council on HIV/AIDS; Phone: (202) 690-5560. More detailed information about PACHA can be...
Polarized triton scattering from 26Mg, 27Al and 28Si at 17 MeV
International Nuclear Information System (INIS)
Hardekopf, R.A.; Brown, R.E.; Correll, F.D.; Ohlsen, G.G.
1980-01-01
Differential-cross-section and analyzing-power angular distributions were measured for 17 MeV tritons elastically scattered from targets of 26 Mg, 27 Al, and 28 Si in the angular range 20 to 160 0 . The experiment was performed at the Los Alamos Scientific Laboratory Van de Graaff facility using the Lamb-shift polarized triton source and the supercube scattering chamber. A pair of detector telescopes with angular resolutions of +-0.4 0 detected the reaction products, with mass identification and storage performed by an on-line computer. The triton beam intensity available at the target was about 70 nA with a polarization of 0.77. The target thicknesses were about 3 mg/cm 2 , although thinner targets were used for the 27 Al forward-angle data
International Nuclear Information System (INIS)
Langley, R.A.
1995-12-01
The proceedings and results of the Final IAEA Research Coordination Meeting on ''Plasma-interaction Induced Erosion of Fusion Reactor Materials'' held on October 9, 10 and 11, 1995 at the IAEA Headquarters in Vienna are briefly described. This report includes a summary of presentations made by the meeting participants, the results of a data survey and needs assessment for the erosion of plasma facing components and in-vessel materials, and recommendations regarding future work. (author). Refs, figs, tabs
2013-08-21
... to Support ATC Winds SC-214 Briefing TOR Changes Other business Sub-Groups meetings Sep 24-26... MET Delivery Architecture Recommendations review Sep 27, Friday, Closing Plenary Sub-Groups reports Appoval for AIS and MET Delivery Architecture Recommendations document to enter FRAC Action item review...
2013-02-27
On February 27, 2013 National Research Council's Committee on Fuel Economy of Light-Duty Vehicles, Phase 2 held a meeting at the John A. Volpe National Transportation Systems Center on the Volpe Model and Other CAFE Issues. The meeting objectives wer...
International Nuclear Information System (INIS)
Dillmann, Iris; Dimitriou, Paraskevi; Singh, Balraj
2014-03-01
A summary is given of the 1st Research Coordination Meeting of the new IAEA Coordinated Research Project (CRP) on Development of a Reference Database for Beta-delayed neutron emission data. Participants presented their work, reviewed the current status of the field with regards to individual precursors and aggregate data, and discussed the scope of the work to be undertaken. A list of priorities and task assignments was produced. (author)
26 CFR 1.163-3 - Deduction for discount on bond issued on or before May 27, 1969.
2010-04-01
... case of a callable bond, at the earlier call date) over the issue price of the bond (as defined in... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deduction for discount on bond issued on or... and Corporations § 1.163-3 Deduction for discount on bond issued on or before May 27, 1969. (a...
OCT investigation of dental lesions
Osiac, Eugen; Popescu, Sanda Mihaela; Scrieciu, Monica; Mercuţ, Rǎzvan; Mercuţ, Veronica; Vǎtu, Mihaela
2018-03-01
There are several important non carious lesions affecting the tooth structure, lesions which may be classified into four clinical forms of dental wear: abfraction, erosion, attrition and abrasion, and different types of root resorption. Search for new, non-invasive and fast methods able to detect and describe such injuries is of utmost importance. Optical coherence tomography (OCT) proved itself as an appropriate investigation method for several medical fields including ophthalmology, dermatology, cardiology etc. Our study reveals OCT preliminary investigations as a promising tool for detecting and evaluating of the mentioned lesions.
Water Reactor Fuel Performance Meeting 2008
International Nuclear Information System (INIS)
2008-10-01
This meeting contains articles of the Water Reactor Fuel Performance Meeting 2008 of Korean Nuclear Society, Atomic Energy Society of Japan, Chinese Nuclear Society, European Nuclear Society and American Nuclear Society. It was held on Oct. 19-23, 2008 in Seoul, Korea and subject of Meeting is 'New Clear' Fuel - A green energy solution. This proceedings is comprised of 5 tracks. The main topic titles of track are as follows: Advances in water reactor fuel technology, Fuel performance and operational experience, Transient fuel behavior and safety-related issues, Fuel cycle, spent fuel storage and transportations and Fuel modeling and analysis. (Yi, J. H.)
Wavelength tunable MEMS VCSELs for OCT imaging
DEFF Research Database (Denmark)
Sahoo, Hitesh Kumar; Ansbæk, Thor; Ottaviano, Luisa
2018-01-01
MEMS VCSELs are one of the most promising swept source (SS) lasers for optical coherence tomography (OCT) and one of the best candidates for future integration with endoscopes, surgical probes and achieving an integrated OCT system. However, the current MEMS-based SS are processed on the III...
Anonymous,
1984-01-01
In the meeting on PCB analyses organized in Ulm, Donau, West Germany, 11-13 April 1984, where the second ringtest 2/1983 (Report 84.27 d.d. 1984- 03-26 ) was discussed, it was decided to organize a next ringtest. In this ringtest identification and quantification of some individual chlorobiphenyls
Curvature correction of retinal OCTs using graph-based geometry detection
Kafieh, Raheleh; Rabbani, Hossein; Abramoff, Michael D.; Sonka, Milan
2013-05-01
In this paper, we present a new algorithm as an enhancement and preprocessing step for acquired optical coherence tomography (OCT) images of the retina. The proposed method is composed of two steps, first of which is a denoising algorithm with wavelet diffusion based on a circular symmetric Laplacian model, and the second part can be described in terms of graph-based geometry detection and curvature correction according to the hyper-reflective complex layer in the retina. The proposed denoising algorithm showed an improvement of contrast-to-noise ratio from 0.89 to 1.49 and an increase of signal-to-noise ratio (OCT image SNR) from 18.27 to 30.43 dB. By applying the proposed method for estimation of the interpolated curve using a full automatic method, the mean ± SD unsigned border positioning error was calculated for normal and abnormal cases. The error values of 2.19 ± 1.25 and 8.53 ± 3.76 µm were detected for 200 randomly selected slices without pathological curvature and 50 randomly selected slices with pathological curvature, respectively. The important aspect of this algorithm is its ability in detection of curvature in strongly pathological images that surpasses previously introduced methods; the method is also fast, compared to the relatively low speed of similar methods.
International Nuclear Information System (INIS)
Clark, R.E.H.
2004-05-01
This report briefly describes the proceedings, conclusions and recommendations of the 2nd Research Co-ordination Meeting (RCM) of the Co-ordinated Research Project (CRP) on 'Atomic and Molecular Data for Fusion Plasma Diagnostics' held on 16-18 June 2003 at IAEA Headquarters, Vienna. During the course of the meeting the progress achieved to data was thoroughly reviewed. It was noted that during the course of the research several new areas of data needs were revealed. During detailed discussions proposals from all participants on ongoing data needs indicated that a one year extension of the CRP would be extremely valuable with an additional RCM to be held in 2004. A specific proposal for such an extension was formulated along with the summary of the results achieved to date. (author)
Remedial action programs annual meeting: Meeting notes
International Nuclear Information System (INIS)
1987-01-01
The US Department of Energy Grand Junction Projects Office was pleased to host the 1987 Remedial Action programs Annual Meeting and herein presents notes from that meeting as prepared (on relatively short notice) by participants. These notes are a summary of the information derived from the workshops, case studies, and ad hoc committee reports rather than formal proceedings. The order of the materials in this report follows the actual sequence of presentations during the annual meeting
2011-09-01
... UNITED STATES INSTITUTE OF PEACE Meeting AGENCY: United States Institute of Peace. Date/Time... Peace Act, Public Law 98-525. Agenda: September 22, 2011 Board Meeting; Approval of Minutes of the One Hundred Fortieth Meeting (June 23-24, 2011) of the Board of Directors; Chairman's Report; President's...
International Nuclear Information System (INIS)
Abriola, Daniel; Dimitriou, Paraskevi; Gurbich, Alexander F.
2013-11-01
A summary is given of a Consultants' Meeting assembled to assess the accuracy of experimental and theoretical nuclear cross-section data for Ion Beam Analysis and the role of benchmarking experiments. The participants discussed the different approaches to assigning uncertainties to evaluated data, and presented results of benchmark experiments performed in their laboratories. They concluded that priority should be given to the validation of cross- section data by benchmark experiments, and recommended that an experts meeting be held to prepare the guidelines, methodology and work program of a future coordinated project on benchmarking.
421--19 Oct 2009 [ Final version].indd
African Journals Online (AJOL)
2009-10-19
Oct 19, 2009 ... keeping; asthma control; documentation; quality. Dates: Received: 05 Feb. 2009. Accepted: 29 July 2009. Published: 19 Oct. 2009. How to cite this article: Du Plessis, J.M. &. Gerber, J.J. 2009, 'Asthma control limitations in selected primary health care clinics', Health SA. Gesongheid 14(1), Art. #421,.
Application of OCT in traumatic macular hole
Directory of Open Access Journals (Sweden)
Wen-Li Fu
2017-12-01
Full Text Available AIM: To observe the application of optical coherence tomography(OCTin the diseases of traumatic macular hole. METHODS: Twenty-five eyes of 23 patients with traumatic macular hole from January 2015 to January 2017 were enrolled in this study, including 9 eyes treated without surgeries, 16 eyes with surgeries. The image features were analyzed using OCT from ZEISS. RESULTS: The OCT characteristics in patients with traumatic macular hole were partial or full-thickness disappearance of the neuro-epithelium. Posterior vitreous detachment was not seen in the traumatic macular hole. OCT examination revealed that 4 eyes had partial detachment of macular hole and 21 eyes had full thickness detachment. Of the twenty-one eyes, 4 eyes had simple macular hole, 10 eyes had macular full-layer division with peripheral nerve epithelium edema, 7 eyes had the macular full-layer hole with the neuro-epithelium localized detachment. In the 25 eyes, 9 eyes did not undergo the surgery, of which 7 eyes were self-healing; 16 eyes were surgically treated. Postoperative OCT showed the macular structure were normal in 12 eyes with the visual acuity improved 3 lines; retinal nerve epithelium were thinning in 4 eyes, visual acuities were not significant improved after surgery. CONCLUSION: OCT examination is necessary for the diagnosis and treatment of traumatic macular hole.
Summary of the Accelerator Meeting
International Nuclear Information System (INIS)
Lia Merminga
2006-01-01
The summary of the paper is: (1) A compelling scientific case is developing for a high luminosity, polarized electron-ion collider, to address fundamental questions in hadron Physics. (2) Much progress over the past years: Design concepts are maturing through innovation and design optimization. (3) Electron cooling is prerequisite for all EIC design scenarios. A rigorous electron cooling R and D program established at BNL. (4) Important to continue collaboration and cross-fertilization of ideas among different design options. (5) Thank you to all the speakers for outstanding and thought-provoking presentations
Quantitative angle-insensitive flow measurement using relative standard deviation OCT.
Zhu, Jiang; Zhang, Buyun; Qi, Li; Wang, Ling; Yang, Qiang; Zhu, Zhuqing; Huo, Tiancheng; Chen, Zhongping
2017-10-30
Incorporating different data processing methods, optical coherence tomography (OCT) has the ability for high-resolution angiography and quantitative flow velocity measurements. However, OCT angiography cannot provide quantitative information of flow velocities, and the velocity measurement based on Doppler OCT requires the determination of Doppler angles, which is a challenge in a complex vascular network. In this study, we report on a relative standard deviation OCT (RSD-OCT) method which provides both vascular network mapping and quantitative information for flow velocities within a wide range of Doppler angles. The RSD values are angle-insensitive within a wide range of angles, and a nearly linear relationship was found between the RSD values and the flow velocities. The RSD-OCT measurement in a rat cortex shows that it can quantify the blood flow velocities as well as map the vascular network in vivo .
Pacific Northwest regional AGU meeting
Hyndman, Roy
The 27th Annual Pacific Northwest Regional American Geophysical Union Meeting, held September 25 and 26, 1980, was hosted by the Pacific Geoscience Centre at the Institute of Ocean Sciences, near Victoria, British Columbia. A total of 79 papers was presented to the 150 registrants in six general sessions: seismology; electromagnetic induction; general geophysics; volcanology; hydrology; and oceanography, and in three special symposia: ‘The Queen Charlotte-Fairweather fault system and other active faults of the Pacific Northwest’ ‘Coastal circulation in the northeast Pacific’ and ‘Studies of the eruption of Mount St. Helens.’
75 FR 52303 - Notice of Meeting; Siskiyou Resource Advisory Committee Meeting at New Location
2010-08-25
... DEPARTMENT OF AGRICULTURE Forest Service Notice of Meeting; Siskiyou Resource Advisory Committee Meeting at New Location SUMMARY: The Siskiyou County Resource Advisory Committee (RAC) will hold its last two meetings in 2010 at a new location. DATES: The meetings will be held on September 20 and October...
STANDING CONCERTATION COMMMITTEE - ORDINARY MEETING ON 26 JUNE 2007
HR Department
2007-01-01
The main items discussed at the meeting of the Standing Concertation Committee on 26 June 2007 included: Mutual Aid Fund The Committee took note of the annual report for 2006 by the Chairman of the Mutual Aid Fund and approved contributions to the Fund’s budget from the Management and the Staff Association and thanked the members of the Fund for their work. Administrative Circular No. 12 A (Rev. 1) - Education Fees The Committee agreed to recommend Administrative Circular No. 12 A entitled "Education Fees" to the Director-General for approval. The circular is applicable to staff, fellows and scientific associates recruited from 1st January 2007 and to staff who were recruited as Local Staff before that date. Further details of reimbursement of school fees will shortly be available in the form of Frequently Asked Questions on the HR Department website. Administrative Circular No. 31 (Rev. 1) - International Indemnity and Non-Resident Allowance The Committee agreed to reco...
Intravitreal Triamcinolone Acetonide for Macular Edema in HLA-B27 Negative Ankylosing Spondylitis
Directory of Open Access Journals (Sweden)
M.M. Moschos
2010-12-01
Full Text Available We report a case of a human leukocyte antigen B27 (HLA-B27-negative patient with cystoid macular edema (CME and ankylosing spondylitis (AS after treatment with triamcinolone acetonide. The patient complained of deterioration of visual acuity of the right eye during the last 10 days. At presentation visual acuity of the right eye was 0.2, and the ophthalmic examination did not reveal any sign of active uveitis. Fluorescein angiography (FA and ocular coherent tomography (OCT showed CME. The left eye was normal with a visual acuity of 0.9. Eight weeks after intravitreal injection of triamcinolone acetonide, visual acuity improved to 0.8 and OCT revealed regression of macular edema. Six months later no recurrence was observed. Our case report indicates for the first time that CME may occur in AS independently of the presence of HLA-B27 and intraocular inflammation. Intravitreal use of triamcinolone acetonide can reduce macular edema and restore visual acuity.
