PH Newsletter
2013-01-01
Peter Jenni, former spokesperson of the ATLAS Collaboration, discusses the challenges and satisfactions from his long-standing career in high-energy physics in this month’s PH Newsletter. Peter Jenni. Following a long career at CERN that dates back to 1970 (ranging from Summer Student to Fellow and to Staff), Peter Jenni recently retired after about 40 years marked by exciting discoveries (from the first two-photon production of eta-prime at SPEAR to the Higgs boson at the LHC). Peter was involved in the LHC from its very beginnings and was spokesperson of the ATLAS Collaboration until February 2009. Peter Jenni will continue working with ATLAS as a guest scientist with the Albert-Ludwigs-University Freiburg, and when he's not travelling he still spends most of his time in his office in Building 40, where he met with interviewer Panos Charitos. Panos Charitos: When did you first arrive to CERN? Peter Jenni: I first came to CERN as a Summer Student in ...
Prof. Manfred Popp, Chairman of the Executive Board, Forschungszentrum Karlsruhe GmbH
Patrice Loïez
2003-01-01
Prof. Popp is pictured here in the ATLAS detector assembly hall with Dr. Horst Wenninger of CERN.Photo 01: Prof. Popp (right) and Dr. Wenninger in front of one of the two vacuum vessels for the ATLAS end-cap toroid magnets.Photo 02: Prof. Popp (right) and Dr. Wenninger in front of one of eight 25-metre-long aluminium-alloy coil casings that will house the racetrack coils of the barrel toroid magnet system.
Directory of Open Access Journals (Sweden)
Cécile Segonzac
2017-08-01
Full Text Available Ralstonia solanacearum is the causal agent of the devastating bacterial wilt disease in many high value Solanaceae crops. R. solanacearum secretes around 70 effectors into host cells in order to promote infection. Plants have, however, evolved specialized immune receptors that recognize corresponding effectors and confer qualitative disease resistance. In the model species Arabidopsis thaliana, the paired immune receptors RRS1 (resistance to Ralstonia solanacearum 1 and RPS4 (resistance to Pseudomonas syringae 4 cooperatively recognize the R. solanacearum effector PopP2 in the nuclei of infected cells. PopP2 is an acetyltransferase that binds to and acetylates the RRS1 WRKY DNA-binding domain resulting in reduced RRS1-DNA association thereby activating plant immunity. Here, we surveyed the naturally occurring variation in PopP2 sequence among the R. solanacearum strains isolated from diseased tomato and pepper fields across the Republic of Korea. Our analysis revealed high conservation of popP2 sequence with only three polymorphic alleles present amongst 17 strains. Only one variation (a premature stop codon caused the loss of RPS4/RRS1-dependent recognition in Arabidopsis. We also found that PopP2 harbors a putative eukaryotic transcriptional repressor motif (ethylene-responsive element binding factor-associated amphiphilic repression or EAR, which is known to be involved in the recruitment of transcriptional co-repressors. Remarkably, mutation of the EAR motif disabled PopP2 avirulence function as measured by the development of hypersensitive response, electrolyte leakage, defense marker gene expression and bacterial growth in Arabidopsis. This lack of recognition was partially but significantly reverted by the C-terminal addition of a synthetic EAR motif. We show that the EAR motif-dependent gain of avirulence correlated with the stability of the PopP2 protein. Furthermore, we demonstrated the requirement of the PopP2 EAR motif for PTI
Diesel sisustab / Jenni Juurinen
Juurinen, Jenni
2007-01-01
Renzo Rosso poolt 1978. a. Itaalias asutatud rõivafirma Diesel sisustas 2007. a. kevadel Stay Inn-projekti raames katusekorteri Helsingi kesklinnas. Diesili kujundaja Vesa Kemppainen. Sisustuses on kasutatud peamiselt soome mööblit ja seintel eksponeeritud soome noorte kunstnike taieseid. Autoreid: Harri Koskinen (voodi), Thomas Pedersen (Stingrey kiiktool), Jenni Hiltunen (maalid)
Jenny's story: reinventing oneself through occupation and narrative configuration.
Price-Lackey, P; Cashman, J
1996-04-01
Two life history interviews were conducted to discover how one women, Jenny, experienced a traumatic head injury, rehabilitation, and recovery. Narrative analysis of the transcribed interviews revealed a rich story of how Jenny had fashioned her identity and character through childhood occupations, including studying classical literature and music, and of how she drew upon resources developed in childhood to engineer her recovery. It also illustrated how Jenny used a recursive process of narrative construction and engagement in self-devised graduated occupations, including studying, playing music, writing, computer graphics, and theater production, to create a new identity and develop capacities to process complex information and exercise creativity. Jenny's story illustrates the usefulness of gaining a perspective on patients as occupational beings through the gathering of life histories focused on occupation, the importance of collaborative patient-therapist goal setting, and the necessity for considering both the doing (practic) and the meaning (narrative) aspects of occupation. Her story supports many scholars' arguments that the therapeutic relationship, and thus occupational therapy practice, may be enhanced through the use of life history interviewing in occupational therapy evaluation and treatment.
Intoxication as Feminist Pleasure: Drinking, Dancing, and Un-Dressing with/for Jenni Rivera
Directory of Open Access Journals (Sweden)
Yessica Garcia Hernandez
2016-04-01
Full Text Available In "Intoxication as Feminist Pleasure: Drinking, Dancing, and Un-Dressing with/for Jenni Rivera," Yessica Garcia Hernandez presents a subculture of unabashed, unambivalent, and unapologetic “wet” feminism. During the concerts of the Chicana singer, Jenni Rivera, intoxication is divorced from the pressures of respectability by both Rivera and her fans, who continue to celebrate the singer and her name brand tequila even after her death.
Record of Pleopis schmackeri (Poppe Branchiopoda in Rio das Ostras, Rio de Janeiro, Brazil
Directory of Open Access Journals (Sweden)
Wanda Maria Monteiro-Ribas
2013-03-01
Full Text Available The paper describes the first occurrence of Pleopis schmackeri (Poppe, 1889 (Branchiopoda, Onychopoda in Rio das Ostras, Rio de Janeiro, Brazil is described. This marine cladoceran species occurred in zooplanktonic samples obtained on July, 2003 with mean density of 10 ind.m-3. Its presence may be related to two hypotheses, due to ballast water and through the Brazilian current, which gets closer to the coast Winter.
Fahad Al-Atawi; Hana Klompen; John C. Moser
2002-01-01
Schizosthetus lyrifomis (McGraw and Farrier, 1969) is redescribed for all inslars, emphasizing ontogenetic changes in sensillar and gland patterns of all body parts This approach allows recognition of some previously unreported patterns. Major positional shifts of lyrifissures over ontogeny appear correlated with the formation of the peritremes, and...
Directory of Open Access Journals (Sweden)
Cyrille Weine
2012-05-01
Full Text Available
There still are, at the periphery of urban centers, timeless and fragile places. Beside the growth, life has arranged places of rest. Ageless buildings, alongside roses, hedges protecting privacy, tables that knew the absinthe ... There are also vehicle ponds, rubbish and weeds. The city grows, preceded by letters of expropriation and its attendant hassles, dramas and uprootings. The framework of lifetimes is promised to total and brutal destruction.
A site full of life and desire. Men there are free, but they also face danger. Soon, developers will chase them. A space of choice, of freewill, exchange and sharing, respect and civility. An area rare and fragile, which reality will reduce to a memory. Children can do nothing. One day soon, they will go, all turning a page in their lives.
The Jenny Avenue in Nanterre seals the border between the suburbian cities of Nanterre and Courbevoie, near la Defence. A property development project in Courbevoie, site of the residence Villapollonia, disrupts the landscape and uses the nanterrian suburban neighborhood.
A striking contrast between urban forms and cultures.
The harpacticoid copepod Microarthridion littorale (Poppe) was tested for interaction effects between salinity change and acute pesticide exposure on the survival and genotypic composition of a South Carolina population. Previous data suggested a significant link betwee...
Record of Pleopis schmackeri (Poppe Branchiopoda in Rio das Ostras, Rio de Janeiro, Brazil
Directory of Open Access Journals (Sweden)
Wanda Maria Monteiro-Ribas
2012-10-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2013v26n1p201 The paper describes the first occurrence of Pleopis schmackeri (Poppe, 1889 (Branchiopoda, Onychopoda in Rio das Ostras, Rio de Janeiro, Brazil is described. This marine cladoceran species occurred in zooplanktonic samples obtained on July, 2003 with mean density of 10 ind.m-3. Its presence may be related to two hypotheses, due to ballast water and through the Brazilian current, which gets closer to the coast Winter.
Commentary on "The Perception and Cognition of Time in Balinese Music" by Andrew Clay McGraw
Ian Cross; Satinder Gill; Sarah Knight; Chris Nash; Tal-Chen Rabinowitch; Lydia Slobodian; Neta Spiro; Ghofur Woodruff; Matthew Woolhouse
2008-01-01
We review the paper by Andrew Clay McGraw, noting that it represents an interesting and valuable contribution to the study of music in cognition in its informed exploration of non-western musical perceptions. We raise a number of concerns about the methods used, and make suggestions as to how the issues that were empirically addressed in the paper might have been tackled in ways that would have enhanced the interpretability of its findings.
Commentary on "The Perception and Cognition of Time in Balinese Music" by Andrew Clay McGraw
Directory of Open Access Journals (Sweden)
Ian Cross
2008-05-01
Full Text Available We review the paper by Andrew Clay McGraw, noting that it represents an interesting and valuable contribution to the study of music in cognition in its informed exploration of non-western musical perceptions. We raise a number of concerns about the methods used, and make suggestions as to how the issues that were empirically addressed in the paper might have been tackled in ways that would have enhanced the interpretability of its findings.
Perez-Marin, C C; Galisteo, I; Perez-Rico, A; Galisteo, J
2016-04-01
This retrospective, population-based, cross-sectional study analyzed data for a total of 104 jennies reared in southern Spain over the period 1995 to 2014. Intervals to ovulation and incidence of multiple ovulation and pregnancy were charted for spontaneous, PGF2α-induced, and postpartum estrous cycles. In spontaneous estrous cycles, the interovulatory interval varied as a function of breed (P estrus signs was longer in older jennies (0.04). Spontaneous cycles were also associated with higher ovulation rates from September to January (P estrus, not only did estrus signs last longer in old (P cycle revealed that postpartum jennies exhibited significantly lower ovulation rates (1.32 ± 0.07) and a lower incidence of multiple ovulation (30.4%) than spontaneous (1.62 ± 0.04, 55.0%) and PGF2α-induced (1.74 ± 0.08, 65.5%) groups. No differences were observed in the incidence of ovulation or pregnancy depending on the location of ovulation in polyovular cycles, and ovulation occurred at similar rates in the right and left ovaries. These findings shed further light on reproductive physiology in jennies and may be of value in improving animal management. Copyright © 2016 Elsevier Inc. All rights reserved.
TWO-DIMENSIONAL SIMULATIONS OF EXPLOSIVE ERUPTIONS OF KICK-EM JENNY AND OTHER SUBMARINE VOLCANOS
Directory of Open Access Journals (Sweden)
Galen Gisler
2006-01-01
Full Text Available Kick-em Jenny, in the Eastern Caribbean, is a submerged volcanic cone that has erupted a dozen or more times since its discovery in 1939. The most likely hazard posed by this volcano is to shipping in the immediate vicinity (through volcanic missiles or loss-of-buoyancy, but it is of interest to estimate upper limits on tsunamis that might be produced by a catastrophic explosive eruption. To this end, we have performed two-dimensional simulations of such an event in a geometry resembling that of Kick-em Jenny with our SAGE adaptive mesh Eulerian multifluid compressible hydrocode. We use realistic equations of state for air, water, and basalt, and follow the event from the initial explosive eruption, through the generation of a transient water cavity and the propagation of waves away from the site. We find that even for extremely catastrophic explosive eruptions, tsunamis from Kick-em Jenny are unlikely to pose significant danger to nearby islands. For comparison, we have also performed simulations of explosive eruptions at the much larger shield volcano Vailulu'u in the Samoan chain, where the greater energy available can produce a more impressive wave. In general, however, we conclude that explosive eruptions do not couple well to water waves. The waves that are produced from such events are turbulent and highly dissipative, and don't propagate well. This is consistent with what we have found previously in simulations of asteroid-impact generated tsunamis. Non-explosive events, however, such as landslides or gas hydrate releases, do couple well to waves, and our simulations of tsunamis generated by sub- aerial and sub-aqueous landslides demonstrate this.
Bernoux, M.; Timmers, T.; Jauneau, A.; Brière, C.; Wit, de P.J.G.M.; Marco, Y.; Deslandes, L.
2008-01-01
Bacterial wilt, a disease impacting cultivated crops worldwide, is caused by the pathogenic bacterium Ralstonia solanacearum. PopP2 (for Pseudomonas outer protein P2) is an R. solanacearum type III effector that belongs to the YopJ/AvrRxv protein family and interacts with the Arabidopsis thaliana
William Shakespeare and Slovene dramatists (I: A. T. Linhart's Miss Jenny Love
Directory of Open Access Journals (Sweden)
Mirko Jurak
2009-12-01
Full Text Available One of the signs of the universality of William Shakespeare's plays is undoubtedly their influence on plays written by other playwrights throughout the world. This is also true of Slovene playwrights who have been attracted by Shakespeare's plays right from the beginning of their creativity in the second half of the eighteenth century, when Anton Tomaž Linhart (1756-1795 wrote his tragedy Miss Jenny Love.-However,-Slovene knowledge about-Shakespeare and his plays reaches back-into the seventeenth century, to the year 1698, when a group of Jesuit students in Ljubljana performed a version of the story of ''King Lear in Slovene. The Jesuits used Slovene in theatrical performances, which were intended for.the broadest circles of the population. The first complete religious play, written in Slovene, is Škofjeloški pasjon (The Passion Play from Škofja Loka, which was prepared by the Cistercian monk Father Romuald. Since 1721 this play was regularly performed at Škofja Loka for several decades, and at the end of the twentieth century its productions were revived again. In December 2009 two hundred and twenty years will have passed since the first production of Anton Tomaž Linhart's comedy Županova Micka (Molly, the Mayor's Daughter. It was first performed in Ljubljana by the Association of Friends of the Theatre on 28 December 1789, and it was printed in 1790 together with Linhart's second comedy, Ta veseli dan ali Matiček se ženi (This Happy Day, or Matiček Gets Married; which was also published in 1790, but not performed until 1848. These comedies represent the climax of Linhart's dramatic endeavours. Linhart's first published play was Miss Jenny Love (1780, which he wrote in German. In the first chapter of my study 1shall discuss the adaptation of Shakespeare's texts for the theatre, which was not practiced only in Austria and Germany, but since the 1660s also in England. Further on I discuss also Linhart's use of language as the "means of
Reproductive Patterns in the Non-Breeding Season in Asinina de Miranda Jennies.
Quaresma, M; Silva, S R; Payan-Carreira, R
2015-10-01
This study aims to characterize the reproductive patterns in Asinina de Miranda jennies during the non-breeding season. Reproductive activity was surveyed in 12 females, aged between 3 and 18 years old, using ultrasound and teasing with a jack. The animals were monitored from September to April, six in each consecutive year. Of these 12 females, nine showed disruption to the normal pattern of ovarian activity during the non-breeding season. Loss of normal cyclicity included anoestrus (41.7%), silent ovulatory oestrus (25%), and persistence of corpus luteum (8.3%). Only three females maintained a regular cyclic pattern with oestrous behaviour during the non-breeding season. Anoestrus began in early November and lasted for an average of 147 ± 28 days (113-191 days), ending near to the spring equinox. Onset of silent oestrous cycles began more erratically, between October and February. In both groups the first behavioural ovulation of the year occurred around the time of the spring equinox. Disrupted reproductive activity was preceded by a shorter oestrous cycle only in females entering anoestrus. The mean follicle size in the first ovulation of the year was larger than in the reproductive season (44.7 ± 2.45 mm vs 39.2 ± 3.60 mm) in anoestrous jennies with protracted oestrus. Though age and body condition score (BCS) were associated, changes in BCS below a threshold of four points (for anoestrus) and five points (for silent oestrus) contributed greatly to disruption of reproductive cycles. BCS in females with regular oestrous cycles during the winter season remained unchanged or exceeded five points prior to the winter solstice. © 2015 Blackwell Verlag GmbH.
Jean-Claude Gadmer
2011-01-01
The delegation included Motsoakapa Makara, principal secretary for the ministry of education and training, Mefane Lintle, Lesotho delegate, and Moshe Anthony Maruping, Lesotho ambassador, visited the ATLAS visitor centre with Peter Jenni, former ATLAS spokesperson.
Directory of Open Access Journals (Sweden)
José Maurício Gurgel
2016-12-01
Full Text Available O resfriamento evaporativo pode ser uma alternativa para substituir o condicionamento de ar (sistema de compressão de vapor dependendo das condições climáticas e das características da carga térmica da edificação. A transferência de calor e massa entre o ar e a película de água nos equipamentos evaporativos foi analisada teoricamente. Um resfriador evaporativo direto e uma torre de resfriamento foram simulados via modelos de Merkel e de Poppe para determinar a temperatura e razão de umidade na saída de cada equipamento. As equações diferenciais ordinárias resultantes foram resolvidas analiticamente quando possível e numericamente através dos métodos de Euler e Runger Kutta. Para validar os modelos simulados, os resultados obtidos do resfriador evaporativo e da torre de resfriamento foram comparados com dados disponíveis na literatura. O modelo de Merkel com soluções analíticas e numéricas foram avaliados realizando ajuste linear e na sequência ajuste quadrático da curva de saturação do ar, resultando que o ajuste quadrático é melhor para o caso da torre de resfriamento e irrelevante no caso do resfriador evaporativo, devido ao pequeno gradiente de temperatura. O modelo de Poppe, através de soluções numéricas mostrou-se mais adequado tanto para a torre de resfriamento quanto para o resfriador evaporativo, pois levou em consideração a taxa de evaporação da água e dessa forma representou melhor o fenômeno físico.
Maximilien Brice
2011-01-01
CERN-HI-1101036 21. Former ATLAS Collaboration Spokesperson P. Jenni, Counsellor for Scientific Affairs S. Michalowski, Secretary General Chief of Staff G. Ramos, OECD Secretary-General A. Gurría, Relations with International Organisations M. Bona, Head of International Relations F. Pauss and Director M. Oborne, in the ATLAS cavern.
Directory of Open Access Journals (Sweden)
Peter KASPRZAK
2011-02-01
Full Text Available During monitoring investigations of lakes in Schleswig-Holstein (northern Germany in 2000 and 2008, the calanoid copepod Eurytemora lacustris (POPPE 1887 was found in three lakes of the Ratzeburger Lake complex: the Kleine Küchensee, the Große Küchensee and the Große Ratzeburger See. The species has a broad geographic distribution but has become rare and endangered by eutrophication and global change. The lakes are mesotrophic (Gr. Ratzeburger See and eutrophic (Kl. Küchensee, Gr. Küchensee with cool (1 mg O2 L-1. Food and physical conditions seem to be favourable enough to permit survival and reproduction of the species at least in spring. It remains unclear, however, whether the populations in the studied lakes are autochthonous. Eurytemora lacustris possibly invaded the lakes or was transported via a canal from the Schaalsee upstream, where a viable population exists.
Czech Academy of Sciences Publication Activity Database
Červinková, Alice; Linková, Marcela
2005-01-01
Roč. 4, 1-2 (2005), s. 23-31 ISSN 1214-1909. [International Networking for Young Scientists Event with Jenny Simanowitz and . Vídeň, 28.02.05-01.03.05] R&D Projects: GA MŠk(CZ) 1P05OK459 Institutional research plan: CEZ:AV0Z70280505 Keywords : young women researchers * networking Subject RIV: AO - Sociology, Demography http://www.zenyaveda.cz/html/index.php?s1=1&s2=3&s3=4&lng=12&PHPSESSID=f20860b9711b5929d6c2a4dbc16511bb
Maximilien Brice
2008-01-01
18 MArch 2008 - Director, Basic and Generic Research Division, Research Promotion Bureau, Japanese Ministry of Education, Culture, Sports, Science and Technology Prof.Ohtake visiting ATLAS cavern with Spokesperson P. Jenni.
Maximilien Brice
2012-01-01
CERN-HI-1203073 16: Senior Canadian Scientist, ATLAS Collaboration, University of Toronto/IPP R. Teuscher; L. Andrzejewski(Spouse); H.-C. Bandulet; R.Voss (behind);ATLAS Collaboration, University of Toronto N.Ilic; ;ATLAS Collaboration, University of Toronto, R. Rezvani; ATLAS Collaboration Former Spokesperson P. Jenni.
Directory of Open Access Journals (Sweden)
Giuseppe Alfonso
2014-06-01
Full Text Available Albania, as well as a great part of the Balkan area in general, still suffers a lack of environmental studies especially in limnological research. The Dumre plateau, in Central Albania, is characterized by an extraordinary high number of karst lakes in a small geographic area. Despite their environmental peculiarity, very few biological data are to date available for these lakes, none on the zooplankton. For this reason, 15 water bodies located in the central area of the plateau were selected for a preliminary limnological survey carried out in the years 2008-2011. Neodiaptomus schmackeri (Poppe & Richard, 1892, a diaptomid calanoid copepod characterized by a South-Eastern Palearctic - Oriental distribution, and the most widely spread Neodiaptomus species in Asia, was found in 8 lakes of the Dumre area. This finding represents the first record of the species, and of the entire genus Neodiaptomus, for Europe. Several environmental variables were measured to characterize the lakes, and the co-occurring planktonic crustaceans were also identified. Taxonomical drawings and descriptions of the main morphological features of both sexes are herein provided in order to compare the Albanian populations of N. schmackeri with those of the native distribution area of the species. The possible causes which determined the occurrence of this non-indigenous species in several Dumre lakes are discussed.
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profiles were collected from XBT casts from the JENNIE & JACKIE from 31 July 1978 to 02 August 1978. Data were collected by the National Marine...
Maximilien Brice
2008-01-01
Dr Mauro Dell’Ambrogio, State Secretary for Education and Research of the Swiss Confederation visit the ATLAS Cavern and the LHC Machine with with Collaboration Spokesperson P. Jenni and Technical Coordinator M. Nessi.
Maximilien Brice
2007-01-01
Professor Tony F. Chan Assistant Director for Mathematics and Physical Sciences National Science Foundation United States of America on 23rd May 2007. Here visiting ATLAS experiment with P. Jenni and M. Tuts.
Maximilien Brice
2011-01-01
24 January 2011 - President of the Deutsche Forschungsgemeinschaft M. Kleiner in the ATLAS visitor centre and underground experimental area with Former Spokesperson P. Jenni, accompanied by P. Mättig and Adviser R. Voss.
Maximilien Brice
2011-01-01
9 August 2011 - United Nations High Commissioner for Human Rights N. Pillay signing the guest book with Head of International Relations F. Pauss; in the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni.
Claudia Marcelloni
2008-01-01
15 April 2008 - British Minister for Science and Innovation I. Pearson MP visiting the ATLAS cavern with Adviser to CERN Director-General J. Ellis, Ambassador to Switzerland S. Featherstone and Collaboration Spokesperson P. Jenni
2011-01-01
28 September 2011 - Canadian Intellectual Property Office Policy, International and Research Office Director K. Georgaras visiting the LHC superconducting magnet test hall with Engineer M. Bajko and Senior Scientists P. Jenni and R. Voss.
Maximilien Brice
2013-01-01
29 January 2013 - Japanese Toshiba Corporation Executive Officer and Corporate Senior Vice President O. Maekawa in the ATLAS visitor centre with representatives of the CERN-Japanese community led by Former Collaboration Spokesperson P. Jenni.
Numerical tsunami hazard assessment of the submarine volcano Kick 'em Jenny in high resolution are
Dondin, Frédéric; Dorville, Jean-Francois Marc; Robertson, Richard E. A.
2016-04-01
Landslide-generated tsunami are infrequent phenomena that can be potentially highly hazardous for population located in the near-field domain of the source. The Lesser Antilles volcanic arc is a curved 800 km chain of volcanic islands. At least 53 flank collapse episodes have been recognized along the arc. Several of these collapses have been associated with underwater voluminous deposits (volume > 1 km3). Due to their momentum these events were likely capable of generating regional tsunami. However no clear field evidence of tsunami associated with these voluminous events have been reported but the occurrence of such an episode nowadays would certainly have catastrophic consequences. Kick 'em Jenny (KeJ) is the only active submarine volcano of the Lesser Antilles Arc (LAA), with a current edifice volume estimated to 1.5 km3. It is the southernmost edifice of the LAA with recognized associated volcanic landslide deposits. The volcano appears to have undergone three episodes of flank failure. Numerical simulations of one of these episodes associated with a collapse volume of ca. 4.4 km3 and considering a single pulse collapse revealed that this episode would have produced a regional tsunami with amplitude of 30 m. In the present study we applied a detailed hazard assessment on KeJ submarine volcano (KeJ) form its collapse to its waves impact on high resolution coastal area of selected island of the LAA in order to highlight needs to improve alert system and risk mitigation. We present the assessment process of tsunami hazard related to shoreline surface elevation (i.e. run-up) and flood dynamic (i.e. duration, height, speed...) at the coast of LAA island in the case of a potential flank collapse scenario at KeJ. After quantification of potential initial volumes of collapse material using relative slope instability analysis (RSIA, VolcanoFit 2.0 & SSAP 4.5) based on seven geomechanical models, the tsunami source have been simulate by St-Venant equations-based code
National Oceanic and Atmospheric Administration, Department of Commerce — Kick'em Jenny is the most active volcano in the Antilles Volcanic Arc. Since its debut eruption in 1939, it has provided scientists with a rare opportunity to learn...
Directory of Open Access Journals (Sweden)
Lucinda Dean
2015-08-01
Full Text Available Steve Boardman and Julian Goodare, eds., Kings, Lords and Men in Scotland and Britain, 1300–1625: Essays in Honour of Jenny Wormald. Edinburgh: Edinburgh University Press, 2014. Pp. 368. ISBN: 9780748691500. £75.00.
Maximilien Brice
2007-01-01
Japanese Ministry of Education, Culture, Sports, Science and Technology (MEXT) representative H. Ikukawa visiting ATLAS experiment with Collaboration Spokesperson P. Jenni, KEK representative T. Kondo and Advisor to CERN DG J. Ellis on 15 May 2007.
Maximilien Brice
2011-01-01
12th September 2011 - Undersecretary for Foreign Affairs F. Schmidt Ariztía in the ATLAS visitor centre with ATLAS Collaboration Former Spokesperson P. Jenni, Adviser for Chile J. Salicio Diez and Senior Physicist J. Mikenberg.
Maximilien Brice
2009-01-01
30 March 2009 - Representatives of the Danish Council for Independent Research Natural Sciences visiting the LHC tunnel at Point 1 with Collaboration Spokesperson F. Gianotti, Former Spokesperson P. Jenni and Transition Radiation Tracker Project Leader C. Rembser.
Mona Schweizer
2008-01-01
6 June 2008 - Chancellor F. Tomàs Vert, University of Valencia, visiting ATLAS control room and experimental area with Collaboration Spokesperson P. Jenni. Other participants: Prof. Francisco José Botella, Director, Instituto de Fisica Corpuscular, University of València and CSIC Prof. José Peñarrocha, Dean, Faculty of Physics Prof. Antonio Ferrer, Instituto de Fisica Corpuscular, University of València and CSIC Prof. Antonio Pich, University of València, Member of IFIC (CSIC - Univ. València), Coordinator of CPAN, Spanish National Centre for Particle, Astroparticle and Nuclear Physics.
Estelle Spirig
2011-01-01
14 December 2011 - Czech Republic Delegation to CERN Council and Finance Committees visiting ATLAS experimental area, LHC tunnel and ATLAS visitor centre with Former Collaboration Spokesperson P. Jenni, accompanied by Physicist R. Leitner and Swiss student A. Lister.
2011-01-01
11th October 2011 - Chinese University of Science and Technology President J. Hou signing the guest book with Adviser R. Voss; in the ATLAS visitor centre with Former Collaboration Spokesperson P. Jenni and Members of the ATLAS Chinese Collaboration.
Maximilien Brice
2011-01-01
28 January 2011 - German State Secretary Ministry for Innovation, Science and Research of North Rhine-Westphalia H. Dockter in the ATLAS experimental cavern at LHC Point 1 with Former Spokesperson P. Jenni; signing the guest book with Adviser R. Voss.
Claudia Marcelloni
2008-01-01
21 January 2008 - Vice-President of the Human Rights Commission Z. Muhsin Al Hussein, Ambassador to United Nations A. Attar and their delegation from Saudi Arabia, visiting the ATLAS experimental cavern with Collaboration Spokesperson P. Jenni and Technical Coordinator M. Nessi.
Maximilien Brice
2008-01-01
Senior Senator from Florida and Chairman, Senate Committee on Space, Aeronautics and Related Sciences W. Nelson, visiting the ATLAS cavern and LHC tunnel with ATLAS Collaboration Spokesperson P. Jenni and AMS Collaboration Spokesperson S.C.C.Ting, 16 March 2008.
Maximilien Brice
2008-01-01
Mr Lars Leijonborg, Minister for Higher Education and Research of Sweden visiting the cavern ATLAS, the control room of ATLAS and the machine LHC at Point 1 with Collaboration Spokesperson P. Jenni and Dr. Jos Engelen, Chief Scientific Officer of CERN.
Maximilien Brice
2010-01-01
23rd June 2010 - Australian Nuclear Science and Technology Organization Chief Executive Officer A. Paterson signing a Joint Statement of Intent and the guest book with CERN Director-General R. Heuer; in the ATLAS visitor centre and control room with Former Collaboration Spokesperson P. Jenni.
2010-01-01
25 June 2010 - Founder Chairman of the Japanese Science and Technology in Society Forum K. Omi signing the guest book with Head of International Relations F. Pauss, Adviser J. Ellis and Director-General R. Heuer; in the ATLAS visitor centre with Former Collaboration Spokesperson P. Jenni.
Jean-Claude Gadmer
2012-01-01
24 February 2012 - Polish Vice-Rectors AGH University of Science and Technology Cracow visiting the ATLAS underground experimental area with Former Collaboration Spokesperson P. Jenni; Vice Rector J. Lis signs a collaboration agreement with A. Unnervik; Adviser T. Kurtyka and A. Siemko accompany the delegation throughout.
Maximilien Brice
2010-01-01
21 June 2010 - TUBITAK Vice President A. Adli signing the guest book with CERN Director-General R. Heuer, visiting the ATLAS control room at Point 1 with Former Collaboration Spokesperson P. Jenni and CMS Control Centre, building 354, with Collaboration Spokesperson G. Tonelli. Throughout accompanied by Adviser J. Ellis.
2014-01-01
“The long road to the LHC” by Prof. Lyn Evans, Dr. Daniel Treille and Prof. Peter Jenni. Thursday 9 October, 7.30 p.m. in the Globe of Science and Innovation. Talk in English with simultaneous interpreting into French. Entrance free. Limited number of seats. Reservation essential: +41 22 767 76 76 or cern.reception@cern.ch Lyn Evans. Lecture by Lyn Evans Abstract The key to the discovery of the Higgs boson has been the development of particle accelerators at CERN over the years. I will explain how a particle accelerator works and will follow the path from the construction of the Proton Synchrotron in the 1950s to the world’s most powerful colliding beam machine, the Large Hadron Collider. Biography Born in 1945, Lyn Evans has spent his whole career in the field of high energy physics and particle accelerators, participating in all the great projects of CERN. From 1993 he led the team that designed, built and commissioned the LHC. He is currently ...
Trying to Live Now: Chronotopic Figures in Jenny Watson’s A Painted Page Series
Directory of Open Access Journals (Sweden)
Chris McAuliffe
2014-06-01
Full Text Available Between late 1979 and early 1980, Australian artist Jenny Watson painted a sequence of six works, each with the title A Painted Page. Combining gridded, painted reproductions of photographs, newspapers and department store catalogues with roughly painted fields of color, the series brought together a range of recent styles and painterly idioms: pop, photorealism, and non-objective abstraction. Watson’s evocation of styles considered dated, corrupted or redundant by contemporary critics was read as a sign of the decline of modernism and the emergence of a postmodernism inflected with irony and a cool, “new wave” sensibility. An examination of the Painted Pages in the context of Watson’s interest in autobiography and her association with the women’s art movement, however, reveals the works to be subjective, highly personal reflections on memory, self and artistic aspiration. Drawing on Bahktin’s model of the chronotope, this paper argues for a spatio-temporal reading of Watson’s Painted Pages rather than the crude model of stylistic redundancy and succession. Watson’s source images register temporal orders ranging across the daily, the seasonal and the epochal. Her paintings transpose Bahktin’s typology of quotidian, provincial and “adventuristic” time into autobiographical paintings of teenage memories, the vicissitudes of the art world and punk subcultures. Collectively, the Painted Pages established a chronotopic field; neither an aggregation of moments nor a collaged evocation of a period but a point at which Watson closed off one kind of time (an art critical time of currency and succession and opened up another (of subjectivity and affective experience.
Directory of Open Access Journals (Sweden)
Natalie Loveless
2013-01-01
Full Text Available As a feminist-mother-artist-theorist writing and making art that reflects on the context of feminist-maternal-art-and-theory today, I have a lot at stake in what one could call the ‘maternal turn.’ This turn is marked by new social media networks, curatorial projects, and recent and upcoming publications that argue for the maternal as a crucial location from which to explore the conditions, ethics, and futures of feminism today. Such turns, of course, are made and not found. Jennie Klein and Meryl Chernick’s 'The M Word: Real Mothers in Contemporary Art', published in May of 2011 by Canada’s Demeter Press, contributes to the making of this maternal turn in contemporary feminist art history, theory and practice today.
Raphaël Piguet
2011-01-01
31st August 2011 - Government of Japan R. Chubachi, Executive Member of the Council for Science and Technology Policy, Cabinet Office, Vice Chairman, Representative Corporate Executive Officer and Member of the Board, Sony Corporation, visiting the ATLAS experimental area with Former Collaboration Spokesperson P. Jenni and Senior physicist T. Kondo.
Bini, Claudio; Maleci, Laura
2014-05-01
Serpentine soils have relatively high concentrations of PTEs (e.g., Co, Cr, Cu, Fe, Ni) but generally low amounts of major nutrients. They often bear a distinctive vegetation, and a frequently-used approach to understanding serpentine ecology and environmental hazard has been the chemical analysis of soils and plants. Long-term studies on aspects of serpentine soils and their vegetation provide results on total concentrations, or on plant-available fractions, of soil elements which counteract ecological conditions. For example, there is evidence of Ni toxicity at Ni-concentration >0.3 mg/L in the soil solution (Johnston and Proctor, 1981). The serpentine vegetation differs from the conterminous non-serpentine areas, being often endemic, and showing macroscopic physionomical characters such as dwarfism, prostrate outcome, glaucescence and glabrescence, leaves stenosis, root shortening (what Jenny, 1980, called "the serpentine syndrome"). Similarly, at microscopic level cytomorphological characteristics of the roots and variations in biochemical parameters such as LPO and phenols have been recorded in serpentine native vegetation (Giuliani et al., 2008). Light microscopy observations showed depressed mitotic activity in the meristematic zone, and consequent reduced root growth (Gabbrielli et al., 1990) The metal content of plants growing on serpentine soils at sites with different microclimatic conditions has been examined by several authors (e.g. Bini et al., 1993; Dinelli and Lombini, 1996) . A preferential Ni distribution in epidermis and sclerenchima has been observed in the stem of Alyssum bertoloni, a well known Ni-accumulator plant (Vergnano Gambi, 1975). The different tolerance mechanisms responsible for plant adaption to high concentrations of PTEs in serpentine soils can be related to the capacity of plants either to limit metal uptake and translocation or to accumulate metals in non toxic forms. The majority of serpentine species (e.g. Silene italica) tend
Maximilien Brice
2011-01-01
28th February 2011 - Turkish Minister of Foreign Affairs A. Davutoğlu signing the guest book with CERN Director for Research and Scientific Computing S. Bertolucci and Head of International Relations F. Pauss; meeting the CERN Turkish Community at Point 1; visiting the ATLAS control room with Former Collaboration Spokesperson P. Jenni.