Anonymous,
1984-01-01
In the meeting on PCB analyses organized in Ulm, Donau, West Germany, 11-13 April 1984, where the second ringtest 2/1983 (Report 84.27 d.d. 1984- 03- 26) was discussed, it was decided to organize a next ringtest. In this ringtest identification and quantification of some individual chlorobiphenyls
Transcription factor Oct1 is a somatic and cancer stem cell determinant.
Directory of Open Access Journals (Sweden)
Jessica Maddox
Full Text Available Defining master transcription factors governing somatic and cancer stem cell identity is an important goal. Here we show that the Oct4 paralog Oct1, a transcription factor implicated in stress responses, metabolic control, and poised transcription states, regulates normal and pathologic stem cell function. Oct1(HI cells in the colon and small intestine co-express known stem cell markers. In primary malignant tissue, high Oct1 protein but not mRNA levels strongly correlate with the frequency of CD24(LOCD44(HI cancer-initiating cells. Reducing Oct1 expression via RNAi reduces the proportion of ALDH(HI and dye efflux(HI cells, and increasing Oct1 increases the proportion of ALDH(HI cells. Normal ALDH(HI cells harbor elevated Oct1 protein but not mRNA levels. Functionally, we show that Oct1 promotes tumor engraftment frequency and promotes hematopoietic stem cell engraftment potential in competitive and serial transplants. In addition to previously described Oct1 transcriptional targets, we identify four Oct1 targets associated with the stem cell phenotype. Cumulatively, the data indicate that Oct1 regulates normal and cancer stem cell function.
An automated approach for early detection of diabetic retinopathy using SD-OCT images.
ElTanboly, Ahmed H; Palacio, Agustina; Shalaby, Ahmed M; Switala, Andrew E; Helmy, Omar; Schaal, Shlomit; El-Baz, Ayman
2018-01-01
This study was to demonstrate the feasibility of an automatic approach for early detection of diabetic retinopathy (DR) from SD-OCT images. These scans were prospectively collected from 200 subjects through the fovea then were automatically segmented, into 12 layers. Each layer was characterized by its thickness, tortuosity, and normalized reflectivity. 26 diabetic patients, without DR changes visible by funduscopic examination, were matched with 26 controls, according to age and sex, for purposes of statistical analysis using mixed effects ANOVA. The INL was narrower in diabetes (p = 0.14), while the NFL (p = 0.04) and IZ (p = 0.34) were thicker. Tortuosity of layers NFL through the OPL was greater in diabetes (all p diabetes. In turn, carries the promise to a reliable non-invasive diagnostic tool for early detection of DR.
2012-09-11
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. ACTION: Regular meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held...
40 CFR 35.532 - Requirements summary.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Requirements summary. 35.532 Section 35.532 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE....532 Requirements summary. (a) Applicants and recipients of Performance Partnership Grants must meet...
40 CFR 35.132 - Requirements summary.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Requirements summary. 35.132 Section 35.132 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE... Requirements summary. Applicants and recipients of Performance Partnership Grants must meet: (a) The...
Peinado, Liliana M.; Bloemen, Paul R.; Almasian, Mitra; van Leeuwen, Ton G.; Faber, Dirk J.
2016-03-01
Despite the improvements in early cancer diagnosis, adequate diagnostic tools for early staging of bladder cancer tumors are lacking [1]. MEMS-probes based on optical coherence tomography (OCT) provide cross-sectional imaging with a high-spatial resolution at a high-imaging speed, improving visualization of cancerous tissue [2-3]. Additionally, studies show that the measurement of localized attenuation coefficient allows discrimination between healthy and cancerous tissue [4]. We have designed a new miniaturized MEMS-probe based on OCT that will optimize early diagnosis by improving functional visualization of suspicious lesions in bladder. During the optical design phase of the probe, we have studied the effect of the numerical aperture (NA) on the OCT signal attenuation. For this study, we have employed an InnerVision Santec OCT system with several numerical apertures (25mm, 40mm, 60mm, 100mm, 150mm and 200mm using achromatic lenses). The change in attenuation coefficient was studied using 15 dilutions of intralipid ranging between 6*10-5 volume% and 20 volume%. We obtained the attenuation coefficient from the OCT images at several fixed positions of the focuses using established OCT models (e.g. single scattering with known confocal point spread function (PSF) [5] and multiple scattering using the Extended Huygens Fresnel model [6]). As a result, a non-linear increase of the scattering coefficient as a function of intralipid concentration (due to dependent scattering) was obtained for all numerical apertures. For all intralipid samples, the measured attenuation coefficient decreased with a decrease in NA. Our results suggest a non-negligible influence of the NA on the measured attenuation coefficient. [1] Khochikar MV. Rationale for an early detection program for bladder cancer. Indian J Urol 2011 Apr-Jun; 27(2): 218-225. [2] Sun J and Xie H. Review Article MEMS-Based Endoscopic Optical Coherence Tomography. IJO 2011, Article ID 825629, 12 pages. doi:10
4-D OCT in Developmental Cardiology
Jenkins, Michael W.; Rollins, Andrew M.
Although strong evidence exists to suggest that altered cardiac function can lead to CHDs, few studies have investigated the influential role of cardiac function and biophysical forces on the development of the cardiovascular system due to a lack of proper in vivo imaging tools. 4-D imaging is needed to decipher the complex spatial and temporal patterns of biomechanical forces acting upon the heart. Numerous solutions over the past several years have demonstrated 4-D OCT imaging of the developing cardiovascular system. This chapter will focus on these solutions and explain their context in the evolution of 4-D OCT imaging. The first sections describe the relevant techniques (prospective gating, direct 4-D imaging, retrospective gating), while later sections focus on 4-D Doppler imaging and measurements of force implementing 4-D OCT Doppler. Finally, the techniques are summarized, and some possible future directions are discussed.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Settlements. 1025.26 Section 1025.26... PROCEEDINGS Prehearing Procedures, Motions, Interlocutory Appeals, Summary Judgments, Settlements § 1025.26 Settlements. (a) Availability. Any party shall have the opportunity to submit an offer of settlement to the...
27 CFR 26.263 - Determination of tax on beer.
2010-04-01
... beer. 26.263 Section 26.263 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Procedure at Port of Entry From the Virgin Islands § 26.263 Determination of tax on beer. If the certificate prescribed in § 26.205 covers beer, the beer tax will be collected on the basis of the number of barrels of...
27 CFR 26.264 - Determination of tax on wine.
2010-04-01
... wine. 26.264 Section 26.264 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Procedure at Port of Entry From the Virgin Islands § 26.264 Determination of tax on wine. If the certificate prescribed in § 26.205 covers wine, the wine tax will be collected at the rates imposed by section 5041...
2010-12-07
... FARM CREDIT SYSTEM INSURANCE CORPORATION Regular Meeting AGENCY: Farm Credit System Insurance Corporation Board. ACTION: Regular meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held...
2012-01-18
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation Board; Regular Meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the...
2011-01-20
... Meeting SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held at the offices of the Farm... meeting of the Board will be open to the [[Page 3630
Meeting of senior officials on managing nuclear knowledge. Summary meeting report
International Nuclear Information System (INIS)
2002-01-01
In response to the recommendations of several Agency advisory committees, e.g. INSAG, SAGNE 2002, SAGNA, SAGTAC, to address issues related to nuclear knowledge management, the IAEA convened a meeting on Managing Nuclear Knowledge with senior representatives from Member States. The purpose of the meeting was to sharpen awareness and understanding of the emerging concerns about the maintenance and preservation of knowledge and expertise in nuclear science, technology and applications and to better comprehend the role of the Agency in this process. The meeting was attended by more than 70 participants from 35 Member States and 4 international organizations, representing academic leaders, senior level executives, managers and governmental officials. This report includes statements and recommendation on possible activities to be undertaken by the IAEA
2010-04-01
... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Certain corporations, etc., that are considered to meet the gross income requirements. 1.856-7 Section 1.856-7 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Real Estate Investment...
OCT evaluation of directional atherectomy compared to balloon angioplasty
International Nuclear Information System (INIS)
Marmagkiolis, Konstantinos; Lendel, Vasili; Cilingiroglu, Mehmet
2015-01-01
Directional atherectomy (DA) is one of the most commonly used modalities for the treatment of obstructive femoropopliteal peripheral arterial disease (PAD), especially in patients with large and calcified atherosclerotic plaques. The effect of directional atherectomy to the vascular wall compared to balloon angioplasty by optical coherence tomography (OCT) has not been previously described. We present the first case of OCT after directional atherectomy with SilverHawk followed by angiosculpt balloon angioplasty. - Highlights: • Directional atherectomy avoids the vascular mechanical damage caused by angioplasty balloons and the exposure of stent struts or the potential of stent fracture with stents. • OCT can accurately assess the effect of endovacular interventions to the vessel wall. • Although angiographic results after directional atherectomy are acceptable, OCT use demonstrated suboptimal improvement of the MLA requiring additional balloon angioplasty. • Longer studies are needed to define whether the improved OCT results with angioplasty compared to DA may offer better clinical outcomes.
OCT evaluation of directional atherectomy compared to balloon angioplasty
Energy Technology Data Exchange (ETDEWEB)
Marmagkiolis, Konstantinos [Citizens Memorial Hospital Heart and Vascular Institute, Bolivar, MO (United States); Lendel, Vasili [Arkansas Heart Hospital, Peripheral Vascular Institute, Little Rock, AR (United States); Cilingiroglu, Mehmet, E-mail: mcilingiroglu@yahoo.com [Arkansas Heart Hospital, Peripheral Vascular Institute, Little Rock, AR (United States); Koc University, School of Medicine, Istanbul (Turkey)
2015-09-15
Directional atherectomy (DA) is one of the most commonly used modalities for the treatment of obstructive femoropopliteal peripheral arterial disease (PAD), especially in patients with large and calcified atherosclerotic plaques. The effect of directional atherectomy to the vascular wall compared to balloon angioplasty by optical coherence tomography (OCT) has not been previously described. We present the first case of OCT after directional atherectomy with SilverHawk followed by angiosculpt balloon angioplasty. - Highlights: • Directional atherectomy avoids the vascular mechanical damage caused by angioplasty balloons and the exposure of stent struts or the potential of stent fracture with stents. • OCT can accurately assess the effect of endovacular interventions to the vessel wall. • Although angiographic results after directional atherectomy are acceptable, OCT use demonstrated suboptimal improvement of the MLA requiring additional balloon angioplasty. • Longer studies are needed to define whether the improved OCT results with angioplasty compared to DA may offer better clinical outcomes.
Ansar, Muhammad; Ramzan, Mohammad; Pham, Thanh L.; Yan, Kai; Jamal, Syed Muhammad; Haque, Sayedul; Ahmad, Wasim; Leal, Suzanne M.
2003-01-01
For autosomal recessive nonsyndromic hearing impairment over 30 loci have been mapped and 19 genes have been identified. DFNB38, a novel locus for autosomal recessive nonsyndromic hearing impairment, was localized in a consanguineous Pakistani kindred to 6q26–q27. The affected family members present with profound prelingual sensorineural hearing impairment and use sign language for communications. Linkage was established to microsatellite markers located on chromosome 6q26–q27 (Multipoint lod...
International Nuclear Information System (INIS)
Muir, D.W.; Pashchenko, A.B.
1992-09-01
The present Report contains the Summary of the IAEA Advisory Group Meeting on Nuclear Data for Neutron Multiplication in Fusion-Reactor First-Wall and Blanket Materials, which was hosted by the Southwest Institute of Nuclear physics and Chemistry (SWINPC) at Chengdu, China and held from 19-21 November 1990. This AGM was organized by the IAEA Nuclear Data Section (NDS), with the cooperation and assistance of local organizers at the SWINPC. The papers which the participants prepared for and presented at the meeting will be published as an INDC report. (author)
International Nuclear Information System (INIS)
Braams, B.J.
2013-04-01
Nine experts in the field of plasma-wall interaction on beryllium surfaces together with IAEA staff met at IAEA Headquarters 26-28 September 2012 for the First Research Coordination Meeting of an IAEA Coordinated Research Project on data for erosion and tritium retention in beryllium plasma-facing materials. They described their on-going research, reviewed the main data needs and made plans for coordinated research during the remaining years of the project. The proceedings of the meeting are summarized in this report. (author)
The Edge Detectors Suitable for Retinal OCT Image Segmentation
Directory of Open Access Journals (Sweden)
Su Luo
2017-01-01
Full Text Available Retinal layer thickness measurement offers important information for reliable diagnosis of retinal diseases and for the evaluation of disease development and medical treatment responses. This task critically depends on the accurate edge detection of the retinal layers in OCT images. Here, we intended to search for the most suitable edge detectors for the retinal OCT image segmentation task. The three most promising edge detection algorithms were identified in the related literature: Canny edge detector, the two-pass method, and the EdgeFlow technique. The quantitative evaluation results show that the two-pass method outperforms consistently the Canny detector and the EdgeFlow technique in delineating the retinal layer boundaries in the OCT images. In addition, the mean localization deviation metrics show that the two-pass method caused the smallest edge shifting problem. These findings suggest that the two-pass method is the best among the three algorithms for detecting retinal layer boundaries. The overall better performance of Canny and two-pass methods over EdgeFlow technique implies that the OCT images contain more intensity gradient information than texture changes along the retinal layer boundaries. The results will guide our future efforts in the quantitative analysis of retinal OCT images for the effective use of OCT technologies in the field of ophthalmology.
Energy Technology Data Exchange (ETDEWEB)
Sakuta, Takashi; Minato, Kazuo; Morita, Yasuji; Nishiza, Masahiro; Akatsu, Eiko [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1995-10-01
This is an example of the answers to the 26th and 27th examination problems for certification of the chief technician of nuclear fuel. Short explanations or references are given for each answer. (author).
International Nuclear Information System (INIS)
Sakuta, Takashi; Minato, Kazuo; Morita, Yasuji; Nishiza, Masahiro; Akatsu, Eiko
1995-10-01
This is an example of the answers to the 26th and 27th examination problems for certification of the chief technician of nuclear fuel. Short explanations or references are given for each answer. (author)
International Nuclear Information System (INIS)
Pashchenko, A.B.