Maximilien Brice
2008-01-01
11 August 2008 - Member of the House of Councillors M. Naito (The National Diet of Japan, The Democratic Party of Japan) visiting the ATLAS experiment control room with Collaboration Spokesperson P. Jenni and ATLAS Muon Project Leader G. Mikenberg. Family photograph with CERN Japanese scientists in front of the ATLAS surface building.
Maximilien Brice
2011-01-01
8 April 2011 - Brazilian Minister of State for Science and Technology A. Mercadante Oliva signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss; in the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni; visiting LHC superconducting magnet test hall with J.M. Jimenez.
2011-01-01
19 September 2011 - Japan Science and Technology Agency President K. Kitazawa visiting the LHC superconducting magnet test hall with engineer M. Bajko; the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni and Senior Scientist T. Kondo; signing the guest book with Adviser R.Voss and Head of International Relations F. Pauss.
Maximilien Brice
2009-01-01
HI-0902038 05: IT Department Head, F. Hemmer; US Google Vice President and Chief Internet Evangelist V. Cerf; Computing Security Officer and Colloquium Convenor D. R. Myers; Member of the Internet Society Advisory Council F. Flückiger; Director for Research and Scientific Computing, S. Bertolucci ; Honorary Staff Member, B. Segal. HI-0902038 16: Computing Security Officer and Colloquium Convenor D. R. Myers; UC Irvine, ATLAS Deputy Spokesperson elect A. J. Lankford; US Google Vice President and Chief Internet Evangelist V. Cerf; ATLAS Collaboration Spokesperson P. Jenni; IT Department Head, F. Hemmer.
Directory of Open Access Journals (Sweden)
Shuh-Sen Young
2013-11-01
Full Text Available We used the mitochondria DNA COI (cytochrome c oxidase subunit I sequence as a genetic marker to analyze the population genetic structure of two species of freshwater copepods, Neodiaptomus schmackeri (Poppe and Richard, 1892 and Mongolodiaptomus birulai (Rylov, 1922 from Taiwan. Four populations with 51 individuals of N. schmackeri and five populations with 65 individuals of M. birulai were included. We compared the nucleotide sequences of a 635-bp fragment of the COI gene of N. schmackeri and a 655-bp fragment of the COI gene of M. birulai, and eight and 14 unique haplotypes were recorded, respectively. Tseng-Wen reservoir and Wu-San-Tao reservoir are linked by a channel, and the gene flow between them was unrestricted (Fst = 0.058; Nm = 4.04; Fst, population differentiation parameter; Nm, the number of succesfull migrants per generation; the gene flow between all other populations of both species was restricted (Fst = 0.4–0.99; Nm = 0–0.37. Based on the COI gene diversification pattern, we suggest that most populations of N. schmackeri and M. birulai are isolated from each other. According to the neighbor-joining tree and the minimum spanning network (MSN, the species have similar metapopulation genetic structures. Genetic distance was not found to be correlated with geographical distance. The genetic diversification pattern was not shown to be comparable with geographical isolation owing to long-distance separation. The genetic structure of the present populations may result from serial extinction and redistribution of the populations formed in each reservoir relative to time. Human activity in the reservoirs with regards to water resource management and the fishery industry also exerts an effect on population redistribution.
Mechanism of host substrate acetylation by a YopJ family effector.
Zhang, Zhi-Min; Ma, Ka-Wai; Gao, Linfeng; Hu, Zhenquan; Schwizer, Simon; Ma, Wenbo; Song, Jikui
2017-07-24
The Yersinia outer protein J (YopJ) family of bacterial effectors depends on a novel acetyltransferase domain to acetylate signalling proteins from plant and animal hosts. However, the underlying mechanism is unclear. Here, we report the crystal structures of PopP2, a YopJ effector produced by the plant pathogen Ralstonia solanacearum, in complex with inositol hexaphosphate (InsP 6 ), acetyl-coenzyme A (AcCoA) and/or substrate Resistance to Ralstonia solanacearum 1 (RRS1-R) WRKY . PopP2 recognizes the WRKYGQK motif of RRS1-R WRKY to position a targeted lysine in the active site for acetylation. Importantly, the PopP2-RRS1-R WRKY association is allosterically regulated by InsP 6 binding, suggesting a previously unidentified role of the eukaryote-specific cofactor in substrate interaction. Furthermore, we provide evidence for the reaction intermediate of PopP2-mediated acetylation, an acetyl-cysteine covalent adduct, lending direct support to the 'ping-pong'-like catalytic mechanism proposed for YopJ effectors. Our study provides critical mechanistic insights into the virulence activity of YopJ class of acetyltransferases.
Jean-Claude Gadmer
2012-01-01
13 February 2012 - World Economic Forum Founder and Executive Chairman K. Schwab and Chairperson and Co-Founder Schwab Foundation for Social Entrepreneurship H. Schwab (Mrs)in the ATLAS experimental area at LHC Point 1 with Collaboration Former Spokesperson P. Jenni; signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss.
Michel Blanc
2012-01-01
27 February 2012 - Director of the Health Directorate at the Research DG European Commission R. Draghia-Akli in the ATLAS visitor centre with ATLAS Former Collaboration Spokesperson P. Jenni and Head of CERN EU Projects Office S. Stavrev; in the LHC superconducting magnet test hall with E. Todesco; and signing the guest book with CERN Director-General R. Heuer.
Implicit Personality and Leadership in Stressful and Dangerous Situations: A First Step
2012-05-01
Galloway , & Popp, 1995; Friedl, Mays, Kramer, & Shippee, 1995; Opstad, 1995; Walker, 1995; Ranger Handbook, 2000; Lock, 2005; Nindl et al., 2007...D. V. (2004). Can chameleons lead? The Leadership Quarterly, 15, 687-718. Bernton, E., Hoover, D., Galloway , R., & Popp, K. (1995). Adaptation to...Organizational Influence Processes (pp. 17-32). Glenview, IL: Scott , Foresman and Company. Kirkpatrick, S. A., & Locke, E. A. (1991
Laurent Egli (visit)
2013-01-01
13 September 2013 - Chairman of the Board of Directors of the von Karman Institute Kingdom of Belgium J.-P. Contzen visiting the ATLAS experimental cavern with ATLAS Former Spokesperson P. Jenni; visiting the LHC tunnel at Point 1 with Technology Department N. Delruelle and signing the guest book with Technology Department Head F. Bordry. International Relations Adviser T. Kurtyka present.
Energy Technology Data Exchange (ETDEWEB)
Popp, M.
2008-01-15
On November 6, 2007, the Kerntechnische Gesellschaft conferred its 30{sup th} honorary membership upon Professor Dr. Manfred Popp. The new Honorary Member has a record of outstanding achievements in the interest of nuclear power in Germany. This commitment is also apparent from his professional career, which was devoted to this high technology with impressive scientific and technical knowledge and political acumen, perseverance and stamina. The KTG is most grateful to Professor Popp for accepting its honorary membership. The article includes a revised version of the lecture given by Professor Manfred Popp at the ceremony conferring honorary membership. The author discusses some thoughts about the future of nuclear power in Germany in the light of societal, political, technical and environmental aspects. The status and perspectives of this technology are considered also within the framework of international developments. (orig.)
Thoughts about the future of nuclear power in Germany
International Nuclear Information System (INIS)
Popp, M.
2008-01-01
On November 6, 2007, the Kerntechnische Gesellschaft conferred its 30 th honorary membership upon Professor Dr. Manfred Popp. The new Honorary Member has a record of outstanding achievements in the interest of nuclear power in Germany. This commitment is also apparent from his professional career, which was devoted to this high technology with impressive scientific and technical knowledge and political acumen, perseverance and stamina. The KTG is most grateful to Professor Popp for accepting its honorary membership. The article includes a revised version of the lecture given by Professor Manfred Popp at the ceremony conferring honorary membership. The author discusses some thoughts about the future of nuclear power in Germany in the light of societal, political, technical and environmental aspects. The status and perspectives of this technology are considered also within the framework of international developments. (orig.)
Novel Nitroxide Resuscitation Strategies in Experimental Traumatic Brain Injury
2010-03-01
conflicting financial interests exist. References Barron, K.D., Dentinger, M.P., Kimelberg, H.K., Nelson, L.R., Bourke , R.S., Keegan, S., Mankes, R...fects of anesthetics on splanchnic arterial blood flow during hemorrhagic shock. J. Appl. Physiol. 76, 2304–2309. Nelson, L.R., Bourke , R.S., Popp...model, in: Neural Trauma. A.J. Popp, R.S. Bourke , L.R. Nelson, H.K. Kimelberg (eds), Raven Press: New York, pps. 297–311. Nelson, T.J., Wall, D.B
Indian Academy of Sciences (India)
Dictionary of Biology. Chancal Sarin. Toto McGraw Hill. 1996, Rs.90. Stoichiometry (51 Units). B I Bhatt and S M Vora. 3rd Edn., Toto McGraw Hill. 1996, Rs.180. Tensor Calculus, Theory and. Problems. A N Srivastava. Universities Press. 1994, Rs.50. A Textbook of Two Dimensional. Geometry. Sat Pal and Harbans lal.
Dondin, F. J. Y.; Dorville, J. F. M.; Robertson, R. E. A.
2015-12-01
The Lesser Antilles Volcanic Arc has potentially been hit by prehistorical regional tsunamis generated by voluminous volcanic landslides (volume > 1 km3) among the 53 events recognized so far. No field evidence of these tsunamis are found in the vincity of the sources. Such a scenario taking place nowadays would trigger hazardous tsunami waves bearing potentially catastrophic consequences for the closest islands and regional offshore oil platforms.Here we applied a complete hazard assessment method on the only active submarine volcano of the arc Kick 'em Jenny (KeJ). KeJ is the southernmost edifice with recognized associated volcanic landslide deposits. From the three identified landslide episodes one is associated with a collapse volume ca. 4.4 km3. Numerical simulations considering a single pulse collapse revealed that this episode would have produced a regional tsunami. An edifice current volume estimate is ca. 1.5 km3.Previous study exists in relationship to assessment of regional tsunami hazard related to shoreline surface elevation (run-up) in the case of a potential flank collapse scenario at KeJ. However this assessment was based on inferred volume of collapse material. We aim to firstly quantify potential initial volumes of collapse material using relative slope instability analysis (RSIA); secondly to assess first order run-ups and maximum inland inundation distance for Barbados and Trinidad and Tobago, i.e. two important economic centers of the Lesser Antilles. In this framework we present for seven geomechanical models tested in the RSIA step maps of critical failure surface associated with factor of stability (Fs) for twelve sectors of 30° each; then we introduce maps of expected potential run-ups (run-up × the probability of failure at a sector) at the shoreline.The RSIA evaluates critical potential failure surface associated with Fs <1 as compared to areas of deficit/surplus of mass/volume identified on the volcanic edifice using (VolcanoFit 2
Spanish Minister of Science and Technology visits ATLAS
Patrice Loïez
2002-01-01
H.E. Mr Josep Piqué i Camps, Minister for Science and Technology, Spain, came to CERN in November. He is seen here visiting the ATLAS assembly hall. Photo 01: The Minister (left) is greeted by Peter Jenni, spokesperson for the ATLAS collaboration. In the centre is Matteo Cavalli-Sforza, Spanish scientist at CERN. Photo 02: The Minister (left) in discussion with Peter Jenni. Photo 03: Peter Jenni shows the visitors one of eight vacuum vessels being built by Spanish company Felguera Construcciones Mecanicas SA for the superconducting coils of the air-core ATLAS barrel toroid magnet system: (left to right) Matteo Cavalli-Sforza of CERN; the Minister; M. Aguilar-Benitez, Spanish delegate to CERN Council; G. Léon; and Peter Jenni.
A Plant Immune Receptor Detects Pathogen Effectors that Target WRKY Transcription Factors.
Sarris, Panagiotis F; Duxbury, Zane; Huh, Sung Un; Ma, Yan; Segonzac, Cécile; Sklenar, Jan; Derbyshire, Paul; Cevik, Volkan; Rallapalli, Ghanasyam; Saucet, Simon B; Wirthmueller, Lennart; Menke, Frank L H; Sohn, Kee Hoon; Jones, Jonathan D G
2015-05-21
Defense against pathogens in multicellular eukaryotes depends on intracellular immune receptors, yet surveillance by these receptors is poorly understood. Several plant nucleotide-binding, leucine-rich repeat (NB-LRR) immune receptors carry fusions with other protein domains. The Arabidopsis RRS1-R NB-LRR protein carries a C-terminal WRKY DNA binding domain and forms a receptor complex with RPS4, another NB-LRR protein. This complex detects the bacterial effectors AvrRps4 or PopP2 and then activates defense. Both bacterial proteins interact with the RRS1 WRKY domain, and PopP2 acetylates lysines to block DNA binding. PopP2 and AvrRps4 interact with other WRKY domain-containing proteins, suggesting these effectors interfere with WRKY transcription factor-dependent defense, and RPS4/RRS1 has integrated a "decoy" domain that enables detection of effectors that target WRKY proteins. We propose that NB-LRR receptor pairs, one member of which carries an additional protein domain, enable perception of pathogen effectors whose function is to target that domain. Copyright © 2015 Elsevier Inc. All rights reserved.
Innovatsiooniosak tuleb appi / Marika Popp
Popp, Marika
2008-01-01
Innovatsiooniosak ( innovation vouchers) kujutab endast kinkekaarti ettevõtjale, selle alusel avaneb eriti väike- ja keskmise suurusega ning seni vähe või üldse mitte teadus- ja arendustööga kokku puutunud ettevõtteil saada esimene kogemus ning tekitada juurdepääs teadmiste allikale
Maximilien Brice
2002-01-01
Photo 01: Dr. Brzustowski (centre) with P. Jenni (left) and Robert Orr. Photo 02: Dr. Brzustowski (7th from left) with (from left to right) P. Jenni, Roy Langstaff, Kenneth Vincent, Mohsen Khakzad, Mircea Cadabeschi, Peter Krieger, Thomas Brzustowski, Robert Orr, Manuella Vincter, Fiona Holness, Rob McPherson, Vance Strickland, Claudiu Cojocaru. Photo 03: Dr. Brzustowski (7th from left) with (from left to right) P. Jenni, Roy Langstaff, Kenneth Vincent, Mohsen Khakzad, Mircea Cadabeschi, Peter Krieger, Thomas Brzustowski, Robert Orr, Manuella Vincter, Fiona Holness, Rob McPherson, Vance Strickland, Claudiu Cojocaru.
2010-03-01
West Conshohocken, PA. 2003. 28. Prescott , L. M.; Harley, J. P.; Klein, D. A. Microbiology . Fifth edition. McGraw Hill: New York, 2002. p. 118. 29...Microbiol. Rev. 1995;59:143-169. 30. Prescott , L. M.; Harley, J. P.; Klein, D. A. Microbiology . Fifth edition. McGraw Hill: New York, 2002. p. 246. 31...unlimited. 13. SUPPLEMENTARY NOTES PAO Case Number: 88ABW-2009-3882, Clearance Date: 09 September 2009. Report contains color. This microbiological
Marston, Jennie
2014-01-01
This article by Jennie Marston provides a framework to assist you in selecting appropriate picture books to present mathematical content. Jennie demonstrates the framework by applying three specific examples of picture books to the framework along with examples of activities.
Jean-Claude Gadmer
2012-01-01
6 February 2012 - Supreme Audit Institutions from Norway, Poland, Spain and Switzerland visiting the LHC tunnel at Point 5, CMS underground experimental area, CERN Control Centre and LHC superconducting magnet test hall. Delegations are throughout accompanied by Swiss P. Jenni, Polish T. Kurtyka, Spanish J. Salicio, Norwegian S. Stapnes and International Relations Adviser R. Voss. (Riksrevisjonen, Oslo; Tribunal de Cuentas , Madrid; the Court of Audit of Switzerland and Najwyzsza Izba Kontroli, Varsaw)
76 FR 55422 - National Science Board; Sunshine Act Meetings; Notice
2011-09-07
...: Jennie L. Moehlmann, [email protected] , (703) 292-7000. PUBLIC AFFAIRS CONTACT: Dana Topousis, dtopousi.... Phil Stokes, SAGUARO Program. Dr. Jennie Scott, Director of Curriculum and Articulation Services, Pima... Professor, School of Life Science, Arizona State University. CSB Subcommittee on Facilities (SCF) Open...
Biological-Mathematical Modeling of Chronic Toxicity.
1981-07-22
34Mathematical Model of Uptake and Distribution," Uptake and Distribution of Anesthetic Agents, E. M. Papper and R. J. Kitz (Editors, McGraw-Hill Book Co., Inc...distribution, In: Papper , E.M. and Kltz, R.J.(eds.) Uptake and distribution of anesthetic agents, McGraw- Hill, New York, p. 72 3. Plpleson, W.W...1963) Quantitative prediction of anesthetic concentrations. In: Papper , E.M. and Kitz, R.J. (eds.) Uptake and distribution of anesthetic agents, McGraw
'Renewable energy is to be better used in the future'
International Nuclear Information System (INIS)
Aeberli, O. E.
2003-01-01
This article presents an interview with Joseph Jenni, an early Swiss pioneer in the area of solar energy on the subject of solar energy use in Switzerland. Jenni observes that as far as energy supply is concerned, the whole question of supply has to be globally rethought. Jenni states that in Switzerland - and the rest of the world, too - more wood and solar energy will have to be used - in the interests of mankind and the environment. Questions dealt with include how Switzerland will meet its energy needs in twenty years, why the share of renewable energy is currently so low and what must be done to increase its use. Other forms of renewable energy such as geothermal energy and wind energy are also discussed. Also, experienced gained with Jenni's 'solar house' is discussed. The potential of wood energy in Switzerland and its contribution to reaching the targets for the reduction of CO 2 emissions is examined
Members of the Forum Engelberg visit CERN
Maximilien Brice
2002-01-01
The Forum Engelberg is an annual interdisciplinary conference held in Engelberg, Switzerland intended to act as an international platform for debate and exchange of views on key issues affecting scientific research, technology, economics and philosophy. Its President, Hubert Curien - former French Minister of Research and Space Research, and President of the CERN Council from 1994 to 1996 - is seen here visiting the ATLAS experiment. Photo 01: Hubert Curien (left) with Peter Jenni, spokesman for the ATLAS collaboration, in front of the barrel toroid coil casing for the ATLAS detector. Photo 02: Hubert Curien (left) with Peter Jenni in front of the liquid-argon barrel cryostat in the ATLAS assembly hall. Photo 03: Hubert Curien (left) and Peter Jenni in front of the liquid-argon barrel electromagnetic calorimeter in the ATLAS assembly hall. Photo 04: Hubert Curien (centre), Peter Jenni and Wendy Korda in front of a barrel toroid coil casing in the ATLAS assembly hall. Photo 06: Hubert Curien (left) and Peter J...
Long-term leptin fluctuations in female donkeys.
Čebulj-Kadunc, N; Škibin, A; Kosec, M
2015-11-01
The interest in donkeys is growing due to their integration in the systems of ecological farming, among other reasons. Due to limited reports on leptin concentrations in donkeys, the aim of the present study was to examine age-dependent and seasonal changes in the circulating leptin concentration in female donkeys (jennies) and thus contribute to knowledge about the physiological characteristics of this species. Prospective longitudinal study. The study was performed over a year (September 2008 to September 2009) on 20 yearling and young adult (pregnant, lactating or barren) jennies aged 1-5 years at the onset of the study; the animals were kept on pasture from May to September and stabled for the rest of the year. Blood samples were taken monthly and analysed for serum leptin concentrations by a commercial radioimmunoassay kit. Circulating leptin concentrations in studied jennies were lower than those reported for donkeys and horses. Despite the tendency for lower values in yearling vs. young adult jennies, the age range of the examined animals was insufficient to confirm any age-related leptin variations. Significant seasonal leptin fluctuations with peak levels in late spring and the lowest levels in autumn months, correlated with photoperiod, were detected in yearling, barren as well as pregnant jennies. Therefore, it was impossible to identify any effects of gestation or lactation on leptin concentrations of jennies. The results of this study cannot be used as evidence of a causal relationship between the photoperiod and seasonal circulating leptin fluctuations in donkeys, but could reflect changes induced by various external or internal factors enabling adaptations of grazing animals in variable submediterranean environments. © 2014 EVJ Ltd.
Dondin, F. J. Y.; Heap, M. J.; Robertson, R. E. A.; Dorville, J. F. M.; Carey, S.
2016-12-01
In the Lesser Antilles over 52 volcanic landslide episodes have been identified. These episodes serve as a testament to the hazard posed by volcanic landslides to a region composed of many islands that are small independent countries with vulnerable local economies. This study presents a relative slope stability analysis (RIA) to investigate the stability condition of the only active submarine volcano of the Lesser Antilles Arc: Kick-'em-Jenny Submarine Volcano (KeJ). Thus we hope to provide better constraint on the landslide source geometry to help mitigate volcanic landslide hazards at a KeJ. KeJ is located ca. 8 km north of Grenada island. KeJ lies within a collapse scar from a prehistorical flank collapse. This collapse was associated with a voluminous landslide deposit of about 4.4km3 with a 14 km runout. Numerial simulations showed that this event could generate a regional tsunami. We aim to quantify potential initial volumes of collapsed material using a RIA. The RIA evaluates the critical potential failure surface associated with factor of safety (Fs) inferior to unity and compares them to areas of deficit/surplus of mass/volume obtained from the comparison of an high resolution digital elevation model of the edifice with an ideal 3D surface. We use freeware programs VolcanoFit 2.0 and SSAP 4.7. and produce a 3D representation of the stability map. We report, for the first time, results of a Limit Equilibrium Method performed using geomechanical parameters retrieved from rock mechanics tests performed on two rock basaltic-andesite rock samples collected from within the crater of the volcano during the 1-18 November 2013 NA039 E/V Nautilus cruise. We performed triaxial and uniaxial deformation tests to obtain values of strength at the top and bottom of the edifice. We further characterized the permeability and P-wave velocity of the samples collected. The chosen internal structure for the model is composed of three bodies: (i) a body composed of basaltic
Video-on-demand over satellite
CSIR Research Space (South Africa)
Roux, K
2007-05-01
Full Text Available in the following table. Table 2: User-item ratings matrix StarWars Batman Harry Potter Matrix Atlantis Whispers Ann Howard Dan Rob Mary Jenny ? ? ? ? ? If we know that Jenny likes StarWars, what else might she like? Batman...
Jean-Claude Gadmer
2011-01-01
Photo 1:ATLAS visitor Center with P. Jenni, ATLAS Collaboration former spokesperson Photo 2-10:visiting the ATLAS cavern Photo 10:D. Hoppe,P. Jenni,M. Stratmann,S. Bethke,S. Braun,D. Klammer Photo 11-15:visiting the LHC tunnel Photo 16-18:Signature of the Guest Book with S. Lettow,Director for Administration and General Infrastructure
Ruchala, T. L.; Chen, M.; Tominaga, M.; Carey, S.
2016-12-01
Kick'em Jenny (KEJ) is an active submarine volcano located in the Lesser Antilles subduction zone, 7.5 km north of the Caribbean island Grenada. KEJ, known as one of the most explosive volcanoes in Caribbean, erupted 12 times since 1939 with recent eruptions in 2001 and possibly in 2015. Multiple generations of submarine landslides and canyons have been observed in which some of them can be attributed to past eruptions. The structure of KEJ can be characterized as a 1300 m high conical profile with its summit crater located around 180 m in depth. Active hydrothermal venting and dominantly CO2 composition gas seepage take place inside this 250m diameter crater, with the most activity occurring primarily within a small ( 70 x 110 m) depression zone (inner crater). In order to characterize the subsurface structure and decipher the processes of this volcanic system, the Nautilus NA054 expedition in 2014 deployed the underwater Remotely Operated Vehicle (ROV) Hercules to conduct near-bottom geological observations and magnetometry surveys transecting KEJ's caldera. Raw magnetic data was corrected for vehicle induced magnetic noise, then merged with ROV to ship navigation at 1 HZ. To extract crustal magnetic signatures, the reduced magnetic data was further corrected for external variations such as the International Geomagnetic Reference Field and diurnal variations using data from the nearby San Juan Observatory. We produced a preliminary magnetic anomaly map of KEJ's caldera for subsequent inversion and forward modeling to delineate in situ magnetic source distribution in understanding volcanic processes. We integrated the magnetic characterization of the KEJ craters with shipboard multibeam, ROV visual descriptions, and photomosaics. Initial observations show the distribution of short wavelength scale highly magnetized source centered at the north western part of the inner crater. Although locations of gas seeps are ubiquitous over the inner crater area along ROV
An Economic Analysis of the Truth in Negotiations Act
2016-01-27
Associate Professor 1st Lt Crystal Champion, USAF Capt Meredith Ellen, USAF Capt Jenny Walk, USAF Graduate School of Business & Public Policy...Professor 1st Lt Crystal Champion, USAF Capt Meredith Ellen, USAF Capt Jenny Walk, USAF Graduate School of Business & Public Policy Naval...appropriate cases, an adjustable price. Fixed-price contracts providing for an adjustable price may include a ceiling price, a target price
Members of the Forum Engelberg visit CERN
Patrice Loïez
2002-01-01
The Forum Engelberg is an annual interdisciplinary conference held in Engelberg, Switzerland intended to act as an international platform for debate and exchange of views on key issues affecting scientific research, technology, economics and philosophy. Its President is Hubert Curien - former French Minister of Research and Space Research, and President of the CERN Council from 1994 to 1996.Seated here at a presentation by Peter Jenni, spokesperson for the ATLAS collaboration, during the visit of Forum members and Geneva public figures are Bernard Ecoffey, Founder of the Forum Engelberg (left), and Jean-Claude Landry, Department of the Interior, Agriculture and Environment, state of Geneva. Photo 01: (left to right) Bernard Ecoffey, Jean-Claude Landry and Peter Jenni. Photos 02, 03: (left to right) Jean-Claude Landry, Bernard Ecoffey and Peter Jenni.
Maximilien Brice
2002-01-01
Photo 01: Dr Pierre Perrolle, Director, Office of International Science and Engineering, National Science Foundation, USA (second from right) in the ATLAS assembly hall with from left to right Randi Ruchti, Peter Jenni and Robert Eisenstein, Senior Science Advisor, National Science Foundation, USA. Photo 02: Dr Pierre Perrolle, Director, Office of International Science and Engineering, National Science Foundation, USA (second from right) in the ATLAS assembly hall with from left to right Randi Ruchti, Robert Eisenstein, Senior Science Advisor, National Science Foundation, USA and Peter Jenni. Photo 03: Dr Pierre Perrolle, Director, Office of International Science and Engineering, National Science Foundation, USA (second from right) in front of the ATLAS End-Cap Toroid vacuum vessel in the ATLAS assembly hall with from left to right Peter Jenni, Robert Eisenstein, Senior Science Advisor, National Science Foundation, USA and Randi Ruchti ________________________________
Maximilien Brice
2011-01-01
Photo 1-13:The delegation visiting ATLAS cavern with ATLAS Former Spokesperson Dr P. Jenni Photo 14:P. Jenni+ATLAS Collaboration Weizmann Institute of Sciences Israeli Industrial Liaison Office (ILO) Prof. Giora Mikenberg+Mr A. Hasson+Adviser for Israel Dr John Ellis+Commercial Attaché to Switzerland and Deputy Permanent Representative to the WTO Permanent Mission of Israel Mr Shai Moses Photo 15-22:Signature of the Guest Book with J. Ellis
Lifescience Database Archive (English)
Full Text Available ge structural protein OS=Lake Victoria marb... 30 6.5 sp|P14745|CD44_PAPHA CD44 antigen OS=Papio hamadryas G...5262|L_MABVP Large structural protein OS=Lake Victoria marburgvirus (strain Popp-
Iisraeli innovatsioonipõhine majandusmudel eeskujuks / Helen Popp
Popp, Helen
2011-01-01
Iisrael on oma majandustegevuse planeerimisel keskendunud innovatsioonile ja start-up-firmadele, Iisrael on maailma üks suuremaid teadus- ja arendustegevusse investeerijaid. Eesti teadus- ja arenduskeskused, innovatsioonile suunatud ettevõtted ja ka teaduspargid võiksid koostööpartnerite otsingul suunata pilgu teiste hulgas ka Iisraeli poole
Teachers’ Learning Design Practice for Students as Learning Designers
DEFF Research Database (Denmark)
Levinsen, Karin Tweddell; Sørensen, Birgitte Holm
2018-01-01
schools (first to 10th grade). The research focussed on information and communication technology (ICT) within the Scandinavian tradition of Problem Oriented Project Pedagogy (POPP), Problem Based Learning (PBL) and students’ production. In recent years, the projects that provide the grounding...
African Journals Online (AJOL)
Industrial Design Programme, Vocational and Technology Education. Programme, (School of ... entrepreneurship; (ii) advertising academic programmes of the School of. Environmental ..... and Integrated Marketing. Communications. McGraw-.
Jean-Claude Gadmer
2013-01-01
29 August 2013 - J.-F. Jauslin, Directeur de l’Office fédéral de la culture (OFC) Ambassadeur suisse auprès de l’UNESCO et de l’OIF au 1er septembre 2013 Confédération suisse visite le centre visiteurs de l’expérience ATLAS ainsi que la caverne expérimentale d'ATLAS avec P. Jenny, ancien Porte-parole d'ATLAS. M. Bona, Conseiller du Directeur général pour les relations avec les Organisations internationales présent tout au long.
Jean Claude Gadmer
2011-01-01
Photo 1-5:The delegation visiting the ATLAS visitor Center with P.Jenni, ATLAS Collaboration former Spokesperson Photo 6-14,15-20:visiting the ATLAS experimental area Photo 15:Y. YANG,Attaché-Q. WAN,First Secretary-Z. Ren,ATLAS Collaboration,High Energy Group,Shandong University-H.E. Mr K. Wu-P. Jenni-R. Voss,Adviser for the People’s Republic of China-H. FENG,Counsellor Photo 21-38:Signature of the Guest Book with CERN Director-General R. Heuer
Lifescience Database Archive (English)
Full Text Available 2305.81 ... (drug) ... AUTHORS ... Papadakis MA and McPhee SJ |(ed) ... TITLE ... Current Medical Diagnosis & Treatment 2015, Fifty-Fourth Edition ... JOURNAL ... McGraw Hill Education
Maximilien Brice
2002-01-01
Photos 01,02: Mr Pat McDonald, Director of "Key Business Technologies", Department of Trade and Industry, UK (third from left, front) in front of the ATLAS End-Cap Toroid vacuum vessel in the ATLAS assembly hall with, from left to right, Fred Wickens, Chris Jones, Peter Fletcher, Ray Browne, Neil Geddes, Jim Fleming, Anne Trefethen, Jim Wilson, Edwin Towndrow, Sharon Bonfield, Guy Rickett, Ken Smith, Peter Jenni. Photo 03: Mr Pat McDonald, Director of "Key Business Technologies", Department of Trade and Industry, UK (fifth from left) visiting ATLAS assembly hall with, from left to right, Jim Wilson, Peter Jenni, Ken Smith, Edwin Towndrow, Ray Brown, Chris Jones, Neil Geddes, Sharon Bonfield, Anne Trefethen, Jim Fleming, Fred Wickens. Photo 04: Mr Pat McDonald, Director of "Key Business Technologies", Department of Trade and Industry, UK (fourth from right) in front of the ATLAS Barrel Toroid coil casing in the ATLAS assembly hall with, from left to right, Peter Jenni, Jim Wilson, Guy Rickett, Anne Trefethen, ...
Lifescience Database Archive (English)
Full Text Available 6.021304.144402 ... (drug) ... AUTHORS ... Papadakis MA and McPhee SJ |(ed) ... TITLE ... Current Medical Diagnosis & Treatment 2015, Fifty-Fourth Edition ... JOURNAL ... McGraw Hill Education
Lifescience Database Archive (English)
Full Text Available ... TITLE ... Current Medical Diagnosis & Treatment 2007, Forty-Sixth Edition ... JOURNAL ... McGraw Hill Educa...tion ... PMID:17853628 (description, env_factor) ... AUTHORS ... Bross MH, Soch K, Morales
Lifescience Database Archive (English)
Full Text Available 20-6 (1995) ... (drug) ... AUTHORS ... Papadakis MA and McPhee SJ |(ed) ... TITLE ... Current Medical Diagnosis & Treatment 2015, Fifty-Fourth Edition ... JOURNAL ... McGraw Hill Education
Frequency Conversion of Single Photons: Physics, Devices, and Applications
2012-07-01
Anton Zeilinger , Alexan- der V. Sergienko, and Yanhua Shih. New high-intensity source of polarization- entangled photon pairs. Physical Review Letters...interface. Nature, 437(7055):116–120, 2005. [36] S. Ramelow, A. Fedrizzi, A. Poppe, N. K. Langford, and A. Zeilinger . Polarization-entanglement-conserving
Lifescience Database Archive (English)
Full Text Available gastro.2005.03.038 ... (drug) ... AUTHORS ... Papadakis MA and McPhee SJ |(ed) ... TITLE ... Current Medical Diagnosis & Treatment 2015, Fifty-Fourth Edition ... JOURNAL ... McGraw Hill Education
Visit of Lord Sainsbury of Turville, Minister for Science, United Kingdom
Laurent Guiraud
1999-01-01
Photo 01: Debbie Morgan explains the complexity of the ATLAS semiconductor tracker to Lord Sainsbury; Roger Cashmore (left), Director for Collider Programmes, and Shaun Roe look on. Photo 04: Lord Sainsbury (second from right) hears about preparations for the ATLAS experiment at the LHC from ATLAS spokesman Peter Jenni (right). With the Minister are CERN Director-General Prof. Luciano Maiani (left) and Roger Cashmore. Photo 07: Lord Sainsbury pictured between Prof. Luciano Maiani (left) and Peter Jenni. Photo 08: Lord Sainsbury (right) with Prof. Luciano Maiani.
AFRREV IJAH, Vol.1 (1) Feb., 2012
African Journals Online (AJOL)
User
and public sectors will require increased investment in research and development, capital and ..... Toronto: Mcgraw-Hill. Oghene, C.K.(2010). ... Fundamental of Human Resource Management in Nigeria: Ibadan College. Press & publishers.
SEDIMENTOLOGIE IN UTRECHT : hoe staat het daar mee?
Westerhoff, Wim
Sinds het vertrek van Poppe de Boer, eind 2014, stelt de Utrechtse Universiteit het zonder een hoogleraar sedimentologie. Toch gaan er jaarlijks honderden studenten op veldwerk en speelt de sedimentologie in onderwijs en onderzoek een cruciale rol. Hoe zit dat eigenlijk? En wie zijn nu de gezichten
Haemorrheologic and fibrinolytic activities in diabetics resident in ...
African Journals Online (AJOL)
STORAGESEVER
2008-05-16
May 16, 2008 ... INTRODUCTION. Diabetes .... Ugwu (1987) Ingram's and Hills (1976) and Nelson (1944) were .... McGraw Hill, pp. ... International committee communications. Reference methods for one stage prothrombin time test on human.
Patrice Loïez
2003-01-01
Photo 01: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (centre), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva and Dr Peter Jenni, ATLAS Spokesperson. Photo 02: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (2nd form left), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva; Dr Peter Jenni, ATLAS Spokesperson; Dr David Jacobs and Dr Philip Bryant, Joint Pakistan-CERN Committee.
GLOBAL JOURNAL OF PURE AND APPLIED SCIENCES VOL 15, NO
African Journals Online (AJOL)
Ada
OPTICAL ABSORPTION AND TRANSMISSION IN CuZnS ALLOYS. K. A ADULOJU .... absorption coefficient. Absorbance ... Figure 7 obtained by extrapolating the linear portion of the plots on ... and Technology”, (McGraw Hill Book Company,.
H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil
Maximilien Brice
2002-01-01
Photo 01: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (centre) with C. Melo (left) and P. Jenni Photo 02: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (centre) with C. Melo (left) and P. Jenni. Photo 03: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (second from right) with R. Salmeron, C. Melo, A. Dos Anjos and H. Pessoa Lima Junior. Photo 05: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (second from left) with, from left to right C. Melo, R. Salmeron, P. Jenni. Photo 06: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (left) with C. Melo. Behind, J. Ellis and J.A. Rubiol. Photo 07: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science,...
Investeerimine on arusaadav ja popp teema / Margit Aedla
Aedla, Margit, 1970-
2005-01-01
Sampo Baltic Asset Managementi müügitoetuse juhi Peeter Schamardini sõnul ei peaks inimesed võtma endale maksimaalset laenumakset võimalikult lühikeseks perioodiks, vaid normaalse suurusega ja pikema ajaperioodi peale
Short Communication Short Communication
African Journals Online (AJOL)
RAGHAVENDRA
INTRODUCTION. The word Helminth ... mostly present in the human intestines either in la or small intestine and ... medicine use vario. Official International Journal of Wollega University, Ethiopia ..... 10th Edn. Mcgraw Hill Medical. Publishing ...
African Journals Online (AJOL)
USER
everyone will enjoy life at all levels of human endeavor. This statutory ..... sector because of poor electricity, the internet and weak communication .... International Student Edition. Mcgraw-Hill Kogakusha, Ltd, 1960. 5. The Nation, Thursday ...
Allen, R. W.; Berry, C.; Henstock, T.; Collier, J.; Dondin, F. J. Y.; Latchman, J. L.; Robertson, R. E. A.
2017-12-01
Effective monitoring is an essential part of the process of identifying and mitigating volcanic hazards. In the submarine environment this task is made all the more difficult with observations typically limited to land-based seismic networks and infrequent shipboard surveys. Since announcing itself to the world in 1939, the Kick-`em-Jenny (KeJ) volcano, 8km off of the north coast of Grenada, has been the source of 13 episodes of T-phase recordings. These distinctive seismic signals, often coincident with heightened seismicity, have been interpreted as extrusive eruptions with a mean recurrence interval of 5-6 years. Visual confirmation of these episodes is rare and many would be unknown without the seismic evidence. By conducting new bathymetric surveys in 2016 and 2017 and reprocessing 3 further legacy data sets spanning more than 30 years and several such events we are able to present a clearer picture of the development of KeJ through time. The final bathymetric grids produced have a cell size of just 5m and, for the more modern surveys, a vertical accuracy on the order of 1m. These grids easily demonstrate the correlation between T-phase episodes and morphological changes at the volcano's edifice. In the time-period of observation we document a clear construction deficit at KeJ with only 5.75x106m3 of material added through constructive volcanism, while 5 times this amount is lost through landslides and volcanic dome collapse. The peak depth of KeJ now sits at 196m b.s.l., the lowest recorded since 1966. Limited recent magma production means that KeJ may be susceptible to larger eruptions with longer repeat times than those covered in our study. These larger eruptions would pose a more significant local hazard than the small scale volcanic events observed in recent decades. We conclude that T-phase recordings are likely to have a more varied origin than previously discussed, and are unlikely to be solely the result of extrusive submarine eruptions. This
International Journal of Health Research
African Journals Online (AJOL)
Erah
2008-11-03
Nov 3, 2008 ... The International Journal of Health Research is an online ... forum for the communication and evaluation of data, methods and findings ... Introduction ... worms are pathogenic for human beings. .... McGraw Hill Co., New York,.
Protective effect of Ziziphus mauritiana leaf extract on carbon ...
African Journals Online (AJOL)
Owner
2005-09-13
Sep 13, 2005 ... Short Communication. Protective effect of Ziziphus ... INTRODUCTION. Medicinal plants play a key role in the human health care. About 80% of the world .... McGraw Hill International Edition, London. Gregus Z, Kiwassen C ...
economic assessment of the performance of private sector ...
African Journals Online (AJOL)
Admin
Economic and Extension, Delta State University, Asaba Campus, Nigeria ... This paper critically attempts to assess the performance of the private sector ... economy would depend to a large extent on the quantity ..... New York, USA: McGraw.
... Goldfrank's Toxicologic Emergencies . 10th ed. New York, NY: McGraw Hill-Medical; 2015:chap 49. Monte AA, Hoppe ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
... Essentials of Toxicology. 3rd ed. New York, NY: McGraw Hill Medical; 2015:chap 23. Theobald JL, Mycyk ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
... Goldfrank's Toxicologic Emergencies . 10th ed. New York, NY: McGraw Hill-Medical; 2015:chap 49. Monte AA, Hoppe ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
... of Internal Medicine . 19th ed. New York, NY: McGraw Hill; 2015:chap 341. Shayne P, Lynch CA. ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
... Goldfrank's Toxicologic Emergencies . 10th ed. New York, NY: McGraw Hill; 2015:chap 105. Review Date 10/16/ ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
... Goldfrank's Toxicologic Emergencies . 10th ed. New York, NY: McGraw Hill-Medical; 2015:chap 71. Review Date 7/ ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
... Goldfrank's Toxicologic Emergencies . 10th ed. New York, NY: McGraw Hill-Medical; 2015:chap 98. Theobald JL, Mycyk ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
... Goldfrank's Toxicologic Emergencies . 10th ed. New York, NY: McGraw Hill-Medical; 2015:chap 95. Theobald JL, Mycyk ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...
Non-equilibrium solidification of undercooled droplets during ...
Indian Academy of Sciences (India)
Unknown
mathematical model, based on classical theory of heterogeneous nucleation and volume separation of nucleants ... atomization processes working on this principle on a ..... Holman J P 1989 Heat transfer (New Delhi: McGraw Hill Book. Co.) p.
Moving potential for Dirac and Klein–Gordon equations
Indian Academy of Sciences (India)
and according to our knowledge the mathematical treatment of relativistic ..... the equation with step + Coulomb is soluble in principle, the time-dependent term ... and A R Hibbs, Quantum mechanics and path integrals (McGraw Hill, New.
Becoming a Coach in Developmental Adaptive Sailing: A Lifelong Learning Perspective.
Duarte, Tiago; Culver, Diane M
2014-10-02
Life-story methodology and innovative methods were used to explore the process of becoming a developmental adaptive sailing coach. Jarvis's (2009) lifelong learning theory framed the thematic analysis. The findings revealed that the coach, Jenny, was exposed from a young age to collaborative environments. Social interactions with others such as mentors, colleagues, and athletes made major contributions to her coaching knowledge. As Jenny was exposed to a mixture of challenges and learning situations, she advanced from recreational para-swimming instructor to developmental adaptive sailing coach. The conclusions inform future research in disability sport coaching, coach education, and applied sport psychology.
Dr. David Syz, State Secretary for Economic Affairs, Switzerland
Maximilien Brice
2003-01-01
Dr. David Syz, State Secretary for Economic Affairs, Switzerland, toured the assembly hall of the ATLAS experiment on a recent visit to CERN.Photos 01, 02: Dr. Peter Jenni, spokesperson for the ATLAS experiment (second from left), explains to Dr. David Syz (fourth from left) and accompanying visitors the process of integration of a 26-metre-long coil of the barrel toroid magnet system into its coil casing.Photo 03: Dr. Peter Jenni (extreme right) with Dr. David Syz (front row, fourth from right) behind a stack of 26-metre-long 'racetrack' coils awaiting integration into their coil casings.
1865-IJBCS-Article -Caroline Nywira
African Journals Online (AJOL)
hp
test. Correlation test was also used to find out whether density of total counts, total coliforms and faecal coliforms were ..... Rei DDC, Edwards AC, Cooper D, Wilson E,. Mcgraw BA. 2003. ... Swimming Purposes in Abeokuta,. Nigeria. Afri.
Downward continuation and tilt derivative of magnetic data for ...
Indian Academy of Sciences (India)
S K Pal
2017-06-12
Jun 12, 2017 ... Downward continuation; tilt derivative; magnetic data; coal fire mapping; Jharia coal field;. India. 1. .... of seams are thin and not suitable for mining but have the ...... Theory and Application; McGraw Hill Education (India).
effect of tenure security on livelihood activities of women farmers in ...
African Journals Online (AJOL)
KANETH
1989-05-03
May 3, 1989 ... Keywords: tenure security, livelihood activities and rural women. INTRODUCTION .... sale to buy farming inputs or other things they cannot produce. Also about 20% of the .... Internet Insiders, USA: McGraw Hill. Quan Julian ...
Using Multi-criteria Evaluation and GIS for Flood Risk Analysis in ...
African Journals Online (AJOL)
New Win User
were then mapped in the GIS to show the spatial disparities in risk. ..... Ayalew, L. & Yamagishi, H 2005, 'The application of GIS-based logistic regression for landslide .... Saaty, TL 1980, The analytic hierarchy process, Mcgraw-Hill, New York.
116 Appraisal as a Determinant for Adequate Compensation in ...
African Journals Online (AJOL)
User
2012-01-24
Jan 24, 2012 ... The fundamental question this work seeks to answer. Appraisal as a Determinant for ..... Organizations should invest richly on people and strive to ... Human Resource Management, New York, McGraw. Hill/Irwin. Drucker P. E. ...
Formula for a solution of ut ‡ H…uYDu† ˆ g
Indian Academy of Sciences (India)
E-mail: aditi@math.tifrbng.res.in; gowda@math.tifrbng.res.in. MS received 10 ... Hamilton±Jacobi equation; dynamic programming principle; viscosity sub and super ...... [11] Rudin W, Functional Analysis (Tata McGraw Hill Pub.) (1974). 414.
THE ENVIRONMENT, OIL AND HUMAN RIGHTS IN NIGERIA*
African Journals Online (AJOL)
Mofasony
'Environmental Impact Analysis Handbook', McGraw-. Hill, New York ... West African Gas Pipeline Project (Special Provisions etc) Act Cap W8 LFN. 2004. The Role .... See D Harris, Cases and Materials on International Law, (5th ed.) London: ...
an evaluation of solutions to moment method of biochemical oxygen
African Journals Online (AJOL)
HOD
mathematical equation or fitting curves into a linear equation. Literature [5] ..... Hill Inc, Tokyo. 1977. [9] Tebbutt, T. H. Y. Principles of Water Quality ... Treatment Disposal and Reuse, 3rd edn, McGraw-. Hill Book Company, New York. 1991.
De Palo, Pasquale; Maggiolino, Aristide; Milella, Paola; Centoducati, Nicola; Papaleo, Alessandro; Tateo, Alessandra
2016-01-01
In recent years, there has been an increasing interest on donkey milk production, on its characteristics, and also on breeding techniques. Donkey milk is characterized by high economic value, although the productive level of jennies is poor. During the milking process, foals are usually separated from their dams, allowing the milk collection in the mammary gland of jennies before milking session. This takes 8 h per day of fastening period for lactating donkey foals. During this period, it could be possible to apply a partial artificial suckling system (artificial suckling during daytime and natural suckling during the night). The aim of the work is the evaluation of the effect of this innovative technique on in vivo performances and on meat production traits of Martina Franca donkey foals. Forty Martina Franca jennies with their foals were used for the trial. After colostrum assumption, 20 foals were partially artificially suckled (AS) during each day, and 20 foals were naturally suckled (NS). From 8.00 to 20.00, both groups were separated from their mothers in order to allow the milking procedures of the jennies. The AS group was in a stall equipped with an automatic calf-suckling machine. For each group, 10 foals were slaughtered at 12 months and 10 foals at 18 months. Artificial suckling system positively affected the growth rate of donkey foals, particularly in the first 6 months from birth, with higher weekly weight gain (P 0.05). Artificial suckling system permitted to extend the time of foal separation from their mothers increasing milk collection time per day, awarding fastening periods in foals.
Lithium-enhanced radioactive iodine ablation of hyperthyroid patients
African Journals Online (AJOL)
accordance with department protocols on management of hyperthyroid ... variables or by the Pearson chi-square test or Fisher's exact test for ..... Medicine. 16th ed.. London: McGraw Hill; 2005. p. 2104–26. 5. Nordyke RA, Gilbert Jr. FI .
Indian Academy of Sciences (India)
Management Systems have been developed and are widely used all over the world (see ... referred to, provides a variety of useful features,: Firstly, business rules such as ..... Page 8 .... Database System Concepts, 2nd ed., McGraw-. Hill, 1991 ...
influence of superplasticizer and varying aggregate size
African Journals Online (AJOL)
HOD
The research findings presented show that laterite .... results support the research findings of Neville(13); ... Design of Concrete Structures 14th Edition, NY, McGraw-. Hill. [3] Neville, A.M.. ... [13] Neville, A. M. Properties of Concrete, 4th Edition,.
l modeling of r—diogeni™ isotopes in twoE™omponent mixing
Indian Academy of Sciences (India)
The mixing other by a mathematical operation, such as summa- equation for the isotopic ratio is as follows (e.g., Faure ..... physical sciences (New York: McGraw Hill) 336 p. ... Faure G 1986 Principles of isotope geology (New York: John.
Н(1) Gauge theory as quantum hydrodynamics
Indian Academy of Sciences (India)
The Institute of Mathematical Sciences, Taramani, Chennai 600 113, India ... gauge fixing is needed in this approach that is closest to the spirit of the gauge principle. ...... C Itzykson and J B Zuber, Quantum field theory (McGraw Hill, Singapore, ...
Mihkelson, Immo, 1959-
2003-01-01
Uutest plaatidest Adel Salameh "Kanza", Hermes House Band "The Album", David Holmes "Analyze That", Boston "Corporate America", Tim McGraw "And The Dancehall Doctors", Marti Pellow "Sings The Hits Of Wet Wet Wet & Smile", "Elvis Costello & The Imposters", Jolly Music "Jolly Bar"
Nonstationary Root Causes of Cobb’s Paradox
2010-07-01
software systems, and the preferred approaches to system development are called evolutionary development ( Pressman , 2001, pp. 34–47). Evolutionary...components onto integrated circuits. Electronics Magazine, 38(8). Pressman , R. S. (2001). Software engineering: A practitioner’s approach. New York: McGraw
THE MIND BODY PROBLEM: THE HERMENEUTICS OF AFRICAN ...
African Journals Online (AJOL)
principles in explaining the mind –body problem due to deep seated criticisms from the ..... over duly by his mathematical intercourse with mere materials and this made him to found his .... Ed. (New York: McGraw Hill), 1993, p. 90. 19 Emefie ...
The National Shipbuilding Research Program. Design for Production Manual 2nd Edition
1999-07-01
New York, 1979 Montgomery, Douglas C., Introduction to Statistical Quality Control, 3rd Edition, John Wiley & Sons, New York, 1997 Ishikawa , Kaoru ...references: Feigenbaum, A.V., Total Quality Control: Engineering and Management, 3rd edition, New York McGraw Hill, 1983. Ishikawa , Kaouro., Guide to
Analytic Culture in the U.S. Intelligence Community: An Ethnographic Study
2005-01-01
Cultures; Jacques Lacan, Ecrits; Ferdinand de Saussure , Course in General Linguistics. 97 CHAPTER EIGHT is the process of learning the ropes; training...American Journal of Sociology 48 (1943): 593–602. Saussure , Ferdinand. Course in General Linguistics. Translated by W. Baskin. New York: McGraw
Pictures from Words, Pictures from Text: Constructing Pictorial Representations of Meaning from Text
2009-11-02
characteristics of language symbolism is its arbitrariness, as Saussure pointed out [17]. Recently there has been a resurgence of interest in the...Kingdom, 20-22 November 2000. The British Computer Society. [17] Saussure , Ferdinand de. 1959. Course in General Linguistics. New York, NY: McGraw
Review of Electrical and Gravity Methods of Near-Surface ...
African Journals Online (AJOL)
USER
In every big city, dozen of new boreholes or hand-dug wells are .... This paper is a review of the electrical and gravity methods of ... audience/readership. II. ..... W. W. Northon and Company, New York. Butler ... McGraw Hill Books Co. New York ...
Journal of Agriculture and Social Research (JASR) Vol. 8, No. 2, 2008
African Journals Online (AJOL)
1986-11-05
Nov 5, 1986 ... Integrated Pest Management Field Farmer School (IPMFFS) (in Indonesian language ... participants, (6) the activeness of the participants, (7) planning program, and (8) ... and regarded as strategic momentum which by the exist human resources and East Java ..... International edition, London: Mcgraw –Hill.
Recipients of 2013 EPS High Energy & Particle Physics Prize
ATLAS, Experiment
2014-01-01
(From left) Joe Incandela, Peter Higgs, Francois Englert, Tejinder Virdee, Dave Charlton, and Peter Jenni. Higgs and Englert gave the prizes to the recipients of the 2013 European Physical Society's High Energy and Particle Physics Prize, for an outstanding contribution to high energy physics. "For the discovery of a Higgs boson, as predicted by the Brout-Englert-Higgs mechanism," the prize was awarded to the ATLAS and CMS collaborations. Spokesperson for CMS, Incandela, and Spokesperson for ATLAS, Charlton, accepted the awards on their collaborations' behalf. "For their pioneering and outstanding leadership roles in the making of the ATLAS and CMS experiments," the prize was awarded to Jenni, Virdee, and Michel Della Negra (not present). Image: ATLAS
International Journal of Health Research
African Journals Online (AJOL)
Erah
The International Journal of Health Research is an online international journal allowing ... forum for the communication and evaluation of data, methods and findings in health sciences and related ... Conclusion: Permeation rate of drugs across the ..... New Delhi, McGraw Hill Medical Publishing ... Human skin permeation of.
An Engineering Context for Software Engineering
2008-09-01
predictable properties. The first two are due to Boehm as described in Pressman [Pre05] and called validation versus verification. 1. solving the right...Quality Software, 2nd ed., New York: Macmillan, 1991. [Pre05] Pressman , Roger, Software Engineering: A Practitioner’s Approach, Sixth Edition, McGraw
Ruffell, Alastair; McKinley, Jennifer
2005-03-01
One hundred years ago Georg Popp became the first scientist to present in court a case where the geological makeup of soils was used to secure a criminal conviction. Subsequently there have been significant advances in the theory and practice of forensic geoscience: many of them subsequent to the seminal publication of "Forensic Geology" by Murray and Tedrow [Murray, R., Tedrow, J.C.F. 1975 (republished 1986). Forensic Geology: Earth Sciences and Criminal Investigation. Rutgers University Press, New York, 240 pp.]. Our review places historical development in the modern context of how the allied disciplines of geology (mineralogy, sedimentology, microscopy), geophysics, soil science, microbiology, anthropology and geomorphology have been used as tool to aid forensic (domestic, serious, terrorist and international) crime investigations. The latter half of this paper uses the concept of scales of investigation, from large-scale landforms through to microscopic particles as a method of categorising the large number of geoscience applications to criminal investigation. Forensic geoscience has traditionally used established non-forensic techniques: 100 years after Popp's seminal work, research into forensic geoscience is beginning to lead, as opposed to follow other scientific disciplines.
121 Has Rural Banking Developed Rural Nigeria? (Pp. 121-130 ...
African Journals Online (AJOL)
User
2009-07-16
Jul 16, 2009 ... should encourage such a venture (Olashore, 1978). These are realisable ... institutions accommodating entrepreneurs in their projects like equipment leasing ... bank Ltd in 1973, launching of operation feed the nation in 1973, and introduction of ..... Basic Econometrics, New York: McGraw Hill. Iyoha, M. A. ...
A Snapshot of the Calculus Classroom
Weathers, Tony D.; Latterell, Carmen M.
2003-01-01
Essentially a focus group to discuss textbook related issues, a meeting of calculus instructors from a wide variety of environments was convened and sponsored by McGraw Hill to provide feedback on the current state of the calculus classroom. This paper provides a description of the group's discussions.
Honing, H.; Ladinig, O.
2008-01-01
While the discussion on the integrity of data obtained from Web-delivered experiments is mainly about issues of method and control (Mehler, 1999; McGraw et al., 2000; Auditory, 2007), this comment stresses the potential that Web-based experiments might have for studies in music perception. It is
Technology Approach: DoD Versus Boeing (A Comparative Study)
2016-01-01
1993). The project cycle, military project management handbook. New York: McGraw -Hill. Donoghue, J. A. (1994, April). Big twin power. Air Transport...work at ICAF, she was Director, Pentagon Liaison Office, Air Force Audit Agency. She holds a Master of Science in National Resource Strategy and a
Dr Stanislaw Huskowski, Mayor of Wroclaw, Poland
Patrice Loïez
2002-01-01
Dr Stanislaw Huskowski, Mayor of Wroclaw, Poland visiting the ATLAS magnet assembly hall, building 180 with Mr Carlo Lamprecht, State Councillor, Dr Stanislaw Huskowski and Dr Peter Jenni, ATLAS Spokesperson
Energy Technology Data Exchange (ETDEWEB)
Schwaninger, E.
2009-07-01
This article presents an interview with Swiss solar energy pioneer Josef Jenni, who is considered one of the most successful European solar innovators. In the interview, Jenni's basic motivation to set up his company and the initial lean spell he encountered are discussed, as is his idea - in the nineteen eighties - of running a tour across Switzerland with solar-powered vehicles. Further topics discussed include the potential for new renewable energy sources, the large-scale photovoltaic installations on his factory buildings, energy self-sufficient buildings, socio-economic factors, training of planners and installers and the replacement of oil with solar and other renewable resources. Swiss energy policy, energy saving efforts and plans for new large-scale power stations are also discussed.
"Loomakari" kui uue ühiskonnakorralduse näide / Ernest Truely ; tõlkinud Ulla Juske
Truely, Ernest
2009-01-01
Sandra Jõgeva kuraatoriprojektist "Loomakari" Tallinna Kunstihoones, avatud 12. aprillini. Kujundaja Tanel Saar. Sandra Jõgeva, Tanel Saare, Anthony Faroux' (Inglismaa), Jenni Juulia Wallinheimo (Soome) ja Kjetil Kauslandi (Norra) töödest
Animaalne antimagnetism / Mari Laaniste
Laaniste, Mari, 1977-
2009-01-01
Rahvusvaheline grupinäitus "Loomakari" Tallinna Kunstihoones kuni 12. aprillini. Kuraator Sandra Jõgeva, kujundaja Tanel Saar. Lühidalt Jenni Juulia Wallinheimo, Kjetil Kauslandi ja Loore Emilie Raavi töödest
African Journals Online (AJOL)
DELL
2017-10-27
Oct 27, 2017 ... growth of canned food borne bacteria.Trans. Nig. Soc. Bio. Conserv., 6:103. – 111. Johansen, H. (1978). Plants Microtechnique. Mcgraw-Hill, New York. 532p. Okaka JC, Okaka ANO (2001). Food composition, spoilage and shelflife extension. Ociarco. Academic publishers, Enugu, Nigeria, pp. 54-57, 61-66.
Development and Design of Sludge Freezing Beds
1988-12-01
Wastewater Treatment/Disposal/Reuse. New York: McGraw Hill, 2nd ed. Morin, W., R. Lewandowski and R. Zaloum (1986) Le traitement des boues a l’aide du gel...degel naturel et epandage des boues en foret. Draft report for Environment Canada, Mon- treal. National Oceanic and Atmospheric Administration (1984
2004-10-01
Graff, M. & van Wyk, K. Secure Coding Principles & Practices. O’Reilly, 2003. • Hoglund, G. & McGraw, G. Exploiting Software: How to Break Code. Addison...Eisenecker, U.; Glück, R.; Vandevoorde, D.; & Veldhuizen , T. “Generative Programming and Active Libraries (Extended Abstract)” <osl.iu.edu/~tveldhui/papers
Gadmer, Jean-Claude
2014-01-01
signing the Guest book with CERN Director-General R. Heuer; visiting the ATLAS Visitor Centre and the ATLAS cavern with ATLAS Collaboration Spokesperson D. Charlon and Former ATLAS Collaboration Spokesperson P. Jenni.
Kubátová, A; Fedorova, T; Skálová, I; Hyniová, L
2016-09-01
The aim of the research was to evaluate two chemical tests for non-invasive pregnancy diagnosis from urine, the Cuboni reaction and the barium chloride test, in donkeys (Equus asinus) and alpacas (Vicugna pacos). The research was carried out from April 2013 to September 2014. Urine samples were collected on five private Czech farms from 18 jennies and 12 alpaca females. Urine was collected non-invasively into plastic cups fastened on a telescopic rod, at 6-9 week intervals. In total, 60 and 54 urine samples from alpacas and jennies, respectively, were collected. The Cuboni reaction was performed by the State Veterinary Institute Prague. The barium chloride test was done with 5 ml of urine mixed together with 5 ml of 1% barium chloride solution. Results of the Cuboni reaction were strongly influenced by the reproductive status of jennies; the test was 100% successful throughout the second half of pregnancy. However, no relationship was found between the real reproductive status of alpaca females and results of the Cuboni reaction. It was concluded that the barium chloride test is not suitable for pregnancy diagnosis either in donkeys, due to significant influence of season on the results, or in alpacas, because no relationship between results of the test and the reproductive status of alpaca females was found. In conclusion, the Cuboni reaction has potential to become a standard pregnancy diagnostic method in donkeys.
A Usability Study of Interactive Web-Based Modules
Girard, Tulay; Pinar, Musa
2011-01-01
This research advances the understanding of the usability of marketing case study modules in the area of interactive web-based technologies through the assignment of seven interactive case modules in a Principles of Marketing course. The case modules were provided for marketing students by the publisher, McGraw Hill Irwin, of the…
Engagement DEOCS 4.1 Construct Validity Summary
2017-08-01
George, D., & Mallery, P. (2006). SPSS for Windows step by step: A simple guide and reference. Boston: Pearson Education, Inc. Glick, W. H. (1985...1993. SPSS for Windows Base System User’s Guide Release 6.0, SPSS Inc. Nunnally, J. C. (1978). Psychometric Theory (2nd ed.). New York: McGraw Hill
Indian Academy of Sciences (India)
quence of the principle that a system in thermodynamic equilib- ... pute analog solutions to mathematical problems which require the minimization .... [4] M Zemansky and R Dittman, Heat and Thermodynamics, 8th ed., McGraw. Hill, 2011. [5] Lord Rayleigh, On the Instability of Jets, Proc. Lond. Math. Soc., Vol.10, p.4,. 1878.
75 FR 27814 - Receipt of Applications for Permit
2010-05-18
... permit to export one female captive bred giant panda (Ailuropoda melanoleuca) born at the zoo in 2005 and... education. The permit numbers and animals are: 070854, Bimbo Jr.; 079868, Vickie; 079870, Jenny; 079871...
Dr Stanislaw Huskowski, Mayor of Wroclaw, Poland
Patrice Loïez
2002-01-01
Dr Stanislaw Huskowski, Mayor of Wroclaw, Poland visiting the ATLAS magnet assembly hall, building 180. From l to r: Mr Carlo Lamprecht, State Councillor, Dr Stanislaw Huskowski and Dr Peter Jenni, ATLAS Spokesperson
Surev luik, ärkavad mälestused ja radioaktiivsus / Kairi Prints
Prints, Kairi, 1977-
2010-01-01
Koreograaf-lavastaja Dmitri Hartšenko loodud Tallinna Tantsuteatri tantsuetendus "Vestlus luigega", koreograaf Jenni Kivelä "Ballroom for Beginners" tantsuteater ZICK, Jo Strømgreni "The Experiment" Jo Strømgren Kompanii esituses
Patrice Loïez
2005-01-01
Picture 01 : Here he is seen with ATLAS spokesperson, Peter Jenni (left), and the ATLAS Muon System project leader, Giora Mikenberg, listening to Karina Loureiro (right), an Argentinian student at the University of Wisconsin
On 20 November CERN hosted a symposium to mark the 70th birthday of Chris Llewellyn Smith
Maximilien Brice
2012-01-01
Left to right: (back) Rolf Heuer, Peter Jenni, Lyn Evans, Chris Llewellyn Smith, Steve Cowley, Zehra Sayers, David Gross, Chris Allsopp, Robert Jaffe, Bikash Sinha; (front) Geoffrey West, Álvaro de Rújula, John Ellis.
Dying for an iPhone: The Labour Struggle of China’s New Working Class
Directory of Open Access Journals (Sweden)
Jenny Chan
2014-10-01
Jenny Chan was Chief Coordinator of SACOM (Students and Scholars Against Corporate Misbehavior between 2006 and 2009. Educated at the Chinese University of Hong Kong and the University of Hong Kong, she went on to pursue her doctorate in sociology and labour studies as a Reid Research Scholar at University of London. She was awarded the Great Britain-China Educational Trust for dissertation writing (PhD diss. 2014. In September 2014 she joined the University of Oxford as Departmental Lecturer in Contemporary Chinese Studies, the School of Interdisciplinary Area Studies. Her recent articles have appeared in Current Sociology, Modern China, The Asia-Pacific Journal, The South Atlantic Quarterly, Global Labour Journal, New Labor Forum, Labor Notes, New Internationalist and New Technology, Work and Employment. http://www.area-studies.ox.ac.uk/dr-jenny-chan
Maximilien Brice; CERN
2009-01-01
Tirage 1-3; 7-9:C. Alonso, R. Heuer Tirage 4-6:F. Pauss, R. Heuer, C. Alonso, J. Labastida Tirage 10-11:M. Aguilar Benitez, C. Alonso at CMS Tirage 12-13:the delegation and G. Tonelli, counting room Tirage 14-15,17:the delegation and G. Tonelli, CMS underground area Tirage 16:G. Tonelli, C. Alonso, CMS underground area Tirage 18-20:G. Tonelli, C. Alonso, M. Aguilar Benitez, CMS underground area Tirage 21-28 :C. Alonso, R. Heuer, signing the Guest book Tirage 29-36;38-41:the delegation at ATLAS with P. Jenni Tirage 37:J. Aparicio, C. Parajes, J. Labastida, P. Jenni, C. Alonso, L. Alvarez Gaume Tirage 42-43:the delegation and spanish ATLAS collaborators Tirage 44-46: Meeting with spanish scientists at CERN
Energy Technology Data Exchange (ETDEWEB)
Jarnagin, Ronald E.; Bandyopadhyay, Gopal K.
2010-01-21
Detailed construction data from the McGraw Hill Construction Database was used to develop construction weights by climate zones for use with DOE Benchmark Buildings and for the ASHRAE Standard 90.1-2010 development. These construction weights were applied to energy savings estimates from simulation of the benchmark buildings to establish weighted national energy savings.
DUKW-21 Autonomous Navigation: Transitioning Between Sea and Land
2010-09-01
velocity at s is equal to ( Pestel , 1968): where v(s) is the velocity at position s, and v(s0) is the velocity at some initial position s0. The...technical report. E. R. Jones, R. L. Childers. Contemporary College Physics. McGraw-Hill Inc.; USA, 2000. E. C. Pestel . Dynamics. McGraw
Wisconsin State Legislative Audit Bureau, Madison.
The Wisconsin legislature has required the Department of Public Instruction to adopt or approve standardized tests for statewide use to measure student attainment of knowledge and concepts in grades 4, 8, and 10. Although school districts generally gave high ratings to the contents of TerraNova (McGraw Hill), the testing instrument most recently…
Journal of Child and Adolescent Mental Health - Vol 20, No 2 (2008)
African Journals Online (AJOL)
Book Review Overcoming Body Image Disturbance: A Programme for People with Eating Disorders By Lorraine Bell and Jenny Rushforth (2008). Carla Dukas. http://dx.doi.org/10.2989/JCAMH.2008.20.2.9.692 ...
Directory of Open Access Journals (Sweden)
Jenny E Myers
2016-04-01
Full Text Available In this Perspective on the study by Hannah Knight and colleagues, Jenny Myers and Edward Johnstone consider the implications of negative findings in a variable setting in which adverse events are rare.
African Journals Online (AJOL)
Experiments in the provision of rural community libraries in South Africa: the family literacy project's initiatives · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Jenny Aitchison, 94-109 ...
Modeling of Direct Contact Wet Cooling Tower in ETRR-2
International Nuclear Information System (INIS)
El Khatib, H.H.; Ismail, A.L.; ElRefaie, M.E.
2008-01-01
The Egyptian Testing and Research Reactor no.2 (ETRR-2) was commissioned at 1997 with maximum power 22 MW for research purposes; an induced draft wet cooling tower (counter flow type) was putted in operation in 2003 instead of the first one. Investigations are achieved to evaluate cooling tower performance to guarantee that the cooling tower capable to dissipate heat generated in reactor core. Merkel and Poppe analysis was applied to simulate this cooling tower packing. Merkel analysis was applied to predict water outlet temperature from cooling tower and also to show the effect of ambient conditions on this temperature. Poppe analysis was applied to predict Merkel number which evaluate cooling tower. The Runge-Kutta numerical method was applied to solve the differential equations in this model and an engineering equation solver (EES) is the language used to model the cooling tower. This research illustrates that the cooling tower achieves good performance in various sever ambient condition at maximum operating condition of reactor power. The results show that at severe summer condition of wet bulb temperature equals 24 degree c and tower inlet temperature equals 37 degree c, the outlet water temperature equals 30.4 degree c from cooling tower, while the Merkel number is be found 1.253
1995-08-01
1955;36pp. 44. Eger El. II. A mathematical model of uptake and distribution, ch. 7, pp.72-87 In E. M. Papper and R. J. Kitz (eds.). Uptake and...Space Environ. Med. 1992;63:386. 119. Papper EM and Kitz RJ. Uptake and distribution of anesthetic agents. New York: McGraw Hill, 1963. 67 120. Per W and
Soome ja ameerika koreograafide tööd Eesti tantsulaval / Maria Goltsman
Goltsman, Maria
2010-01-01
Tantsulavastustest "Ballroom for Beginners" ("Algajate tantsusaal"), koreograaf Jenni Kivelä, esietendus 7. mail Kumu auditooriumis ja Cid Pearlmani "This is what we do in the winter" ("See, mida me talvel teeme"), esietendus 25. mail Kanuti gildi saalis
Jens Beckert, 2016, Fraud and Fantasy
DEFF Research Database (Denmark)
Harrington, Brooke
2017-01-01
Contribution to review symposium on: Jens Beckert (2016): Imagined Futures. Fictional Expectations and Capitalist Dynamics. Harvard University Press. Other ontributions from: Akos Rona-Tas (University of California, San Diego) ; William Deringer (Massachusetts Institute of Technology) and Jenny...
Swiss and German Ministers make a joint visit to CERN
2008-01-01
On Friday, 23 May the German Federal Minister of Education and Research, Annette Schavan, and the Head of the Swiss Federal Department of Foreign Affairs, Micheline Calmy-Rey, paid a joint visit to CERN. German Federal Minister of Education and Research, Annette Schavan and the Head of the Swiss Federal Department of Foreign Affairs, Micheline Calmy-Rey, with Robert Aymar, Rolf-Dieter Heuer and Jos Engelen. The Swiss and German ministers in front of the ATLAS experiment, accompanied by Robert Aymar, Rolf-Dieter Heuer, Jos Engelen and Peter Jenni. Director-General Robert Aymar gave the ministers a short introduction to CERN, which was followed by the signing of the Guest Book. Both ministers took the opportunity to go to Point 1 to visit the ATLAS experiment, guided by the ATLAS spokesperson Peter Jenni, and also the LHC tunnel.
Abielud, mis muutsid maailma / Guido Ilves
Ilves, Guido
1997-01-01
Muhamed ja Chadidisha. Martin Luther ja Katharina von Bora. Inglise kuninga Henry VIII abielud. Habsburgide keiser Franz Joseph I ja Elisabeth. Vene keisrinna Katariina II abielu keiser Peeter III-ga. Karl Marx ja Jenny. Albert Einstein ja Mileva Maric
Directory of Open Access Journals (Sweden)
Kee Hoon Sohn
2014-10-01
Full Text Available Plant nucleotide-binding leucine-rich repeat (NB-LRR disease resistance (R proteins recognize specific "avirulent" pathogen effectors and activate immune responses. NB-LRR proteins structurally and functionally resemble mammalian Nod-like receptors (NLRs. How NB-LRR and NLR proteins activate defense is poorly understood. The divergently transcribed Arabidopsis R genes, RPS4 (resistance to Pseudomonas syringae 4 and RRS1 (resistance to Ralstonia solanacearum 1, function together to confer recognition of Pseudomonas AvrRps4 and Ralstonia PopP2. RRS1 is the only known recessive NB-LRR R gene and encodes a WRKY DNA binding domain, prompting suggestions that it acts downstream of RPS4 for transcriptional activation of defense genes. We define here the early RRS1-dependent transcriptional changes upon delivery of PopP2 via Pseudomonas type III secretion. The Arabidopsis slh1 (sensitive to low humidity 1 mutant encodes an RRS1 allele (RRS1SLH1 with a single amino acid (leucine insertion in the WRKY DNA-binding domain. Its poor growth due to constitutive defense activation is rescued at higher temperature. Transcription profiling data indicate that RRS1SLH1-mediated defense activation overlaps substantially with AvrRps4- and PopP2-regulated responses. To better understand the genetic basis of RPS4/RRS1-dependent immunity, we performed a genetic screen to identify suppressor of slh1 immunity (sushi mutants. We show that many sushi mutants carry mutations in RPS4, suggesting that RPS4 acts downstream or in a complex with RRS1. Interestingly, several mutations were identified in a domain C-terminal to the RPS4 LRR domain. Using an Agrobacterium-mediated transient assay system, we demonstrate that the P-loop motif of RPS4 but not of RRS1SLH1 is required for RRS1SLH1 function. We also recapitulate the dominant suppression of RRS1SLH1 defense activation by wild type RRS1 and show this suppression requires an intact RRS1 P-loop. These analyses of RRS1SLH1 shed
Systems Analysis | Hydrogen and Fuel Cells | NREL
chain costs, sustainability metrics, and financial analyses within an optimization framework. NREL's , Handbook of Clean Energy Systems (2015) Retail Infrastructure Costs Comparison for Hydrogen and Electricity Heimiller, and Jenny Melius (2012) Infrastructure Analysis Tools: A Focus on Cash Flow Analysis, Hydrogen
TLÜ teadlased andsid panuse avastusse, mis tõotab läbimurret Alzheimeri ravis
2015-01-01
Tallinna ülikooli teadlased professor Jan Johansson ja dr Jenny Presto teevad koostööd kolleegidega Karolinska instituudist, Cambridge’ist ja Lundi ülikoolist. Uurimisrühm leidis Alzheimeri tõbe käivitava molekuli ning seda on õpitud blokeerima
Maximilien Brice
2011-01-01
Photo 1-24:Collaboration ATLAS, Ancien Porte-parole P. Jenni+F. Pauss+Experte en pédagogie S. Forster+R. Dreifuss+C. Bossy+JP Bossy, visite de la caverne ATLAS Photo 25-40:Visite du Tunnel LHC au Point 1
Maximilien Brice
2002-01-01
L. to r.: Dr Diether Blechschmidt, Adviser for Non Member States Relations, Dr Peter Jenni, Spokesman, ATLAS Experiment, Prof. Chen, Mr Jean-Luc Baldy, Head of the LHC Civil Engineering Group and Dr John Ellis, Adviser for Non Member States Relations.