1996-09-01
The present report contains the Summary of the Third and Final IAEA Research Co-ordination Meeting (RCM) on ''Improvement of Measurements, Theoretical Computations and Evaluations of Neutron Induced Helium Production Cross Sections'' which was hosted by the Tohoku University and held in Sendai, Japan, from 25 to 29 September 1995. This RCM was organized by the IAEA Nuclear Data Section (NDS), with the co-operation and assistance of local organizers from Tohoku University. Summarized are the proceedings and results of the meeting. The List of Participants and meeting Agenda are included. (author)
International Nuclear Information System (INIS)
Trkov, A.; Greenwood, L.R.; Simakov, S.P.
2013-09-01
In accordance with the recommendations of the International Nuclear Data Committee in May 2012, the Nuclear Data Section of IAEA has initiated a new Coordinated Research Project (CRP number F41031) with the main goal to test, validate and improve the international dosimetry library for fission and fusion (IRDFF). The output of this CRP will be a reference dosimetry database of cross sections and decay data with corresponding documentation. It will serve to the needs of fission, fusion and accelerator applications. The first Research Coordination Meeting (RCM) was held 1 to 5 July 2013 in IAEA. At this meeting, the attendees discussed the objectives of the whole CRP, presented their contributions and elaborated on consolidated recommendations and actions for implementation over the next 1.5 year period. This Summary Report documents the individual contributions and joint decisions made during this meeting. (author)
78 FR 32295 - Commission Meeting
2013-05-29
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: June 20...
77 FR 10599 - Commission Meeting
2012-02-22
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: March 15...
78 FR 12412 - Commission Meeting
2013-02-22
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: March 21...
78 FR 52601 - Commission Meeting
2013-08-23
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the Supplementary Information section of this notice. DATES: September 19, 2013...
77 FR 70204 - Commission Meeting
2012-11-23
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the SUPPLEMENTARY INFORMATION section of this notice. DATES: December 14, 2012...
78 FR 69517 - Commission Meeting
2013-11-19
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the Supplementary Information section of this notice. DATES: December 12, 2013...
77 FR 52106 - Commission Meeting
2012-08-28
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: September 20...
1974-01-08
17. 18 19 2-22 23- 24 25-26 27- 2829 30- 3 WeB Bu . 1 00/7..107 75 757 106/105 1. 82 19 102/01 4 .1 .84 42 1001 99 .0 .0 .1 " 3 92 9? 68/697 . . 1...DATA Pkw’mSSING, BRANCH{~ USAF ETA. PSYCHROMETRIC SUMMARY AIR VIL’ATIER S.iPVICt=/mAC 0’, 231.? NIRTPN ArtB CALIF/SAN F rRNt.fti) NCV 43-71 1 F VP
Curvature correction of retinal OCTs using graph-based geometry detection
International Nuclear Information System (INIS)
Kafieh, Raheleh; Rabbani, Hossein; Abramoff, Michael D; Sonka, Milan
2013-01-01
In this paper, we present a new algorithm as an enhancement and preprocessing step for acquired optical coherence tomography (OCT) images of the retina. The proposed method is composed of two steps, first of which is a denoising algorithm with wavelet diffusion based on a circular symmetric Laplacian model, and the second part can be described in terms of graph-based geometry detection and curvature correction according to the hyper-reflective complex layer in the retina. The proposed denoising algorithm showed an improvement of contrast-to-noise ratio from 0.89 to 1.49 and an increase of signal-to-noise ratio (OCT image SNR) from 18.27 to 30.43 dB. By applying the proposed method for estimation of the interpolated curve using a full automatic method, the mean ± SD unsigned border positioning error was calculated for normal and abnormal cases. The error values of 2.19 ± 1.25 and 8.53 ± 3.76 µm were detected for 200 randomly selected slices without pathological curvature and 50 randomly selected slices with pathological curvature, respectively. The important aspect of this algorithm is its ability in detection of curvature in strongly pathological images that surpasses previously introduced methods; the method is also fast, compared to the relatively low speed of similar methods. (paper)
Deciphering the Sox-Oct partner code by quantitative cooperativity measurements.
Ng, Calista K L; Li, Noel X; Chee, Sheena; Prabhakar, Shyam; Kolatkar, Prasanna R; Jauch, Ralf
2012-06-01
Several Sox-Oct transcription factor (TF) combinations have been shown to cooperate on diverse enhancers to determine cell fates. Here, we developed a method to quantify biochemically the Sox-Oct cooperation and assessed the pairing of the high-mobility group (HMG) domains of 11 Sox TFs with Oct4 on a series of composite DNA elements. This way, we clustered Sox proteins according to their dimerization preferences illustrating that Sox HMG domains evolved different propensities to cooperate with Oct4. Sox2, Sox14, Sox21 and Sox15 strongly cooperate on the canonical element but compete with Oct4 on a recently discovered compressed element. Sry also cooperates on the canonical element but binds additively to the compressed element. In contrast, Sox17 and Sox4 cooperate more strongly on the compressed than on the canonical element. Sox5 and Sox18 show some cooperation on both elements, whereas Sox8 and Sox9 compete on both elements. Testing rationally mutated Sox proteins combined with structural modeling highlights critical amino acids for differential Sox-Oct4 partnerships and demonstrates that the cooperativity correlates with the efficiency in producing induced pluripotent stem cells. Our results suggest selective Sox-Oct partnerships in genome regulation and provide a toolset to study protein cooperation on DNA.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Docket. 102.27 Section 102.27 Foreign Relations... other than the Director of the Office of Aviation and summaries of oral communications prepared in...) All comments submitted under this subpart and placed in the docket, are available for public...
IAEA specialists' meeting on communication and data transfer in NPP 24-26 April 1990, Lyon, France
International Nuclear Information System (INIS)
1990-04-01
The meeting was held within the framework of the programme of the IAEA International Working Group on Nuclear Power Plant Control and Instrumentation. The aim of the meeting was to review experience accumulated by the Member States in the area of design of process control and supervision systems to improve NPP performance and to consider possible recommendations to the agency regarding the above subject. The 73 participants, representing 21 countries and IAEA presented 27 papers Proceedings of the meeting are divided into 5 sessions: process control and supervision applications (new plants and retrofits), part 1 (4 papers); process control and supervision applications (new plants and retrofits), part 2 (7 papers); communication and design aspects, part 3 (6 papers); hardware and software qualification and standardization (6 papers); high reliable architectures (4 papers). A separate abstract was prepared for each of these papers. Refs, figs and tabs
Tyndall AFB, Florida. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.
1982-12-03
8.. 4. o.0I 44 ’ ’O I6F .3 16 .J PSYCHROMETRIC SUMMARY T-WET BULB TEM4PERATURE DEPRESION JF) TOTAL TOTAL F 0 1 2 3 4 5 6 8 9 T10 12 13 ]A 15 6...STATION VATON AM.3 WET BULB TEMPERATURE DEPRESION F1 TOTAL TOTAL (F) 0 1-2 3-4 5-6 7-. 9 10 11. 2 13 14 151. 6 17 1 19 20 21 22 23 24.25-26.27 2.29 30 31
2011-03-31
... the 2008-9 study on Quantitative Risk Assessment of the State Licensed Radioactive Waste Disposal Area... of vitrified high-level radioactive waste (HLW); determination of waste classification of the melter... NUCLEAR WASTE TECHNICAL REVIEW BOARD Board Meeting: April 27, 2011--Amherst, New York; the U.S...
Volumetric three-dimensional reconstruction and segmentation of spectral-domain OCT.
Aaker, Grant D; Gracia, Luis; Myung, Jane S; Borcherding, Vanessa; Banfelder, Jason R; D'Amico, Donald J; Kiss, Szilárd
2011-07-01
Despite advances in optical coherence tomography (OCT), three-dimensional (3D) renderings of OCT images remain limited to scanning consecutive two-dimensional (2D) OCT slices. The authors describe a method of reconstructing 2D OCT data for 3D retinal analysis and visualization in a Computer Assisted Virtual Environment (CAVE). Using customized signal processing software, raw data from 2D slice-based spectral-domain OCT images were rendered into high-resolution 3D images for segmentation and quantification analysis. Reconstructed OCT images were projected onto a four-walled space and viewed through stereoscopic glasses, resulting in a virtual reality perception of the retina. These 3D retinal renderings offer a novel method for segmentation and isolation of volumetric images. The ability to manipulate the images in a virtual reality environment allows visualization of complex spatial relationships that may aid our understanding of retinal pathology. More importantly, these 3D retinal renderings can be viewed, manipulated, and analyzed on traditional 2D monitors independent of the CAVE. Copyright 2011, SLACK Incorporated.
Efficient OCT Image Enhancement Based on Collaborative Shock Filtering.
Liu, Guohua; Wang, Ziyu; Mu, Guoying; Li, Peijin
2018-01-01
Efficient enhancement of noisy optical coherence tomography (OCT) images is a key task for interpreting them correctly. In this paper, to better enhance details and layered structures of a human retina image, we propose a collaborative shock filtering for OCT image denoising and enhancement. Noisy OCT image is first denoised by a collaborative filtering method with new similarity measure, and then the denoised image is sharpened by a shock-type filtering for edge and detail enhancement. For dim OCT images, in order to improve image contrast for the detection of tiny lesions, a gamma transformation is first used to enhance the images within proper gray levels. The proposed method integrating image smoothing and sharpening simultaneously obtains better visual results in experiments.
77 FR 28420 - Commission Meeting
2012-05-14
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the Supplementary Information section of this notice. DATES: June 7, 2012, at 9...
International Nuclear Information System (INIS)
Oblozinsky, P.
1996-03-01
The present report contains the summary of the First Research Co-ordination Meeting on ''Development of Reference Charged Particle Cross Section Data Base for Medical Radioisotope Production'', held at the IAEA Headquarters, Vienna, from 15 to 17 November 1995. The project focuses on monitor reactions and production reactions for gamma emitters and positron emitters induced with light charged particles of incident energies up to about 100 MeV. Summarized are technical discussions and the resulting work plan of the Coordinated Research Programme, including actions and deadlines. Attached are an information sheet on the project, the agenda and a list of participants of the meeting. Also attached is brief information on the adjacent Consultant's Meeting on ''Automated Synthesis Systems for the Cyclotron Production of 18 F and 123 I and their Labeled Radiopharmaceuticals''. (author)
2010-10-01
... 49 Transportation 6 2010-10-01 2010-10-01 false Settlement. 511.26 Section 511.26 Transportation...; Summary Judgment; Settlement § 511.26 Settlement. (a) Applicability. This section applies only to cases of..., 89 Stat. 911 (15 U.S.C. section 2007(3)). Settlement in other cases may be made only in accordance...
27 CFR 6.26 - Indirect interest.
2010-04-01
... OF THE TREASURY LIQUORS âTIED-HOUSEâ Unlawful Inducements Interest in Retail License § 6.26 Indirect interest. Industry member interest in retail licenses includes any interest acquired by corporate officials, partners, employees or other representatives of the industry member. Any interest in a retail license...
Meeting summary housing and registration information
The 1986 Ocean Sciences Meeting of the American Geophysical Union and the American Society of Limnology and Oceanography (ASLO) will be held January 13-17, 1986, in New Orleans, La., at the Fairmont Hotel. Co-sponsoring societies are the Acoustical Society of America (ASA), the American Meteorological Society (AMS), the Marine Technology Society (MTS), and the Institute of Electrical and Electronics Engineers, Oceanic Engineering Society (OES).Some of the most compelling problems in science and technology span two or more disciplines, and this is especially true of oceanography, which is an amalgamation of several sciences with technology. This meeting will cover topics that include physical and biological oceanography, atmospheric sciences, chemical and geological oceanography, underwater acoustics, and ocean technology.
27 CFR 26.222 - Still wines containing carbon dioxide.
2010-04-01
... carbon dioxide. 26.222 Section 26.222 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... ISLANDS Formulas for Products From the Virgin Islands § 26.222 Still wines containing carbon dioxide. (a) General. Still wines may contain not more than 0.392 gram of carbon dioxide per 100 milliliters of wine...
27 CFR 26.52 - Still wines containing carbon dioxide.
2010-04-01
... carbon dioxide. 26.52 Section 26.52 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... ISLANDS Formulas for Products From Puerto Rico § 26.52 Still wines containing carbon dioxide. (a) General. Still wines may contain not more than 0.392 gram of carbon dioxide per 100 milliliters of wine; except...
27 CFR 26.207 - Destruction of marks and brands.
2010-04-01
... brands. 26.207 Section 26.207 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Products Coming Into the United States From the Virgin Islands § 26.207 Destruction of marks and brands. The marks, brands, and serial numbers required by this part to be placed on barrels, casks, or similar...
27 CFR 26.41 - Destruction of marks and brands.
2010-04-01
... brands. 26.41 Section 26.41 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Products Coming Into the United States From Puerto Rico § 26.41 Destruction of marks and brands. The marks, brands, and serial numbers required by this part to be placed on barrels, casks, or similar containers...
Liu, Henry C; Goldenberg, Anne; Chen, Yuchen; Lun, Christina; Wu, Wei; Bush, Kevin T; Balac, Natasha; Rodriguez, Paul; Abagyan, Ruben; Nigam, Sanjay K
2016-10-01
Statistical analysis was performed on physicochemical descriptors of ∼250 drugs known to interact with one or more SLC22 "drug" transporters (i.e., SLC22A6 or OAT1, SLC22A8 or OAT3, SLC22A1 or OCT1, and SLC22A2 or OCT2), followed by application of machine-learning methods and wet laboratory testing of novel predictions. In addition to molecular charge, organic anion transporters (OATs) were found to prefer interacting with planar structures, whereas organic cation transporters (OCTs) interact with more three-dimensional structures (i.e., greater SP3 character). Moreover, compared with OAT1 ligands, OAT3 ligands possess more acyclic tetravalent bonds and have a more zwitterionic/cationic character. In contrast, OCT1 and OCT2 ligands were not clearly distinquishable form one another by the methods employed. Multiple pharmacophore models were generated on the basis of the drugs and, consistent with the machine-learning analyses, one unique pharmacophore created from ligands of OAT3 possessed cationic properties similar to OCT ligands; this was confirmed by quantitative atomic property field analysis. Virtual screening with this pharmacophore, followed by transport assays, identified several cationic drugs that selectively interact with OAT3 but not OAT1. Although the present analysis may be somewhat limited by the need to rely largely on inhibition data for modeling, wet laboratory/in vitro transport studies, as well as analysis of drug/metabolite handling in Oat and Oct knockout animals, support the general validity of the approach-which can also be applied to other SLC and ATP binding cassette drug transporters. This may make it possible to predict the molecular properties of a drug or metabolite necessary for interaction with the transporter(s), thereby enabling better prediction of drug-drug interactions and drug-metabolite interactions. Furthermore, understanding the overlapping specificities of OATs and OCTs in the context of dynamic transporter tissue
Quality control for retinal OCT in multiple sclerosis
DEFF Research Database (Denmark)
Schippling, S; Balk, Lj; Costello, F
2015-01-01
to provide guidance on the use of validated quality control (QC) criteria for the use of OCT in MS research and clinical trials. METHODS: A prospective multi-centre (n = 13) study. Peripapillary ring scan QC rating of an OCT training set (n = 50) was followed by a test set (n = 50). Inter-rater agreement...