2004-01-01
Iiri ansambli Westlife uuest ilmuvast singlist ; Robi Williamsi uuest raamatust ja menulaulude albumist "Feel" ; MTV muusikavideo auhinna nominatsioonide edetabeli liider räppar Jay-Z ; Atomic Kitteni endise liikme Jenny Frosti pulmadest ; Saksa ansambli Rammstein kontserdist Saku Suurhallis 22. novembril
Submicron FETs Using Molecular Beam Epitaxy.
1981-01-01
2rin w2Cgs Req + 2(rw 2Cg2 Req + rin 2Reqgs Podell 9 has found empirically for one-micron gate length FETs that R =1.25 (10) eq gm Using Eq. (10) in...Transmission, Modulation, and Noise (McGraw- Hill, NY, 1959), p. 223. 9. A. Podell , to be published. 10. P. Wolf, "Microwave Properties of Schottky-Barrier
1986-06-01
disposal, and sub- aqueous capping using cleaner sediment. Options for controlling confined disposal impacts include treatment, storage, and reuse . Evaluate...dominated first by Anabaena felisii and then replaced by Anabaena spiroides and Aphanizomenon flos- aguae (all filamentous, mat-forming blue-green...Protection Agency, Washington, DC, 1980. 247 Metcalf and Eddy, Inc., Wastewater Engineering Treatment/Disposal/ Reuse , McGraw Hill Book Company, New York
How effective is the invisible hand? Agricultural and food markets in Central and Eastern Europe
Brosig, Stephan; Hockmann, Heinrich
2005-01-01
This volume of proceedings, available both as hard copy and pdf , is a compilation of selected contributions to the IAMO Forum 2005, which will be held in Halle (Saale), Germany, at the Institute of Agricultural Development in Central and Eastern Europe from June 16-18, 2005. CONTENTS: Agricultural and food markets in Central and Eastern Europe: An introduction; Stephan Brosig, Heinrich Hockmann. Agricultural markets in CEE - An overview; József Popp. Regoverning agrifood markets in CEEC - Po...
His Majesty King Abdullah II of the Hashemite Kingdom of Jordan.
Patrice Loïez
2003-01-01
Photo 03: King of Jordan visited some ATLAS installations. From left to right: Maurice Bourquin, President of the CERN Council, Luciano Maiani, Director-General of CERN, King Abdullah II of Jordan, Herwig Schopper, President of the SESAME Council and Peter Jenni, ATLAS spokesman.
Short Report Assessing the feasibility of mobile phones for follow ...
African Journals Online (AJOL)
largely paper-based. As part of a feasibility study ... Committee in Malawi and by the University of Washington,. USA. Victoria Hardy1, Jenny Hsieh2, Baxter Chirambo3, Tsung-Shu Joseph Wu2, John O'Donoghue4,. Adamson S. Muula5 ...
Maximilien Brice
2005-01-01
They visited the assembly hall for the CMS experiment, the COMPASS experiment and the test facilities for the LHC magnets. They are pictured (no 01) in the ATLAS cavern with Peter Jenni, ATLAS spokesman, and Gabriele Fioni, CEA deputy director of programmes
Brice, Maximilien
2014-01-01
signing the Guest book with CERN Director-General R. Heuer and visiting the ATLAS cavern with ATLAS Collaboration, Former Spokesperson P. Jenni, ATLAS Collaboration, University of Copenhagen M. Dam and Niels Bohr Institute, University of Copenhagen, senior ATLAS Denmark member P. Hansen.
CONTRIBUTIONS OF 20TH CENTURY WOMEN TO PHYSICS
Annotated Photo Gallery In Her Own Words Some Physics History 500+ Books and Articles Field Editors Physical Society, the University of California, UCLA Physics and Astronomy Department, the Laboratories of , Vera Atomic, Molecular, and Optical Physics Bonnelle, Christiane Bramley, Jenny Cauchois, Yvette Connes
Calculating the evaporated water flow in a wet cooling tower
International Nuclear Information System (INIS)
Grange, J.L.
1994-04-01
On a cooling tower, it is necessary to determine the evaporated water flow in order to estimate the water consumption with a good accuracy according to the atmospheric conditions, and in order to know the characteristics of the plume. The evaporated flow is small compared to the circulating flow. A direct measurement is very inaccurate and cannot be used. Only calculation can give a satisfactory valuation. The two usable theories are the Merkel's one in which there are some simplifying assumptions, and the Poppe's one which is more exact. Both theories are used in the numerical code TEFERI which has been developed and is run by Electricite de France. The results obtained by each method are compared and validated by measurements made in the hot air of a cooling tower. The consequences of each hypothesis of Merkel's theory are discussed. This theory does not give the liquid water content in the plume and it under-estimates the evaporated flow all the lower the ambient temperature is. On the other hand, the Poppe's method agrees very closely with the measurements as well for the evaporated flow than for the liquid water concentration. This method is used to establish the specific consumption curves of the great nuclear plants cooling towers as well as to calculate the emission of liquid water drops in the plumes. (author). 11 refs., 9 figs
Short communication Responses of Abyssinian Jennies to ...
African Journals Online (AJOL)
effects (locomotor disturbances, respiratory distress, tachycardia and sweat- ing) at doses lower than 100 mg but the effects are profound at doses of 400 mg and above (Pharmacia and Upjohn Company, 2004). No side effect was re- corded in a regimen of 0.5 mg PGF2 given24 hours apart compared to a 10 mg.
Tants - üks viis edastada kehalist kogemist / Evelin Lagle
Lagle, Evelin, 1986-
2008-01-01
Helsingi teatriakadeemia tantsukompanii TADaC Kumus 25. III 2008: Ervi Siren "Seize the Moment - Snatch, Catch, Enjoy", Jyrki Karttunen "Dramatic Miniatures", Maria Saivosalmi ja Andrius Katinas "Farewell Anna Karenina", Jenni Kivelä "Scrapbook for Rainy Days", Ari Tenhula videomäng/installatsioon "Entr'acte"
South African Medical Journal - Vol 102, No 1 (2012)
African Journals Online (AJOL)
Gadzikanani Monyatsi, Paul C Mullan, Benjamin R Phelps, Michael A Tolle, Edwin M Machine, Floriza F Gennari, Jenny Makosky, Gabriel M Anabwani ... Luminex-based virtual crossmatching for renal transplantation in South Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT ...
76 FR 76769 - National Science Board; Sunshine Act Meetings
2011-12-08
... matters specified, as follows: AGENCY HOLDING MEETING: National Science Board DATE AND TIME: Monday.../notices/ . AGENCY CONTACT: Jennie L. Moehlmann, [email protected] , (703) 292-7000. PUBLIC AFFAIRS CONTACT... STEM education plan. Discussion of the NSF STEM education research portfolio: getting from theory to...
Technique for Geolocation of EMI Emitters by O3B Satellites
2016-06-01
Communication Systems: An Introduction to Signals and Noise in Electrical Communications , 5th edition (New York: McGraw -Hill, 2011), 4. 6 system to...the only one caused by humans , that will be our focus—the others can be thought of as the cost of doing business in satellite communications and can...SATELLITE COMMUNICATIONS OVERVIEW ...............................2 B. EMI AND JAMMING OVERVIEW .......................................................5
The first recipients of the ATLAS PhD Grant Scholarship Programme 2014
Marcelloni, Claudia
2014-01-01
First recipients of the ATLAS PhD Grant Scholarship 2014 : With certificates, Lailin Xu, Josefina Alconada, and Gagik Vardanyan. The selection committee members, IFAE Barcelona’s Martine Bosman, Fabiola Gianotti, Peter Jenni and from CERN HR James PurvisProgramme: Lailin Xu, Josefina Alconada, and Gagik Vardanyan
Centers for Disease Control (CDC) Podcasts
2011-08-04
In this 60-second podcast, gynecologic cancer survivor, Jenny Allen, urges women to see a doctor if symptoms last two weeks or more. Created: 8/4/2011 by National Center for Chronic Disease Prevention and Health Promotion. Date Released: 8/4/2011.
Maximilien Brice
2008-01-01
Also present: ATLAS Collaboration Spokesperson P. Jenni, ATLAS Collaboration and University of Tokyo T. Kawamoto Adviser for Non-Member State Relations J. Ellis Deputy Director-General, Chief Scientific Officer J. Engelen ATLAS Collaboration and KEK T.Kondo Second Secretary, Permanent Mission of Japan in Geneva K. Saito
77 FR 64318 - Atlantic Highly Migratory Species; Advisory Panel
2012-10-19
... Fishery Management Plans (FMPs) or FMP amendments for Atlantic tunas, swordfish, sharks, and billfish... membership in the HMS AP (note that there are no Environmental/NGO terms expiring, so no nominations for that...: Jenni Wallace, Highly Migratory Species Management Division, NMFS, 1315 East-West Highway, Silver Spring...
2008-01-01
Rahvusvahelise ideekonkursi "Suur-Helsingi 2050" 109 projekti seas võitis WSP Finland Ltd tööga "Emerald", mille põhiautorid on arhitektid Juha Eskolin, Jenni Lautso, Ilona Mansikka ja Tuomas Vuorinen. Projekt tegeleb komplekselt maakasutuse, elustiili, transpordi, maastikukujunduse, energiatootmise ja säästva arenguga
2005-01-01
Venemaa moenädalal (Russian Fashion Week) Moskvas näidatud kollektsioonidest sügis-talveks 2005/2006. Oma kollektsioone näitasid ameerika popmuusik ja moedisainer Boy George (George ÒDowd), inglise moedisainer Jenny Packham ning Jelena Suprun, Jekaterina Poljanskaja, Olga Komissarova, Olga Brovkina jt. Venemaalt
Another round of special visitors
Claudia Marcelloni de Oliveira; Bilge Demirkoz
H. E. Mrs. Michelle Bachelet, president of Chile, visited CERN and the ATLAS detector on June 3. Peter Jenni, spokesperson of ATLAS is seen here having a pleasant discussion with Mrs. Bachelet while members of her impressive delegation were watching on. An animated discussion from the platform overlooking the ATLAS detector during Christer Fuglesang's visit to ATLAS on June 14. A former CERN fellow working on ATLAS, Christer went on to become the first Swedish astronaut and participated in the STS-116 Space Shuttle mission to the International Space Station last December. He is seen here with his family, Peter Jenni and Kerstin Jon-And. See ATLAS eNews January 2007 issue for more details. Richard Stallman, the president and founder of the Free Software Foundation visited CERN and gave the IT Computing Seminar on June 18th, 2007 on Ethics and Practice of Free Software. (His talk will be soon available in OGG format from the IT computing seminar website.) After that, with accompanying memb...
Celebrating the Barrel Toroid commissioning
Peter Jenni
ATLAS invited Funding Agency representatives and Laboratory Heads directly related to the funding and construction of the Barrel Toroid for a small ceremony on 13th December 2006 at Point 1, in order to mark the successful first full excitation of the BT (see last eNews). On that date, which was during the December CERN Council week, several of the Funding Agency Heads or their representatives could be present, representing CEA France, INFN Italy, BMBF Germany, Spain, Sweden, Switzerland, Russia, JINR Dubna and CERN. Speeches were delivered by the ATLAS spokesperson Peter Jenni thanking the Funding Partners in the name of the Collaboration, by Magnet Project Leader Herman ten Kate tracing the BT construction history, and by the CERN Director-General Robert Aymar congratulating all those who have contributed to the successful project. Herman ten Kate addressing the delegates. The text of the introductory address by Peter Jenni is reproduced here. "It is a great pleasure for me to welcome you all here...
Rosaria Marraffino
2014-01-01
Emeritus Professor Sir Thomas W.B. Kibble, from Imperial College London visited LHC for the first time last week and delivered a colloquium on the genesis of electroweak unification and the Brout-Englert-Higgs mechanism. From left to right: Jim Virdee, Tiziano Camporesi, Tom Kibble and Austin Ball on the visit to CMS. On his way back from Trieste, where he received the Abdus Salam International Centre for Theoretical Physics' Dirac Medal, Tom Kibble stopped by CERN for his first visit to the LHC. Kibble had a standing invitation from Jim Virdee, former CMS spokesperson, who is also a researcher from Imperial College London. Peter Jenni (left) and Tom Kibble tour the ATLAS detector. (Image: Erwan Bertrand) Kibble made the trip to CERN a family outing and brought along 14 relatives, including his children and grandchildren. He visited the ATLAS detector with Peter Jenni, its former spokesperson, on Friday 10 October. In the afternoon, Kibble delivered a colloquium in the...
ATLAS honours two Swiss companies
2003-01-01
On 18 June 2003, ATLAS presented awards to two Swiss companies, Cicorel SA and Isola Composites AG, the suppliers of the electrodes and the composite bars for the electromagnetic calorimeter. "Physicists' dreams could not become reality without industry's active participation and creativity", said Peter Jenni, ATLAS spokesman, congratulating two of the collaboration's suppliers, to which it presented awards on 18 June. Swiss quality was the order of the day, since the two companies, Cicorel SA and Isola Composites AG, which are both involved in the production of components for the electromagnetic calorimeter, are located in Switzerland's Jura region. "You have taken up and met a challenge that bordered on the impossible", added Peter Jenni. The suppliers who received the ATLAS award: Hans Wyss from Cicorel SA (left) and Constant Gentile from Isola Composites (right).Circorel SA produced enough electrodes to cover an entire football pitch. Each electrode, measuring 2 square metres, consists of three layers of...
ATLAS PhD Grant Scholarship Programme
Abha Eli Phoboo
2014-01-01
On 11 February, the first recipients of the ATLAS PhD Grant were presented with a certificate by the programme’s selection committee. The three scholars - Lailin Xu of China, Josefina Alconada of Argentina and Gagik Vardanyan of Armenia - were delighted at being able to continue their PhD programmes at CERN. With certificates, from left: Lailin Xu, Josefina Alconada, and Gagik Vardanyan. The selection committee members, from left: IFAE Barcelona’s Martine Bosman, Fabiola Gianotti, Peter Jenni and from CERN HR James Purvis. (Image: ATLAS/Claudia Marcelloni). Former ATLAS spokespersons Peter Jenni and Fabiola Gianotti started the fund with the Fundamental Physics Prize award money they received last year. Both have used the entirety of their prizes for educational and humanitarian programmes. "We wanted to do something for students who are working on ATLAS, in particular those who otherwise could not come here and actually see the detector they are working on,&am...
Swiss State Secretary visits CERN
2008-01-01
The new Swiss State Secretary for Education and Research recently visited CERN. Peter Jenni, the spokesperson for ATLAS, gave Mauro Dell’Ambrogio, the new Swiss State Secretary for Education and Research, a tour of ATLAS and the LHC tunnel.On 2 April, the newly appointed Swiss State Secretary for Education and Research, Mauro Dell’Ambrogio, was welcomed to CERN by Director-General Robert Aymar. On arrival the Swiss minister was given a guided tour of ATLAS and the adjoining LHC tunnel by Peter Jenni, the ATLAS spokesperson. Dr Dell’Ambrogio was then greeted by Swiss scientists and attended presentations by young post doc physicists about Swiss contributions to CMS and LHCb, in particular their work concerning hardware contribution and data analysis. There are 120 physicists from Swiss universities working on CERN’s experiments, and many more Swiss people working at CERN in other departments due to Switzerland’s special position as a host state. Also before ...
1992-10-01
infiltration studies ( Westerdahl and Skogerboe 1982). Extensive field 53 verification studies have been conducted with the WES Rainfall Simulator...Lysimeter System on a wide range of Corps project sites ( Westerdahl and Skogerboe 1982, Lee and Skogerboe 1984, Skogerboe et al. 1987). The WES Rain- fall...Vicksburg, MS. Winer, B. J. 1971. Statistical Principles in Experimental Design, McGraw- Hill Book Company, New York. Westerdahl , H. E., and Skogerboe, J
Improving Customer Satisfaction: A People CMM Perspective
2010-10-11
Work Environment Customer Relationship Management Program 19 Improving Customer Satisfaction: A People CMM Perspective P. Buttles, S. McGraw, D...Professional in 2009 and Customer Care Manager in July 2006. He has a bachelor of arts degree from the University of Pittsburgh and a bachelor of science...conferences throughout the United States and Europe. He has as a bachelor of science degree in management . 4 Improving Customer Satisfaction: A
2010-03-01
Prescott , L. M.; Harley, J. P.; Klein, D. A. Microbiology . Fifth edition. McGraw Hill: New York, 2002. 26. Amman, R. I., Ludwig, W., Schleifer, K. H...Recent advances in petroleum microbiology . Microbiology and molecular biology reviews 2003, 67, 503-49. 6. Langer, G. JP-4 Fuel System Icing. Armour...Wright Air Development Center. 8. Elderfield, R. C. Proceedings on Jet Fuel Microbiology and Corrosion Conference. Prevention of Deterioration Center
Implementing Strategy in a Budget: A Model for the Coast Guard Reserve
1990-06-01
Handbook, McGraw-Hill Book Co., 1983. Andrews, K. R., The Concept of Corporate Strategy, McGraw- Hill Book Co., 1965. Ansoff , H. Igor , Strategic...SNARE OKKARIIL. ADOPTION Of NEW MARKETIG CONCEPTS I CRATNE INCNRtImG MARKITIMCNGGNUP!S Figure 4.( Ansoff ,1979,p. 65) 17 The niche question focuses...domain. Ansoff observed the increasing competition for resources and commented: The explosive growth of expenditures for government and social welfare
2015-03-24
improving the disclosure of CPARS program office Audit results (Black et al., 2014, pp. 48–49). Acquisition Research Program Graduate School of...improving the disclosure of CPARS program office audit results (Black et al., 2014, pp. 44–49). Recommendations Based on our conclusions, we identified...Fitzsimmons, J. A., & Fitzsimmons, M. J. (2006). Service management: Operations, strategy, and information technology (5th ed.). New York, NY: McGraw -Hill
Contractor Past Performance Information: An Analysis of Assessment Narratives and Objective Ratings
2015-04-30
narratives, and improving the disclosure of CPARS program office audit results (Black et al., 2014, pp. 48–49). Summary, Conclusions, and Recommendations...office audit results (Black et al., 2014, pp. 44–49). Recommendations Based on our conclusions, we identified the following five recommendations...and information technology (5th ed.). New York, NY: McGraw -Hill. Freeman, R. E. (1984). Strategic management: A stakeholder approach. Boston, MA
Centers for Disease Control (CDC) Podcasts
2011-08-04
In this 60-second public service announcement, gynecologic cancer survivor, Jenny Allen, urges women to see a doctor if symptoms last two weeks or more. Created: 8/4/2011 by National Center for Chronic Disease Prevention and Health Promotion. Date Released: 8/4/2011.
crobiological Property of Abyssinian Donkey's Milk
African Journals Online (AJOL)
2Department of Clinical Studies, School of Veterinary Medicine, Addis Ababa University. *Corresponding author: ... milk in its protein, lactose, vitamin C, pH, density, and zinc contents whereas, ... its unique nutritional quality and its similarity to human milk. ... acid rinsed, sterile container from 24 healthy jennies. The milk ...
Euroopa Liidu sünnipäeva logoks valiti "Tögethér"
2006-01-01
Üleeuroopalise võistluse võitis Poola kunstitudeng Szymon Skrzypczak. Erineva fondi ja värviga tähed moodustavad sõna, mis inglise keeles tähendab "üheskoos". Logo alapealkiri "Since 1957". Teise koha sai taanlase Tore Rosbo "Ristuvad kultuurid", kolmanda rootslanna Jenny Lundgreni kujundatud "Keelte kogukond"
Building Social Bonds: Connections That Promote Well-Being
... words, neglect, and withholding affection are examples of verbal or emotional abuse. In an unhealthy or abusive relationship, your partner ... make a huge difference in the life of kids whose family structures may not ... life is characterized by abuse and neglect,” says Dr. Jennie Noll of the ...
Weiner, Jennie Miles; Burton, Laura J.
2016-01-01
In this study of nine participants in a turnaround principal preparation program, Jennie Miles Weiner and Laura J. Burton explore how gender role identity shaped participants' views of effective principal leadership and their place within it. The authors find that although female and male participants initially framed effective leadership…
Are you a strategist or just a manager?
Hinterhuber, H H; Popp, W
1992-01-01
Perhaps the greatest strategist of all time was not a business executive but a general. Helmuth von Moltke, chief of the Prussian and German general staffs from 1858 to 1888, issued "directives" to his officers rather than specific commands. These guidelines for autonomous decision making encouraged Moltke's subordinates to show individual initiative. In this article, Hans Hinterhuber and Wolfgang Popp translate Moltke's example into business terms. According to Moltke, strategy is applied common sense and cannot be taught. The authors suggest that good entrepreneurs and managers--along with generals--are born with the qualities that make them successful. But even if managers have the potential to be good strategists, they must develop and hone their natural talents. And CEOs and top management can help by identifying and promoting such talents in their employees. Hinterhuber and Popp have created a questionnaire that helps measure strategic management competence. Managers and entrepreneurs take this test themselves, answering ten questions such as, "Do I have an entrepreneurial vision?", "Do I have a corporate philosophy?", and "Do I have competitive advantages?" Using the questionnaire, company management can evaluate managers being considered for a promotion. At the same time, those who take the test can use it to determine their own performance as strategists. Strategic managers provide subordinates with general guidelines, just as Helmuth von Moltke issued directives to his officers. And outstanding entrepreneurs create a corporate culture in which their vision, philosophy, and business strategies are implemented by employees who think independently.
Jean-Claude Gadmer
2012-01-01
In the ATLAS visitor centre with Former Spokesperson P. Jenni; visiting the LHC superconducting magnet test hall with Technology Department Head F. Bordry. Where aslo present throughout: TRIUMF Science Division Deputy Head J. Dilling; TRIUMF Accelerator Division Head L. Merminga and ATLAS Collaboration Members A. Canepa and O. Stelzer-Chilton.
Moodsa kunsti järeleaitamistund / Heie Treier
Treier, Heie, 1963-
1998-01-01
Bruce Naumani näitus 'Kiasmas' Helsingis 24. jaanuarini 1999. Majandusajakiri 'Capital' paigutab B. Naumani maailma kunstnike top 100-s esimesele kohale. Bruce Naumanist (s. 1941 USA-s Indiana osariigis), tema filmidest, videotest, videoinstallatsioonidest, konkreetsetest töödest. Neoonsõnumitest, nende võrdlus Jenny Holzeri töödega.
Maximilien Brice
2002-01-01
From left to right: John Ellis, Michael Bancroft, Robert Orr, Ambassor Ziswiler, Brigitte Léger, Robert McPherson, Isabel Trigger, Arthur Carty, Claude Leroy, James Pinfold, Louise Proulx, Carmen Charette (partly hidden), Alain Caillé, Dennis Salahub, Paul Guild, Alain Shotter, Nigel Lloyd, Regula Bubb, Benjamin Smith, Pekka Sinervo, Peter Jenni.
Maximilien Brice
2011-01-01
During a visit to CERN on 22 June, Naledi G Pandor, minister of science and technology for the Republic of South Africa, looked round the ATLAS visitor centre with Peter Jenni, former spokesperson for the ATLAS experiment. She also toured the LHC superconducting magnet test hall and the ALICE visitor centre.
IDENTIFIKASI DAN EVALUASI AKSES PUBLIK DAN OPEN SPACE DI KAWASAN SENG HIE PONTIANAK
Directory of Open Access Journals (Sweden)
Bontor Jumaylinda Br. Gultom
2016-09-01
Seng Hie area has a unique character that gives the image of the city of Pontianak. This area has the potential to be developed. This area already has the appeal of the inherent function, namely trade. This makes this area very easily become a magnet to invite more people to visit. REFERENCES Breen, Ann dan Dick Rigby. (1994. Waterfront, Cities Reclaim Their Edge. Mc.Graw Hill. New York Breen, Ann dan Dick Rigby. (1996. The New Waterfront: A Worldwide Urban Success Story. Mc.Graw Hill. New York Department of City Planning, Waterfront Urban Design Technical Advisory Committee. (1997. The Port of San Francisco Waterfront Design & Access: An Element of the Waterfront Land Use Plan, Port of San Francisco. San Francisco. Garnham, Harry Launce. (1985 Maintaining the Spirit of Place: a Process for the preservation of Town Character. PDA Publisher Corp. Madison Garnham. H. L. (1976. Maintaining the Spirit of Place: A Guidebook for Citizen/professional Participation in the Preservation and Enhancement of Small Texas Towns. A & M University Printing. Texas. Jumaylinda. (2007. Kualitas Visual Fasad Bangunan Komersil Seng Hie. Thesis. UGM. Yogyakarta Maryono, Agus; Parikesit, Danang. (2003. Transportasi Sungai Mulai Ditinggalkan. Kompas, 01 Mei 2003 Wrenn, Douglas M, dkk. (1983. Urban Waterfront Development. Urban Land Institute. Michigan
Is Transformational Leadership Effective in a System Program Office
1988-09-01
Management , 31: 12-16 (March-April 1988). 12. Fiedler, Fred E. A Theory of Leadership Effectiveness. New York: McGraw Hill, Inc., 1967. 13. Fulghum, David... management and leadership . It was my hope to profit personally from this research by becoming a better leader and manager in the future. I am indebted...centers around the situational theory of lec;Iership, which suggests that the most effective style of leadership depends on the individual situation the
McGraw, Thomas
2016-01-01
Thomas McGraw Global Medical Affairs, Merck & Co., Inc., Kenilworth, NJ, USA Purpose: To evaluate the safety and tolerability of aqueous solution concentrate (ASC) of polyethylene glycol (PEG) 3350 in patients with functional constipation.Patients and methods: The patients who met Rome III diagnostic criteria for functional constipation were randomized in this multicenter, randomized, placebo-controlled, single-blind study to receive once daily dose of PEG 3350 (17 g) ASC or ...
Usability Evaluation of Air Warfare Assessment & Review Toolset in Exercise Black Skies 2012
2013-12-01
is, it allows the user to do what they want to do with it ( Pressman , 2005). This concept is sometimes called fitness for purpose (Nielsen, 1993...Other characteristics of good software defined by Pressman (2005) are: reliability – the proportion of time the software is available for its intended...Diego, CA: Academic Press,. Pressman , R. S. (2005). Software Engineering: A Practitioner’s Approach. New York: McGraw- Hill. Symons, S., France, M
Characterizing Spatial Ability: Different Mental Processes Reflected in Accuracy and Latency Scores.
1978-08-01
Prince- ton, New Jersey: Educational Testing Service, March, 1969. 6. Guilford, J. P., The Nature of Human Intelligence . New York: McGraw- Hill, 1969. 7...of visual- figural systems (CFS-V) , cognition of figural transformations (CFT), and cogni- tion of kinesthetic -figural systems (CFS-K) , represents...position and direction that has occurred from the top to the bottom drawing of a motorboat heading toward a coastline. The time limit on the 60-item GZO is
Quantifying the Effects of Propagation on Classification of Cetacean Vocalizations
2015-09-30
human audition . This would be particularly useful if expert listeners aren’t available –such as diagnosing heart murmurs in remote communities that...when the sheer volume of data makes human audition untenable – such as classifying ocean acoustic data for species population monitoring. Finally...Underwater Sound, 3rd ed., McGraw -Hill Book Company, 1983. [2] F. B. Jensen, W. A. Kuperman, M.B. Porter, and H. Schmidt, Computational Ocean Acoustics
2004-01-01
Dr. Mervyn Hine, CERN pioneer of the Proton Synchrotron construction, and of computing and networking, ex CERN Director, passed away yesterday 26 April, following a serious accident in his home. He died peacefully, surrounded by his wife Jenny, and his daughters Alison, Marion and Jessica. An obituary will appear in the next Bulletin.
Ethiopian Journal of Health Development - Vol 16 (2002)
African Journals Online (AJOL)
birth cohort study in south-west Ethiopia to identify factors associated with infant mortality that are amenable for intervention. Makonnen Asefa, Robert Drewett, Fasil Tessema. http://dx.doi.org/10.4314/ejhd.v16i4.9786 · An Ethiopian birth cohort study: the study design. Makonnen Asefa, Robert Drewett, Jenny Hewison.
A practical approach to anaesthesia for paediatric liver transplantation
African Journals Online (AJOL)
A practical approach to anaesthesia for paediatric liver transplantation. Jenny Thomas, M McCulloch, W Spearman, T Butt, A Numanoglu ... In more recent years, the use of reduced size and living related organs has increased the donor pool for infants and children. Paediatric liver transplantation in South Africa, up until the ...
Come and play with HEAL in Microcosm!
Stefania Pandolfi
2016-01-01
A new interactive game in Microcosm informs about hadron therapy – come and test it! HEAL is a new interactive game currently under evaluation at Microcosm to inform visitors about hadron therapy, one aspect of the CERN-related contributions to the medical field. Microcosm is continuously evolving and new content is installed regularly. One of the most recent exhibits is called HEAL - an interactive game with the aim of informing visitors about the hadron therapy to treat cancer. It has been developed by Jenny Rompa, a PhD student at CERN, within the activities of MediaLab. The application is controlled through body movements and the player is asked to set the right energy and the right angle of the hadron beam to make the (brain) cancer disappear. As part of her doctoral thesis, Jenny also built a questionnaire to hand out to visitors in order to examine their user experience. The goal of the study is to evaluate the effectiveness of using inter...
Impact of bathymetric system advances on hydrography
Digital Repository Service at National Institute of Oceanography (India)
Ranade, G.
undergone unprecedented changes with the advancement in the motion sensor technology. By late 1970 gyro stabilized accelerometer based attitude monitoring systems, computing roll, pitch and heave sensing and came in to existence. Doppler sonar principle...). “Multibeam bathymetric sonar: Sea Beam and Hydrochart”, Mar. Geod., vol. 4, pp.77-93. 4. Urick, R. (1975), “Principles of Underwater Acoustics”, McGraw – Hill. 5. Christian de Moustier, C. (1987). “Online Sea Beam acoustic imaging, Proc. Oceans ‘87...
THE ROLE OF DYNAMIC SYSTEMS IN MOTOR DEVELOPMENT RESEARCH. JUST A METAPHOR OR A NOTABLE REALITY?
Ivan Šerbetar
2015-01-01
In the present article an application of a new theory of motor control in the context of motor development theories and research has been discussed. In a brief overview of traditional theories of motor development a neuro-maturational theory is mentioned along with the two prominent proponents - McGraw & Gesell. Bernstein’s fundamental insights in motor control were emphasized, such as the concepts of degrees of freedom and synergies, along with his contribution to the measurement technology ...
2005-07-01
23. Connor, J . H., Quan, H. N., Raniaswamy, N. T., Zhang, L., Barik , S., Zbeng, J ., 44. Wu, X., and Tatchell, K, (2001) Biochemistry 40, 7410-7420...McGraw, E. Kevin Heist, J . Luis Guerrero, Anna A. DePaoli-Roach, Roger J . Hajjar and Evangelia G. Kranias. "Enhancement of Cardiac Function and...by this fellowship allowed me to present a poster at the ASCB meeting and successfully defend my thesis in Dec 2004. References: 1. Secombe, J
Software Assurance Curriculum Project Volume 3: Master of Software Assurance Course Syllabi
2011-07-01
thods and process of model-driven development. • Pressman , Roger S., Software Engineering: A Practitioner’s Approach, 6th ed. McGraw Hill, 2009...audience • [Bishop 2002] Chapter 18 • [Allen 2008] Chapters 1, 2 • [ Pressman 2009] Chapter 1 • [Merkow 2010] Chapter 3 • [Mouratidis 2007...Allen 2008] Chapters 3,4 • [ Pressman 2009] Chapters 3,4 • [Merkow 2010] Chapter 5 • [DHS 2008-2009a] • [Mellado 2010] • [CERT 2009] 3
McNamara, John
2016-01-01
John McNamara shares his wisdom and humbly credits Camillo Grazzini, Jenny Höglund, and David Kahn for his growth in Montessori. Recognizing more than what he has learned from his mentors, he shares the lessons he has learned from his students themselves. Math, science, history, and language are so integrated in the curriculum that students…
Maximilien Brice
2003-01-01
Armenian Minister for Trade and Economic Development, K. Chshmaritian third from right with from left to right : Aram Kotzinian, JINR, Dubna; Dr Marzio Nessi, ATLAS, Zohrad Mnatsakanian, Ambassador at the Permanent Mission of the Republic of Armenia in Geneva, Karen Chshmaritian, Armenian Minister for Trade and Economic Development, Alexey Sissakian, Vice-Director of JINR and Peter Jenni, ATLAS Spokesperson.
Mr Nissim Dahan, MK, Minister of Health, Israel, at the ATLAS exhibition
Laurent Guiraud
2001-01-01
Photo 01: L. to r.:Dr Jim Allaby, Dr Peter Jenni, Prof. Bracha Regev, Chief Scientist, Ministry of Health, Mr Nissim Dahan, MK, Minister of Health, Dr Boaz Lev, Director General, Ministry of Health, Dr Hans F. Hoffmann and Dr Georges Mikenberg. Photo 02: Mr Nissim Dahan, MK, Minister of Health, Israel, signing the Guest Book.
On the design criteria for the evaporated water flow rate in a wet air cooler
International Nuclear Information System (INIS)
Bourillot, C.
1982-01-01
The author discusses Poppe's formulation used for the modelling of heat exchangers between air and water, in Electricite de France's TEFERI numerical wet atmospheric cooler model: heat transfer laws in unsaturated and saturated air, Bosnjakivic's formula, evaporation coefficient. The theorical results show good agreement with the measurements taken on Neurath's cooler C in West Germany, whatever the ambient temperature (evaporated water flow rate, condensate content of warm air). The author then demonstrates the inadequacy of Merkel's method for calculating evaporated water flow rates, and estimates the influence of the assumptions made on the total error [fr
An Audit of Visual Acuity using a Snellen chart for Residents in a Care home, aged 65years or over
Ward, Hannah
2012-01-01
Background: Visual impairment (VI) is highly prevalent, but currently remains untreated and preventable in Britain‟s older population (Evans, Fletcher, Wormald et al. 2002). Eighty percent of all VI can be avoided or treated (WHO, 2011). People in residential or nursing homes are at a higher risk of having their eye problems overlooked (Pols, Bates, McGraw et al. 2000). Aim: To conduct an audit of visual acuity (VA), a measure of VI against a national standard, the British Geriatric Societ...