Tank Inspection NDE Results for Fiscal Year 2014, Waste Tanks 26, 27, 28 and 33
Energy Technology Data Exchange (ETDEWEB)
Elder, J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Vandekamp, R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2014-09-29
Ultrasonic nondestructive examinations (NDE) were performed on waste storage tanks 26, 27, 28 and 33 at the Savannah River Site as a part of the “In-Service Inspection (ISI) Program for High Level Waste Tanks.” No reportable conditions were identified during these inspections. The results indicate that the implemented corrosion control program continues to effectively mitigate corrosion in the SRS waste tanks. Ultrasonic inspection (UT) is used to detect general wall thinning, pitting and interface attack, as well as vertically oriented cracks through inspection of an 8.5 inch wide strip extending over the accessible height of the primary tank wall and accessible knuckle regions. Welds were also inspected in tanks 27, 28 and 33 with no reportable indications. In a Type III/IIIA primary tank, a complete vertical strip includes scans of five plates (including knuckles) so five “plate/strips” would be completed at each vertical strip location. In FY 2014, a combined total of 79 plate/strips were examined for thickness mapping and crack detection, equating to over 45,000 square inches of area inspected on the primary tank wall. Of the 79 plate/strips examined in FY 2014 all but three have average thicknesses that remain at or above the construction minimum thickness which is nominal thickness minus 0.010 inches. There were no service induced reportable thicknesses or cracking encountered. A total of 2 pits were documented in 2014 with the deepest being 0.032 inches deep. One pit was detected in Tank 27 and one in Tank 33. No pitting was identified in Tanks 26 or 28. The maximum depth of any pit encountered in FY 2014 is 5% of nominal thickness, which is less than the minimum reportable criteria of 25% through-wall for pitting. In Tank 26 two vertical strips were inspected, as required by the ISI Program, due to tank conditions being outside normal chemistry controls for more than 3 months. Tank 28 had an area of localized thinning on the exterior wall of the
OCT angiography of acute non-arteritic anterior ischemic optic neuropathy.
Rougier, M-B; Delyfer, M-N; Korobelnik, J-F
2017-02-01
To describe changes of the retinal peripapillary microvasculature on optical coherence tomography angiography (OCT-A) in non-arteritic anterior ischemic optic (NAION) neuropathy. Observational study of 10 patients at the acute phase of NAION. OCT-A was performed using a 3mm×3mm square centered on the optic disc (Cirrus HD-OCT with Angioplex, Carl Zeiss Meditec, Dublin, CA). A qualitative comparison was made with the healthy fellow eye of each patient. All patients had a fluorescein angiography (HRA2, Heidelberg, Germany) and a visual field examination (Octopus 101 ® , Haag-Streit, USA). In the affected eyes, OCT-A showed clear modifications in the radial peripapillary network. In all these eyes, a focal disappearance of the superficial capillary radial pattern was present, twisted and irregular. In 8 eyes, there was also a lack of vascularization in some focal areas, appearing as dark areas. No correlation was found between the topography of the vascular alteration shown on OCT-A and visual field pattern defects. OCT-A is a new imaging technology able to demonstrate easily and safely the changes in the peripapillary capillary network during the acute phase of NAION. These changes are likely related to a decrease of the prelaminar optic nerve blood flow during the acute phase of NAION. Visual field defects are not correlated with OCT-A images, suggesting that they may be due mainly to disturbances in posterior ciliary artery blood flow. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Assessing idiopathic pulmonary fibrosis (IPF) with bronchoscopic OCT (Conference Presentation)
Hariri, Lida P.; Adams, David C.; Colby, Thomas V.; Tager, Andrew M.; Suter, Melissa J.
2016-03-01
Idiopathic pulmonary fibrosis (IPF) is a progressive, fatal form of fibrotic lung disease, with a 3 year survival rate of 50%. Diagnostic certainty of IPF is essential to determine the most effective therapy for patients, but often requires surgery to resect lung tissue and look for microscopic honeycombing not seen on chest computed tomography (CT). Unfortunately, surgical lung resection has high risks of associated morbidity and mortality in this patient population. We aim to determine whether bronchoscopic optical coherence tomography (OCT) can serve as a novel, low-risk paradigm for in vivo IPF diagnosis without surgery or tissue removal. OCT provides rapid 3D visualization of large tissue volumes with microscopic resolutions well beyond the capabilities of CT. We have designed bronchoscopic OCT catheters to effectively and safely access the peripheral lung, and conducted in vivo peripheral lung imaging in patients, including those with pulmonary fibrosis. We utilized these OCT catheters to perform bronchoscopic imaging in lung tissue from patients with pulmonary fibrosis to determine if bronchoscopic OCT could successfully visualize features of IPF through the peripheral airways. OCT was able to visualize characteristic features of IPF through the airway, including microscopic honeycombing (< 1 mm diameter) not visible by CT, dense peripheral fibrosis, and spatial disease heterogeneity. These findings support the potential of bronchoscopic OCT as a minimally-invasive method for in vivo IPF diagnosis. However, future clinical studies are needed to validate these findings.
2013-01-23
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the offices of the Farm...
2010-09-02
... FARM CREDIT SYSTEM INSURANCE CORPORATION Regular Meeting AGENCY: Farm Credit System Insurance Corporation Board. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the offices of the Farm...
2011-02-18
... DEPARTMENT OF THE TREASURY United States Mint Public Meeting ACTION: Notification of Citizens Coinage Advisory Committee March 1, 2011, Public Meeting. SUMMARY: Pursuant to United States Code, Title... (CCAC) public meeting scheduled for March 1, 2011. Date: March 1, 2011. Time: 10 a.m. to 1 p.m. Location...
Distinctive expression pattern of OCT4 variants in different types of breast cancer.
Soheili, Saamaaneh; Asadi, Malek Hossein; Farsinejad, Alireza
2017-01-01
OCT4 is a key regulator of self-renewal and pluripotency in embryonic stem cells which can potentially encode three spliced variants designated OCT4A, OCT4B and OCT4B1. Based on cancer stem cell concept, it is suggested that the stemness factors misexpressed in cancer cells and potentially is involved in tumorigenesis. Accordingly, in this study, we investigated the potential expression of OCT4 variants in breast cancer tissues. A total of 94 tumoral and peritumoral breast specimens were evaluated with respect to the expression of OCT4 variants using quantitative RT-PCR and immunohistochemical (IHC) analysis. We detected the expression of OCT4 variants in breast tumor tissues with no or very low levels of expression in peritumoral samples of the same patients. While OCT4B was highly expressed in lobular type of breast cancer, OCT4A and OCTB1 variants are highly expressed in low grade (I and II) ductal tumors. Furthermore, the results of this study revealed a considerable association between the expression level of OCT4 variants and the expression of ER, PR, Her2 and P53 factors. All data demonstrated a distinctive expression pattern of OCT4 spliced variants in different types of breast cancer and provide further evidence for the involvement of embryonic genes in carcinogenesis.
Technical training - places available
2012-01-01
If you would like more information on a course, or for any other inquiry/suggestions, please contact Technical.Training@cern.ch Valeria Perez Reale, Learning Specialist, Technical Programme Coordinator (Tel.: 62424) Eva Stern and Elise Romero, Technical Training Administration (Tel.: 74924) HR Department »Electronics design Next Session Duration Language Availability Comprehensive VHDL for FPGA Design 08-Oct-12 to 12-Oct-12 5 days English 3 places available Foundations of Electromagnetism and Magnet Design (EMAG) 14-Nov-12 to 27-Nov-12 6 days English 20 places available Impacts de la suppression du plomb (RoHS) en électronique 26-Oct-12 to 26-Oct-12 8 hours French 15 places available Introduction to VHDL 10-Oct-12 to 11-Oct-12 2 days English 7 places available LabVIEW Real Time and FPGA 13-Nov-12 to 16-Nov-12 5 days French 5 places available »Mechanical design Next Se...
Miniaturized Fourier-plane fiber scanner for OCT endoscopy
International Nuclear Information System (INIS)
Vilches, Sergio; Kretschmer, Simon; Ataman, Çağlar; Zappe, Hans
2017-01-01
A forward-looking endoscopic optical coherence tomography (OCT) probe featuring a Fourier-plane fiber scanner is designed, manufactured and characterized. In contrast to common image-plane fiber scanners, the Fourier-plane scanner is a telecentric arrangement that eliminates vignetting and spatial resolution variations across the image plane. To scan the OCT beam in a spiral pattern, a tubular piezoelectric actuator is used to resonate an optical fiber bearing a collimating GRIN lens at its tip. The free-end of the GRIN lens sits at the back focal plane of an objective lens, such that its rotation replicates the beam angles in the collimated region of a classical telecentric 4f optical system. Such an optical arrangement inherently has a low numerical aperture combined with a relatively large field-of-view, rendering it particularly useful for endoscopic OCT imaging. Furthermore, the optical train of the Fourier-plane scanner is shorter than that of a comparable image-plane scanner by one focal length of the objective lens, significantly shortening the final arrangement. As a result, enclosed within a 3D printed housing of 2.5 mm outer diameter and 15 mm total length, the developed probe is the most compact forward-looking endoscopic OCT imager to date. Due to its compact form factor and compatibility with real-time OCT imaging, the developed probe is also ideal for use in the working channel of flexible endoscopes as a potential optical biopsy tool. (paper)
Miniaturized Fourier-plane fiber scanner for OCT endoscopy
Vilches, Sergio; Kretschmer, Simon; Ataman, Çağlar; Zappe, Hans
2017-10-01
A forward-looking endoscopic optical coherence tomography (OCT) probe featuring a Fourier-plane fiber scanner is designed, manufactured and characterized. In contrast to common image-plane fiber scanners, the Fourier-plane scanner is a telecentric arrangement that eliminates vignetting and spatial resolution variations across the image plane. To scan the OCT beam in a spiral pattern, a tubular piezoelectric actuator is used to resonate an optical fiber bearing a collimating GRIN lens at its tip. The free-end of the GRIN lens sits at the back focal plane of an objective lens, such that its rotation replicates the beam angles in the collimated region of a classical telecentric 4f optical system. Such an optical arrangement inherently has a low numerical aperture combined with a relatively large field-of-view, rendering it particularly useful for endoscopic OCT imaging. Furthermore, the optical train of the Fourier-plane scanner is shorter than that of a comparable image-plane scanner by one focal length of the objective lens, significantly shortening the final arrangement. As a result, enclosed within a 3D printed housing of 2.5 mm outer diameter and 15 mm total length, the developed probe is the most compact forward-looking endoscopic OCT imager to date. Due to its compact form factor and compatibility with real-time OCT imaging, the developed probe is also ideal for use in the working channel of flexible endoscopes as a potential optical biopsy tool.
Experiment list: SRX977384 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NA 47241296,98.3,15.4,813 GSM1648635: input DNA day3; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 3days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtTA
Experiment list: SRX977387 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NA 56426857,98.7,10.2,674 GSM1648638: input DNA day11; Mus musculus; ChIP-Seq source_name=reprogramming inte...rmediate after 11days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rt
Experiment list: SRX977385 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NA 58688448,98.6,12.6,1031 GSM1648636: input DNA day5; Mus musculus; ChIP-Seq source_name=reprogramming inte...rmediate after 5days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT
Experiment list: SRX977386 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NA 53476648,98.4,14.3,878 GSM1648637: input DNA day7; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 7days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtTA
Experiment list: SRX977388 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NA 56072187,98.6,9.2,704 GSM1648639: input DNA day15; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 15days of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT
Experiment list: SRX977383 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NA 59099899,98.6,14.0,974 GSM1648634: input DNA day1; Mus musculus; ChIP-Seq source_name=reprogramming inter...mediate after 24hour of induction || cell type=reprogramming intermediate || genotype=Oct4-GFP/ Rosa26-M2rtT
Heartbeat OCT: In vivo intravascular megahertz-optical coherence tomography
T. Wang (Tianshi); A.F.H. Pfeiffer (Andreas); E.S. Regar (Eveline); W. Wieser (Wolfgang); H.M.M. van Beusekom (Heleen); C.T. Lancée (Charles); T. Springeling (Tirza); I. Krabbendam (Ilona); A.F.W. van der Steen (Ton); R. Huber (Roman); G. van Soest (Gijs)
2015-01-01
textabstractCardiac motion artifacts, non-uniform rotational distortion and undersampling affect the image quality and the diagnostic impact of intravascular optical coherence tomography (IV-OCT). In this study we demonstrate how these limitations of IV-OCT can be addressed by using an imaging
Towards the use of OCT angiography in clinical dermatology
Baran, Utku; Choi, Woo June; Wang, Ruikang K.
2016-02-01
Optical coherence tomography (OCT) is a popular imaging technique used in ophthalmology, and on the way to become clinically viable alternative in dermatology due to its capability of acquiring histopathology level images of in vivo tissue, noninvasively. In this study, we demonstrate the capabilities of OCT-based angiography (OMAG) in detecting high-resolution, volumetric structural and microvascular features of in vivo human skin with various conditions using a swept source OCT system that operates on a central wavelength of 1310 nm with an A-line rate of 100 kHz. OMAG images provide detailed in vivo visualization of microvasculature of abnormal human skin conditions from face, chest and belly. Moreover, the progress of wound healing on human skin from arm is monitored during longitudinal wound healing process. The presented results promise the clinical use of OCT angiography in treatment of prevalent cutaneous diseases within human skin, in vivo.
75 FR 17167 - Sunshine Act Meetings; Correction
2010-04-05
... NATIONAL COUNCIL ON DISABILITY Sunshine Act Meetings; Correction AGENCY: National Council on Disability. ACTION: Notice; correction. Type: Quarterly meeting. SUMMARY: NCD published a Sunshine Act Meeting Notice in the Federal Register on March 11, 2010, notifying the public of a quarterly meeting in...
Dentistry investigations of teeth and dental prostheses using OCT
Sinescu, C.; Duma, V.-F.; Canjau, S.; Dobre, G.; Demian, D.; Cernat, R.; Negrutiu, M. L.; Todea, C.; Topala, F. I.; Hutiu, Gh.; Bradu, A.; Podoleanu, A. G.
2016-04-01
We present some of our recent investigations in Dental Medicine using Optical Coherence Tomography (OCT). Time Domain (TD), Spectral Domain (SD), and Swept Source (SS) OCT in-house developed systems are being used, for both ex vivo and in vivo investigations in the oral cavity. We study ex vivo the interface between the tooth and the dental sealant and demonstrate the limitations of the X-rays investigations that are now the gold standard for such procedures. Using OCT, defects in the interface that cannot be identified in radiographs can be determined both as position and magnitude. The drilling process of teeth can also be characterized in real time using OCT, to monitor the remaining dentin thickness (RDT) in order to avoid opening the pulp chamber. We demonstrate in this respect that an RDT of 0.5 mm is the minimum value to assure the integrity of the dentin wall between the drilled cavity and the pulp chamber; at an RDT of 0.3 mm or less a fracture is initiated, the dentin is punctured and endodontic treatment must follow. In vivo OCT investigations in the oral cavity were also performed (i.e., for metalloceramic prostheses and for ceramic inlay tooth interfaces), with the low cost, light weight and versatile handheld probes with 1D galvoscanners that we have developed and applied for a range of in-house developed OCT systems, in various clinical applications. They are briefly discussed, as well as some of our current and future work in the field, including for studies of soft tissue in the mouth.
On-chip Mach-Zehnder interferometer for OCT systems
van Leeuwen, Ton G.; Akca, Imran B.; Angelou, Nikolaos; Weiss, Nicolas; Hoekman, Marcel; Leinse, Arne; Heideman, Rene G.
2018-04-01
By using integrated optics, it is possible to reduce the size and cost of a bulky optical coherence tomography (OCT) system. One of the OCT components that can be implemented on-chip is the interferometer. In this work, we present the design and characterization of a Mach-Zehnder interferometer consisting of the wavelength-independent splitters and an on-chip reference arm. The Si3N4 was chosen as the material platform as it can provide low losses while keeping the device size small. The device was characterized by using a home-built swept source OCT system. A sensitivity value of 83 dB, an axial resolution of 15.2 μm (in air) and a depth range of 2.5 mm (in air) were all obtained.
A multi-axis electrothermal micromirror for a miniaturized OCT system
Izhar, U.
2011-06-01
We report on the development of a low power thermally actuated bi-axis SOI micromirror that is capable of performing angular and vertical scans for optical coherence tomography (OCT) applications. The device consists of a mirror with an aluminum coating over a 3 μm thick single crystal silicon base, aluminum/polysilicon electrothermal actuators with embedded heaters and polysilicon flexural connectors. In scanning mode, this mirror can satisfy our target specification of 5° angle at the low power of 1.7 mW with a temperature increase of 16.5 °C ± 7 °C from ambient in the actuator. Furthermore, a maximum angle of 32° has been achieved at 12 mW. In piston mode, it can reach vertical displacements of up to 131 μm at 12 mW with the temperature increase of 16.5 °C ± 7 °C from ambient in the actuator. The scanning speed for the mirror has been measured and the time response of the mirror is found to be 100 ms. The curvature of the mirror is found to be 2.4 mm ± 0.26 mm with a roughness of 100 nm ± 20 nm. Due to low driving power and moderate temperatures developed during its operation, this device can potentially be integrated with broadband light source, photodetector and interferometery system, to form a fully integrated OCT system on GaAs substrate. © 2011 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-04-01
This report summarizes a meeting held on February 19, 1997, in Washington, D.C. The meeting was held primarily to exchange information among the contractors involved in the U.S. Department of Energy`s efforts to improve the safety of Soviet-designed nuclear power plants. Previous meetings have been held on December 5-6, 1995, and May 22, 1996. The meetings are sponsored by the U.S. Department of Energy and coordinated by the Pacific Northwest National Laboratory. The U.S. Department of Energy works with countries to increase the level of safety at 63 Soviet-designed nuclear reactors operating in Armenia, Bulgaria, the Czech Republic, Hungary, Lithuania, Russia, Slovakia, and Ukraine. The work is implemented largely by commercial companies and individuals who provide technologies and services to the countries with Soviet-designed nuclear power plants. Attending the meeting were 71 representatives of commercial contractors, the U.S. Department of Energy, the U.S. Department of State, national laboratories, and other federal agencies. The presentations and discussions that occurred during the exchange are summarized in this report. While this report captures the general presentation and discussion points covered at the meeting, it is not a verbatim, inclusive record. To make the report useful, information presented at the meeting has been expanded to clarify issues, respond to attendees` requests, or place discussion points in a broader programmatic context. Appendixes A through F contain the meeting agenda, list of attendees, copies of presentation visuals and handouts, the Strategy Document discussed at the meeting, and a summary of attendees` post-meeting evaluation comments. As with past information exchanges, the participants found this meeting valuable and useful. In response to the participant`s requests, a fourth information exchange will be held later in 1997.
International Nuclear Information System (INIS)
1997-04-01
This report summarizes a meeting held on February 19, 1997, in Washington, D.C. The meeting was held primarily to exchange information among the contractors involved in the U.S. Department of Energy's efforts to improve the safety of Soviet-designed nuclear power plants. Previous meetings have been held on December 5-6, 1995, and May 22, 1996. The meetings are sponsored by the U.S. Department of Energy and coordinated by the Pacific Northwest National Laboratory. The U.S. Department of Energy works with countries to increase the level of safety at 63 Soviet-designed nuclear reactors operating in Armenia, Bulgaria, the Czech Republic, Hungary, Lithuania, Russia, Slovakia, and Ukraine. The work is implemented largely by commercial companies and individuals who provide technologies and services to the countries with Soviet-designed nuclear power plants. Attending the meeting were 71 representatives of commercial contractors, the U.S. Department of Energy, the U.S. Department of State, national laboratories, and other federal agencies. The presentations and discussions that occurred during the exchange are summarized in this report. While this report captures the general presentation and discussion points covered at the meeting, it is not a verbatim, inclusive record. To make the report useful, information presented at the meeting has been expanded to clarify issues, respond to attendees' requests, or place discussion points in a broader programmatic context. Appendixes A through F contain the meeting agenda, list of attendees, copies of presentation visuals and handouts, the Strategy Document discussed at the meeting, and a summary of attendees' post-meeting evaluation comments. As with past information exchanges, the participants found this meeting valuable and useful. In response to the participant's requests, a fourth information exchange will be held later in 1997
Why choroid vessels appear dark in clinical OCT images
Kirby, Mitchell A.; Li, Chenxi; Choi, Woo June; Gregori, Giovanni; Rosenfeld, Philip; Wang, Ruikang
2018-02-01
With the onset of clinically available spectral domain (SD-OCT) and swept source (SS-OCT) systems, clinicians are now easily able to recognize sub retinal microstructure and vascularization in the choroidal and scleral regions. As the bloodrich choroid supplies nutrients to the upper retinal layers, the ability to monitor choroid function accurately is of vital importance for clinical assessment of retinal health. However, the physical appearance of the choroid blood vessels (darker under a healthy Retinal Pigmented Epithelium (RPE) compared to regions displaying an RPE atrophic lesion) has led to confusion within the OCT ophthalmic community. The differences in appearance between each region in the OCT image may be interpreted as different vascular patterns when the vascular networks are in fact very similar. To explain this circumstance, we simulate light scattering phenomena in the RPE and Choroid complexes using the finite difference time domain (FDTD) method. The simulation results are then used to describe and validate imaging features in a controlled multi-layered tissue phantom designed to replicate human RPE, choroid, and whole blood microstructure. Essentially, the results indicate that the strength of the OCT signal from choroidal vasculature is dependent on the health and function of the RPE, and may not necessarily directly reflect the health and function of the choroidal vasculature.
A comparative study on OCT before and after the operation for vitreomacular traction syndrome
Directory of Open Access Journals (Sweden)
Shu-Qi Song
2017-07-01
Full Text Available AIM: To make a contrast and then analyze the difference of optical coherence tomography(OCTbefore and after vitreomacular traction syndrome(VTSwas performed. METHODS: The clinical date of 11 evaluable eyes of 11 patients with VTS who were diagnosed by OCT and underwent 25G vitreous surgery from January 2013 to January 2014 were retrospectively analyzed. Patients were followed up for an average of 6mo, to observe the visual acuity and OCT examination of the patient before and after operation. We compared the changes of retinal thickness and local morphology before and after operation.RESULTS: After vitreous retraction, 6 eyes improved, 2 eyes do not improve. One eye received macular membrane traction, in the operation the macular epiretinal membrane peeling, retrial membrane stripping and the triamcinolone acetonide intravitreal injection were given, but after the operation, the vision does not improve. Two eyes received vitreous combined with retinal macular membrane traction. In the operation, macular epiretinal membrane stripping was given, after the operation, visual acuity improved. The proportion of those with visual acuity of 0.1 or more increased from 46% before to 73% after the operation. Before operations, the mean central macular thickness was 619.27±195.13μm, 239.12±143.84μm after, which decreased significantly(PCONCLUSION: Vitrectomy can effectively relieve the vitreous traction of the macula, and can prevent further decline in visual acuity and reduce macular edema as well as improve the visual acuity of some patients. So, OCT has important guiding significance on the diagnosis and prognosis of this group.
Directory of Open Access Journals (Sweden)
Dario Nicetto
Full Text Available Post-translational modifications (PTMs of histones exert fundamental roles in regulating gene expression. During development, groups of PTMs are constrained by unknown mechanisms into combinatorial patterns, which facilitate transitions from uncommitted embryonic cells into differentiated somatic cell lineages. Repressive histone modifications such as H3K9me3 or H3K27me3 have been investigated in detail, but the role of H4K20me3 in development is currently unknown. Here we show that Xenopus laevis Suv4-20h1 and h2 histone methyltransferases (HMTases are essential for induction and differentiation of the neuroectoderm. Morpholino-mediated knockdown of the two HMTases leads to a selective and specific downregulation of genes controlling neural induction, thereby effectively blocking differentiation of the neuroectoderm. Global transcriptome analysis supports the notion that these effects arise from the transcriptional deregulation of specific genes rather than widespread, pleiotropic effects. Interestingly, morphant embryos fail to repress the Oct4-related Xenopus gene Oct-25. We validate Oct-25 as a direct target of xSu4-20h enzyme mediated gene repression, showing by chromatin immunoprecipitaton that it is decorated with the H4K20me3 mark downstream of the promoter in normal, but not in double-morphant, embryos. Since knockdown of Oct-25 protein significantly rescues the neural differentiation defect in xSuv4-20h double-morphant embryos, we conclude that the epistatic relationship between Suv4-20h enzymes and Oct-25 controls the transit from pluripotent to differentiation-competent neural cells. Consistent with these results in Xenopus, murine Suv4-20h1/h2 double-knockout embryonic stem (DKO ES cells exhibit increased Oct4 protein levels before and during EB formation, and reveal a compromised and biased capacity for in vitro differentiation, when compared to normal ES cells. Together, these results suggest a regulatory mechanism, conserved
Sauzay, C; White-Koning, M; Hennebelle, I; Deluche, T; Delmas, C; Imbs, D C; Chatelut, E; Thomas, F
2016-08-01
We hypothesized that pazopanib is an inhibitor of cisplatin renal transporters OCT2, MATE1 and MATE2-K based on previous studies demonstrating an interaction between tyrosine kinase inhibitors and these transporters. Because several combinations of targeted therapies and cytotoxics are currently in development for cancer treatment, such an interaction is worth investigating. Experiments on HEK293 cells stably transfected to express OCT2, MATE1, MATE2-K or an empty vector (EV) were conducted. The inhibitory effect of pazopanib on these transporters was measured using the uptake of fluorescent substrate ASP+ and cisplatin in the different cell lines. The effect of pazopanib on cisplatin-induced cytotoxicity was also evaluated. A decrease of ASP+ uptake was observed in OCT2-HEK, MATE1-HEK and MATE2K-HEK cell lines after addition of pazopanib at increasing concentrations. Pazopanib inhibited cisplatin specific uptake in OCT2-HEK, MATE1-HEK and MATE2K-HEK lines. Cytotoxicity experiments showed that co-incubation of cisplatin with pazopanib multiplied up to 2.7, 2.4 and 1.6 times the EC50 values of cisplatin in OCT2-HEK, MATE1-HEK and MATE2K-HEK cell lines respectively, reaching about the same values as in EV-HEK cells. To conclude, pazopanib inhibits OCT2, MATE1 and MATE2-K, which are involved in cisplatin secretion into urine. The combination of these two drugs may lead to an interaction and increase the cisplatin-induced systemic toxicity. Given the wide variability of plasma pazopanib concentrations observed in vivo, the interaction may occur in a clinical setting, particularly in overexposed patients. The existence of a drug-drug interaction should be investigated when pazopanib is associated with a substrate of these transporters. Copyright © 2016 Elsevier Ltd. All rights reserved.
Proceedings of the 5th meeting on ultra high vacuum techniques for accelerators and storage rings
International Nuclear Information System (INIS)
Horikoshi, Gen-ichi
1984-08-01
This is the proceedings of the 5th meeting on UHV Techniques for Accelerators and Storage Rings held at KEK, March 26-27, 1984. More than 110 vacuum scientists attended the meeting, and 23 reports were presented. Main subjects were, of course, concerning with the vacuum systems for large accelerators and plasma devices under planning or construction in Japan. At the same time, many reports on the general problems of vacumm science were also presented. The subjects of these reports were outgassing phenomenon, surface problems, new type UHV pumps and others. (author)
Quasi-simultaneous OCT en-face imaging with two different depth resolutions
International Nuclear Information System (INIS)
Podoleanu, Adrian Gh; Cucu, Radu G; Rosen, Richard B; Dobre, George M; Rogers, John A; Jackson, David A
2003-01-01
We report a system capable of acquiring two quasi-simultaneous en-face optical coherence tomography (OCT) images of different depth resolution (one better than 20 μm and the other between 80 and 330 μm) at a frame rate of 2 Hz. The larger depth resolution image makes it ideal for target positioning in the OCT imaging of moving organs, such as eye fundus and cornea, as well as in the alignment of stacks of en-face OCT images. This role is similar to that of the confocal channel in a previously reported dual channel OCT/confocal imaging instrument. The system presented operates as a dual channel imaging instrument, where both channels operate on the OCT principle. We illustrate the functionality of the system with examples from a coin, skin from a finger and optic nerve in vivo
Summaries of poster contributions
International Nuclear Information System (INIS)
1981-01-01
The 10. meeting covered subjects on the application of electron microscopy in numerous fields such as biology and medicine, solid state physics, semiconductor research and production, crystallography, materials science, and chemistry of polymers. 174 summaries of poster contributions are included
The octopamine receptor Octβ2R regulates ovulation in Drosophila melanogaster.