Maximilien Brice
2010-01-01
CERN-HI-1011300 19-41: visiting SM18 with F. Bertinelli CERN-HI-1011300 43-66; visiting CMS Control Centre in Meyrin with Collaboration Spokesperson G. Tonelli CERN-HI-1011300 67-85: in the ATLAS Visitor Centre with Former Collaboration Spokesperson P. Jenni CERN-HI-1011300 86-87: meeting young representatives of the CERN Chinese community in the Glassbox, restaurant 1.
Maximilien Brice
2006-01-01
For contributing vital pieces to the ATLAS puzzle, three industries were recognized on Friday 5 May during a supplier awards ceremony. After a welcome and overview of the ATLAS experiment by spokesperson Peter Jenni, CERN Secretary-General Maximilian Metzger stressed the importance of industry to CERN's scientific goals. Picture 30 : representatives of the three award-wining companies after the ceremony
An Empirical Evaluation of Language-Tailored PDLs.
1982-05-01
principles in experimental design. New York: McGraw- Hill, 1971. -21- APPENDIX A PDL FORMATS I iiCLDL4. pA; Bl.ANK(-NO1 T nui.s.i VMC~ PROGRAM...O2O70 IF XJ) LE , X(J+I)) -;0 T 230 -43- TECHNICAL REPORTS DISTRIBUTION LIST -45- OFFICE OF NAVAL RESEARCH Code 442 TECHNICAL REPORTS DISTRIBUTION LIST...OSD Department of the Navy Capt. Paul R. Chatelier Office of the Deputy Under Secretary ONR Eastern/Central Regional Officeof DefenseOREatr/etaReinl
EPS HEPP Prize 2013: Certificate and Medal
Rao, Achintya
2013-01-01
The 2013 High Energy and Particle Physics Prize, for an outstanding contribution to High Energy Physics, is awarded to the ATLAS and CMS collaborations, "for the discovery of a Higgs boson, as predicted by the Brout-Englert-Higgs mechanism", and to Michel Della Negra, Peter Jenni, and Tejinder Virdee, "for their pioneering and outstanding leadership roles in the making of the ATLAS and CMS experiments".
Lifescience Database Archive (English)
Full Text Available OS=Drosophila melanogast... 34 0.58 sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria... m... 33 0.99 sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria m... 33 1.7 s... 32 3.8 sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 31 4.... 3956 >sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria marburgvirus (strain Popp-67) GN=VP30 ... NHH R+ ++T Sbjct: 11 RNHQTASSIYHETQLPSKPHYTNHHPRARSMSST 44 >sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria
A Survey of Technologies Supporting Virtual Project Based Learning
DEFF Research Database (Denmark)
Dirckinck-Holmfeld, Lone
2002-01-01
This paper describes a survey of technologies and to what extent they support virtual project based learning. The paper argues that a survey of learning technologies should be related to concrete learning tasks and processes. Problem oriented project pedagogy (POPP) is discussed, and a framework...... for evaluation is proposed where negotiation of meaning, coordination and resource management are identified as the key concepts in virtual project based learning. Three e-learning systems are selected for the survey, Virtual-U, Lotus Learningspace and Lotus Quickplace, as each system offers different strategies...... for e-learning. The paper concludes that virtual project based learning may benefit from facilities of all these systems....
1980-08-23
MA = -a a (A ILa 0. on 4 04 - 0 4.. 4i 44 4i . 4 4. PN w 4 - at AISA 4, 4. 4 ac I r V tvso l, -Vcp4pnfyw to &A0: 1. 0.V. 494 4...for Nuclear Power Plants, Regulating Guide 1.59, Revision 2, August1977 3. Linsley and Franzini: Water Resources Engineering, Second Edition , McGraw...Hill (1972) 4. W. Viessman, Jr., J. Knapp, G. Lewis, 1977, 2nd Edition , Introduction to Hydrology 5. Ven Te Chow: Handbook of Applied Hydrology, McGraw
1985-04-24
feasibility of terrorist organizations, state-sponsored or otherwise, resorting to* Legislation unconventional means (including nuclear, biological ...responsibility for dealing with April, we already have active programs under way with a nuclear and chemical/ biological terrorism. While as yet no dozen...16Alex P. Schmid and Jenny de Graaf, I’iolence As Communication, London: Sate, 1982, 57. John Naisbitt, Megatrends , New York: Warner Books, 1982. 1 8
Dr. David Syz, State Secretary for Economic Affairs, Switzerland
Maximilien Brice
2003-01-01
Dr. David Syz, State Secretary for Economic Affairs, Switzerland is seen here (seventh from right) visiting the assembly hall for the ATLAS experiment during his recent visit to CERN. To his right is Dr. Peter Jenni (blue shirt), spokesperson for the ATLAS Collaboration. The horizontal metal cylinder behind the group is one of the eight vacuum vessels for the superconducting coils of the ATLAS barrel toroid magnet system.
Micropatterning on glass with deep UV
sprotocols
2015-01-01
Authors: Nicolas CARPI, Matthieu PIEL, Ammar Azioune & Jenny Fink ### Abstract This protocol describes a method to print micropatterns on glass with extra-cellular matrix proteins to promote cell adhesion. The non-adhesive part is made with polylysine grafted polyethyleneglycol (PLL-g-PEG). This technique is reproducible, cheap, fast and can achieve high resolution (~1 µm). ### Introduction This protocol explains how to make high resolution adhesive micropattens of protein...
Johnson, Will
2008-01-01
As someone more at home in jeans and pumps it was a bit of a shock. The author could not quite get used to the sight of his feet in his father-in-law's black and pointy dancing shoes. Jennie, more often seen in trainers or steel-capped boots, had on a pair of strappy heels she'd borrowed from her mum. They felt like kids dressing up in their…
Tough Tommy’s Space Force: General Thomas S. Power and the Air Force Space Program
2016-06-01
watching a barnstorming pilot over a nearby cow pasture with a World War I-era Curtiss Jenny trainer.4 Fascinated by what he saw, Tommy asked the...is the aerodynamic heating problem.” Schriever continued that the engineering “data required cover a broader range for...to isolate artificially the ICBM from the desire to develop space capability. It must also be stressed that Schriever himself was of two minds
Åström, Jenny-Maria; Haddad, Wendelina; Rabi Navarro, Rosalia
2016-01-01
Abstract - Do consumers care about CSR? A study about the relation between corporate social responsibility and consumer value when purchasing clothes. Date: May 26th, 2016 Level: Bachelor Thesis in Business Administration, 15 ECTS Institution: School of Business, Society and Engineering, Mälardalen University Authors: Wendelina Haddad 910915, Rosalia Rabi Navarro 890828, Jenny-Maria Åström 870630 Title: Do consumers care about CSR? A study about the relation between corporate social respon...
Türkiye Türkçesi Ağızlarında Lambdasizm Sigmatizm Meselesinin İzleri
YILDIZ, Hüseyin
2015-01-01
Lambdasizm / sigmasizm konusu gerek Türk lehçeleri arasında, gerekse Türkçeyle akraba olan diğer diller arasında tanıklanan örneklerden ortaya çıkmış problemlerdir. İçinde /l/ ünsüzü bulunan bazı kelimelerin bir başka dilde ya da lehçede /ş/’li olarak görülmesi, probleme sebep olan soruyu sordurmuştur: Hangisi daha arkaiktir? İlk olarak W. Schoot’un ortaya koyduğu bu problem hakkında Radloff, Gombocz, Németh, Benzing, Clauson, Meyer, Róna-Tas, Nauta, Scherner, Adamović, Ramstedt, Poppe, Räsän...
TREAT - Teachers redesigning educational activities with technology
DEFF Research Database (Denmark)
Nielsen, Tobias Alsted; Andersen, Mathias Elmose; Alsholm, Anne-Mette
undervisningssituationer på Aarhus Universitet BSS. TREAT kan anvendes som en selvstændig ressource af den enkelte underviser, eller som en integreret del af Educational IT/blended learning kurser. TREAT tager afsæt i Dee Finks “Integrated Course Design” (2005), som belyser hvordan undervisere kan sammensætte et...... ressourcen i forbindelse med CUL’s blended learning kurser har været positive. Vi oplever derudover en national såvel som international interesse for ressourcen. treat.au.dk Referencer: Biggs, J. & C. Tang (2007): Teaching for Quality Learning at University. Open University Press, McGraw- Hill Education...
Näripea, Eva
2009-01-01
2007. a. oktoobris toimunud konverentsi "Via Transversa : Lost Cinema of the Former Eastern Bloc" ettekannetel põhinevast kogumikust: Via Transversa : Lost Cinema of the Former Eastern Bloc / editors Eva Näripea, Andreas Trossek. Tallinn : Eesti Kunstiakadeemia, 2008. (Koht ja paik ; 7)
Stonecipher, Karl G; Chia, Jenny; Onyenwenyi, Ahunna; Villanueva, Linda; Hollander, David A
2013-01-01
Karl G Stonecipher,1 Jenny Chia,2 Ahunna Onyenwenyi,2 Linda Villanueva,2 David A Hollander2 1TLC Laser Eye Centers, Greensboro, NC, 2Allergan, Inc., Irvine, CA, USA Background: Dry eye is a multifactorial, symptomatic disease associated with ocular surface inflammation and tear film hyperosmolarity. This study was designed to assess patterns of topical cyclosporine ophthalmic emulsion 0.05% (Restasis®) use in dry eye patients and determine if there were any differences in use based o...
Axäll, Jenny
2004-01-01
AbstractTitle: Communicative leadership – a leadership for modern organizationsQualitative research attempting to define the concept.(Kommunikativt ledarskap – ett ledarskap för moderna organisationerKvalitativ studie med ansats att definiera begreppet.)Author: Jenny AxällAim: The aim of this essay is to try to find the essence of and a definition of the communicative leadership. Questions asked are: How can communicative leadership be described? How can it be practiced? What does it demand o...
Evaluation of the flipped classroom approach in a veterinary professional skills course
Moffett, Jenny; Mill, Aileen C
2014-01-01
Jenny Moffett,1 Aileen C Mill2 1Ross University School of Veterinary Medicine, West Farm, St Kitts, West Indies; 2Modelling Suite, School of Biology, Newcastle University, Newcastle upon Tyne, UK Background: The flipped classroom is an educational approach that has had much recent coverage in the literature. Relatively few studies, however, use objective assessment of student performance to measure the impact of the flipped classroom on learning. The purpose of this study was to evaluate the...
Viljan till fysisk aktivitet : en intervention avsedd att stimulera ungdomar att bli fysiskt aktiva
Isberg, Jenny
2009-01-01
Jenny Isberg (2009): Viljan till fysisk aktivitet – en intervention avsedd att stimulera ungdomar att bli fysiskt aktiva. Örebro Studies in Sport Sciences 6, 141 pp. Physical education (PE) at school may play an important role in the process of becoming physically active in the adolescence and in developing a physically active lifestyle. The opportunities for teachers to provide positive physical activity experiences to the student population extend regularly over the school terms. For some s...
Institutional and pedagogical criteria for productive open source learning environments
DEFF Research Database (Denmark)
Svendsen, Brian Møller; Ryberg, Thomas; Semey, Ian Peter
2004-01-01
In this article we present some institutional and pedagogical criteria for making an informed decision in relation to identifying and choosing a productive open source learning environment. We argue that three concepts (implementation, maintainability and further development) are important when...... considering the sustainability and cost efficiency of an open source system, and we outline a set of key points for evaluating an open source software in terms of cost of system adoption. Furthermore we identify a range of pedagogical concepts and criteria to emphasize the importance of considering...... the relation between the local pedagogical practice and the pedagogical design of the open source learning environment. This we illustrate through an analysis of an open source system and our own pedagogical practice at Aalborg University, Denmark (POPP)....
Ekerstad, Niklas; Karlson, Bj?rn W; Dahlin Ivanoff, Synneve; Landahl, Sten; Andersson, David; Heintz, Emelie; Husberg, Magnus; Alwin, Jenny
2016-01-01
Niklas Ekerstad,1,2 Björn W Karlson,3 Synneve Dahlin Ivanoff,4 Sten Landahl,5 David Andersson,6 Emelie Heintz,7 Magnus Husberg,2 Jenny Alwin2 1Department of Cardiology, NU (NÄL-Uddevalla) Hospital Group, Trollhattan, 2Division of Health Care Analysis, Department of Medical and Health Sciences, Linköping University, Linköping, 3Department of Molecular and Clinical Medicine, Institute of Medicine, 4Centre for Ageing and Health, AGECAP, Department of Health a...
2003-01-01
During his visit to CERN on 4 July 2003, Karen Chshmaritian, Armenian Minister for Trade and Economic Development, toured the ATLAS experimental cavern and assembly hall. From left to right: Aram Kotzinian, from the international organization JINR from Dubna, Marzio Nessi from ATLAS, Karen Chshmaritian, Armenian Minister for Trade and Economic Development, Zohrab Mnatsakanian, Ambassador at the Permanent Mission of the Republic of Armenia to the United Nations in Geneva, Alexandre Sissakian, Vice-Director of JINR and Peter Jenni, ATLAS spokesman.
Jonsson, Viktoria; Linnér, Rebecka
2016-01-01
Corporate Social Responsibility (CSR) represents a theory and practice that is well-known and communicating its content has shown to play an important role in order to exploit its advantages and engage stakeholders on CSR issues. Even though, CSR communication has shown to be a real challenge, since corporations are encouraged to engage in CSR, but not to communicate too loud about this engagement. This study was inspired by Jenny Dawkins (2005) and her initial idea that tailoring CSR message...
Michel Blanc
2010-01-01
other Members of the delegation: State of Lower Saxony, Ministry of Science and Culture,Head of Science and Innovation H. Gevers ATLAS Collaboration and II. Physikalisches Institut, Georg-August-Universität Göttingen A. Quadt Accompanied by CERN Adviser to the Coordinator for External Relations R. Voss Visiting the Antiproton Decelerator Facility with AEGIS Collaboration Spokesperson M. Doser, the Superconducting Magnet Test Hall with Technology Departement R. Schmidt and ATLAS visitor centre with Former Collaboration Spokesperson P. Jenni and T. Wengler.
Members of the Forum Engelberg visit CERN
Patrice Loïez
2002-01-01
The Forum Engelberg is an annual interdisciplinary conference held in Engelberg, Switzerland intended to act as an international platform for debate and exchange of views on key issues affecting scientific research, technology, economics and philosophy. Its President is Hubert Curien - former French Minister of Research and Space Research, and President of the CERN Council from 1994 to 1996. Photo 01: Jean-Claude Landry, Department of the Interior, Agriculture and Environment, state of Geneva (right) in discussion with Peter Jenni, spokesperson for the ATLAS collaboration.
Mujeres novelistas. Jóvenes narradoras de los noventa.
Castro Díaz, Mariola; Redondo G., Alicia
2006-01-01
SUMARIO Presentación Pacheco O., Bettina 1.- Artículos Los elementos clásicos en el diseño de los personajes de la comedia televisiva contemporánea. Bustamante N., Jenny Cambridge, la aventura del viaje y la reescritura de la historia. Fernández, Mireya Representaciones de la ciudad de México en la crónica. Karam, Tanius The lonely londoners: metáfora del desarraigo. Pérez Sisto, Edith Calibán, la raza como oficio y el pens...
Carluccio, A; Noto, F; Parrillo, S; Contri, A; De Amicis, I; Gloria, A; Robbe, D; Veronesi, M C
2016-12-01
In the recent years, the donkey population decreased dramatically so that many breeds are presently considered as endangered. In comparison to the horse, the donkey placenta still remains not completely studied. In the horse, one of the diagnostic tools useful to identify pregnant mares at risk of abortion or premature delivery, include the transrectal ultrasound examination of the uterus and its contents; and especially of the combined thickness of the uterus and of the placenta (CUPT). Since the CUPT was never investigated in donkeys, the present study was aimed to define the transrectal CUPT values during the last half of pregnancy in 20 Martina Franca jennies. Foalings times, foals characteristics and placental gross appearance, and measurements were also evaluated and values resulted always within normality. Differently to the mare, a continuous significant CUPT increase between the sixth to the 12 months of pregnancy, and a substantial increase from the ninth to the 12th month of pregnancy, was found. Although statistically not evaluable, the CUPT values recorded from three jennies with pregnancy loss did not show evidence of CUPT increases. In conclusion, normal CUPT values from the sixth to the 12th month of pregnancy in Martina Franca donkeys are provided, but further investigations are needed to define possible breed or body-size CUPT specific differences, as well as the CUPT values during pregnancy disturbances or placental abnormalities. Copyright © 2016 Elsevier Inc. All rights reserved.
Variational principles for locally variational forms
International Nuclear Information System (INIS)
Brajercik, J.; Krupka, D.
2005-01-01
We present the theory of higher order local variational principles in fibered manifolds, in which the fundamental global concept is a locally variational dynamical form. Any two Lepage forms, defining a local variational principle for this form, differ on intersection of their domains, by a variationally trivial form. In this sense, but in a different geometric setting, the local variational principles satisfy analogous properties as the variational functionals of the Chern-Simons type. The resulting theory of extremals and symmetries extends the first order theories of the Lagrange-Souriau form, presented by Grigore and Popp, and closed equivalents of the first order Euler-Lagrange forms of Hakova and Krupkova. Conceptually, our approach differs from Prieto, who uses the Poincare-Cartan forms, which do not have higher order global analogues
Teachers’ Learning Design Practice for Students as Learning Designers
DEFF Research Database (Denmark)
Levinsen, Karin Tweddell; Sørensen, Birgitte Holm
2018-01-01
that simultaneously scaffold students’ subject-related inquiry, agency, reflection and learning. Research studies have documented that this approach constitutes arenas that support students’ deep learning and mastery of both transdisciplinary and subject matter, along with their acquisition of digital literacy and 21......This paper contributes with elements of an emerging learning design methodology. The paper takes as its starting point the theory of Students as Learning Designers, which was developed by Sørensen and Levinsen and based on more than a decade of research-and-development projects in Danish primary...... schools (first to 10th grade). The research focussed on information and communication technology (ICT) within the Scandinavian tradition of Problem Oriented Project Pedagogy (POPP), Problem Based Learning (PBL) and students’ production. In recent years, the projects that provide the grounding...
U.S. Geological Survey ArcMap Sediment Classification tool
O'Malley, John
2007-01-01
The U.S. Geological Survey (USGS) ArcMap Sediment Classification tool is a custom toolbar that extends the Environmental Systems Research Institute, Inc. (ESRI) ArcGIS 9.2 Desktop application to aid in the analysis of seabed sediment classification. The tool uses as input either a point data layer with field attributes containing percentage of gravel, sand, silt, and clay or four raster data layers representing a percentage of sediment (0-100%) for the various sediment grain size analysis: sand, gravel, silt and clay. This tool is designed to analyze the percent of sediment at a given location and classify the sediments according to either the Folk (1954, 1974) or Shepard (1954) as modified by Schlee(1973) classification schemes. The sediment analysis tool is based upon the USGS SEDCLASS program (Poppe, et al. 2004).
Teachers’ Learning Design Practice for Students as Learning Designers
DEFF Research Database (Denmark)
Levinsen, Karin Tweddell; Sørensen, Birgitte Holm
2018-01-01
This paper contributes with elements of an emerging learning design methodology. The paper takes as its starting point the theory of Students as Learning Designers, which was developed by Sørensen and Levinsen and based on more than a decade of research-and-development projects in Danish primary...... schools (first to 10th grade). The research focussed on information and communication technology (ICT) within the Scandinavian tradition of Problem Oriented Project Pedagogy (POPP), Problem Based Learning (PBL) and students’ production. In recent years, the projects that provide the grounding...... for the theory have focussed specifically on learning designs that constitute students as learning designers of digital productions (both multimodal and coded productions). This includes learning designs that contribute to students’ empowerment, involvement and autonomy within the teacher-designed frameworks...
Demir, Ender; Gozgor, Giray
2018-02-01
The renewable energy sources are considered as the important factor to decrease the level of carbon emissions and to promote the global green economy. Understanding the dynamics of renewable energy consumption, this paper analyzes whether there is a unit root in renewable energy consumption in 54 countries over the period 1971-2016. To this end, the unit root test of Narayan-Popp with two endogenous (unknown) breaks is implemented. The paper finds that renewable energy consumption series are stationary around a level and the time trend in 45 of 54 countries. In other words, renewable energy consumption follows a unit root process only in nine countries: Brazil, China, Colombia, India, Israel, Japan, the Netherlands, Spain, and Turkey. The evidence implies that renewable energy demand policies, which aimed to decrease the carbon emissions, will only have permanent effects in those nine countries.
Lenguaje: Errores comunes en el lenguaje periodístico. Neologismos en la horma del zapato.
Espinosa Cordero, Simón
2002-01-01
Liz y Jenny van de shopping. -¿A qué mall irán? Irán al "Mall del Sol" y allá van las dos, cual rubias hermanitas de rinseado pelo estyled como se usa en USA. Compran bacon, pancakes, lomo para roast-beef, aftershave para el Johnsito al que le están saliendo los primeros pelos, slips para Kenny, shorts para el Richard, y boxers para que las balls del Joe resalten mejor. Son tan chiquitas, pobrecito. A media mañana se toman un coffee break en la bakery del mall. Y deciden, porque tienen el ...
Members of the State Council of Geneva
Maximilien Brice
2002-01-01
Luncheon hosted by the Director-General for members of the State Council of Geneva: From left to right A. Naudi; J. May; M. Carlo Lamprecht, State Council - Employement, Foreign Office and Economic Departement; M. Robert Hensler, State Chancellor; L. Maiani, CERN Director General; H.F. Hoffmann; M. Robert Cramer, State Council - Environment, Agriculture and Interior Departement; J.Van Der Boon; M. Laurent Moutinot, State Council - Installation, equipment and housing Departement; C. Détraz; C. Wyss; P. Jenni; G. Hentsch; M. Pierre-François Unger, State Council - Health and Social Action Departement; G. Stassinakis; M. Bourquin, CERN Council President.
Marcelloni De Oliveira, Claudia
2015-01-01
ATLAS PHd Grants - We are excited to announce the creation of a dedicated grant scheme (thanks to a donation from Fabiola Gianotti and Peter Jenni following their award from the Fundamental Physics Prize foundation) to encourage young and high-caliber doctoral students in particle physics research (including computing for physics) and permit them to obtain world class exposure, supervision and training within the ATLAS collaboration. This special PhD Grant is aimed at graduate students preparing a doctoral thesis in particle physics (incl. computing for physics) to spend one year at CERN followed by one year support also at the home Institute.
The “Serpentine Syndrome” (H. Jenny, 1980: A Proxy for Soil Remediation
Directory of Open Access Journals (Sweden)
Claudio Bini
2014-12-01
Full Text Available Serpentine soils have relatively high concentrations of PTEs (Co, Cr, Cu, Fe, Ni but generally low amounts of major nutrients. They often bear a distinctive vegetation, and a frequently-used approach to understanding serpentine ecology and related environmental hazard has been the chemical analysis of soils and plants. In this paper we report past and current studies on serpentine soils and serpentinophytes. The serpentine vegetation differs from the conterminous non-serpentine areas, being often endemic, and showing macroscopic physionomical characters. Similarly, at microscopic level cytomorphological characteristics of the roots and variations in biochemical parameters were recorded in serpentinophytes. Light microscopy observations showed depressed mitotic activity in the meristematic zone, and consequent reduced root growth. The different tolerance mechanisms responsible for plant adaption to high concentrations of PTEs in serpentine soils can be related to the capacity of plants to limit metal uptake and translocation. The majority of serpentinophytes tend to limit metal absorption to roots: the cell wall constitutes a barrier against metal penetration inside plant tissues. Only a few species are able to accumulate metals in their aerial parts, acting a tolerance mechanism to very high metal concentrations. Serpentinophytes, therefore, could represent proxies for plants used in remediation of metal-contaminated soils and in phytomining as well.
Directory of Open Access Journals (Sweden)
Pasquale De Palo
Full Text Available Dairy donkey milking procedures require separating foals from their dams for a few hours a day. Artificial suckling in this species is a good technique for improving milk production and foal welfare. The aim of the work is to compare the effect of two different diets on donkey foals when separated from jennies for milking procedures with and without a milk replacer. Forty newborn Martina Franca donkey foals were subdivided into two experimental groups. Both groups were separated from their respective dams from 8.00to 20.00to allow the jennies to be milked. During the separation, all the foals had access ad libitum to water, hay and feed. During the separation period, one group had the availability of a mechanical milk replacer dispenser, so foals were partially artificially suckled (AS, while the other group had no milk replacer available, and so were totally naturally suckled (NS. The AS group had milk replacer availability until 120±7d of life. Both groups were naturally weaned at 168±7d. Blood samples were collected weekly starting from birth until two wks after weaning (i.e. at 182d, from all the foals included in the trial. Almost all the analytes were influenced by suckling technique and age of foals. Alanine-aminotransferase, aspartate-aminotransferase, alkaline phosphatase, NEFA, lipid hydroperoxides, serum proteins showed the greatest differences between the two experimental groups. Separating foals from their dams for 12hdaily for 24 weeks does not lead to pathological subclinical and metabolic conditions, thus confirming the high rusticity and resistance of the donkey.
Interactive Multimedia Software on Fundamental Particles and Forces. Final Technical Report
International Nuclear Information System (INIS)
Jack Sculley
1999-01-01
Research in the SBIR Phase 2 grant number 95 ER 81944 centered on creating interactive multimedia software for teaching basic concepts in particle physics on fundamental particles and forces. The work was undertaken from February 1997 through July 1998. Overall the project has produced some very encouraging results in terms of product development, interest from the general public and interest from potential Phase 3 funders. Although the original Phase 3 publisher, McGraw Hill Home Interactive, was dissolved by its parent company, and other changes in the CD-ROM industry forced them to change their focus from CD-ROM to the Internet, there has been substantial interest from software publishers and online content providers in the content developed in the course of the Phase 2 research. Results are summarized
Final Technical Report: Mu2e at the City University of New York
Energy Technology Data Exchange (ETDEWEB)
Lynch, Kevin [City Univ. (CUNY), NY (United States); Popp, James [City Univ. (CUNY), NY (United States)
2017-06-25
This DOE grant award for was for the period June 1, 2013 to March 31, 2016. Popp was awarded an internship in the Visiting Faculty Program at FNAL in summer of 2015; consequently the unused portion of summer salary funds allowed us to apply for a no-cost extension with our remaining funds until March 31, 2017. That support furnished us with the means to carry out numerous successful projects for Mu2e for nearly four years. Up to now, the driving force to our work has been dictated primarily by the Mu2e Project cost and schedule needs. Our work has been under the purview of three of the Working Groups to which we belong: Target Station, Electron Tracker, and Stopping Target Monitor. We have carried out a mix of bench-top testing tasks locally, more elaborate work at Fermilab every summer, and extensive software development and simulation studies.
ATLAS rewards Russian supplier for scintillating tile production
Patrice Loïez
2001-01-01
The ATLAS collaboration has awarded Russian firm SIA Luch from Podolsk in the Moscow region an ATLAS Supplier Award. This follows delivery by the company of the final batch of scintillating tiles for the collaboration's tile calorimeter some six months ahead of schedule. Representatives of the firm are seen here receiving the award at a ceremony held in the collaboration's tile calorimeter instrumentation plant at CERN on 30 July. In front of one tile calorimeter module instrumented by scintillating tiles are (left to right) IHEP physicists Evgueni Startchenko and Andrei Karioukhine, Luch Podolsk representatives Igor Karetnikov and Yuri Zaitsev, tile calorimeter project leader Rupert Leitner, ATLAS spokesperson Peter Jenni, and CERN tile calorimeter group leader Ana Henriques-Correia.
Special offer for early shift takers!
Muriel
Peter Jenni, spokesperson of the ATLAS collaboration, just made the following announcement. "Despite the few problems that we are encountering, which of course are unavoidable in such a large project, I am very pleased with the way the ATLAS experiment is taking shape. With the imminence of data taking, I would like to make a special gesture as a thank you to all of you who are working so hard for ATLAS to meet its many deadlines. The first 100 ATLAS members who will sign up for shifts will receive twice the standard OTSMOU credit." You can sign up for shifts as of April 1st by sending an e-mail to Atlas.Shifts@cern.ch.
Directory of Open Access Journals (Sweden)
Luiz Henrique Costa Garcia
2015-04-01
Full Text Available The present study was aimed at proposing a systematic evaluation of cranial computed tomography, identifying the main aspects to be analyzed in order to facilitate the decision making process regarding diagnosis and management in emergency settings. The present descriptive study comprised a literature review at the following databases: Access Medicine and Access Emergency Medicine (McGraw- Hill Education; British Medical Journal Evidence Center; UptoDate; Bireme; PubMed; Lilacs; SciELO; ProQuest; Micromedex (Thomson Reuters; Embase. Once the literature review was completed, the authors identified the main diseases with tomographic repercussions and proposed the present system to evaluate cranial computed tomography images. An easy-to-memorize ABC system will facilitate the decision making in emergency settings, as it covers the main diseases encountered by intensivists and emergency physicians, and provides a sequential guidance about anatomical structures to be investigated as well as their respective alterations.
Directory of Open Access Journals (Sweden)
Huijun Zhang
2018-01-01
Full Text Available The regiospecific distribution of fatty acids (FAs and composition of triglyceride (TAG molecular species of fishes were analyzed and calculated by pancreatic lipase (PL hydrolysis and Visual Basic (VB program. DHA was preferentially located at sn-2 position in TAG molecule, whereas EPA was almost equally distributed in each position of glycerol backbone. DOP, DPP, EPP, PoPP, PPO, and PPP were the predominant TAG species. MPP in anchovy, DDP, DOP, DPP in tuna, and EOO and OOO in salmon were the characteristic TAG molecules, which were meaningful to differentiate marine fish oils. Furthermore, the data management, according to TCN and ECN, was firstly applied to classify the TAG molecular species. The ECN42, ECN46, and ECN48 groups were rich in TAGs. The lower ECN values, compared to the higher TCN values, indicated that the most abundant TAGs exhibited a higher unsaturated degree. Therefore, our study not only offered a simple and feasible approach for the analysis of TAG composition but also firstly summarized the information by data management within ECN and TCN.
Dairy donkey: an alternative building layout
Directory of Open Access Journals (Sweden)
Carlo Bibbiani
2017-03-01
Full Text Available In Italy, donkey dairies are growing in popularity to produce an alternative milk source for human infants. The use of donkey milk is not limited to the paediatric field, being used in geriatric nutrition and in the cosmetic industry. In 2010, the Department of Veterinary Science, University of Pisa, was involved in a project supported by the Tuscany Region Rural Development Fund 2007- 2013 dealing with the creation of a donkey milk productive chain. The project has as its main partner the Bandite di Scarlino, an agro-forestry complex of considerable size. It covers approximately 9000 hectares, which fall in Scarlino, Castiglione della Pescaia, Follonica and Gavorrano municipalities, under Tuscany regional control. The so-called FILAMI project (Filiera Latte Asino Amiatino, acronym of the goal of the project in Italian had among its goals helping preserve an indigenous breed of donkeys called Amiatina. Salimei (2011 assessed that the presence of the foal during milking does not affect milk ejection in jennies (the female donkey adapted to the milking procedure, but when foals are not present the milking routine is more manageable for the animals and for optimal milk harvest; in accordance, in the present farming system the jenny has been kept separately from the foal during the milking session. To this purpose, the stable, the milking parlour and the paddocks must be well organised with a proper milking routine. Milking facilities must be designed for the milk treatment and storage at low temperature or for freezing. Currently, the milk undergoes a pasteurisation cycle for human consumption, or directed to the cosmetic industry. Moreover, the milking facilities should fulfil the creation of a milk collection centre in order to play an important role between the dairy donkey farms and the dairy industry. In this paper, the technical and technological aspects of the donkey stable, paddocks, milking parlour, mobile milking unit, and processing
On Russian concepts of Soil Memory - expansion of Dokuchaev's pedological paradigm
Tsatskin, A.
2012-04-01
Having developed from Dokuchaev's research on chernosem soils on loess, the Russian school of pedology traditionally focused on soils as essential component of landscape. Dokuchaev's soil-landscape paradigm (SLP) was later considerably advanced and expanded to include surface soils on other continents by Hans Jenny. In the 1970s Sokolov and Targulian in Russia introduced the new term of soil memory as an inherent ability of soils to memorize in its morphology and properties the processes of earlier stages of development. This understanding was built upon ideas of soil organizational hierarchy and different rates of specific soil processes as proposed by Yaalon. Soil memory terminology became particularly popular in Russia which is expressed in the 2008 multi-author monograph on soil memory. The Soil Memory book edited by Targulian and Goryachkin and written by 34 authors touches upon the following themes: General approaches (Section 1), Mineral carriers of soil memory (Section 2), Biological carriers of soil memory (section 3) and Anthropogenic soil memory (section 4). The book presents an original account on different new interdisciplinary projects on Russian soils and represents an important contribution into the classical Dokuchaev-Jenny SL paradigm. There is still a controversy as to in what way the Russian term soil memory is related to western terms of soil as a record or archive of earlier events and processes during the time of soil formation. Targulian and Goryachkin agree that all of the terms are close, albeit not entirely interchangeable. They insist that soil memory may have a more comprehensive meaning, e.g. applicable to such complex cases when certain soil properties whose origin is currently ambiguous cannot provide valid environmental reconstructions or dated by available dating techniques. Anyway, not terminology is the main issue. The Russian soil memory concept advances the frontiers of pedology by deepening the time-related soil functions and
Gold Medal Award for Life Achievement in Psychology in the Public Interest: Beatrice A. Wright.
2016-01-01
The American Psychological Foundation (APF) Gold Medal Awards recognize distinguished and enduring records of accomplishment in 4 areas of psychology. The 2016 recipient of Gold Medal Award for Life Achievement in Psychology in the Public Interest is Beatrice A. Wright. Dorothy W. Cantor, president of the APF, will present the APF Gold Medal Awards at the 124th Annual Convention of the American Psychological Association on August 5, 2016, at 4:00 p.m. Members of the 2016 APF Board of Trustees are: Dorothy W. Cantor, president; David H. Barlow, vice president; Melba J. T. Vasquez, secretary; Richard C. McCarty, treasurer; Elisabeth R. Straus, executive vice president/executive director; Cynthia Belar; Camilla Benbow; Rosie Phillips Bingham; Connie S. Chan; Anthony Jackson; Terence M. Keane; Archie L. Turner; W. Bruce Walsh; and Bonnie Markham and Rick McGraw, APA Board of Directors liaisons. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
A search for hot pulsators similar to PG1159-035 and the central star of K 1-16
International Nuclear Information System (INIS)
Bond, H.E.; Grauer, A.D.; Liebert, J.; Fleming, T.; Green, R.F.
1987-01-01
The variations of PG1159-035 (GWVir)were discovered by McGraw et al. This object is the prototype of a anew class of pulsating stars located in an instability strip at the left-hand edge of the HR diagram. PG1159-035 and the spectroscopically similar objects PG1707+427 and PG2131+066 display complex non-radial modes with periodicities of order 10 minutes. Grauer and Bond recently discovered that the central star of the planetary nebula Kohoutek 1-16 also exhibits pulsation properties, with dominant periodicities of 25-28 minutes. These four objects display the following characteristics: High effective temperatures (--10 5 Κ) and moderately high surface gravities (log g ≅ 6-8); He II, C IV, and O VI absorption lines in the optical spectra, often reversed with emission cores; No hydrogen lines clearly detected; The pulsational instability has been attributed to partial ionization of carbon and/or oxygen
Public education and media relations in psychology.
Wedding, Danny
2017-11-01
This article reviews psychology's attempts to influence public attitudes about both the science and the profession of psychology. The early history of the profession is reviewed, and the efforts of the American Psychological Association (APA) to shape the public's perception of psychology are discussed. The rise of social media is reviewed, and important social media outlets relevant to psychology are identified. The activities of the Society for Media Psychology and Technology (APA Division 46) are illustrated, and the presidents of the Division are identified. The work of those psychologists who are noted public intellectuals or who have received Nobel prizes or National Medal of Science awards for their research is briefly reviewed, and the public notoriety of 4 prominent media celebrities (Joy Browne, Joyce Brothers, Laura Schlessinger, and Phil McGraw) is discussed. Several controversies in the field of psychology that have influenced the public and their attitudes about psychology are also briefly reviewed. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Okely, Judith A; Weiss, Alexander; Gale, Catharine R
2018-02-01
The link between greater wellbeing and longevity is well documented. The aim of the current study was to test whether this association is consistent across individualistic and collectivistic cultures. The sample consisted of 13,596 participants from 11 European countries, each of which was assigned an individualism score according to Hofstede et al.'s (Cultures and organizations: software of the mind, McGraw Hill, New York, 2010) cultural dimension of individualism. We tested whether individualism moderated the cross-sectional association between wellbeing and self-rated health or the longitudinal association between wellbeing and mortality risk. Our analysis revealed a significant interaction between individualism and wellbeing such that the association between wellbeing and self-rated health or risk of mortality from cardiovascular disease was stronger in more individualistic countries. However, the interaction between wellbeing and individualism was not significant in analysis predicting all-cause mortality. Further prospective studies are needed to confirm our finding and to explore the factors responsible for this culturally dependent effect.