Directory of Open Access Journals (Sweden)
Junghwa Lim
Full Text Available Oviposition is induced upon mating in most insects. Ovulation is a primary step in oviposition, representing an important target to control insect pests and vectors, but limited information is available on the underlying mechanism. Here we report that the beta adrenergic-like octopamine receptor Octβ2R serves as a key signaling molecule for ovulation and recruits protein kinase A and Ca(2+/calmodulin-sensitive kinase II as downstream effectors for this activity. We found that the octβ2r homozygous mutant females are sterile. They displayed normal courtship, copulation, sperm storage and post-mating rejection behavior but were unable to lay eggs. We have previously shown that octopamine neurons in the abdominal ganglion innervate the oviduct epithelium. Consistently, restored expression of Octβ2R in oviduct epithelial cells was sufficient to reinstate ovulation and full fecundity in the octβ2r mutant females, demonstrating that the oviduct epithelium is a major site of Octβ2R's function in oviposition. We also found that overexpression of the protein kinase A catalytic subunit or Ca(2+/calmodulin-sensitive protein kinase II led to partial rescue of octβ2r's sterility. This suggests that Octβ2R activates cAMP as well as additional effectors including Ca(2+/calmodulin-sensitive protein kinase II for oviposition. All three known beta adrenergic-like octopamine receptors stimulate cAMP production in vitro. Octβ1R, when ectopically expressed in the octβ2r's oviduct epithelium, fully reinstated ovulation and fecundity. Ectopically expressed Octβ3R, on the other hand, partly restored ovulation and fecundity while OAMB-K3 and OAMB-AS that increase Ca(2+ levels yielded partial rescue of ovulation but not fecundity deficit. These observations suggest that Octβ2R have distinct signaling capacities in vivo and activate multiple signaling pathways to induce egg laying. The findings reported here narrow the knowledge gap and offer insight into novel
Oct4 targets regulatory nodes to modulate stem cell function.
Directory of Open Access Journals (Sweden)
Pearl A Campbell
2007-06-01
Full Text Available Stem cells are characterized by two defining features, the ability to self-renew and to differentiate into highly specialized cell types. The POU homeodomain transcription factor Oct4 (Pou5f1 is an essential mediator of the embryonic stem cell state and has been implicated in lineage specific differentiation, adult stem cell identity, and cancer. Recent description of the regulatory networks which maintain 'ES' have highlighted a dual role for Oct4 in the transcriptional activation of genes required to maintain self-renewal and pluripotency while concomitantly repressing genes which facilitate lineage specific differentiation. However, the molecular mechanism by which Oct4 mediates differential activation or repression at these loci to either maintain stem cell identity or facilitate the emergence of alternate transcriptional programs required for the realization of lineage remains to be elucidated. To further investigate Oct4 function, we employed gene expression profiling together with a robust statistical analysis to identify genes highly correlated to Oct4. Gene Ontology analysis to categorize overrepresented genes has led to the identification of themes which may prove essential to stem cell identity, including chromatin structure, nuclear architecture, cell cycle control, DNA repair, and apoptosis. Our experiments have identified previously unappreciated roles for Oct4 for firstly, regulating chromatin structure in a state consistent with self-renewal and pluripotency, and secondly, facilitating the expression of genes that keeps the cell poised to respond to cues that lead to differentiation. Together, these data define the mechanism by which Oct4 orchestrates cellular regulatory pathways to enforce the stem cell state and provides important insight into stem cell function and cancer.
Graham, Melanie L; Ziegelhofer, Tracy; Ehrmann, Jon
2018-04-11
The 33rd Annual Meeting of the Academy of Surgical Research was held from October 4 to 6, 2017 in Las Vegas, Nevada. The meeting welcomed >160 participants from 27 different states and five countries representing the organization's diverse membership of technicians, veterinarians, medical doctors, and biomedical researchers. The Academy's annual meeting is focused on promoting the advancement of professional and academic standards, education, and research related to the art and science of experimental surgery. Presentations included four invited keynote speakers and 30 selected lectures and posters. A primary strength of the meeting was that lectures were complimented with practical sessions that included four wet lab and two dry lab half-day courses. Likewise, participants were brought together in workshops emphasizing research workflow from starting experimental design to readying results for publication. In this report, we present the highlights from this meeting and some selected abstracts that illustrate the diverse scientific expertise of the Academy and progress in surgical research.
International Nuclear Information System (INIS)
Sasa, Toshinobu
2016-03-01
The first topical meeting on Asian Network for Accelerator-driven System (ADS) and Nuclear Transmutation Technology (NTT) was held on 26-27 October 2015 at the J-PARC Center, Japan Atomic Energy Agency, Japan. The topical meeting was an optional one in-between the regular meeting, which is held in every two years. Instead of the regular meetings, which cover all research fields for ADS and NTT, such as accelerator, spallation target, subcritical reactor, fuel, and material, the topical meeting is focused on a specific topic to make technical discussions more deeply. In this meeting, the technology for lead-bismuth eutectic alloy was selected, as it was one of the hot issues in the world, and the topic was deeply discussed by specialists in Asian countries. This report summarizes all presentation materials discussed in the meeting. (author)
International Nuclear Information System (INIS)
Sublet, J.-Ch.; Capote Noy, R.
2004-11-01
A summary is given of the Second Research Coordination Meeting on Nuclear Data for Production of Therapeutic Radionuclides. The new library of evaluated cross section will cover the reactor and/or accelerator production of therapeutic radionuclides to appropriate specific activities and purity along with the relevant decay data. There are a significant number of radioisotopes in use or being proposed for therapeutic applications. As a consequence of the work undertaken during the course of this CRP, the resulting completeness and accuracy of the nuclear data for the production of these nuclides to appropriate specific activities and purity along with the re-definition of their decay data should be adequate for safe and efficient medical applications. The radioisotopes to be considered in the CRP were divided into two categories: Established Radioisotopes (therapeutic radioisotopes that have established clinical uses) and Emerging Radioisotopes (less-commonly used but potentially interesting radioisotopes for which medical applications have been demonstrated). Experimental data compilations and selection and preliminary evaluations for each of the reactions were extensively discussed during the meeting. The recommendations for both established and emerging radionuclides, and validation/testing of the cross section library are summarized. Technical discussions and the resulting work plan of the Coordinated Research Programme are summarized for every reaction path to be evaluated, along with actions and deadlines. Participants' contributions to the RCM are also attached. (author)
Summary and Outlook for KEKTC5
International Nuclear Information System (INIS)
Quinn, Helen R
2002-01-01
This is the summary talk of a meeting held at the KEK, Tsukuba, Japan, November 20-22, 2001. This meeting has been a wonderful testimony to the success of particle physics in Japan. The hosts are involved in all aspects of flavor physics, both with the world-class facilities in this laboratory and elsewhere in this country, and through their participation in experiments elsewhere. The results they have shown these past few days are at the forefront of B physics and neutrino physics, and the plans for the future we have seen are equally impressive. I give a brief summary of the talks we heard, and a few comments of my own on various points that have been made. Other talks given at this meeting are referred to by the speakers last name; these talks will appear in the same proceedings. See these talks for the detailed references for each subject
International Nuclear Information System (INIS)
Abriola, D.; Vickridge, I.
2009-12-01
Highlights of the third and last Research Coordination Meeting are given with respect to the progress achieved in the Co-ordinated Research Project on Development of a Reference Database for Ion Beam Analysis. The meeting took place at the IAEA headquarters in Vienna from 27 March to 3 April 2009. Participants presented the results of their work and identified and assigned key tasks in pursuance of the final output of the CRP, in particular the update of the IBANDL library and the drafting of the final Technical Report of the CRP. In addition, a number of productive discussions took place concerning issues such as measurements, assessments, evaluations, benchmarks and recommendations. The main conclusions as well as lists of responsibilities and tasks towards the production of the final report are presented. (author)
2015-01-01
Please note that our next series of Academic Training Lectures will take place on the 26, 27 and 29 May 2015. Theories of Electroweak Symmetry Breaking: A Post LHC Run-I Perspective, by James Daniel Wells (University of Michigan (US)) from 11.00 a.m. to 12.00 p.m. in the Council Chamber (503-1-001) https://indico.cern.ch/event/383514/
International Nuclear Information System (INIS)
Pashchenko, A.B.
1995-02-01
The report contains the Summary of the First IAEA Research Co-ordination Meeting (RCM) of the new Co-ordinated Research Programme (CRP) on ''Establishment of an International Reference Data Library of Nuclear Activation Cross Sections''. The meeting was organized by the IAEA Nuclear Data Section with co-operation and assistance of local organizers from the Institute of Experimental Physics and held in Debrecen, Hungary, from 4 to 7 October 1994. The purpose of the RCM was to discuss the scope and goals of the CRP, to report and evaluate the first results of the research carried out by each participating laboratory, to review the current tasks, identify further actions of participants and agree on the coordination of work under this CRP. The detailed agenda, the list of participants, conclusions and recommendations of the meeting are presented in the summary report. (author)
2017 Landsat Science Team Summer Meeting Summary
Crawford, Christopher J.; Loveland, Thomas R.; Wulder, Michael A.; Irons, James R.
2018-01-01
The summer meeting of the U.S. Geological Survey (USGS)-NASA Landsat Science Team (LST) was held June 11-13, 2017, at the USGS’s Earth Resources Observation and Science (EROS) Center near Sioux Falls, SD. This was the final meeting of the Second (2012-2017) LST.1 Frank Kelly [EROS—Center Director] welcomed the attendees and expressed his thanks to the LST members for their contributions. He then introduced video-recorded messages from South Dakota’s U.S. senators, John Thune and Mike Rounds, in which they acknowledged the efforts of the team in advancing the societal impacts of the Landsat Program.
Segmentation and Quantification for Angle-Closure Glaucoma Assessment in Anterior Segment OCT.
Fu, Huazhu; Xu, Yanwu; Lin, Stephen; Zhang, Xiaoqin; Wong, Damon Wing Kee; Liu, Jiang; Frangi, Alejandro F; Baskaran, Mani; Aung, Tin
2017-09-01
Angle-closure glaucoma is a major cause of irreversible visual impairment and can be identified by measuring the anterior chamber angle (ACA) of the eye. The ACA can be viewed clearly through anterior segment optical coherence tomography (AS-OCT), but the imaging characteristics and the shapes and locations of major ocular structures can vary significantly among different AS-OCT modalities, thus complicating image analysis. To address this problem, we propose a data-driven approach for automatic AS-OCT structure segmentation, measurement, and screening. Our technique first estimates initial markers in the eye through label transfer from a hand-labeled exemplar data set, whose images are collected over different patients and AS-OCT modalities. These initial markers are then refined by using a graph-based smoothing method that is guided by AS-OCT structural information. These markers facilitate segmentation of major clinical structures, which are used to recover standard clinical parameters. These parameters can be used not only to support clinicians in making anatomical assessments, but also to serve as features for detecting anterior angle closure in automatic glaucoma screening algorithms. Experiments on Visante AS-OCT and Cirrus high-definition-OCT data sets demonstrate the effectiveness of our approach.
Energy Technology Data Exchange (ETDEWEB)
Klyuchnikov, O O [eds.
1999-07-01
These transactions contain materials of International Scientific and Practical Conference 'Shelter-98', which was held 27-30 November 1998 in Slavutich. They describe the results of the research work of the specialists from Ukraine, neighborhood and far foreign counties. The results, targeted at solving the problems of converting the Shelter Object into oncologically safe state.
77 FR 22286 - Western Pacific Fishery Management Council; Public Meeting
2012-04-13
... Pacific Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS.... SUMMARY: The Western Pacific Fishery Management Council (Council) will hold a meeting of its Pelagics Plan... pelagics annual report module changes 4. American Samoa annual report module changes 5. Summary of current...
International Nuclear Information System (INIS)
1987-01-01
This volume contains summaries of 28 papers presented at the 27. conference of the Canadian Nuclear Association. These papers discuss the general situation of the Canadian nuclear industry and the CANDU reactor; dialogue with the public; the International Atomic Energy Agency; and economic goals and operating lessons. It also contains summaries of 70 papers presented at the 8. conference of the Canadian Nuclear Society, which discuss plant life extension; safety and the environment; reactor physics; thermalhydraulics; risk assessment; the CANDU spacer location and repositioning project; CANDU operations; safety research after Chernobyl; fuel channels; and nuclear technology developments. The individual papers are also available in INIS-mf--13673 (CNA), and INIS-mf--12909 (CNS). (L.L.)
Energy Technology Data Exchange (ETDEWEB)
Ganser, B. [Rhenag Rheinische Energie AG, Koeln (Germany)
1998-07-01
The 6th World Conference for natural gas vehicles (NGV `98) which was held from May 26th-28th, 1998 in Cologne under the patronage of the Federal Environment Minister Dr. Angela Merkel, lead more than 1000 participants from all over the world to the Cathedral City. The conference, accompanied by an exhibition at which 65 exhibitors showed the newest trends in the vehicle- and filling station technology, was made use of by more than 2000 visitors to inform themselves about the latest technical developments. With this extremely positive resonance of visitors for the conference and trade exhibition, the NGV `98 so far is worldwide the largest event on alternative vehicle drivers. (orig.) [Deutsch] Die 6. Weltkonferenz fuer Erdgasfahrzeuge (NGV `98), die vom 26. bis 28. Maerz 1998 in Koeln unter der Schirmherrschaft von Bundesumweltministerin Dr. Angela Merkel stattfand, fuehrte mehr als 1000 Teilnehmer aus aller Welt in die Domstadt. Die konferenzbegleitende Ausstellung, auf der 65 Aussteller die neuesten Trends in der Fahrzeug- und Tankstellentechnik zeigten, wurde von den mehr als 2000 Besuchern genutzt, um sich ueber die aktuellen technischen Entwicklungen zu informieren. Mit dieser aeusserst positiven Besucherresonanz von Konferenz und Fachausstellung ist die NGV `98 weltweit die bisher groesste Veranstaltung ueber alternative Fahrzeugantriebe. (orig.)
Specialists' meeting on carbon in sodium. Summary report
International Nuclear Information System (INIS)
1980-05-01
The purpose of the meeting was to provide a forum for the exchange of views on: the chemistry and thermodynamics of carbon in sodium; the analysis and monitoring of carbon in sodium; the behaviour of carbon in sodium circuits; and the implications of the above in LMFBRs. The technical parts of the meeting were divided into five major sessions
Specialists' meeting on carbon in sodium. Summary report
Energy Technology Data Exchange (ETDEWEB)
NONE
1980-05-01
The purpose of the meeting was to provide a forum for the exchange of views on: the chemistry and thermodynamics of carbon in sodium; the analysis and monitoring of carbon in sodium; the behaviour of carbon in sodium circuits; and the implications of the above in LMFBRs. The technical parts of the meeting were divided into five major sessions.
75 FR 59747 - NASA Advisory Council; Meeting.
2010-09-28
... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice: (10-113)] NASA Advisory Council; Meeting. AGENCY: National Aeronautics and Space Administration. ACTION: Notice of meeting. SUMMARY: In accordance... Space Administration announces a meeting of the NASA Advisory Council. DATES: Wednesday, October 6, 2010...
ACRF Archive User Meeting Summary
Energy Technology Data Exchange (ETDEWEB)
SA Edgerton; RA McCord; DP Kaiser
2007-10-30
On October 30, 2007, the U.S. Department of Energy’s (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) sponsored an all-day workshop to assess the status of the ACRF Archive. Focus areas included usability of current functions, plans for revised functions, proposals for new functions, and an overarching discussion of new ideas. Although 13 scientists familiar with ACRF and the ARM Program were invited to the workshop, only 10 scientists were available to attend the workshop. ACRF consists of the infrastructure that was developed to support the ARM Program and includes the ACRF Archive (previously called the ARM Archive). The scientists who participated in the meeting ranged from those who used the Archive frequently to those who seldom or never had accessed the Archive. The group was spread across disciplines, i.e. modelers, conservationists, and others from universities and government laboratories. A few of the participants were funded by the ARM Program, but most were not funded currently by ARM. During the past year, several improvements were made to the ACRF Archive to link it with the ARM/ACRF web pages, add a shopping cart feature, and expand on search parameters. Additional modifications have been proposed and prototypes of these proposals were made available for the participants. The participants were given several exercises to do before the meeting, and their feedback was requested to help identify potential problems and shortcomings with the existing structure and to recommend improvements.
ARCOCT: Automatic detection of lumen border in intravascular OCT images.
Cheimariotis, Grigorios-Aris; Chatzizisis, Yiannis S; Koutkias, Vassilis G; Toutouzas, Konstantinos; Giannopoulos, Andreas; Riga, Maria; Chouvarda, Ioanna; Antoniadis, Antonios P; Doulaverakis, Charalambos; Tsamboulatidis, Ioannis; Kompatsiaris, Ioannis; Giannoglou, George D; Maglaveras, Nicos
2017-11-01
Intravascular optical coherence tomography (OCT) is an invaluable tool for the detection of pathological features on the arterial wall and the investigation of post-stenting complications. Computational lumen border detection in OCT images is highly advantageous, since it may support rapid morphometric analysis. However, automatic detection is very challenging, since OCT images typically include various artifacts that impact image clarity, including features such as side branches and intraluminal blood presence. This paper presents ARCOCT, a segmentation method for fully-automatic detection of lumen border in OCT images. ARCOCT relies on multiple, consecutive processing steps, accounting for image preparation, contour extraction and refinement. In particular, for contour extraction ARCOCT employs the transformation of OCT images based on physical characteristics such as reflectivity and absorption of the tissue and, for contour refinement, local regression using weighted linear least squares and a 2nd degree polynomial model is employed to achieve artifact and small-branch correction as well as smoothness of the artery mesh. Our major focus was to achieve accurate contour delineation in the various types of OCT images, i.e., even in challenging cases with branches and artifacts. ARCOCT has been assessed in a dataset of 1812 images (308 from stented and 1504 from native segments) obtained from 20 patients. ARCOCT was compared against ground-truth manual segmentation performed by experts on the basis of various geometric features (e.g. area, perimeter, radius, diameter, centroid, etc.) and closed contour matching indicators (the Dice index, the Hausdorff distance and the undirected average distance), using standard statistical analysis methods. The proposed method was proven very efficient and close to the ground-truth, exhibiting non statistically-significant differences for most of the examined metrics. ARCOCT allows accurate and fully-automated lumen border
International Nuclear Information System (INIS)
2014-01-01
National radioactive waste repository programmes are collecting large amounts of data to support the long-term management of their nations' radioactive wastes. The data and related records increase in number, type and quality as programmes proceed through the successive stages of repository development: pre-siting, siting, characterisation, construction, operation and finally closure. Regulatory and societal approvals are included in this sequence. Some programmes are also documenting past repository projects and facing a challenge in allowing both current and future generations to understand actions carried out in the past. Metadata allows context to be stored with data and information so that it can be located, used, updated and maintained. Metadata helps waste management organisations better utilise their data in carrying out their statutory tasks and can also help verify and demonstrate that their programmes are appropriately driven. The NEA Radioactive Waste Repository Metadata Management (RepMet) initiative aims to bring about a better understanding of the identification and administration of metadata - a key aspect of data management - to support national programmes in managing their radioactive waste repository data, information and records in a way that is both harmonised internationally and suitable for long-term management and use. This is a summary record of the 1. meeting of the RepMet initiative. The actions and decisions from this meeting were sent separately to the group after the meeting, but are also included in this document (Annex A). The list of participants is attached as well (Annex B)
Directory of Open Access Journals (Sweden)
Jun Chen
2016-02-01
Full Text Available The core pluripotency factor Oct4 plays key roles in somatic cell reprogramming through transcriptional control. Here, we profile Oct4 occupancy, epigenetic changes, and gene expression in reprogramming. We find that Oct4 binds in a hierarchical manner to target sites with primed epigenetic modifications. Oct4 binding is temporally continuous and seldom switches between bound and unbound. Oct4 occupancy in most of promoters is maintained throughout the entire reprogramming process. In contrast, somatic cell-specific enhancers are silenced in the early and intermediate stages, whereas stem cell-specific enhancers are activated in the late stage in parallel with cell fate transition. Both epigenetic remodeling and Oct4 binding contribute to the hyperdynamic enhancer signature transitions. The hierarchical Oct4 bindings are associated with distinct functional themes at different stages. Collectively, our results provide a comprehensive molecular roadmap of Oct4 binding in concert with epigenetic rearrangements and rich resources for future reprogramming studies.
National Research Council Canada - National Science Library
1996-01-01
.... This Record of Decision (ROD) addresses AOCs 25 (the Explosives Ordnance Disposal (EOD) Range), 26 (Zulu Ranges), and 27 (Hotel Range) and a subset of the groundwater within the South Post Impact Area...
2010-04-01
... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Inclusion as interest of original issue discount... Special Rules for Determining Capital Gains and Losses § 1.1232-3A Inclusion as interest of original issue discount on certain obligations issued after May 27, 1969. (a) Ratable inclusion as interest—(1) General...
Staff Association
2014-01-01
You were hundreds of persons to participate in our information meetings of October 3 and 6 2014, and we thank you for your participation! The full presentation is available here. A summary of the topics is available here (in french).
Of Mice and Snakes: A Tail of Oct4.
Shylo, Natalia A; Weatherbee, Scott D
2016-08-08
The vertebrate axial skeleton comprises regions of specialized vertebrae, which vary in length between lineages. Aires et al. (2016) uncover a key role for Oct4 in determining trunk length in mice. Additionally, a heterochronic shift in Oct4 expression may underlie the extreme elongation of the trunk in snakes. Copyright © 2016 Elsevier Inc. All rights reserved.
Poddar, Raju; Werner, John S.
2018-06-01
We present noninvasive depth-resolved imaging of human retinal and choroidal microcirculation with an ultrahigh-speed (1.7 MHz A-scans/s), Fourier-domain mode locked (FDML) swept-source optical coherence tomography (SS-OCT) system having a central wavelength of 1065 nm. Three OCT angiography (OCTA) motion based contrast methods, namely phase variance (PV), amplitude decorrelation (AD) and Joint Spectral and Time domain OCT (STdOCT) were implemented. The OCTA imaging was performed with a field of view of 16° (5 mm × 5 mm) and 30° (9 mm × 9 mm), on the retina. A qualitative comparison of images obtained with all three OCTA methods is demonstrated using the same eye of a healthy volunteer. Different parameters, namely acquisition time, scanning area, and scanning density, are discussed. The phase-variance OCTA (PV-OCTA) method produced relatively better results than the other two. Different features regarding the retinal and choroidal vessels are described in different subjects.
27 CFR 26.105 - Prepayment of tax-release of beer.
2010-04-01
... of beer. 26.105 Section 26.105 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... ISLANDS Taxpayment of Liquors and Articles in Puerto Rico Beer § 26.105 Prepayment of tax—release of beer. (a) Action by brewer. Where the beer is to be withdrawn from bonded storage after payment of the...
27 CFR 26.96 - Prepayment of tax-release of wine.
2010-04-01
... of wine. 26.96 Section 26.96 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Taxpayment of Liquors and Articles in Puerto Rico Wine § 26.96 Prepayment of tax—release of wine. (a) Action by proprietor. Where the wine is to be withdrawn from bonded storage after payment of the computed...
Bones and Brexit: The Past and the Future Introduction to PIA Volume 26/27
Directory of Open Access Journals (Sweden)
Clare Lewis
2017-12-01
Full Text Available On behalf of the editorial team we are delighted to introduce volumes 26 & 27 of Papers from the Institute of Archaeology. The contributions in this joint volume were intentionally edited together to encompass the diverse range of research undertaken at UCL Institute of Archaeology. The context to this research environment is provided in the forum covering archaeological and heritage sector implications of Britain’s vote in 2016 to leave the European Union. We also introduce three new projects in this joint volume as a new dynamic to Papers from the Institute of Archaeology. The interview has an audio recording accessible in the online version, the winning poster from our poster competition accompanies this editorial, and the first of a series of ‘Postcards from Qatar’ is also presented.
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-07-01
This fifth one-day energy forum of the DNK held in Bonn on 26 November 1998 once again gathered many representatives of industry, science and research, and the political arena. The date of the meeting in mid-November was well-chosen, as it offered the opportunity to discuss the outcome of the 17th World Energy Congress held two months ago in Houston/USA, and to communicate on expectations in Germany linked to the future energy policy of the new coalition in power. The general theme of the forum, 'Energy and environment as issues of a dialogue of politicians, industry and science' thus fits in well with the global energy issues. The contributions to the panel discussion with the concluding summary of Dr. Ott as well as the lectures presented at the meeting are reproduced or this conference report from the manuscripts and the minutes. (orig./CB) [German] Der 5. Energietag des DNK in Bonn am 26. November 1998 hat erneut zahlreiche Repraesentanten aus Wirtschaft, Wissenschaft und Politik zusammengefuehrt. Der Zeitpunkt Mitte November 1998 bot die Gelegenheit, einerseits die Ergebnisse des 17. Kongresses des Weltenergierates, der gerade 2 Monate zuvor in Houston stattfand, zu erlaeutern und zum anderen, ueber die energiepolitischen Erwartungen an die neue Bundesregierung und deren Vorstellungen zur kuenftigen Energiepolitik zu diskutieren. Das Generalthema des Forums 'Energie und Umwelt im Dialog zwischen Politik, Wirtschaft und Wissenschaft' hatte damit aktuellen Bezug. Die Beitraege der Podiumsdiskussion mit den Schlussbemerkungen von Dr. Ott sind wie die Vortraege weitgehend im Originalwortlaut wiedergegeben. Sie werden im vorliegenden Heft dokumentiert. (orig./RHM)
Oct4 is required ~E7.5 for proliferation in the primitive streak.
Directory of Open Access Journals (Sweden)
Brian DeVeale
2013-11-01
Full Text Available Oct4 is a widely recognized pluripotency factor as it maintains Embryonic Stem (ES cells in a pluripotent state, and, in vivo, prevents the inner cell mass (ICM in murine embryos from differentiating into trophectoderm. However, its function in somatic tissue after this developmental stage is not well characterized. Using a tamoxifen-inducible Cre recombinase and floxed alleles of Oct4, we investigated the effect of depleting Oct4 in mouse embryos between the pre-streak and headfold stages, ~E6.0-E8.0, when Oct4 is found in dynamic patterns throughout the embryonic compartment of the mouse egg cylinder. We found that depletion of Oct4 ~E7.5 resulted in a severe phenotype, comprised of craniorachischisis, random heart tube orientation, failed turning, defective somitogenesis and posterior truncation. Unlike in ES cells, depletion of the pluripotency factors Sox2 and Oct4 after E7.0 does not phenocopy, suggesting that ~E7.5 Oct4 is required within a network that is altered relative to the pluripotency network. Oct4 is not required in extraembryonic tissue for these processes, but is required to maintain cell viability in the embryo and normal proliferation within the primitive streak. Impaired expansion of the primitive streak occurs coincident with Oct4 depletion ∼E7.5 and precedes deficient convergent extension which contributes to several aspects of the phenotype.
Uncertainty in Less Developed Countries in the Face of Crisis (Pp ...
African Journals Online (AJOL)
First Lady
2012-10-27
Oct 27, 2012 ... no repeat of the contagious market crises of 1997-98. The credit market .... Almost all developing countries adopted an export-led growth model, which ... continent from the disruptive effects of the crisis (apart from Kenya, South ... Price volatility and changes in marketing margins means that the benefits of.
Energy Technology Data Exchange (ETDEWEB)
Jensen, Mikael
1999-06-01
Summary report from discussions with Robert Bernero and Chris Whipple regarding compliance with the Swedish HLW Regulations from meetings in Stockholm. The report also contains bibliographical information and preliminary observations made by Robert Bernero and Chris Whipple.