A Visual Basic program to plot sediment grain-size data on ternary diagrams
Poppe, L.J.; Eliason, A.H.
2008-01-01
Sedimentologic datasets are typically large and compiled into tables or databases, but pure numerical information can be difficult to understand and interpret. Thus, scientists commonly use graphical representations to reduce complexities, recognize trends and patterns in the data, and develop hypotheses. Of the graphical techniques, one of the most common methods used by sedimentologists is to plot the basic gravel, sand, silt, and clay percentages on equilateral triangular diagrams. This means of presenting data is simple and facilitates rapid classification of sediments and comparison of samples.The original classification scheme developed by Shepard (1954) used a single ternary diagram with sand, silt, and clay in the corners and 10 categories to graphically show the relative proportions among these three grades within a sample. This scheme, however, did not allow for sediments with significant amounts of gravel. Therefore, Shepard's classification scheme was later modified by the addition of a second ternary diagram with two categories to account for gravel and gravelly sediment (Schlee, 1973). The system devised by Folk (1954, 1974)\\ is also based on two triangular diagrams, but it has 21 categories and uses the term mud (defined as silt plus clay). Patterns within the triangles of both systems differ, as does the emphasis placed on gravel. For example, in the system described by Shepard, gravelly sediments have more than 10% gravel; in Folk's system, slightly gravelly sediments have as little as 0.01% gravel. Folk's classification scheme stresses gravel because its concentration is a function of the highest current velocity at the time of deposition as is the maximum grain size of the detritus that is available; Shepard's classification scheme emphasizes the ratios of sand, silt, and clay because they reflect sorting and reworking (Poppe et al., 2005).The program described herein (SEDPLOT) generates verbal equivalents and ternary diagrams to
DEFF Research Database (Denmark)
Hovden, Jan
2008-01-01
The Hovdabrekka group is a group of nordic researchers doing survey studies of Nordic journalism schools (2005,2008). This site is dedicated to information from this project. The current members are: Norway: Rune Ottosen,Gunn Bjørnsen and Jan Fredrik Hovden Sweden: Jenny Wiik Denmark: Ida Willig...... and Jannie Møller Hartley. Finland: Henrika Zilliacus-Tikkanen and Raimo Solokangas Former members: Jan Dyberg and Hanne Jørndrup (Denmark), Marina Ghersetti (Sweden) Project Hovdabrekka originated at the Nordic conference for journalist teachers at Hovdabrekka, Iceland September 2004, where a small group...... of scientists/lecturers assembled with a desire to do a comparative quantitative study of students at Nordic journalism schools. Until very recently, there existed little systematic knowledge on the students of journalism in the Nordic countries. For these reasons, the Hovdabrekka group planned and sent out...
Energy Technology Data Exchange (ETDEWEB)
NONE
2010-07-01
Within the International Conference and Exhibition at 16th September,2010 at the Maritim Hotel (Wuerzburg, Federal Republic of Germany) the following lectures were held: (1) History of Organic Photovoltaics (Niyazi Serdar Sariciftci); (2) PV Activities at the ZAE Bayern (Vladimir Dyakonov); (3) Progress in Solid State DSC (Peter Erk); (4) Polymer Semiconductors for OPV (Mats Andersson); (5) Fullerene Derivative N-Types in Organic Solar Cells (David Kronholm); (6) Modelling Charge-Transport in Organic Photovoltaic Materials (Jenny Nelson); (7) Multi Junction Modules R and D Status and Outlook (Paul Blom); (8) Imaging Technologies for Organic Solar Cells (Jonas Bachmann); (9) Production of Multi-junction Organic Photovoltaic Cells and Modules (Martin Pfeiffer); (10) Upscaling of Polymer Solar Cell Fabrication Using Full Roll-to-roll Processing (Frederik Christian Krebs); (11) Industrial Aspects and Large Scale OPV Production (Jens Hauch).
Hirmu iroonia / Jan Kaus, Jürgen Rooste
Kaus, Jan, 1971-
2006-01-01
Kuni 27. VIII Helsingi Kiasmas avatud näitusest "Ars 06". Tellervo Kalleineni ja Oliver Kochta-Kalleineni, Carl Michael von Hausswolffi ja Thomas Nordanstadi, Lars Nilssoni, Motohiko Odani, Adriana Varejao, Juan Manuel Echavarria, hispaania rühmituse El Perro, vene rühmituse AES+F jt. töödest. Võrdluseks Kirke Kangro mullaskulptuuridest, Peeter Lauritsa ja Marcos Lopeze fotodest. Valik üritusi: 28. III-23. IV Põhja- ja Baltimaade üliõpilaste näitus ja töötuba "Pime kohting"; 27. IV-14. V Jenni Leskineni installatsioon ja meistriklass "Unelelu"; 16. V-11. VI Helsingi kunstiakadeemia meistriklass ja näitus; 17. V seminar "Julgus, rõõm ja kriitika"; 18. V Roi Vaara jt. performance; 15. VI-23. VII Montri Toemsombati installatsioon; 25. VII-27. VIII üliõpilaste rahvusvaheline näitus "Kollaboratsioon"
Fabiola Gianotti, the newly elected Spokesperson of ATLAS
2008-01-01
On 11 July Fabiola Gianotti was elected by the ATLAS Collaboration as its future Spokesperson. Her term of office will start on 1 March 2009 and will last for two years. She will take over from Peter Jenni who has been ATLAS Spokesperson since its formalization in 1992. Three distinguished physicists stood as candidates for this election: Fabiola Gianotti (CERN), Marzio Nessi (CERN), and Leonardo Rossi (INFN Genova, Italy). The nomination process started on 30 October 2007, with a general email sent to the ATLAS collaboration calling for nominations, and closed on 25 January 2008. Any ATLAS physicist could nominate a candidate, and 24 nominees were proposed before the ATLAS search committee narrowed them to the final three. After the voting process, which concluded the ATLAS general meeting in Bern, the Collaboration Board greeted the result with warm applause.
Mancianti, Francesca; Nardoni, Simona; Papini, Roberto; Mugnaini, Linda; Martini, Mina; Altomonte, Iolanda; Salari, Federica; D'Ascenzi, Carlo; Dubey, Jitender P
2014-04-03
Toxoplasma gondii is a worldwide zoonotic protozoan. Consumption of raw milk from infected animals is considered a risk factor for acquiring toxoplasmosis in humans. Recently, donkey milk has been indicated for therapeutic and nutritional purposes and T. gondii infection is common in donkeys. The purpose of the present paper was to detect the presence of parasite DNA in milk of T. gondii positive donkeys. Antibodies to T. gondii were found in 11 out of 44 healthy lactating donkeys by IFAT. T. gondii DNA was detected by PCR in blood of 6 and milk of 3 seropositive jennies. Results of limited RFLP-PCR genotyping indicated the presence of T. gondii genotype II or III, commonly found in Europe. The occurrence of T. gondii DNA in milk suggests that the consumption of raw milk from seropositive donkeys could be a potential source of human infection.
Spanish Minister of Science and Technology visits ATLAS
Patrice Loïez
2002-01-01
H.E. Mr Josep Piqué i Camps, Minister for Science and Technology, Spain, pictured in front of a barrel toroid cryostat vessel in the ATLAS assembly hall. The air-core ATLAS barrel toroid magnet system will consist of eight large superconducting coils, each in its own vacuum vessel, built by Spanish company Felguera Construcciones Mecanicas SA under the responsibility of IFAE (Institute for High Energy Physics), Barcelona. Photo 01: The Minister in front of the cryostat vessel. Photo 02: The Minister (right) with H.E. Mr Joaquin Pérez-Villanueva y Tovar, Spanish Ambassador to the United Nations in Geneva. Photo 03: (left to right) Manuel Delfino, leader of the Information Technology division at CERN; Matteo Cavalli-Sforza of CERN; Juan Antonio Rubio, leader of the Education and Technology Transfer division at CERN; The Minister; and Peter Jenni, ATLAS spokesperson.
George Mikenberg honoured by the Sharing Knowledge Foundation
CERN Bulletin
2016-01-01
The Sharing Knowledge Foundation Prize was presented to the ATLAS physicist at a ceremony on 18 March. ATLAS physicist George Mikenberg receives the Sharing Knowledge Foundation Prize. From left to right: Peter Jenni, former ATLAS Spokesperson, Rolf Heuer, former CERN Director-General, Frédérick Bordry, CERN Director for Accelerators and Technology, George Mikenberg, Patrick Fassnacht, CERN International Relations sector, Eliane Jacot-Des-Combes Mikenberg, Herwig Schopper, former CERN Director-General, Constantin Lanaras, treasurer of the Sharing Knowledge Foundation, Robert Klapisch, President of the Sharing Knowledge Foundation, Federico Saldana, logistical support, Catherine Cesarsky, Vice-President of the CERN Council, Eliezer Rabinovici, Vice-President of the CERN Council and of SESAME. (Image: Sophia Bennett/CERN) The Sharing Knowledge Foundation awarded its 2016 prize to George Mikenberg, a member of the LHC's ATLAS experiment who has been...
DEFF Research Database (Denmark)
Sørensen, Hans Eibe; Williamson, Trevor
Abstract In September 2014, nine months after launching a major growth opportunity, Jenny Dunne, managing director of Nu2U, called for an extraordinary status meeting with her COO and CMO. A fast-growing online retailer of refurbished household appliances, Nu2U planned to acquire market share...... by improving internal logistics and delivery services, aided by a new, fully integrated software system. The company's gross profit had been increasing steadily, but recent accounts revealed a fall in net profit margins. It became apparent that implementation of the business plan for the project...... was problematic because of loose governance and poor communication across Nu2U's different specialist functions during planning and implementation. The Nu2U case illustrates how executives' cognition and span of control/overview may be hampered in fast-growing firms and how this ...
Laparoscopic pelvic lymphadenectomy: experience of a Gynaecological Cancer Centre in the UK.
Karanjgaokar, Vrunda C; Wright, Jeremy T; Murphy, Damian J; Mann, Christopher H
2012-04-01
The role of laparoscopic lymphadenectomy in the management of gynaecological cancers has been established over the last two decades, having been first described in Dargent and Selvat (L'envahissement ganglionnaire pelvin. Medsi-Mcgraw Hill, Paris, 1989). It has been shown that laparoscopic lymphadenectomy can be performed in the majority of patients and is associated with a low complication rate. However, the technique continues to be undertaken in only a relatively small number of Gynaecological Cancer Centres in the UK owing to the long learning curve and wide variations in training. At the Royal Wolverhampton NHS Trust Gynaecological Cancer Centre in the Greater Midlands Cancer Network laparoscopic lymphadenectomy has been performed since 1999 in the management of early cervical and high grade endometrial cancers. We have undertaken a retrospective audit (1999-2009) of these 42 cases to assess the feasibility of the procedure as well as to assess the complication rate. We are presenting the first reported series of exclusive laparoscopic transperitoneal lymphadenectomies from a Gynaecological Cancer Centre in the UK.
Directory of Open Access Journals (Sweden)
Antonio Flavio Barbosa Moreira
2007-06-01
Full Text Available O artigo focaliza um processo de construção curricular em uma escola da rede municipal de Belo Horizonte, no qual vigora a proposta oficial da ESCOLA PLURAL. Destaca as dificuldades vividas pelo corpo docente da escola e desenvolve o argumento de que propostas curriculares inovadoras podem criar um espaço discursivo no qual se segregam as crianças das camadas populares, reduzindo suas possibilidades de autonomia na sociedade. Com base nas concepções de política de Stephen Ball e Jenny Ozga, analisam-se os textos políticos da Escola Plural e de uma escola da rede municipal. Verificou-se a complexa relação entre documentos oficiais e experiências locais, bem como a necessidade de se afirmar a importância do conhecimento escolar no currículo. Argumenta-se que a supervalorização do aluno e de suas experiências culturais, em associação com a secundarização do conhecimento escolar, pode criar um espaço em que a criança seja confinada e jamais vista como normal.The paper focuses on a process of curriculum construction which was developed in a school from the Belo Horizonte educational system. The school is organized according to the official curricular proposal entitled PLURAL SCHOOL. It emphasizes the difficulties which were faced by the academic staff of the school and argues that innovative curricular proposals may create a space in which children from working class are segregated and have their possibilities of autonomy in society reduced. Drawing on the conceptions of politics by Stephen Ball and Jenny Ozga, the political texts, written on the level of the Plural School proposal and on the level of the school, are analyzed. The complex relations among official documents and local experiences are emphasized. The importance of school knowledge is stressed. It is argued that the overvaluation of the students and their cultural experiences and the undervaluation of school knowledge can create a space in which children are
2007-01-01
The Swedish astronaut Christer Fuglesang, a former CERN physicist now working for ESA, made his debut space flight last December. On 14 June he returned to CERN to talk about the experience. Christer Fuglesang during one of his spacewalks last December to upgrade the building of the International Space Station (ISS). Image Credit: NASA Christer Fuglesang (left) and his family visit the ATLAS experiment guided by Peter Jenni, the experiment’s spokesperson (right).Does an astronaut make a good cosmic ray detector? A particle physicist is undoubtedly very well placed to answer this kind of question. And as a former CERN physicist and now an astronaut with the European Space Agency (ESA), where he has worked since 1992, Christer Fuglesang has experience of both fields. Last December witnessed his first space journey, a 12-day mission on board the ISS International Space Station (see Bulletin No. ...
2007-01-01
Dutch Minister of Education, Culture and Science R. Plasterk (third from left) in the ATLAS cavern with NIKHEF Director F. Linde, CERN Chief Scientific Officer J. Engelen, Ambassador J. van Eenennaam, ATLAS Collaboration Spokesperson P. Jenni, Mission Representative G. Vrielink and ATLAS Magnet Project Leader H. ten Kate.Minister of Education, Culture and Science from the Kingdom of the Netherlands, Ronald Plasterk, visited CERN on 25th October. With Jos Engelen, CERN Scientific Director, as his guide he visited Point 1 of the LHC tunnel and ATLAS, where Nikhef (the national institute for subatomic physics, a Dutch government and university collaboration) constructed all 96 of the largest muon drift chambers in the barrel as well as parts of the magnet system, the inner detector, the DAQ and triggering. Overall the Netherlands contribute 4.5% to the annual CERN budget and the minister’s visit celebrated the contributions of the 79 ...
2007-01-01
The ATLAS experiment has recognised the outstanding contribution of two firms to the pixel detector. Recipients of the supplier award with Peter Jenni, ATLAS spokesperson, and Maximilian Metzger, CERN Secretary-General.At a ceremony held at CERN on 28 November, the ATLAS collaboration presented awards to two of its suppliers that had produced sensor wafers for the pixel detector. The CiS Institut für Mikrosensorik of Erfurt in Germany has supplied 655 sensor wafers containing a total of 1652 sensor tiles and the firm ON Semiconductor has supplied 515 sensor wafers (1177 sensor tiles) from its foundry at Roznov in the Czech Republic. Both firms have successfully met the very demanding requirements. ATLAS’s huge pixel detector is very complicated, requiring expertise in highly specialised integrated microelectronics and precision mechanics. Pixel detector project leader Kevin Einsweiler admits that when the project was first propo...
Ye, Jing; Cao, Xiaoji; Cheng, Zhuo; Qin, Ye; Lu, Yanbin
2015-12-01
In this work, the chromatographic performance of superficially porous particles (Halo core-shell C18 column, 50 mm × 2.1 mm, 2.7 μm) was compared with that of sub-2 μm fully porous particles (Acquity BEH C18 , 50 mm × 2.1 mm, 1.7 μm). Four parabens, methylparaben, ethylparaben, propylparaben, and butylparaben, were used as representative compounds for calculating the plate heights in a wide flow rate range and analyzed on the basis of the Van Deemter and Knox equations. Theoretical Poppe plots were constructed for each column to compare their kinetic performance. Both phases gave similar minimum plate heights when using nonreduced coordinates. Meanwhile, the flat C-term of the core-shell column provided the possibilities for applying high flow rates without significant loss in efficiency. The low backpressure of core-shell particles allowed this kind of column, especially compatible with conventional high-performance liquid chromatography systems. Based on these factors, a simple high-performance liquid chromatography method was established and validated for the determination of parabens in various seafood sauces using the Halo core-shell C18 column for separation. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Vogt, Norbert (ed.)
2012-11-01
Within the eleventh geotechnics conference at 09th March, 2012 in Munich (Federal Republic of Germany), the following lectures were held: (1) New construction of the highway A44 on a new open pit dump (N. Vogt); (2) Soil liquefaction issues at mining dumps in the Lausitz (Wolfram Kudla); (3) Underfloor pumped-storage power plants in facilities of hard coal minings (Eugen Perau); (4) Geothermal energy power plant trademark (H. Haemmerle); (5) Surface settlements during the tunnel heading in the loose rock - prognosis, measurement and impact (J. Fillibeck); (6) Ring wall storages - an essential contribution to geotechnics for energy storage (M. Popp); (7) Storage basins and their geotechnical challenges (S. Messerklinger); (8) Energy from the Andes: The hydroelectric power plant La Confluencia in Chile (M. Mueller); (9) Particularities of geotechnical verifications for flat foundations of offshore wind power plants (U. Hartwig); (10) Dimensioning of piles for the foundation of offshore wind power plants (M. Achmus); (11) Offshore wind power fundaments: Practical experiences from the projects London Array and Dan Tysk (M. Horn); (12) Installation of a mono pile as a foundation structure for a tide turbine (S. Schmitz); (13) Carbon footprint - International comparison of assessment approaches at specialist foundation engineering techniques (A. Zoehrer); (14) Geotechnical assessments of upgrading power transmission lines (A. Smith).
Modelling oil price volatility with structural breaks
International Nuclear Information System (INIS)
Salisu, Afees A.; Fasanya, Ismail O.
2013-01-01
In this paper, we provide two main innovations: (i) we analyze oil prices of two prominent markets namely West Texas Intermediate (WTI) and Brent using the two recently developed tests by Narayan and Popp (2010) and Liu and Narayan, 2010 both of which allow for two structural breaks in the data series; and (ii) the latter method is modified to include both symmetric and asymmetric volatility models. We identify two structural breaks that occur in 1990 and 2008 which coincidentally correspond to the Iraqi/Kuwait conflict and the global financial crisis, respectively. We find evidence of persistence and leverage effects in the oil price volatility. While further extensions can be pursued, the consideration of asymmetric effects as well as structural breaks should not be jettisoned when modelling oil price volatility. - Highlights: ► We analyze oil price volatility using NP (2010) and LN (2010) tests. ► We modify the LN (2010) to account for leverage effects in oil price. ► We find two structural breaks that reflect major global crisis in the oil market. ► We find evidence of persistence and leverage effects in oil price volatility. ► Leverage effects and structural breaks are fundamental in oil price modelling.
Directory of Open Access Journals (Sweden)
Annette von Alemann
2009-03-01
Full Text Available Die Autorin geht der Frage nach, warum in der Wirtschaft Frauen nicht gefördert werden, obwohl ihre gesellschaftliche Benachteiligung und ihre Unterrepräsentation in Führungspositionen wahrgenommen wird. Mit Hilfe von Leitfadeninterviews mit Führungskräften aus elf Unternehmen kommt sie zu dem Ergebnis, dass sich die Unternehmen für die Herstellung von Chancengleichheit nicht verantwortlich sehen. Zum einen widersprechen Frauenförderprogramme dem meritokratischen Verständnis individueller Leistungszurechnung, zum anderen sehen sich Unternehmen außerstande, das Kernproblem der Benachteiligung – das „Risiko Mutterschaft“ – zu lösen. Die herausgearbeiteten Begründungsmuster für die Unterrepräsentation von Frauen in Führungspositionen werden als Hinweis auf männerbündische Strukturen in den Organisationen identifiziert, deren Ziel die Ausgrenzung von Frauen aus wichtigen Positionen ist.The author pursues the question as to why businesses do not support women, even though they readily admit to the discrimination of women in society and their underrepresentation in executive positions. On the basis of guided interviews with executives from eleven businesses she comes to the conclusion that businesses do not consider themselves responsible for the creation of equal opportunities. For one, the programs for the promotion of women contradict the meritocratic understanding of individual performance within businesses. Secondly, businesses see themselves as unable to solve the core problem of the discrimination: the “danger of motherhood.” The author extracts patterns for the rationalization of the underrepresentation of women in executive positions and identifies these as evidence of masculine group structures within businesses that intend to exclude women from important positions.
2013-01-01
Earlier this week, the European Physical Society (EPS) announced its High Energy and Particle Physics prizes for 2013, and I’m pleased to say that the LHC featured highly. With all that has been happening in the last few years, that’s perhaps not too surprising, but these awards nevertheless constitute a great honour for our community. The High Energy and Particle Physics Prize went to the ATLAS and CMS collaborations “for the discovery of a Higgs boson, as predicted by the Brout-Englert-Higgs mechanism”, and to Michel Della Negra, Peter Jenni and Tejinder Virdee “for their pioneering and outstanding leadership roles in the making of the ATLAS and CMS experiments”. Among the other awards, the Young Experimental Physicist Prize went to Diego Martinez Santos “for his outstanding contributions to the trigger and commissioning of the LHCb experiment, and the analyses leading to first evidence for the rare decay B0s→ ...
Energy Technology Data Exchange (ETDEWEB)
Bottrel, M.; Fortes, T.; Ortiz, I.; Hidalgo, M.; Dorado, J.
2017-07-01
Female mules are considered as infertile; however, they could be used as recipients in interspecific embryo transfer. This study reports for the first time how it is possible to obtain the birth of a live Andalusian donkey foal after transfer a donkey embryo to a non-cycling mule. Two non-cycling mules were used as recipients, oestradiol benzoate was administered when donors showed oestrus and long-acting progesterone after ovulation. The mules also received long-acting progesterone every 7 days until 120 days of gestation. One embryo was collected from the two donor jennies and transferred to one of the mules after 5 days of progesterone treatment. Pregnancy was established and maintained after embryo transfer. The pregnant mule carried to term and delivered a live donkey foal after 375 days of pregnancy. In conclusion, non-cycling mules treated with oestradiol benzoate and long-acting progesterone can be successfully used as recipients of donkey embryos, which open new ways for the conservation of endangered donkey species.
ATLAS rewards two Japanese suppliers of major detector components.
Patrice Loïez
2002-01-01
The ATLAS supplier award in recognition of excellence has just been attributed to Kawasaki Heavy Industries, who produced the liquid-argon barrel cryostat. Kawasaki received its award in Hall 189 on the Meyrin site, where the cryostat is currently located. Toshiba Corporation's award for the superconducting central solenoid was presented two months ago at the Toshiba headquarters in Japan. Photo 01: P. Pailler, project leader for the ATLAS liquid-argon cryostats, addressing the Kawasaki delegation. Photo 04: H. Oberlack, project leader for the ATLAS liquid-argon system, addressing the Kawasaki delegation. Photo 11: P. Jenni (left), ATLAS Collaboration spokesperson, presenting the ATLAS supplier award for the barrel cryostat for the liquid-argon calorimeter to Mr. S. Nose, General Manager of Kawasaki Heavy Industries Ltd. Photo 18: J. Sondericker (left), liquid-argon barrel cryostat project engineer (BNL), presenting Mr. Nose (Kawasaki) an award from Brookhaven for the barrel cryostat for the ATLAS liquid-argo...
British Minister over the moon after visit to CERN
2008-01-01
The UK Minister for Science and Innovation, Ian Pearson MP, recently visited CERN. Ian Pearson, UK Minister for Science and Innovation (back row, third left), in the LHC tunnel with Peter Jenni, ATLAS Spokesperson (back row, centre), John Ellis (back row, third right), Simon Featherstone, UK Ambassador to Switzerland (back row, far left), Keith Mason, Chief Executive of STFC (the UK funding agency) (back row, second from right), and British scientists working at ATLAS.On the 15 April UK Minister for Science and Innovation, Ian Pearson, made his first trip to CERN. The UK is one of the founding Member States of CERN, and the British contingent is one of the largest of any country with around 650 British scientists and a further 250 staff members working here. After an introduction to the facilities by Director-General Robert Aymar, who expressed CERN’s gratitude for UK government support through its Science and Technology Facilitie...
2009-01-01
Steven Weinberg visiting the ATLAS cavern accompanied by Peter JenniIt was no surprise that the CERN audience arrived early in the Globe of Science and Innovation for the colloquium on 7 July. Nobel laureate Steven Weinberg is one of the major contributors to the Standard Model of particle physics. He received the Nobel Prize for Physics in 1979 for his work on the unified theory of the electromagnetic and weak interactions, one of the essential pillars of the Standard Model. After lunch at CERN and a visit to ATLAS, Weinberg gave a colloquium on "The Quantum Theory of Fields: Effective or Fundamental" to a packed audience. In his talk, he looked at how the use of quantum field theory in particle physics has fluctuated in popularity since Paul Dirac first introduced the approach to describe the interaction of particles with electromagnetic fields in the late 1920s. In particular, he posed the question: Is quantum field theory fundamental or does it a...
ATLAS Rewards Russian Supplier for Scintillating Tile Production
2001-01-01
At a ceremony held at CERN on 30 July, the ATLAS collaboration awarded Russian firm SIA Luch from Podolsk in the Moscow region an ATLAS Suppliers Award. This follows delivery by the company of the final batch of scintillating tiles for the collaboration's Tile Calorimeter some six months ahead of schedule. Representatives of Russian firm Luch Podolsk received the ATLAS Suppliers Award in the collaboration's Tile Calorimeter instrumentation plant at CERN on 30 July. In front of one Tile Calorimeter module instrumented by scintillating tiles are (left to right) IHEP physicists Evgueni Startchenko and Andrei Karioukhine, Luch Podolsk representatives Igor Karetnikov and Yuri Zaitsev, Tile Calorimeter Project Leader Rupert Leitner, ATLAS spokesperson Peter Jenni, and CERN Tile Calorimeter group leader Ana Henriques-Correia. Scintillating tiles form the active part of the ATLAS hadronic Tile Calorimeter, which will measure the energy and direction of particles produced in LHC collisions. They are emb...
Members of the Science and Technology Commission, Spanish Senate visit ATLAS
Maximilien Brice
2002-01-01
Photo 01: Members of the Science and Technology Commission, Spanish Senate, in front of a barrel toroid cryostat vessel in the ATLAS assembly hall. The air-core ATLAS barrel toroid magnet system will consist of eight large superconducting coils, each in its own vacuum vessel, built by Spanish company Felguera Construcciones Mecanicas SA under the responsibility of IFAE (Institute for High Energy Physics), Barcelona. Standing (left to right): Dr Peter Jenni, ATLAS spokesperson; Dr Manuel Aguilar-Benitez, delegate for Spain to CERN Council; Mrs Mercedes Senen, Lawyer of the Commission; Mr Alonso Arroyo, President of the Commission; Mr Ramon Antonio Socias, Second Vice-President of the Commission; Mr Francisco Xabier Albistur, Senator; H.E. Mr Joaquin Pérez-Villaneuva Y Tovar, Ambassador, Permanent Representative of Spain to the Office of the United Nations in Geneva and other international organisations in Switzerland, Spanish delegate to CERN Council; and Miguel Gomez. Seated (left to right): Mr Adolfo Abejon...
Antonella Del Rosso
2015-01-01
Last week, Semiconductor – the winners of the Collide@CERN Ars Electronica award for 2015 – and artists Francesco Mariotti and José-Carlos Mariátegui visited CERN and met the scientists. Ruth Jarman (left) and Joe Gerhardt (right) of Semiconductor with Peter Jenni, one of the scientists they met during their visit to ATLAS. Just a few weeks ago, Ruth Jarman and Joe Gerhardt, two English artists collaborating under the name Semiconductor, were awarded the Collide@CERN Ars Electronica prize for 2015. Last week, they came on their first visit to CERN to meet the scientists and select their scientific partner in preparation for their residency. They will soon begin a two-month residency at CERN before going to Linz (Austria), where they will spend a month at the Ars Electronica Futurelab. During their residency, the artists aim to create a digital artwork elaborating on the n...
2006-01-01
Showing excellence in mechanics, electronics and cryogenics, three industries are honoured for their contributions to the ATLAS experiment. Representatives of the three award-wining companies after the ceremony. For contributing vital pieces to the ATLAS puzzle, three industries were recognized on Friday 5 May during a supplier awards ceremony. After a welcome and overview of the ATLAS experiment by spokesperson Peter Jenni, CERN Secretary-General Maximilian Metzger stressed the importance of industry to CERN's scientific goals. Close interaction with CERN was a key factor in the selection of each rewarded company, in addition to the high-quality products they delivered to the experiment. Alu Menziken Industrie AG, of Switzerland, was honoured for the production of 380,000 aluminium tubes for the Monitored Drift Tube Chambers (MDT). As Giora Mikenberg, the Muon System Project Leader stressed, the aluminium tubes were delivered on time with an extraordinary quality and precision. Between October 2000 and Jan...
Maria van der Hoeven, the Netherlands minister for education, culture and science, visited CERN
maximilien Brice
2005-01-01
On 21 April, the Netherlands Minister for Education, Culture and Science, Mrs Maria van der Hoeven, was welcomed to CERN by the Director-General, Robert Aymar, and the Chief Scientific Officer, Jos Engelen. Minister van der Hoeven visited the ATLAS installations, the LHC tunnel and the magnet assembly and test hall before meeting a group of young scientists from the Netherlands. Picture 05 : from left to right, Frank Linde, Director of the Netherlands National Institute for Nuclear Physics and High Energy Physics (NIKHEF), Jos Engelen, CERN's Chief Scientific Officer, Maria van der Hoeven, Netherlands Minister for Education, Culture and Science, and Herman Ten Kate, Head of the ATLAS magnet project, visiting the ATLAS assembly hall.Picture 09 ; Here she talks with, from left to right, Jos Engelen, CERN's chief scientific officer, Peter Jenni, the ATLAS spokesman, Herman Ten Kate, head of the ATLAS magnet project, and Frank Linde, director of the Netherlands National Institute for Nuclear Physics and High Ener...
ATLAS rewards two pixel detector suppliers
2007-01-01
Peter Jenni, ATLAS spokesperson, presented the ATLAS supplier award to Herbert Reichl, IZM director, and to Simonetta Di Gioia, from the SELEX company.Two of ATLAS’ suppliers were awarded prizes at a ceremony on Wednesday 13 June attended by representatives of the experiment’s management and of CERN. The prizes went to the Fraunhofer Institut für Zuverlässigkeit und Mikrointegration (IZM) in Berlin and the company SELEX Sistemi Integrati in Rome for the manufacture of modules for the ATLAS pixel detector. SELEX supplied 1500 of the modules for the tracker, while IZM produced a further 1300. The modules, each made up of 46080 channels, form the active part of the ATLAS pixel detector. IZM and SELEX received the awards for the excellent quality of their work: the average number of faulty channels per module was less than 2.10-3. They also stayed within budget and on schedule. The difficulty they faced was designing modules based on electronic components and sensor...
Celebration for the ATLAS Barrel Toroid magnet
2007-01-01
Representatives from Funding Agencies and Barrel Toroid Magnet Laboratories during the ceremony. From left to right: Jean Zinn-Justin (Head of DAPNIA/CEA/Saclay), CERN Director-General Robert Aymar, and Roberto Petronzio (President INFN).Allan Clark (DPNC University Geneva) and Enrique Fernandez (IFAE Barcelona) were among the guests visiting the ATLAS cavern. The barrel toroid is visible in the background. A celebration took place at Point 1 on 13 December to toast the recent powering-up of the ATLAS barrel toroid magnet to full field (Bulletin No. 47-48/06). About 70 guests were invited to attend, mainly composed of representatives from funding partners and key members of the laboratory management teams of the barrel toroid magnet, representing CEA France, INFN Italy, BMBF Germany, Spain, Sweden, Switzerland, Russia, JINR Dubna and CERN. An introductory speech by ATLAS spokesperson Peter Jenni the scene for evening. This was followed by the ATLAS magnet system project leader Herman Ten Kate's account of the...
Report from the June Trigger and Physics Week
Chris Bee
The week of June 4th saw the 5th ATLAS Trigger and Physics week at CERN. The meeting, bringing together people working in the trigger, data preparation, detector combined-performance and physics groups, aimed at focusing work and discussions on preparing ATLAS for first data-taking. The meeting started on Monday afternoon with a set of plenary presentations on topics ranging from software status and validation, the ATLAS analysis model and its implications for the computing model, and initial ideas for trigger menus for the expected LHC start-up luminosity of 1031cm-2s-1. There was also a report from Peter Jenni on the expected LHC start-up schedule. The participation exceeded the organisers' wildest dreams as the CERN Council Chamber (seating capacity 160) proved woefully inadequate to seat everyone. A packed Council Chamber for the opening plenary Tuesday was dedicated to parallel sessions of the trigger and combined performance groups. A great deal of progress was presented in all areas, notably on...
2007-01-01
The President of Chile, Michelle Bachelet, in the ATLAS cavern with, from left to right, Peter Jenni, ATLAS Spokesman, Vivian Heyl, CONICYT President, and Robert Aymar, CERN Director-General. Robert Aymar, CERN Director-General, and Vivian Heyl, CONICYT President, signing a cooperation agreement between CERN and Chile’s Comisión Nacional de Investigación Científica y Tecnológica (CONICYT).The President of Chile, Michelle Bachelet, paid a visit to CERN during her three-day tour of Switzerland. The charismatic Michelle Bachelet and her large delegation were greeted by the CERN Director-General and then taken to see the ATLAS experiment and the LHC. She also took time to meet the Chilean community working at CERN, comprising several physicists in the Theory Group and the ATLAS experiment. The meeting was followed by the signing of a cooperation agreement between CERN and Chile’s Comisión Nacional de Investigación Científi...
International Nuclear Information System (INIS)
Bottrel, M.; Fortes, T.; Ortiz, I.; Hidalgo, M.; Dorado, J.
2017-01-01
Female mules are considered as infertile; however, they could be used as recipients in interspecific embryo transfer. This study reports for the first time how it is possible to obtain the birth of a live Andalusian donkey foal after transfer a donkey embryo to a non-cycling mule. Two non-cycling mules were used as recipients, oestradiol benzoate was administered when donors showed oestrus and long-acting progesterone after ovulation. The mules also received long-acting progesterone every 7 days until 120 days of gestation. One embryo was collected from the two donor jennies and transferred to one of the mules after 5 days of progesterone treatment. Pregnancy was established and maintained after embryo transfer. The pregnant mule carried to term and delivered a live donkey foal after 375 days of pregnancy. In conclusion, non-cycling mules treated with oestradiol benzoate and long-acting progesterone can be successfully used as recipients of donkey embryos, which open new ways for the conservation of endangered donkey species.
Energy Technology Data Exchange (ETDEWEB)
Boehlecke, Robert
2004-11-01
This Corrective Action Decision Document (CADD) has been prepared for Corrective Action Unit (CAU) 536: Area 3 Release Site, Nevada Test Site (NTS), Nevada, in accordance with the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S Department of Defense (FFACO, 1996). The NTS is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 536 is comprised of a single Corrective Action Site (CAS), 03-44-02, Steam Jenny Discharge, and is located in Area 3 of the NTS (Figure 1-2). The CAU was investigated in accordance with the Corrective Action Investigation Plan (CAIP) and Record of Technical Change (ROTC) No. 1 (NNSA/NV, 2003). The CADD provides or references the specific information necessary to support the recommended corrective action alternative selected to complete closure of the site. The CAU 536, Area 3 Release Site, includes the Steam Jenny Discharge (CAS 03-44-02) that was historically used for steam cleaning equipment in the Area 3 Camp. Concerns at this CAS include contaminants commonly associated with steam cleaning operations and Area 3 Camp activities that include total petroleum hydrocarbons (TPH), unspecified solvents, radionuclides, metals, and polychlorinated biphenyls (PCBs). The CAIP for Corrective Action Unit 536: Area 3 Release Site, Nevada Test Site, Nevada (NNSA/NV, 2003), provides additional information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for the CAS within CAU 536. The evaluation of corrective action alternatives is based on process knowledge and the results of the investigative activities conducted in accordance with the CAIP (NNSA/NV, 2003) that was approved prior to the start of the
2003-01-01
In an award ceremony on 3 September, ATLAS honoured the French company Axon Cable for its special coaxial cables, which were purpose-built for the Liquid Argon calorimeter modules. Working for CERN since the 1970s, Axon' Cable received the ATLAS supplier award last week for its contribution to the liquid argon calorimeter cables of ATLAS (LAL/Orsay, France and University of Victoria, Canada), started in 1996. Its two sets of minicoaxial cables, called harnesses "A" and "B", are designed to function in the harsh conditions in the liquid argon (at 90 Kelvin or -183°C) and under extreme radiation (up to several Mrads). The cables are mainly used for the readout of the calorimeters, and are connected to the outside world by 114 signal feedthroughs with 1920 channels each. The signal from the detectors is transmitted directly without any amplification, which imposes tight restrictions on the impedance and on the signal propagation time of the cables. Peter Jenni, ATLAS spokesperson, gives the award for best s...