International Nuclear Information System (INIS)
Jensen, Mikael
1999-06-01
Summary report from discussions with Robert Bernero and Chris Whipple regarding compliance with the Swedish HLW Regulations from meetings in Stockholm. The report also contains bibliographical information and preliminary observations made by Robert Bernero and Chris Whipple
International Nuclear Information System (INIS)
2015-05-01
The NEA's nuclear data evaluation co-operation activities involve the following evaluation projects: ENDF (United States), JENDL (Japan), ROSFOND/BROND (Russia), JEFF (other Data Bank member countries) and CENDL (China) in close co-operation with the Nuclear Data Section of the International Atomic Energy Agency (IAEA). The working party was established to promote the exchange of information on nuclear data evaluations, measurements, nuclear model calculations, validation, and related topics, and to provide a framework for co-operative activities between the participating projects. The working party assesses nuclear data improvement needs and addresses these needs by initiating joint evaluation and/or measurement efforts. The 27. Meeting of the WPEC was the occasion to review the experimental activities, the evaluation projects and the Status of subgroups. This document brings together the available documents of the meeting: 1 - The Proposed agenda, the list of participants and the Summary record of the previous meeting, May 2014 (Report NEA-SEN-NSC-WPEC--2014-2); 2 - The Reports on experimental activities: Europe (NEA DB), Japan, USA, Russia, China; 3 - Some Brief progress reports from the evaluation projects: ENDF, JEFF, JENDL, BROND/ROSFOND, CENDL, IAEA, and TENDL; 4 - The Status of some subgroups: Subgroup 35 (Scattering angular distribution in the fast energy range); Subgroup 36 (Reporting and usage of experimental data for evaluation in the resolved resonance region); Subgroup 37 (Improved fission product yield evaluation methodologies); Subgroup 38 (A modern nuclear database structure beyond the ENDF format); Subgroup 39 (Methods and approaches to provide feedback from nuclear and covariance data adjustment for improvement of nuclear data files); Subgroup 40 (Collaborative International Evaluated Library Organisation (CIELO) Pilot Project); Subgroup 41 (Improving nuclear data accuracy of 241 Am and 237 Np capture cross-sections); Subgroup C (High
Energy Technology Data Exchange (ETDEWEB)
Cardinal, Julie; Flowers, Larry; Siegel, Judy; Taylor, Roger; Weingart, Jerome
1999-03-24
This is the fifth Village Power workshop sponsored by NREL. We have held these meetings every year since 1993, to focus, challenge, and provide a forum for interaction among practitioners working in the field of using renewable energy technologies as an economically viable pathway to electrification of rural populations throughout the world. Starting with a small group of 30 colleagues in 1993, this ''workshop'' has doubled in size every year. When the NREL staff was planning for this meeting, they were hoping for something around 400 participants. We are now looking at over 500, and we apologize for the somewhat cramped accommodations. This overwhelming response, however, shows that the use of renewable energy to solve some of the world's serious problems is coming of age. This meeting, this ''conference'' (it's clearly no longer a workshop) marks a transition. A transition from the viewpoint that renewables are, and forever will be a technology of the future; to the reality that renewables have come of age. We have technologies available today, at today's prices, that can make a substantive contribution to the pressing needs of environmentally sustainable development in the world. This is a collection of all the papers presented at the Village Power '98 conference.
76 FR 20375 - Meetings of Humanities Panel
2011-04-12
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities ACTION: Notice of additional meeting. SUMMARY: Pursuant to the... the following meeting of the Humanities Panel will be held at the Old Post Office, 1100 Pennsylvania...
76 FR 70168 - Meetings of Humanities Panel
2011-11-10
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of additional meeting. SUMMARY: Pursuant to the... the following meeting of the Humanities Panel will be held at the Old Post Office, 1100 Pennsylvania...
76 FR 41826 - Meetings of Humanities Panel
2011-07-15
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of additional meeting. SUMMARY: Pursuant to the... the following meeting of the Humanities Panel will be held at the Old Post Office, 1100 Pennsylvania...
78 FR 61404 - Federal Salary Council; Meeting
2013-10-03
... OFFICE OF PERSONNEL MANAGEMENT Federal Salary Council; Meeting AGENCY: Office of Personnel Management. ACTION: Notice of meeting. SUMMARY: The Federal Salary Council will meet on November 5, 2013, at... recommendations cover the establishment or modification of locality pay areas, the coverage of salary surveys, the...
75 FR 63215 - Federal Salary Council Meeting
2010-10-14
... OFFICE OF PERSONNEL MANAGEMENT Federal Salary Council Meeting AGENCY: Office of Personnel Management. ACTION: Notice of Meeting. SUMMARY: The Federal Salary Council will meet on October 29, 2010, at... recommendations cover the establishment or modification of locality pay areas, the coverage of salary surveys, the...
76 FR 59175 - Federal Salary Council; Meeting
2011-09-23
... OFFICE OF PERSONNEL MANAGEMENT Federal Salary Council; Meeting AGENCY: Office of Personnel Management. ACTION: Notice of meeting. SUMMARY: The Federal Salary Council will meet on November 4, 2011, at... recommendations cover the establishment or modification of locality pay areas, the coverage of salary surveys, the...
Directory of Open Access Journals (Sweden)
Mônica Weyll
2006-12-01
Full Text Available OBJETIVO: Detectar possíveis sinais de maculopatia hipotônica subclínica por meio da OCT III em pacientes submetidos à cirurgia filtrante. MÉTODOS: Pacientes que realizaram procedimento cirúrgico filtrante com pressão intra-ocular menor que 9 mmHg submeteram-se ao exame OCT III. RESULTADOS: Sete (87,50% pacientes apresentaram diagnóstico prévio de glaucoma crônico simples e 1 (12,50% de glaucoma agudo de ângulo fechado. Apenas duas pacientes (25,00% apresentaram maculopatia hipotônica detectada pela OCT III. CONCLUSÃO: A OCT III parece ser um bom método diagnóstico de maculopatia hipotônica subclínica em pacientes submetidos à cirurgia filtrante convencional.PURPOSE: To detect nondiagnostic hypotony maculopathy by OCT III after filtration surgery. METHODS: After surgery, patients with intraocular pressure less than 9 mmHg were submitted to OCT III examination. RESULTS: Seven (87.50% patients with previous diagnosis of open angle glaucoma and one (12.50% of them with acute angle closure glaucoma. Two patients (25.00% presented hypotony maculopathy on OCT III examination. CONCLUSION: OCT III examination seems to be a good diagnostic method to detect subclinical hypotony maculopathy after filtration surgery.
International Nuclear Information System (INIS)
Lira, Sabrina Lopes; Paiva, Mayara Rafaela Soares; Misso, Agatha Matos; Elias, Daniel Ricco; Yamagata, Chieko
2012-01-01
Lanthanum silicate oxyapatite materials are promising for application as electrolyte in solid oxide fuel cells because of high ionic conductivity at temperatures between 600 deg C and 800 deg C. In this work, oxyapatites with the composition La 9,56 (SiO 4 ) 6 O 2,34 , and La 9,8 Si 5,7 Mg 0,3 O 26,4 were synthesized by using the sol-gel method, followed by precipitation. Initially, the gel of silica was synthesized from sodium silicate solution, by acid catalysis using lanthanum and magnesium chloride solution. Then, the La and Mg hydroxides were precipitated with NaOH in the gel. The powders were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and measurements of specific surface area. The crystalline oxyapatite phase of La 9,56 (SiO 4 ) 6 O 2,34 , and was La 9,8 Si 5,7 Mg 0,3 O 26,4 obtained by calcination at 900 deg C for 2 and 1h respectively (author)
International Nuclear Information System (INIS)
Abriola, D.; Pedro de Jesus, A.
2010-03-01
A summary is given of a Consultants' Meeting assembled to assess the viability of a new IAEA Co-ordinated Research Project (CRP) on Development of nuclear data for PIGE for analytical applications. The need for such a CRP was strongly agreed. Both the technical discussions and the expected outcomes of such a project are described, along with detailed recommendations for implementation. The participants discussed the past and present status of the field and the experiments performed in their home institutes. Subsequently, they addressed the nuclear data needs for PIGE analysis and produced recommendations concerning the compilation, assessment, measurements, evaluation and benchmarking of cross-section data for PIGE as well as their inclusion in the existent IBANDL database. (author)
76 FR 6828 - Meetings of Humanities Panel
2011-02-08
... THE NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of Meetings. SUMMARY: Pursuant to the provisions of... following meetings of Humanities Panels will be held at the Old Post Office, 1100 Pennsylvania Avenue, NW...
75 FR 18906 - Meetings of Humanities Panel
2010-04-13
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of Meetings. SUMMARY: Pursuant to the provisions of... following meetings of Humanities Panels will be held at the Old Post Office, 1100 Pennsylvania Avenue, NW...
75 FR 50007 - Meetings of Humanities Panel
2010-08-16
... THE NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of Meetings. SUMMARY: Pursuant to the provisions of... following meetings of Humanities Panels will be held at the Old Post Office, 1100 Pennsylvania Avenue, NW...
75 FR 26285 - Meetings of Humanities Panel
2010-05-11
... THE NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of meetings. SUMMARY: Pursuant to the provisions of... following meetings of Humanities Panels will be held at the Old Post Office, 1100 Pennsylvania Avenue, NW...
77 FR 22359 - Meetings of Humanities Panel
2012-04-13
... THE NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of Meetings. SUMMARY: Pursuant to the provisions of... following meetings of Humanities Panels will be held at the Old Post Office, 1100 Pennsylvania Avenue NW...
76 FR 52697 - Meetings of Humanities Panel
2011-08-23
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of meetings. SUMMARY: Pursuant to the provisions of... following meetings of Humanities Panels will be held at the Old Post Office, 1100 Pennsylvania Avenue, NW...
76 FR 63664 - Meetings of Humanities Panel
2011-10-13
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of meetings. SUMMARY: Pursuant to the provisions of... following meetings of Humanities Panels will be held at the Old Post Office, 1100 Pennsylvania Avenue, NW...
Validation of the UNC OCT Index for the Diagnosis of Early Glaucoma.
Mwanza, Jean-Claude; Lee, Gary; Budenz, Donald L; Warren, Joshua L; Wall, Michael; Artes, Paul H; Callan, Thomas M; Flanagan, John G
2018-04-01
To independently validate the performance of the University of North Carolina Optical Coherence Tomography (UNC OCT) Index in diagnosing and predicting early glaucoma. Data of 118 normal subjects (118 eyes) and 96 subjects (96 eyes) with early glaucoma defined as visual field mean deviation (MD) greater than -4 decibels (dB), aged 40 to 80 years, and who were enrolled in the Full-Threshold Testing Size III, V, VI comparison study were used in this study. CIRRUS OCT average and quadrants' retinal nerve fiber layer (RNFL); optic disc vertical cup-to-disc ratio (VCDR), cup-to-disc area ratio, and rim area; and average, minimum, and six sectoral ganglion cell-inner plexiform layer (GCIPL) measurements were run through the UNC OCT Index algorithm. Area under the receiver operating characteristic curve (AUC) and sensitivities at 95% and 99% specificity were calculated and compared between single parameters and the UNC OCT Index. Mean age was 60.1 ± 11.0 years for normal subjects and 66.5 ± 8.1 years for glaucoma patients ( P < 0.001). MD was 0.29 ± 1.04 dB and -1.30 ± 1.35 dB in normal and glaucomatous eyes ( P < 0.001), respectively. The AUC of the UNC OCT Index was 0.96. The best single metrics when compared to the UNC OCT Index were VCDR (0.93, P = 0.054), average RNFL (0.92, P = 0.014), and minimum GCIPL (0.91, P = 0.009). The sensitivities at 95% and 99% specificity were 85.4% and 76.0% (UNC OCT Index), 71.9% and 62.5% (VCDR, all P < 0.001), 64.6% and 53.1% (average RNFL, all P < 0.001), and 66.7% and 58.3% (minimum GCIPL, all P < 0.001), respectively. The findings confirm that the UNC OCT Index may provide improved diagnostic perforce over that of single OCT parameters and may be a good tool for detection of early glaucoma. The UNC OCT Index algorithm may be incorporated easily into routine clinical practice and be useful for detecting early glaucoma.
International Working Group on Fast Reactors Second Annual Meeting. Summary Report
International Nuclear Information System (INIS)
1969-01-01
The Agenda of the Meeting was as follows: Opening of the meeting. 2. Appraisal of the IWGFB's activity for the period from the first annual meeting of the Group. 3. Comments on national programmes on fast breeder reactors. 4. Presentation of general findings and conclusions of national and regional meetings on fast reactor problems held in represented countries and international organisations last year. 5. Comments on the programmes of international meetings on fast reactors to be held in 1969. 6. Consideration of a schedule for meetings on fast reactors in 1970. 7. Suggestions for the topics and location of specialists' meetings in 1969-1970. 8. Suggestions for reviews and studies in the field of fast reactors. 9. The time and place of the third annual meeting of the IWGFR. 10. Closing of the meeting
77 FR 67808 - Environmental Management Advisory Board Meeting
2012-11-14
... DEPARTMENT OF ENERGY Environmental Management Advisory Board Meeting AGENCY: Department of Energy. ACTION: Notice of Open Meeting. SUMMARY: This notice announces a meeting of the Environmental Management... Assistant Secretary for Environmental Management (EM) with advice and recommendations on corporate issues...
[Comparison of anterior chamber angle examination by UBM, SL-OCT and gonioscopy].
Liu, Rui-jue; Wang, Men; Xia, Wen-tao; Yu, Xiao-ying; Chen, Jie-min; Zhou, Shu; Peng, Shu-ya; Liu, Dong-mei
2014-08-01
To compare the agreement of anterior chamber angle examination by ultrasound biomicroscope (UBM), slit lamp optical coherence tomography (SL-OCT), and gonioscopy in angle recession and angle closure. The anterior chamber angle was measured with UBM, SL-OCT and gonioscopy in turns for temporal, nasal, superior and inferior quadrant in the same dark room. The results were compared with the agreement of the three methods in angle recession and angle closure by χ2 test and Kappa test. There were no statistically significant differences of the three methods in testing angle closure and angle recession (P>0.05). The consistency of UBM and gonioscopy was better (Kappa value of 0.882) than that of SL-OCT and gonioscopy (Kappa value of 0.624). When testing angle recession, UBM is better than SL-OCT with gonioscopy as the standard. When testing angle closure, UBM, SL-OCT and gonioscopy have good agreement.
78 FR 63501 - Meetings of Humanities Panel
2013-10-24
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: National Endowment for the Humanities. ACTION: Notice of meetings. SUMMARY: Pursuant to section 10(a)(2) of the... Humanities Panel will be held during November, 2013 as follows. The purpose of the meetings is for panel...
77 FR 61643 - Arts Advisory Panel Meeting
2012-10-10
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Arts Advisory Panel Meeting AGENCY: National Endowment for the Arts, National Foundation on the Arts and Humanities. ACTION: Notice of meeting. SUMMARY... hereby given that sixteen meetings of the Arts Advisory Panel to the National Council on the Arts will be...
78 FR 17942 - Arts Advisory Panel Meeting
2013-03-25
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Arts Advisory Panel Meeting AGENCY: National Endowment for the Arts, National Foundation on the Arts and Humanities. ACTION: Notice of meetings. SUMMARY... hereby given that five meetings of the Arts Advisory Panel to the National Council on the Arts will be...
78 FR 21978 - Arts Advisory Panel Meeting
2013-04-12
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Arts Advisory Panel Meeting AGENCY: National Endowment for the Arts, National Foundation on the Arts and Humanities. ACTION: Notice of meeting. SUMMARY... is hereby given that one meeting of the Arts Advisory Panel to the National Council on the Arts will...