T.D Lee and Lisa Randall visit ATLAS
Pauline Gagnon
Professor Tsung-Dao Lee, who received the Nobel Prize for Physics in 1957 for postulating that parity is not conserved in weak interactions, visited the ATLAS detector this month. He is seen here in the company of Peter Jenni, spokesperson for ATLAS. T.D. Lee is still very active at over 80, pursuing his theory work to this day. Professor Lisa Randall from Harvard University, the well-known theorist behind the Randall-Sundrum theory for extra dimensions, was also part of the group visiting the ATLAS detector. She is seen here with Fabiola Gianotti, deputy spokesperson for ATLAS. Lisa Randall's two initial papers have been quoted both more than 2500 times, making her the most cited theoretical physicist in the world in the last five years as of last autumn - a total of about 10,000 citations! One wonders here if Peter is pointing to a CP-violating graviton spotted in the ATLAS cavern... From left to right: Fabiola Gianotti, Gustaaf Brooijmans, convener of the ATLAS Exotics physics gro...
Mercados Cautivos para Productos Ancestrales Chicha de Jora y Morada
Directory of Open Access Journals (Sweden)
Pilco Mosquera, Wilian Enrique
2013-12-01
Full Text Available The physiological function of thirst is satisfied in daily life, for the most part, by products which con- tain chemical elements. The preference for each of them is driven by advertising campaigns and corpo- rate communications which in one way or another cause the decision to purchase a particular brand; tastes and preferences of customers are dynamic, faced with the diversity of innovative offers available in the market. This situation prompted us to conduct this research, we used inductive, deductive, systematic and analytical techniques. The rational, emotional, motivational and attitudinal factors which determine consumer choice were all investigated so the research was qualitative and quantitative in nature.The questionnaires were developed with direct questions and closed for conscious responses, and the quantitative part was reflectedin the percentage statistics obtained.This research grew out of the pre-professional training of two Marketing students, Emilia Benalcazar and Jenny Sanchez. The project yielded a new alternative to quench the thirst: chicha de jora (maize chicha and morada, both ancestral products from Chimborazo province
Three new students selected for the ATLAS PhD Grant Scheme
Antonella Del Rosso
2016-01-01
Initiated in 2013, the ATLAS PhD Grant Scheme aims to enable young, talented and motivated students to work on part of their PhD thesis at CERN. The collaboration has just selected the three students who will start their theses in 2016. The three students who received the ATLAS grant, which will cover part of their PhD studies. From left to right: Ruth Jacobs (Germany), Artem Basalaev (Russia), Nedaa B I Asbah (Palestine). The ATLAS PhD Grant Scheme was made possible thanks to a large donation by former ATLAS spokespersons Fabiola Gianotti and Peter Jenni, who started the fund with money from the Fundamental Physics Prize they received in 2013. Applications are handled by CERN HR, via this link. The aim of the initiative is to offer a unique educational opportunity to students within the ATLAS collaboration and to give them the possibility to continue their career in particle physics. Selected candidates receive a stipend allowing them to spend one year at CERN, followed by one year at their h...
ATLAS honours one of its suppliers
2003-01-01
On 12 February the Netherlands firm Schelde Exotech was awarded a prize for best ATLAS supplier for the construction of the two vacuum chambers for the ATLAS endcap toroid magnets. The award for best supplier is handed over to representatives of the firm Schelde Exotech in front of one of the two vacuum chambers built by the firm. From left to right: E. Baynham (RAL), H. Geerink (NIKHEF), Y. Lefevere (NIKHEF), J. Engelen (NIKHEF), P. Jenni (CERN), E. Holtom (RAL), R. Boddaert (Schelde Exotech), G. Luijckx (NIKHEF), H. Klumpus (Schelde Exotech), M. Nessi (CERN), H. ten Kate (CERN), M. Nordberg (CERN), H. Hoffmann (CERN).This ceremony has now become something of a tradition. For the third consecutive year, ATLAS has given best supplier awards for the most exceptional contributors to the construction of the future detector. The Netherlands firm Schelde Exotech has just received the award for the construction of the two vacuum chambers for the ATLAS endcap toroid magnets. With a diameter of 11 metres and a volum...
Croquet club
2016-01-01
The CERN Croquet season started Saturday 7 May with the annual opening tournament. A total of 14 very happy players in the spring sunshine. It was a lovely day in all senses - friendly competition, a lot of laughter and catching up with one another. Players are divided into PROs (low-handicap) and AMs (high-handicap), all matches are played as doubles. The pairings are changed during the day and the individual points go towards determining the winner. Congratulations to Ian Sexton for winning the Pros and Beryl Allardyce who won the Ams. Many of the games were very close and Ian seemed to have some good challenges in his block! Overall results: Pros: 1st - Ian 2nd - Brian 3rd - Angelina 4th - Jean Ams: 1st - Beryl 2nd - Frank 3rd - Peter (+Margaret) 4th - Roberta (+Jenny) Special thanks to the manager Danny Davids for making this tournament such a smooth and well run affair. CERN croquet club holds...
Croquet club
2016-01-01
The CERN Croquet season started Saturday 7 May with the annual opening tournament. A total of 14 very happy players in the spring sunshine. It was a lovely day in all senses - friendly competition, a lot of laughter and catching up with one another. Players are divided into PROs (low-handicap) and AMs (high-handicap), all matches are played as doubles. The pairings are changed during the day and the individual points go towards determining the winner. Congratulations to Ian Sexton for winning the Pros and Beryl Allardyce who won the Ams. Many of the games were very close and Ian seemed to have some good challenges in his block! Overall results: Pros: 1st - Ian 2nd - Brian 3rd - Angelina 4th - Jean Ams: 1st - Beryl 2nd - Frank 3rd - Peter (+Margaret) 4th - Roberta (+Jenny) Special thanks to the manager Danny Davids for making this tournament such a smooth and well run affair. CERN croquet club hold...
Staff Members with more than 25 years service at CERN in 2000
2000-01-01
Allegrini Roberto SL Arimatea Claudio SL Baudic Yves SPL Becquet Christian SL Bergamaschi Angelo ST Bourquin Pierre EST Brand Jean-Paul ST Bresciani Pietro EST Brocard Robert EP Cameron Willie EST Carminati Daniel PS Chasseloup De Laubat Jacques ST Chouvelon Alain TIS Cittolin Sergio EP Cochet Evelyne ST Coly Patrick LHC David Eric EP De Jonge Luit Koert SL Delattre André LHC Detraz Claude Charles EP Dreesen Peter PS Dydak Friedrich EP Favini Pierre EST Ferioli Gianfranco SL Fiebiger Heinz PS Fontbonne Andrée HR Fournel Jacques EST Fournier Gérard AS Fromm Daniel EP Gagliardi Fabrizio IT Gaidon Michèle ST Galbraith Peter LHC Gavaggio Richard LHC Genand Roger SL Gendre Francis PS Geoffroy Michel ST Geretschlager Ingrid ETT Grabit Robert EP Grill Manfred ST Heinze Wolfgang PS Hoh Roger PS Hudry Jean SL Jenny Bernard EST Koutchouk Jean-Pierre SL Laffin Michel SL Laurent Jean-Michel LHC Le Gras Marc PS Legrand Patrick LHC Lerho Jean-Marie ST Lewis Ray ETT Liptow Ulr...
Energy Technology Data Exchange (ETDEWEB)
None
2003-06-27
This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's approach to collect the data necessary to evaluate corrective action alternatives (CAAs) appropriate for the closure of Corrective Action Unit (CAU) 536: Area 3 Release Site, Nevada Test Site, Nevada, under the Federal Facility Agreement and Consent Order. Corrective Action Unit 536 consists of a single Corrective Action Site (CAS): 03-44-02, Steam Jenny Discharge. The CAU 536 site is being investigated because existing information on the nature and extent of possible contamination is insufficient to evaluate and recommend corrective action alternatives for CAS 03-44-02. The additional information will be obtained by conducting a corrective action investigation (CAI) prior to evaluating CAAs and selecting the appropriate corrective action for this CAS. The results of this field investigation are to be used to support a defensible evaluation of corrective action alternatives in the corrective action decision document. Record of Technical Change No. 1 is dated 3-2004.
THE ROLE OF DYNAMIC SYSTEMS IN MOTOR DEVELOPMENT RESEARCH. JUST A METAPHOR OR A NOTABLE REALITY?
Directory of Open Access Journals (Sweden)
Ivan Šerbetar
2015-01-01
Full Text Available In the present article an application of a new theory of motor control in the context of motor development theories and research has been discussed. In a brief overview of traditional theories of motor development a neuro-maturational theory is mentioned along with the two prominent proponents - McGraw & Gesell. Bernstein’s fundamental insights in motor control were emphasized, such as the concepts of degrees of freedom and synergies, along with his contribution to the measurement technology and quantification. Basic principles of dynamic systems theory and common concepts such as self-organization, patterns, attractors or non-equilibrium systems are briefly described. In the main part, an example of research in motor development carried out in dynamical perspective was introduced. The chosen example was the body of the research performed by Thelen et al. (1982, 1984, 1990 on a newborn’s stepping. The distinction between the maturational perspective in which all the sequences of motor development are the result of maturation of nervous system, and the dynamic perspective in which development is seen as a mutual interaction between a number of body systems, including neural and muscular systems, which continuously affect the movement although none of them dominate (Kamm et al., 1990 has been made.
Systematic coarse-graining in nucleation theory
Schweizer, M.; Sagis, L. M. C.
2015-08-01
In this work, we show that the standard method to obtain nucleation rate-predictions with the aid of atomistic Monte Carlo simulations leads to nucleation rate predictions that deviate 3 - 5 orders of magnitude from the recent brute-force molecular dynamics simulations [Diemand et al., J. Chem. Phys. 139, 074309 (2013)] conducted in the experimental accessible supersaturation regime for Lennard-Jones argon. We argue that this is due to the truncated state space the literature mostly relies on, where the number of atoms in a nucleus is considered the only relevant order parameter. We here formulate the nonequilibrium statistical mechanics of nucleation in an extended state space, where the internal energy and momentum of the nuclei are additionally incorporated. We show that the extended model explains the lack in agreement between the molecular dynamics simulations by Diemand et al. and the truncated state space. We demonstrate additional benefits of using the extended state space; in particular, the definition of a nucleus temperature arises very naturally and can be shown without further approximation to obey the fluctuation law of McGraw and LaViolette. In addition, we illustrate that our theory conveniently allows to extend existing theories to richer sets of order parameters.
McDonaldsi juht : iga klient tahab sooja sööki ... ja kiiresti! / Jenny Wiggins ; tõlk. Erik Aru
Wiggins, Jenny
2007-01-01
Kiirtoiduketi tegevjuht Jim Skinner räägib iseendast, karjäärist McDonaldþsis, firma tegevusest ja edust, personalipoliitikast, juhiomadustest. Lisad: Distsipliin hakkas külge mereväes ; Arvud (McDonalds käive ja kasum 2004-2006)
Correlation and Fishers’ Perception in Selected Sites in Laguna de Bay, Luzon Island, Philippines
Directory of Open Access Journals (Sweden)
Arthur J. Lagbas
2017-01-01
Full Text Available White goby (Glossogobius giuris Hamilton 1822 is an omnivorous, native fish species which can be found in Laguna de Bay and its tributaries, and in other bodies of water in the Philippines. Deteriorating water quality, unsustainable fishing practices, aquaculture and predation by introduced invasive species are threatening the population of white goby and other native fish species in Laguna de Bay. This study was conducted to correlate select physico-chemical parameters of lake water and zooplankton abundance, and to assess white goby population based on fishers’ perception. Water samples were collected in three sites in June, September and December 2014. Twenty one zooplankton species belonging to 12 families were identified. The most abundant and frequently encountered zooplankton species is Eurytemora affinis Poppe 1880. Zooplanktons were most abundant in June and lowest in September. Key informant interviews with local fishers revealed that white goby population was abundant in April to August while catch report showed that fish catch is abundant in June and least during December. The fish abundance in April to June could be attributed to high productivity especially in summer season. The fishers perceived that the population of white goby was declining mainly due to water pollution, aquaculture, and predation by invasive alien species. A multi-stakeholder sustainable watershed management should be adapted to improve the water quality and extinction of native fish species in Laguna de Bay.
Points-Based Safe Path Planning of Continuum Robots
Directory of Open Access Journals (Sweden)
Khuram Shahzad
2015-07-01
Full Text Available Continuum robots exhibit great potential in a number of challenging applications where traditional rigid link robots pose certain limitations, e.g., working in unstructured environments. In order to enable the usage of continuum robots in safety-critical applications, such as surgery and nuclear decontamination, it is extremely important to ensure a safe path for the robot's movement. Existing algorithms for continuum robot path planning have certain limitations that need to be addressed. These include the fact that none of the algorithms provide safety assurance parameters and control for path planning. They are computationally expensive, applicable to a specific type of continuum robots, and mostly they do not incorporate design and kinematics constraints. In this paper, we propose a points-based path planning (PoPP algorithm for continuum robots that computes the path by imposing safety constraints and improves upon the limitations of existing approaches. In the algorithm, we exploit the constant curvature-bending property of continuum robots in their path planning process. The algorithm is computationally efficient and provides a good tradeoff between accuracy and efficiency that can be implemented to enable the safety-critical application of continuum robots. This algorithm also provides information regarding path volume and flexibility in movement. Simulation results confirm that the algorithm possesses promising potential for all types of continuum robots (following the constant curvature-bending property. We believe that this effectively balances the desired safety and efficiency requirements.
Cross, Robert W; Fenton, Karla A; Geisbert, Joan B; Ebihara, Hideki; Mire, Chad E; Geisbert, Thomas W
2015-10-01
Phylogenetic comparisons of known Marburg virus (MARV) strains reveal 2 distinct genetic lineages: Ravn and the Lake Victoria Marburg complex (eg, Musoke, Popp, and Angola strains). Nucleotide variances of >20% between Ravn and other MARV genomes suggest that differing virulence between lineages may accompany this genetic divergence. To date, there exists limited systematic experimental evidence of pathogenic differences between MARV strains. Uniformly lethal outbred guinea pig models of MARV-Angola (MARV-Ang) and MARV-Ravn (MARV-Rav) were developed by serial adaptation. Changes in genomic sequence, weight, temperature, histopathologic findings, immunohistochemical findings, hematologic profiles, circulating biochemical enzyme levels, coagulation parameters, viremia levels, cytokine levels, eicanosoid levels, and nitric oxide production were compared between strains. MARV-Rav infection resulted in delayed increases in circulating inflammatory and prothrombotic elements, notably lower viremia levels, less severe histologic alterations, and a delay in mean time to death, compared with MARV-Ang infection. Both strains produced more marked coagulation abnormalities than previously seen in MARV-infected mice or inbred guinea pigs. Although both strains exhibit great similarity to pathogenic markers of human and nonhuman primate MARV infection, these data highlight several key differences in pathogenicity that may serve to guide the choice of strain and model used for development of vaccines or therapeutics for Marburg hemorrhagic fever. Published by Oxford University Press on behalf of the Infectious Diseases Society of America 2015. This work is written by (a) US Government employee(s) and is in the public domain in the US.
Directory of Open Access Journals (Sweden)
Gérard Selbach
2009-10-01
Full Text Available ForewordThe Mission Cultural Center for Latino Arts (MCCLA is located at 2868 Mission Street in San Francisco, in a district mainly inhabited by Hispanics and well-known for its numerous murals. The Center was founded in 1977 by artists and community activists who shared “the vision to promote, preserve and develop the Latino cultural arts that reflect the living tradition and experiences of Chicano, Central and South American, and Caribbean people.”August 2001 was as busy at the Center as a...
Pustular psoriasis of pregnancy: current perspectives
Directory of Open Access Journals (Sweden)
Trivedi MK
2018-02-01
Full Text Available Megha K Trivedi,1,2 Alexandra R Vaughn,3 Jenny E Murase1,4 1Department of Dermatology, University of California, San Francisco, CA, USA; 2Medical School, University of Michigan, Ann Arbor, MI, USA; 3College of Medicine, Drexel University, Philadelphia, PA, USA; 4Department of Dermatology, Palo Alto Medical Foundation, Palo Alto, CA, USA Abstract: Pustular psoriasis of pregnancy (PPP is a life-threatening condition for both the pregnant mother and fetus, and must be efficiently and accurately diagnosed and treated. This condition has historically been classified as a unique, separate dermatosis of pregnancy. However, current opinion and data suggest that it may be a variant of generalized pustular psoriasis. PPP typically occurs in the third trimester and is characterized by widespread coalescent pustules, desquamation, and systemic symptoms. Clinical features and histopathologic evaluation aid in diagnosis. Treatments during pregnancy include high-dose corticosteroids, cyclosporine, narrow-band ultraviolet B radiation, infliximab, granulocyte and monocyte adsorptive apheresis, and systemic antibiotics. Both the mother and fetus should be closely monitored with appropriate laboratory studies for the duration of the pregnancy and postpartum. Keywords: pustular psoriasis of pregnancy, impetigo herpetiformis, generalized pustular psoriasis, dermatoses of pregnancy
Directory of Open Access Journals (Sweden)
Jonna Nykky
2010-06-01
Full Text Available Jonna Nykky, Jenni E Tuusa, Sanna Kirjavainen, Matti Vuento, Leona GilbertNanoscience Center and Department of Biological and Environmental Science, University of Jyväskylä, FinlandAbstract: Viruses have great potential as nanotools in medicine for gene transfer, targeted gene delivery, and oncolytic cancer virotherapy. Here we have studied cell death mechanisms of canine parvovirus (CPV to increase the knowledge on the CPV life cycle in order to facilitate the development of better parvovirus vectors. Morphological studies of CPV-infected Norden laboratory feline kidney (NLFK cells and canine fibroma cells (A72 displayed characteristic apoptotic events. Apoptosis was further confirmed by activation of caspases and cellular DNA damage. However, results from annexin V-propidium iodide (PI labeling and membrane polarization assays indicated disruption of the plasma membrane uncommon to apoptosis. These results provide evidence that secondary necrosis followed apoptosis. In addition, two human cancer cell lines were found to be infected by CPV. This necrotic event over apoptotic cell death and infection in human cells provide insightful information when developing CPV as a nanotool for cancer treatments.Keywords: canine parvovirus, apoptosis, necrosis, nanoparticle, virotherapy
An efficient particle Fokker–Planck algorithm for rarefied gas flows
Energy Technology Data Exchange (ETDEWEB)
Gorji, M. Hossein; Jenny, Patrick
2014-04-01
This paper is devoted to the algorithmic improvement and careful analysis of the Fokker–Planck kinetic model derived by Jenny et al. [1] and Gorji et al. [2]. The motivation behind the Fokker–Planck based particle methods is to gain efficiency in low Knudsen rarefied gas flow simulations, where conventional direct simulation Monte Carlo (DSMC) becomes expensive. This can be achieved due to the fact that the resulting model equations are continuous stochastic differential equations in velocity space. Accordingly, the computational particles evolve along independent stochastic paths and thus no collision needs to be calculated. Therefore the computational cost of the solution algorithm becomes independent of the Knudsen number. In the present study, different computational improvements were persuaded in order to augment the method, including an accurate time integration scheme, local time stepping and noise reduction. For assessment of the performance, gas flow around a cylinder and lid driven cavity flow were studied. Convergence rates, accuracy and computational costs were compared with respect to DSMC for a range of Knudsen numbers (from hydrodynamic regime up to above one). In all the considered cases, the model together with the proposed scheme give rise to very efficient yet accurate solution algorithms.
International Nuclear Information System (INIS)
Frisone, Fulvio
2006-01-01
In this work we wish to demonstrate that a reaction path as the following dislocations, deformations due to thermodynamic stress and, finally, microcrack occurrence, can enhance the process of fusion of the deuterons introduced into the lattice by deuterium loading (F. Frisone, Can variations in temperature influence deuteron interaction within crystalline lattices?, Nuovo Cimento D, 18, 1279 (1996)). In fact, calculating the rate of deuteron-plasmon-deuteron fusion within a microcrack, showed, together with an enhancement of the tunneling effect, an increase of at least 2 - 3 orders of magnitude compared to the probability of fusion on the no deformed lattice. In fact, strong electric fields can take place in the microcrack and the deuterons are accelerated to the energy which is enough for the D-D tunnelling (M. Rabinowitz, High temperature superconductivity and cold fusion, Mod. Phys, Lett. B, 4, 233 (1990); J. Price Hirt and J. Lothe, Theory of Dislocation (McGraw Hill); Z. Phys., 457, 156 (1960)). These phenomena open the way to the theoretical hypothesis that a kind of chain reaction, catalyzed by the microcracks produced in the structure as a result of deuterium loading, can favour tho process of deuteron-plasmon fusion (N. W. Ashcroft and N. D. Mermin (Eds.), Solid State Physics, Chapter 25 (Saunders College, Philadelphia, 1972, pp. 492-509)
McDonald, Siobhan
2016-04-01
My name is Siobhan McDonald. I am a visual artist living and working in Dublin. My studio is based in The School of Science at University College Dublin where I was Artist in Residence 2013-2015. A fascination with time and the changeable nature of landmass has led to ongoing conversations with scientists and research institutions across the interweaving disciplines of botany, biology and geology. I am developing a body of work following a recent research trip to the North Pole where I studied the disappearing landscape of the Arctic. Prompted by my experience of the Arctic shelf receding, this new work addresses issues of the instability of the earth's materiality. The work is grounded in an investigation of material processes, exploring the dynamic forces that transform matter and energy. This project combines art and science in a fascinating exploration of one of the Earth's last relatively untouched wilderness areas - the High Arctic to bring audiences on journeys to both real and artistically re-imagined Arctic spaces. CRYSTALLINE'S pivotal process is collaboration: with The European Space Agency; curator Helen Carey; palaeontologist Prof. Jenny McElwain, UCD; and with composer Irene Buckley. CRYSTALLINE explores our desire to make corporeal contact with geological phenomena in Polar Regions. From January 2016, in my collaboration with Jenny McElwain, I will focus on the study of plants and atmospheres from the Arctic regions as far back as 400 million years ago, to explore the essential 'nature' that, invisible to the eye, acts as imaginary portholes into other times. This work will be informed by my arctic tracings of sounds and images recorded in the glaciers of this disappearing frozen landscape. In doing so, the urgencies around the tipping of natural balances in this fragile region will be revealed. The final work will emerge from my forthcoming residency at the ESA in spring 2016. Here I will conduct a series of workshops in ESA Madrid to work with
Maximilien Brice
2012-01-01
Murray Gell-Mann, well known for proposing the quark model and as a recipient of the Nobel Prize in Physics in 1969, came to CERN on 23 January. During his visit he gave a theoretical physics seminar on decoherent histories in quantum mechanics.
CARLOS FRADIQUE MENDES: PRESENÇA NA CONTEMPORANEIDADE
Directory of Open Access Journals (Sweden)
Inês Cardin Bressan
2014-12-01
Full Text Available A Correspondência de Fradique Mendes (1900 apresenta uma variedade temática expressiva e, deste modo, desperta uma multiplicidade de temas. Assim, este artigo busca apresentar uma análise intertextual comparativa entre as obras A Correspondência de Fradique, de Eça de Queiroz (1900 e a Autobiografia de Carlos Fradique Mendes (2002, de José Pedro Fernandes. Um levantamento preliminar demonstra que há pouca fortuna crítica referente à terceira fase de Eça, mais especificamente à obra supracitada. Há que se considerar também que a obra de José Pedro Fernandes tem a intertextualidade comparativa como foco principal, e a busca destes intertextos justificam e motivam uma pesquisa neste sentido. De caráter bibliográfico, e fundamentado em Bakhtin, Jenny e Genette, este estudo abrirá espaço para alguns debates, enriquecerá o percurso dos atuais pesquisadores, servindo-lhes de motivação para novos caminhos, e também colaborará para o conhecimento do universo da personagem Fradique Mendes, cuja complexidade de criação ainda desperta nos autores contemporâneos a disposição para sua recriação.
D'Alessandro, A G; Vizzarri, F; Palazzo, M; Martemucci, G
2017-09-01
Various uses of donkeys' milk have been recently proposed for human consumption on the basis of its nutritional characteristics. Improvements in milk fatty acid profile and animal oxidative status can be induced through dietary supplementation of phenolic compounds. The study aimed to evaluate in donkeys the effects of dietary supplementation with verbascoside (VB) on: (i) the fatty acid profile and vitamins A and E contents of milk during a whole lactation, and (ii) blood biochemical parameters and markers of oxidative status of the animals. At foaling, 12 lactating jennies were subdivided into two groups (n 6): control, without VB supplement; VB, receiving a lipid-encapsulated VB supplement. Gross composition, fatty acid profile and vitamins A and E contents in milk were assessed monthly over the 6 months of lactation. Serum total cholesterol, high-density lipoproteins cholesterol and low-density lipoproteins cholesterol, tryglicerides, non-esterified fatty acid, bilirubin, alanine aminotransferase (ALT), aspartate aminotransferase, reactive oxygen metabolites, thiobarbituric acid reactive substances (TBARs), vitamin A and vitamin E were evaluated at 8 days after foaling (D0) and then at D90, D105 and D120 of lactation. In milk, the VB supplementation decreased the saturated fatty acids (Pdonkey's milk with a benefit on the oxidative status and serum lipidic profile of the animals.
'And next, just for your enjoyment!': sex, technology and the constitution of desire.
Dowsett, Gary W
2015-01-01
In the 1976 sci-fi film Logan's Run, actor Michael York, relaxing in a fetching caftan after a day hunting 'Runners', logs-in to the 'Circuit', a de- and re-materialisation technology that allows those seeking sex to select partners. Logan's first candidate, a young man, is passed over with a smile. The second is co-star Jenny Agutter; she is accepted and we join a sexual ride in the future. Online dating sites such as Gaydar® and RSVP® would seem to have a long way to go to achieve that, and Microsoft™ needs some fast apps development to get us there. Against this background, this paper examines some starting points in our fascination with technosex, long before the Internet, in books and magazines, the creative arts and other media and cultural forms. It focuses upon gay men's contribution to this fascination, and looks at the queering of heterosexuality and the part technology has played in that process. Online technologies are examined, particularly in relation to the 'publicisation' of sexual life and to shifts in sexual identity and practice related to changing processes of sexual objectification, self-objectification and subjectification. Finally, the transformation of sex into health and healthy sex is discussed.
Substance use disorders in military veterans: prevalence and treatment challenges
Directory of Open Access Journals (Sweden)
Teeters JB
2017-08-01
Full Text Available Jenni B Teeters,1,2 Cynthia L Lancaster,1,2 Delisa G Brown,3 Sudie E Back1,2 1Department of Psychiatry and Behavioral Sciences, Medical University of South Carolina, Charleston, SC, USA; 2Ralph H Johnson Veterans Affairs (VA Medical Center, Charleston, SC, USA, 3Department of Human Development and Psychoeducation, Howard University, Washington, DC, USA Abstract: Substance use disorders (SUDs are a significant problem among our nation’s military veterans. In the following overview, we provide information on the prevalence of SUDs among military veterans, clinical characteristics of SUDs, options for screening and evidence-based treatment, as well as relevant treatment challenges. Among psychotherapeutic approaches, behavioral interventions for the management of SUDs typically involve short-term, cognitive-behavioral therapy interventions. These interventions focus on the identification and modification of maladaptive thoughts and behaviors associated with increased craving, use, or relapse to substances. Additionally, client-centered motivational interviewing approaches focus on increasing motivation to engage in treatment and reduce substance use. A variety of pharmacotherapies have received some support in the management of SUDs, primarily to help with the reduction of craving or withdrawal symptoms. Currently approved medications as well as treatment challenges are discussed. Keywords: addiction, alcohol use disorders, drug use disorders, treatment, pharmacotherapy, psychotherapy
«Eit givande, men krevjande lagspel for å betre tenestene». Brukarerfaringar frå samarbeidsforsking
Directory of Open Access Journals (Sweden)
Anne-Grethe Halding
2016-06-01
Full Text Available “A precious, but challenging teamwork for improved healthcare”. Service users´ experiences from participatory research In spite of identifying the importance of service user (SU involvement in healthcare research, few studies define specific activities. Although an effective infrastructure is acknowledged as key to enable SU’s equal contribution, we, in Norway, recognize a lack of their involvement in studies on Chronic Obstructive Pulmonary Disease (COPD. Consequently, a preliminary project was designed to implement a research-training programme for co-researchers and seek their collaboration in a participatory research study on COPD. This paper reports the co-researchers’ experiences using a focus group interview. Through content analysis, we describe coresearchers’ experiences, which recognize the importance and challenges of participatory research.These experiences demonstrate how acknowledgement, a fruitful climate for collaboration, new insight and practical arrangements promote involvement, whilst too extensive training and vague expectations may hinder involvement. Empowering equality of relationships and involvement, particularly for co-researchers with failing health and no former research training, demands thorough planning and organizing. Samarbeidspartnarar: brukarar Nina Maria Dolmen, Aud Jenny Jensen, Sissel Stavøstrand og Steinar Valvik, spesialsjukepleiar Grete Berg Grimelid, Helse Førde, ergoterapeut Evy Aarsheim, Flora kommune, og sosionom og PhD stipendiat Tone Larsen, Helse Førde
A sustainable life-cycle method
Directory of Open Access Journals (Sweden)
Diruji Dugarte
2015-07-01
Full Text Available The need for innovative and cost effective approaches for infrastructure maintenance has never been more crucial. In fact, this has been a popular topic in technical reports like the McGraw Hill Construction, the Dutch Cobouw construction magazine and the new multidisciplinary journal “Infrastructure Asset Management” by the Institution of Civil Engineers. The financial status of Industrial Parks (IP and Business Parks (BP in the Netherlands, as well as in the rest of the world, has been greatly influenced by the 2007-2008 financial crisis. As a consequence, several IPs and BPs have suffered from infrastructural deterioration that needs to be revitalized. Therefore, one of the priorities facing municipalities nowadays is stimulating companies to invest and redefine such areas with the goal of improving its economic output and optimize the expenditure on its maintenance costs. The different stakeholders involved in the life-cycle management of these parks make strategic decisions based on data that has been gathered over time by its users, either private or public. However, gathering data is becoming more and more complex with time. Infrastructures in these parks are increasingly demanding custom supply of services by the private industry to cope with their technical operations. As a consequence, the level of detail of the assets information is very high. Hence, the digital collaboration and interoperability has become almost mandatory for enabling proper management in construction areas. Interoperability can be described as the ability of making systems and organization work together.
Popp, Birgit
2009-01-01
Gerd Heuschmanni poolt väljaantud raamatust Finger in der Wunde ja selle ingliskeelsest tõlkest Tug of War : Classical versus "Modern" Dressage ning kakskeelsest filmist Stimmen der Pferde = If Horses Could Speak. Kõigis neis teostes käsiteltaksehobuse pingevaba kehahoiaku kujundamise ja hobusõbraliku koolituse vajalikkust ning ratsahobustele vigastuste ning kannatuste põhjustamist hobuse anatoomia vähese tundmise ja juba väljakujunenud treeningmeetodite järgimise tulemusel kasutatavast valest ratsutamistiilist
Production and use of light olefins. Preprints of the conference
Energy Technology Data Exchange (ETDEWEB)
Ernst, S.; Buzzoni, R.; Leitner, W.; Lercher, J.A.; Lichtscheidl, J.; Nees, F.; Santacesaria, E. (eds.)
2009-07-01
Within the conference of the German Society for Petroleum and Coal Science and Technology e.V. (Hamburg, Federal Republic of Germany) in Berlin (Federal Republic of Germany) at 28th to 30th September, 2009, the following lectures were held: (1) Steamcracking - State of the Art (H. Zimmermann); (2) Diversify Feedstock Options to Olefin Production (Q. Ling et al.); (3) Syngas to lower olefins (E. Schwab et al.); (4) STAR process registered for the on-purpose production of propylene (K. Bueker); (5) The catalytic activity of zinc oxide supported on aerosil for C-H activation of light alkanes (S. Arndt et al.); (6) Novel catalytic approaches for the oxidative dehydrogenation of ethane (D. Hartmann); (7) A comparison of the active sites structures of homogeneous and heterogeneous olefin polymerisation catalysts (A. Zecchina); (8) Catalytic strategies in metathesis (C. Coperet); (9) Multi-technology integrated production and consumption of olefins (J. Popp et al.); (10) Olefin oligomerization for the production of fuels and petrochemicals (H. Olivier-Bourbigou et al.); (11) Dieselization of the world - How to increase diesel yield in a refinery (A. Dueker); (12) Isomerization of butenes: LyondellBasell's Isomplus technology development (T. Zak et al.); (13) Valuable products from butadiene, carbon dioxide and further base chemicals (A. Behr); (14) The partial oxidation of propene to propylene oxide using N{sub 2}O as an oxidant (T. Thoemmes); (15) Alternative feedstocks for olefin production: What role will ethanol play? (B.R. Maughon); (16) Production of light olefins from renewable resources - The effect of deoxygenation degree on yields of light olefins (D. Kubicka et al.); (17) Recovery of low olefins from refinery offgases (M. Bender).
Charging Customers or Making Profit? Business Model Change in the Software Industry
Directory of Open Access Journals (Sweden)
Margit Malmmose Peyton
2014-08-01
Full Text Available Purpose: Advancements in technology, changing customer demands or new market entrants are often seen as a necessary condition to trigger the creation of new Business Models, or disruptive change in existing ones. Yet, the sufficient condition is often determined by pricing and how customers are willing to pay for the technology (Chesbrough and Rosenbloom, 2002. As a consequence, much research on Business Models has focused on innovation and technology management (Rajala et al., 2012; Zott et al., 2011, and software-specific frameworks for Business Models have emerged (Popp, 2011; Rajala et al., 2003; Rajala et al., 2004; Stahl, 2004. This paper attempts to illustrate Business Model change in the software industry. Design: Drawing on Rajala et al. (2003, this case study explores the (1 antecedents and (2 consequences of a Business Model-change in a logistics software company. The company decided to abolish their profitable fee-based licensing for an internet-based version of its core product and to offer it as freeware including unlimited service. Findings: Firstly, we illustrate how external developments in technology and customer demands (pricing, as well as the desire for a sustainable Business Model, have led to this drastic change. Secondly, we initially find that much of the company’s new Business Model is congruent with the company-focused framework of Rajala et al. (2003 [product strategy; distribution model, services and implementation; revenue logic]. Value: The existing frameworks for Business Models in the software industry cannot fully explain the disruptive change in the Business Model. Therefore, we suggest extending the framework by the element of ‘innovation’.
Directory of Open Access Journals (Sweden)
Inês Cardoso Martins Moreira
2011-04-01
ém de assumirem as funções actanciais características das histórias policiais, há outro desdobramento de papeis que se dá por meio de disfarces: Samuel surge, na primeira cena do ato 2, “vestido como um policial” para, em seguida, revelar ser ele o assassino, mesmo estando, nesse momento, diante de Jenny, a assassina confessa. O policial, que supostamente deveria exercer função investigativa, apresenta-se como uma figura ameaçadora a ponto de inspirar a imediata confissão por parte de Jenny de crimes que ela nem mesmo sabe se cometeu. A revelação de Samuel, vestido de policial, de que ele é o assassino, propõe uma inversão ou uma confusão de funções: o policial é o assassino, e não aquele que irá descobrir o assassino. O que ironicamente, no entanto, facilita extraordinariamente o trabalho do policial, pois sua função já estaria cumprida de saída. Quem ele busca é ele mesmo, nesse caso. O mesmo Samuel introduziria outra camuflagem no início do ato 3, surgindo agora como um apache, novo disfarce com o qual pretendia cometer mais alguns assassinatos. Os personagens já mortos, no entanto, ressurgem nesse momento, como vozes em off, acusando não a ele, mas a Jenny de ser a assassina. E ela, que seria a provável vítima de Samuel, identifica-se com o papel de assassina e o assume, disposta a matá-lo, o que acaba fazendo sem querer, para, em seguida, matar-se, já que não teria sentido “viver sozinha sem ninguém para matar.” No âmbito do jogo de assassinato estabelecido pelos personagens, Jenny e Samuel apresentam facetas variadas conforme vão assumindo diferentes papéis. Samuel é um policial, mas também um assassino, e depois um apache, que é também assassino, e, ao final, acumularia as funções de vítima e detetive (já que, assassinado por Jenny, ainda tem tempo de verificar e lamentar o fato de ser ela afinal a assassina e não ele. Jenny passa de vítima potencial a assassina confessa, e novamente a vítima potencial
Reminiscence of CFD simulation; CFD simulation no omoide
Energy Technology Data Exchange (ETDEWEB)
Shimamoto, Y. [University of Shiga Prefecture, Shiga (Japan)
1998-12-01
Upon graduation from university, the author began studying internal combustion engines, and has been engaged in the numerical analysis of gas flows for 45 years. His graduation study involved the measurement of velocity distribution at the turbine nozzle outlet in the subsonic domain. When he was in the internal engine laboratory of the graduate school, Mentor Fujio Nagao presented him with an essay of E. Jenny on the characteristic curve method, that is, a writing on the numerical analysis of gas flows in the exhaust system of a pulse operation engine. From that time onward, he has been involved with numerical simulation in this field. Some seniors of his gave him various advice about his way too much inclined toward numerical calculation. But the author believes that, as far as one is interested in numerical analysis and does not refrain from touching things, new discoveries related to engineering will occur at the same probability, whether one is absorbed in experiment or in simulation. In the study of simulation, although the engineers concerned are supposed to make propositions on practical programs for prediction that may be applicable to various fields well as to seek for new schemes, it is desired that cooperative studies between industries and universities will become real that are open to the public. (NEDO)
Directory of Open Access Journals (Sweden)
Grignon JS
2014-05-01
Full Text Available Jessica S Grignon,1,2 Jenny H Ledikwe,1,2 Ditsapelo Makati,2 Robert Nyangah,2 Baraedi W Sento,2 Bazghina-werq Semo1,2 1Department of Global Health, University of Washington, Seattle, WA, USA; 2International Training and Education Center for Health, Gaborone, Botswana Abstract: To address health systems challenges in limited-resource settings, global health initiatives, particularly the President's Emergency Plan for AIDS Relief, have seconded health workers to the public sector. Implementation considerations for secondment as a health workforce development strategy are not well documented. The purpose of this article is to present outcomes, best practices, and lessons learned from a President's Emergency Plan for AIDS Relief-funded secondment program in Botswana. Outcomes are documented across four World Health Organization health systems' building blocks. Best practices include documentation of joint stakeholder expectations, collaborative recruitment, and early identification of counterparts. Lessons learned include inadequate ownership, a two-tier employment system, and ill-defined position duration. These findings can inform program and policy development to maximize the benefit of health workforce secondment. Secondment requires substantial investment, and emphasis should be placed on high-level technical positions responsible for building systems, developing health workers, and strengthening government to translate policy into programs. Keywords: human resources, health policy, health worker, HIV/AIDS, PEPFAR
Investigaciones sobre la Fertilidad de los Suelos de Tres Regiones del Norte de Colombia
Directory of Open Access Journals (Sweden)
Rodríguez J. Manuel
1962-09-01
Full Text Available Se hizo el estudio sobre la fertilidad de los suelos de tres regiones en el norte de Colombia a saber: San Jorge, Bajo Cauca y Ayapel. Se tomaron muestras en los lugares que se consideraron más representativos, para hacer análisis químicos detallados yen, sayos de invernadero. Los ensayos de invernadero se hicieron siguiendo la técnica de Jenny con algunas variaciones que consistieran en lo siguiente: a adicionar dos tratamientos más, uno completo más elementos menores y otro completo más cal; b hacer dos siembras de lechuga en la misma maceta, agregando en la primera todos los elementos, pero en la segunda sólo N y K; c usar el sistema del análisis de variancia para comparar los resultados obtenidos. En los análisis químicos se encontró que los suelos de San Jorge son casi neutros (pH 6,7 mientras que los del Bajo Cauca y Ayapel son frecuentemente ácidos (pH 5.38 y 5.10 respectivamente. El contenido de materia orgánica está entre 1.70 y 2,67%, El P soluble extraído por el método de Olsen es bajo en los tres suelos estudiados, pero especialmente en los del Bajo Cauca y Ayapel (2,8 y 4,2 mg./ kg, respectivamente. Al analizar los resultados por el sistema de la variancia se encontró, para los suelos de San Jorge, que el N y el K disminuyen los rendimientos y que esta disminución es estadísticamente significativa para una de las siembras. Que la aplicación de elementos menores alimenta los rendimientos en las dos siembras y que en una de ellas es estadísticamente significativa. Para el suelo del Bajo Cauca, la aplicación de P o de elementos menores aumenta en las dos siembras los rendimientos y en una de ellas en forma estadísticamente significativa. En los suelos de Ayapel se encontró que la cal o los elementos menores alimentaron los rendimientos en las dos siembras y en una de ellas el aumento fue estadísticamente significativo. En general, se puede observar por el rendimiento del testigo de los tres suelos, que el
Jochum, Tobias; Popp, Juergen; Frosch, Torsten
2016-04-01
Soil and groundwater contamination with benzene can cause serious environmental damages. However, many soil microorganisms are capable to adapt and known to strongly control the fate of organic contamination. Cavity enhanced Raman gas spectroscopy (CERS) was applied to investigate the short-term response of indigenous soil bacteria to a sudden surface contamination with benzene regarding the temporal variations of gas products and their exchange rates with the adjacent atmosphere. 13C-labeled benzene was spiked on a silty-loamy soil column (sampled from Hainich National Park, Germany) in order to track and separate the changes in heterotrophic soil respiration - involving 12CO2 and O2 - from the microbial process of benzene degradation, which ultimately forms 13CO2.1 The respiratory quotient (RQ) of 0.98 decreased significantly after the spiking and increased again within 33 hours to a value of 0.72. This coincided with maximum 13CO2 concentration rates (0.63 μ mol m-2 s-1), indicating highest benzene degradation at 33 hours after the spiking event. The diffusion of benzene in the headspace and the biodegradation into 13CO2 were simultaneously monitored and 12 days after the benzene spiking no measurable degradation was detected anymore.1 The RQ finally returned to a value of 0.96 demonstrating the reestablished aerobic respiration. In summary, this study shows the potential of combining Raman gas spectroscopy and stable isotopes to follow soil microbial biodegradation dynamics while simultaneously monitoring the underlying respiration behavior. Support by the Collaborative Research Center 1076 Aqua Diva is kindly acknowledged. We thank Beate Michalzik for soil analysis and discussion. 1. T. Jochum, B. Michalzik, A. Bachmann, J. Popp and T. Frosch, Analyst, 2015, 140, 3143-3149.
Dust ablation on the giant planets: Consequences for stratospheric photochemistry
Moses, Julianne I.; Poppe, Andrew R.
2017-11-01
Ablation of interplanetary dust supplies oxygen to the upper atmospheres of Jupiter, Saturn, Uranus, and Neptune. Using recent dynamical model predictions for the dust influx rates to the giant planets (Poppe et al., 2016), we calculate the ablation profiles and investigate the subsequent coupled oxygen-hydrocarbon neutral photochemistry in the stratospheres of these planets. We find that dust grains from the Edgeworth-Kuiper Belt, Jupiter-family comets, and Oort-cloud comets supply an effective oxygen influx rate of 1.0-0.7+2.2 ×107 O atoms cm-2 s-1 to Jupiter, 7.4-5.1+16 ×104 cm-2 s-1 to Saturn, 8.9-6.1+19 ×104 cm-2 s-1 to Uranus, and 7.5-5.1+16 ×105 cm-2 s-1 to Neptune. The fate of the ablated oxygen depends in part on the molecular/atomic form of the initially delivered products, and on the altitude at which it was deposited. The dominant stratospheric products are CO, H2O, and CO2, which are relatively stable photochemically. Model-data comparisons suggest that interplanetary dust grains deliver an important component of the external oxygen to Jupiter and Uranus but fall far short of the amount needed to explain the CO abundance currently seen in the middle stratospheres of Saturn and Neptune. Our results are consistent with the theory that all of the giant planets have experienced large cometary impacts within the last few hundred years. Our results also suggest that the low background H2O abundance in Jupiter's stratosphere is indicative of effective conversion of meteoric oxygen to CO during or immediately after the ablation process - photochemistry alone cannot efficiently convert the H2O into CO on the giant planets.
International Nuclear Information System (INIS)
Haase, E.L.; Ruzicka, J.
1992-03-01
After the successful basic solution of the Nb 3 Ge and Nb 3 Si problems, optimization strategies and quality criteria were developed for high Tc superconducting (HTCS) samples in analogy. After improvements of the sputtering system, the preparation parameters were tightly controlled, leading to samples with a reproducible linear slope of the specific resistance ρ(T). Further improvements by us and Poppe et al. lead to the preparation of 123 films with non-linear ρ(T) curves above 120K. A generalization to a T 2 behavior of ρ(T) leads to the further generalization that defect free HTCS are essentially two dimensional in nature, with all ensuing consequences. The momentum transport of the moving charge cariers requires, because of momentum conservation, a mechanism to transfer momentum to the lattice (momentum relaxation). The qualitative theory developed for two dimensional (2D) systems shows that the electron-phonon interaction is strongly suppressed and hence that the weaker electron-electron interaction dominates. That theory makes numerous predictions, which so far are confirmed by experiments. In particular, it accounts for the extreme temperature dependence of the mean free path and the Hall effect. It is inferred that the mechanism of HTCS is predominantly due to electron-electron interaction - probably of bipolaron nature, as indicated by experiment. At this point experiment meets just a few theories, that conform with the experimental facts and above theory, all based on the quasi-particle theory of electron-electron interaction. The theory of Newns, Pattnaik and Tsuei should have a T 2 shape of ρ(T) and, because E F lies near a nearly logarithmic van Hove singularity, accounts for the high Tc. Ruvalds and Virosztek's theory predicts the T 2 shape of ρ(T). (orig./GSCH)
Directory of Open Access Journals (Sweden)
Óscar Castro Garcia
2016-10-01
Full Text Available Tanto ciencia como filosofía han querido explicar la conciencia como culmen de nuestra experiencia vital. Inteligencia, intuición, conocimiento, emociones, capacidad de razonar, percepción, entre otras propiedades integradas en nuestra experiencia psicobiologica, nos acompañan ontogénica y filogénicamente. Pero no hay un consenso explicativo sobre la conciencia. Su atribución sólo al ser humano no parece hoy admisible tanto en ciencia, como en su comprensión profunda filosófica. Sería como si la etología pudiese conectar con la biología celular, incluso molecular y, así crear una etología comparativa. Nos referimos a todo ser vivo, al determinar aspectos muy concretos de lo que es «percibir el medio circundante», el umwelt de Jacob von Uexküll. Este artículo trata los rasgos biosemióticos neurales que pueden conducirnos a señales o signos que suponen conciencia o a características que comprendan transducción de información y su posterior respuesta consecuente. Hablaremos de la biosemiótica actual, en lo referente a los signos que provocan información en las máquinas celulares, para trascender el sentido de máquina celular cuando existen signos de percepción tanto de su autoorganización y como de su entorno (emergencia de la conciencia. Para ello nos centraremos en la biofísica de los microtúbulos (Hameroff-Penrose y de los biofotones del profesor Fritz Albert Popp aplicados a los procesos sinápticos del cerebro.
Wiegersma, Marian; Panman, Chantal M. C. R.; Kollen, Boudewijn J.; Vermeulen, Karin M.; Schram, Aaltje J.; Messelink, Embert J.; Berger, Marjolein Y.; Lisman-Van Leeuwen, Yvonne; Dekker, Janny H.
Pelvic floor muscle training (PFMT) and pessaries are commonly used in the conservative treatment of pelvic organ prolapse (POP). Because there is a lack of evidence regarding the optimal choice between these two interventions, we designed the "Pelvic Organ prolapse in primary care: effects of
Scurvy and cloudberries: a chapter in the history of nutritional sciences.
De Luca, Luigi M; Norum, Kaare R
2011-12-01
We translated two Latin texts about scurvy. One is by Ambrosius Rhodius, who in 1635 published his doctoral thesis on scurvy. This contains aspects of 16th- and 17th-century folklore medicine. The other is a 1593 letter by Henrik Høyer (Hoierus), a German physician in Bergen, Norway. The letter states that in Norway grew a plant, Chamaemorus Norvegicus, whose berries had curative abilities against scurvy. Rhodius lists symptoms of scurvy and suggests ingestion of fatty and smoked foods as etiological agents. He thought that a malfunction of the spleen was involved in this disease, so that the undigested parts of the chylus perturbed liver function. Plants with curative abilities were "those that abound in volatile salts." He listed seven facilitating causes of scurvy and its therapies. These included blood-letting after laxatives and root extracts. The star of the show was the cloudberry, which had miraculous effects on scurvy patients. Palliative care included a bath containing decoction of brooklime, water cress, mallow, hogweed, roman chamomile, and similar plants. Before bathing, the person was to drink an extract of wormwood, scurvy grass, or elder. As medication for gums and teeth, Rhodius recommended rosemary, hyssop, bistort, sage, nasturtium, waterweed, creeping Jenny, and scurvy grass. He referred to medications described by Albertus, Sennertus, and in antiquity by Hippocrates and Galenus. We discuss the manuscripts by Høyer and Rhodius in light of earlier treatments and opinions about scurvy.
Maximilien Brice
2009-01-01
Present during the ATLAS undegrround visit: Dr Fabiola Gianotti,ATLAS CollaborationDeputy Spokesperson and Spokesperson Designate; Dr Monica Pepe-Altarelli, LHCb Collaboration CERN Team Leader; Prof. Guido Tonelli,CMS Collaboration, Deputy Spokesperson; Prof. Roberto Petronzio, INFN President. CERN participants present in the audience during the presentations by the Director-General R. Heuer and by Prof. Antonino Zichichi, ALICE Collaboration, University of Bologna: Prof. Sergio Bertolucci,Director for Research and Scientific Computing; Prof. Felicitas Pauss, Coordinator for External Relations Coordinator; Prof. Carlo Rubbia, CERN Former Director-General, Nobel Prize in Physics 1984; Dr Jurgen Schukraft, ALICE Collaboration Spokesperson. Members of the delegation in the audience: Ambassador to the UN, H. Exc. Mr Caracciolo di Vetri; Ambassador Alain G.M. Economides,Capo di Gabinetto; Prof. Antonio Bettanini\tCons. dell’On. Ministro per le Relazioni istituzionali; On. Mario Pescante and Min. Plen Maurizio Mas...
Closure Report for Corrective Action Unit 536: Area 3 Release Site, Nevada Test Site, Nevada
International Nuclear Information System (INIS)
NSTec Environmental Restoration
2007-01-01
Corrective Action Unit (CAU) 536 is located in Area 3 of the Nevada Test Site. CAU 536 is listed in the Federal Facility Agreement and Consent Order of 1996 as Area 3 Release Site, and comprises a single Corrective Action Site (CAS): (sm b ullet) CAS 03-44-02, Steam Jenny Discharge The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CAS 03-44-02 is clean closure. Closure activities included removing and disposing of total petroleum hydrocarbon (TPH)- and polyaromatic hydrocarbon (PAH)-impacted soil, soil impacted with plutonium (Pu)-239, and concrete pad debris. CAU 536 was closed in accordance with the NDEP-approved CAU 536 Corrective Action Plan (CAP), with minor deviations as approved by NDEP. The closure activities specified in the CAP were based on the recommendations presented in the CAU 536 Corrective Action Decision Document (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2004). This Closure Report documents CAU 536 closure activities. During closure activities, approximately 1,000 cubic yards (yd3) of hydrocarbon waste in the form of TPH- and PAH-impacted soil and debris, approximately 8 yd3 of Pu-239-impacted soil, and approximately 100 yd3 of concrete debris were generated, managed, and disposed of appropriately. Additionally, a previously uncharacterized, buried drum was excavated, removed, and disposed of as hydrocarbon waste as a best management practice. Waste minimization techniques, such as the utilization of laboratory analysis to characterize and classify waste streams, were employed during the performance of closure
Forest Vegetation Monitoring Protocol for National Parks in the North Coast and Cascades Network
Woodward, Andrea; Hutten, Karen M.; Boetsch, John R.; Acker, Steven A.; Rochefort, Regina M.; Bivin, Mignonne M.; Kurth, Laurie L.
2009-01-01
Plant communities are the foundation for terrestrial trophic webs and animal habitat, and their structure and species composition are an integrated result of biological and physical drivers (Gates, 1993). Additionally, they have a major role in geologic, geomorphologic and soil development processes (Jenny, 1941; Stevens and Walker, 1970). Throughout most of the Pacific Northwest, environmental conditions support coniferous forests as the dominant vegetation type. In the face of anthropogenic climate change, forests have a global role as potential sinks for atmospheric carbon (Goodale and others, 2002). Consequently, knowledge of the status of forests in the three large parks of the NCCN [that is, Mount Rainier (MORA), North Cascades (NOCA), and Olympic (OLYM) National Parks] is fundamental to understanding the condition of Pacific Northwest ecosystems. Diverse climate and soil properties across the Pacific Northwest result in a variety of forest types (Franklin and Dyrness, 1973; Franklin and others, 1988; Henderson and others, 1989, 1992). The mountainous terrain of Mount Rainier, North Cascades, and Olympic National Parks create steep elevational and precipitation gradients within and among the parks: collectively, these parks span from sea level to more than 4,200 m; and include areas with precipitation from 90 to more than 500 cm. The resulting forests range from coastal rainforests with dense understories and massive trees draped with epiphytes; to areas with drought-adapted Ponderosa pines; to high-elevation subalpine fir forests interspersed with meadows just below treeline (table 1). These forests, in turn, are the foundation for other biotic communities constituting Pacific Northwest ecosystems.
Directory of Open Access Journals (Sweden)
D. Martynenko
2010-11-01
Full Text Available An information content analysis for multi-wavelength SYNergetic AErosol Retrieval algorithm SYNAER was performed to quantify the number of independent pieces of information that can be retrieved. In particular, the capability of SYNAER to discern various aerosol types is assessed. This information content depends on the aerosol optical depth, the surface albedo spectrum and the observation geometry. The theoretical analysis is performed for a large number of scenarios with various geometries and surface albedo spectra for ocean, soil and vegetation. When the surface albedo spectrum and its accuracy is known under cloud-free conditions, reflectance measurements used in SYNAER is able to provide for 2–4° of freedom that can be attributed to retrieval parameters: aerosol optical depth, aerosol type and surface albedo.
The focus of this work is placed on an information content analysis with emphasis to the aerosol type classification. This analysis is applied to synthetic reflectance measurements for 40 predefined aerosol mixtures of different basic components, given by sea salt, mineral dust, biomass burning and diesel aerosols, water soluble and water insoluble aerosols. The range of aerosol parameters considered through the 40 mixtures covers the natural variability of tropospheric aerosols. After the information content analysis performed in Holzer-Popp et al. (2008 there was a necessity to compare derived degrees of freedom with retrieved aerosol optical depth for different aerosol types, which is the main focus of this paper.
The principle component analysis was used to determine the correspondence between degrees of freedom for signal in the retrieval and derived aerosol types. The main results of the analysis indicate correspondence between the major groups of the aerosol types, which are: water soluble aerosol, soot, mineral dust and sea salt and degrees of freedom in the algorithm and show the ability of the SYNAER to
Directory of Open Access Journals (Sweden)
Evans S
2013-03-01
Full Text Available Subhadra Evans, Laura C Seidman, Kirsten C Lung, Lonnie K Zeltzer, Jennie C TsaoPediatric Pain Program, Department of Pediatrics, David Geffen School of Medicine at UCLA, Los Angeles, CA, USABackground: Parental behaviors, emotions, and cognitions are known to influence children's response to pain. However, prior work has not tested the association between maternal psychological factors and children's responses to a conditioned pain modulation (CPM task. CPM refers to the reduction in perceived pain intensity for a test stimulus following application of a conditioning stimulus to a remote area of the body, and is thought to reflect the descending inhibition of nociceptive signals.Methods: The present study examined sex differences in the association between maternal anxiety about pain and children's CPM responses in 133 healthy children aged 8–17 years. Maternal pain anxiety was assessed using the Pain Anxiety Symptoms Scale-20. In addition to the magnitude of CPM, children's anticipatory anxiety and pain-related fear of the CPM task were measured.Results: Sequential multiple linear regression revealed that even after controlling for child age and general maternal psychological distress, greater maternal pain anxiety was significantly related to greater CPM anticipatory anxiety and pain-related fear in girls, and to less CPM (ie, less pain inhibition in boys.Conclusion: The findings indicate sex-specific relationships between maternal pain anxiety and children's responses to a CPM task over and above that accounted for by the age of the child and the mother's general psychological distress.Keywords: diffuse noxious inhibitory controls, pediatric pain, mother-child relationship, cold pressor, pressure pain, laboratory pain
Amiata donkey milk chain: animal health evaluation and milk quality
Directory of Open Access Journals (Sweden)
Giuseppe Ragona
2016-08-01
Full Text Available This study presents an investigation of Amiata donkey health and quality of milk for human consumption. Thirty-one lactating dairy jennies were examined. The following samples were collected: faecal samples from the rectum of animals for parasitological examination; cervical swabs for the detection of bacteria causing reproductive disorders; and blood samples for serological diagnosis of main zoonotic (Brucella spp., Leptospira spp. and donkey abortion agents (Brucella spp., Leptospira spp., Salmonella abortus equi, Equine viral arterithis virus, Equine herpesvirus type 1. In addition, individual milk samples were collected and analysed for mastitis- causing pathogens and milk quality. Regarding animal health, we detected a high prevalence of strongyle parasites in donkeys. It is very important to tackle parasitic diseases correctly. Selective control programmes are preferable in order to reduce anthelmintic drug use. For dairy donkeys, withdrawal periods from anthelmintic drugs need to be carefully managed, in accordance with EU and national regulations. The isolation of Staphylococcus aureus in milk highlights the importance of preventing contamination during milking, by adopting appropriate hygiene and safety practices at a farm level. Lysozyme activity was high compared to cow’s milk, contributing to the inhibitory activity against certain bacteria. Donkey milk was characterised by high lactose content, low caseins, low fat, higher levels of unsaturated fatty acids compared to ruminant milks. Unsaturated fatty acids and omega 3 fatty acids in particular have become known for their beneficial health effect, which is favourable for human diet. These characteristics make it suitable for infants and children affected by food intolerance/ allergies to bovine milk proteins and multiple food allergies as well as for adults with dyslipidemias. It is also recommended to prevent cardiovascular diseases.
Tsunami hazard in the Caribbean: Regional exposure derived from credible worst case scenarios
Harbitz, C. B.; Glimsdal, S.; Bazin, S.; Zamora, N.; Løvholt, F.; Bungum, H.; Smebye, H.; Gauer, P.; Kjekstad, O.
2012-04-01
The present study documents a high tsunami hazard in the Caribbean region, with several thousands of lives lost in tsunamis and associated earthquakes since the XIXth century. Since then, the coastal population of the Caribbean and the Central West Atlantic region has grown significantly and is still growing. Understanding this hazard is therefore essential for the development of efficient mitigation measures. To this end, we report a regional tsunami exposure assessment based on potential and credible seismic and non-seismic tsunamigenic sources. Regional tsunami databases have been compiled and reviewed, and on this basis five main scenarios have been selected to estimate the exposure. The scenarios comprise two Mw8 earthquake tsunamis (north of Hispaniola and east of Lesser Antilles), two subaerial/submarine volcano flank collapse tsunamis (Montserrat and Saint Lucia), and one tsunami resulting from a landslide on the flanks of the Kick'em Jenny submarine volcano (north of Grenada). Offshore tsunami water surface elevations as well as maximum water level distributions along the shore lines are computed and discussed for each of the scenarios. The number of exposed people has been estimated in each case, together with a summary of the tsunami exposure for the earthquake and the landslide tsunami scenarios. For the earthquake scenarios, the highest tsunami exposure relative to the population is found for Guadeloupe (6.5%) and Antigua (7.5%), while Saint Lucia (4.5%) and Antigua (5%) have been found to have the highest tsunami exposure relative to the population for the landslide scenarios. Such high exposure levels clearly warrant more attention on dedicated mitigation measures in the Caribbean region.
Directory of Open Access Journals (Sweden)
Marian Luctkar-Flude
2010-11-01
Full Text Available Marian Luctkar-Flude1, Cynthia Baker1, Cheryl Pulling1, Robert McGraw2, Damon Dagnone2, Jennifer Medves1, Carly Turner-Kelly11School of Nursing, Queen’s University, Kingston, Ontario, Canada; 2School of Medicine, Queen’s University, Kingston, Ontario, CanadaPurpose: Interprofessional (IP collaboration during cardiac resuscitation is essential and contributes to patient wellbeing. The purpose of this study is to evaluate an innovative simulation-based IP educational module for undergraduate nursing and medical students on cardiac resuscitation skills.Methods: Nursing and medical trainees participated in a new cardiac resuscitation curriculum involving a 2-hour IP foundational cardiac resuscitation skills lab, followed by three 2-hour IP simulation sessions. Control group participants attended the existing two 2-hour IP simulation sessions. Study respondents (N = 71 completed a survey regarding their confidence performing cardiac resuscitation skills and their perceptions of IP collaboration.Results: Despite a consistent positive trend, only one out of 17 quantitative survey items were significantly improved for learners in the new curriculum. They were more likely to report feeling confident managing the airway during cardiac resuscitation (P = 0.001. Overall, quantitative results suggest that senior nursing and medical students were comfortable with IP communication and teamwork and confident with cardiac resuscitation skills. There were no significant differences between nursing students’ and medical students’ results. Through qualitative feedback, participants reported feeling comfortable learning with students from other professions and found value in the IP simulation sessions.Conclusion: Results from this study will inform ongoing restructuring of the IP cardiac resuscitation skills simulation module as defined by the action research process. Specific improvements that are suggested by these findings include strengthening the team
A Visual Basic program to classify sediments based on gravel-sand-silt-clay ratios
Poppe, L.J.; Eliason, A.H.; Hastings, M.E.
2003-01-01
the highest current velocity at the time of deposition, together with the maximum grain size of the detritus that is available; Shepard's classification scheme emphasizes the ratios of sand, silt, and clay because they reflect sorting and reworking (Poppe et al., 2000).
Poppe, L.J.; Eliason, A.H.; Hastings, M.E.
2004-01-01
Measures that describe and summarize sediment grain-size distributions are important to geologists because of the large amount of information contained in textural data sets. Statistical methods are usually employed to simplify the necessary comparisons among samples and quantify the observed differences. The two statistical methods most commonly used by sedimentologists to describe particle distributions are mathematical moments (Krumbein and Pettijohn, 1938) and inclusive graphics (Folk, 1974). The choice of which of these statistical measures to use is typically governed by the amount of data available (Royse, 1970). If the entire distribution is known, the method of moments may be used; if the next to last accumulated percent is greater than 95, inclusive graphics statistics can be generated. Unfortunately, earlier programs designed to describe sediment grain-size distributions statistically do not run in a Windows environment, do not allow extrapolation of the distribution's tails, or do not generate both moment and graphic statistics (Kane and Hubert, 1963; Collias et al., 1963; Schlee and Webster, 1967; Poppe et al., 2000)1.Owing to analytical limitations, electro-resistance multichannel particle-size analyzers, such as Coulter Counters, commonly truncate the tails of the fine-fraction part of grain-size distributions. These devices do not detect fine clay in the 0.6–0.1 μm range (part of the 11-phi and all of the 12-phi and 13-phi fractions). Although size analyses performed down to 0.6 μm microns are adequate for most freshwater and near shore marine sediments, samples from many deeper water marine environments (e.g. rise and abyssal plain) may contain significant material in the fine clay fraction, and these analyses benefit from extrapolation.The program (GSSTAT) described herein generates statistics to characterize sediment grain-size distributions and can extrapolate the fine-grained end of the particle distribution. It is written in Microsoft
The INTIMATE event stratigraphy and recommendations for its use
Rasmussen, Sune O.
2014-05-01
. Popp, I.K. Seierstad, J.P. Steffensen, A.M. Svensson, P. Vallelonga, B.M. Vinther, M.J.C. Walker, J.J. Wheatley, and M. Winstrup (deceased).
Bell, K. L. C.; Raineault, N.; Carey, S.; Eberli, G. P.; John, B. E.; Cheadle, M. J.; German, C. R.; Mirmalek, Z.; Pallant, A.
2016-02-01
As the US oceanographic research fleet shrinks, reducing seagoing opportunities for scientists and students, remote participation in cruises via telepresence will become increasingly vital. The Nautilus Exploration Program is improving the experience of shoreside participants through the development of new tools and methodologies for connecting them to expeditions in real time increasing accessibility to oceanographic cruises. The Scientist Ashore Program is a network of scientists around the world who participate in Exploration Vessel Nautilus expeditions from their own labs or homes. We have developed a suite of collaboration tools to allow scientists to view video and data in real time, as well as to communicate with ship-based and other shore-based participants to enable remote participation in cruises. Post-cruise, scientists and students may access digital data and biological and geological samples from our partner shore-based repositories: the University of Rhode Island Inner Space Center, Harvard Museum of Comparative Zoology, and URI Marine Geological Samples Lab. We present examples of successful shore-based participation by scientists and students in Nautilus expeditions. In 2013, Drs. Cheadle and John stood watch 24/7 with ten undergraduate and graduate students at the University of Wyoming, recording geologic features and samples, during a cruise to the Cayman Rise. The Straits of Florida & Great Bahama Bank cruise was co-led by Dr. Eberli at the University of Miami in 2014, greatly complementing existing data. That same year, the ISC hosted four early career scientists and their twelve undergraduate students who led dives from shore in collaboration with Dr. Carey, Lead Scientist at sea on the Kick'em Jenny Volcano & the Barbados Mud Volcanoes cruise. In 2015, 12 Scientists Ashore worked in collaboration with the ship-based team on the exploration of Galapagos National Park, and more than 20 are working with OET on post-cruise data & sample analysis.
Hatten, James R.; Waste, Stephen M.; Maule, Alec G.
2014-01-01
We provide an overview of an interdisciplinary special issue that examines the influence of climate change on people and fish in the Yakima River Basin, USA. Jenni et al. (2013) addresses stakeholder-relevant climate change issues, such as water availability and uncertainty, with decision analysis tools. Montag et al. (2014) explores Yakama Tribal cultural values and well-being and their incorporation into the decision-making process. Graves and Maule (2012) simulates effects of climate change on stream temperatures under baseline conditions (1981–2005) and two future climate scenarios (increased air temperature of 1 °C and 2 °C). Hardiman and Mesa (2013) looks at the effects of increased stream temperatures on juvenile steelhead growth with a bioenergetics model. Finally, Hatten et al. (2013) examines how changes in stream flow will affect salmonids with a rule-based fish habitat model. Our simulations indicate that future summer will be a very challenging season for salmonids when low flows and high water temperatures can restrict movement, inhibit or alter growth, and decrease habitat. While some of our simulations indicate salmonids may benefit from warmer water temperatures and increased winter flows, the majority of simulations produced less habitat. The floodplain and tributary habitats we sampled are representative of the larger landscape, so it is likely that climate change will reduce salmonid habitat potential throughout particular areas of the basin. Management strategies are needed to minimize potential salmonid habitat bottlenecks that may result from climate change, such as keeping streams cool through riparian protection, stream restoration, and the reduction of water diversions. An investment in decision analysis and support technologies can help managers understand tradeoffs under different climate scenarios and possibly improve water and fish conservation over the next century.
Optimal support systems for patients with stomas – an opinion piece
Directory of Open Access Journals (Sweden)
Burch J
2014-06-01
Full Text Available Jennie BurchSt Marks Hospital, Surgery, London, UKAbstract: Coping with a stoma is physically and emotionally difficult. This adaptation process can be hindered by various factors, including complications associated with the stoma, such as appliance leakage, and comorbidities, such as arthritis. There are many ways of learning to live successfully with a stoma, which may be influenced by family, health care professionals, and spiritual support. There is some evidence that a good social support network can result in a positive coping mechanism for people with a newly formed stoma. Difficulty in accepting the stoma has been shown to slow down the adaptation process. This article explores the basic issues related to stomas and the general preoperative and postoperative support that is supplied by health care professionals. There was no optimal support system protocol discovered in the review of the literature. However, some of the published data related to stoma care were extrapolated to enable the reader to understand the important role that support systems can play in the acceptance of the stoma. Health care professionals provide support in a variety of ways, including the provision of telephone advice, clinics, and “open days”, to assist the patient to come to terms with their newly formed stoma. Care includes training on the practical aspects of the stoma, supporting empowerment and self-efficacy of people with a stoma (ostomates, and providing assistance when problems arise. Other support systems that are available are support groups, which may be local or national. It can be seen that the adaptation process takes many months or longer, but by utilizing various means of support, people with a stoma can have a good quality of life. The optimal support systems for patients with a stoma are discussed in relation to the literature and the personal experience of the author.Keywords: colostomy, ileostomy, urostomy
Directory of Open Access Journals (Sweden)
Godley J
2014-10-01
Full Text Available Jenny Godley,1 Nicole M Glenn,2 Arya M Sharma,3 John C Spence4 1Department of Sociology, University of Calgary, Calgary, AB, Canada; 2School of Public Health, Université de Montréal, Montreal, QC, Canada; 3Department of Medicine, 4Sedentary Living Laboratory, Faculty of Physical Education and Recreation, University of Alberta, Edmonton, AB, Canada Abstract: Students training in obesity research, prevention, and management face the challenge of developing expertise in their chosen academic field while at the same time recognizing that obesity is a complex issue that requires a multidisciplinary and multisectoral approach. In appreciation of this challenge, the Canadian Obesity Network (CON has run an interdisciplinary summer training camp for graduate students, new career researchers, and clinicians for the past 8 years. This paper evaluates the effects of attending this training camp on trainees' early careers. We use social network analysis to examine the professional connections developed among trainee Canadian obesity researchers who attended this camp over its first 5 years of operation (2006–2010. We examine four relationships (knowing, contacting, and meeting each other, and working together among previous trainees. We assess the presence and diversity of these relationships among trainees across different years and disciplines and find that interdisciplinary contact and working relationships established at the training camp have been maintained over time. In addition, we evaluate the qualitative data on trainees' career trajectories and their assessments of the impact that the camp had on their careers. Many trainees report that camp attendance had a positive impact on their career development, particularly in terms of establishing contacts and professional relationships. Both the quantitative and the qualitative results demonstrate the importance of interdisciplinary training and relationships for career development in the health
Selected Aspects of Soil Science History in the USA - Prehistory to the 1970s
Brevik, Eric C.; Fenton, Thomas E.; Homburg, Jeffrey A.
2017-04-01
Interest in understanding America's soils originated in prehistory with Native Americans. Following European settlement, notable individuals such as Thomas Jefferson and Lewis and Clark made observations of soil resources. Moving into the 1800s, state geological surveys became involved in soil work and E.W. Hilgard started to formulate ideas similar to those that would eventually lead to V.V. Dokuchaev being recognized as the father of modern soil science. However, Hilgard's advanced ideas on soil genesis were not accepted by the wider American soil science community at the time. Moving into the 1900s, the National Cooperative Soil Survey, the first nationally organized detailed soil survey in the world, was founded under the direction of M. Whitney. Initial soil classification ideas were heavily based in geology, but over time Russian ideas of soil genesis and classification moved into the American soil science community, mainly due to the influence of C.F. Marbut. Early American efforts in scientific study of soil erosion and soil fertility were also initiated in the 1910s and university programs to educate soil scientists started. Soil erosion studies took on high priority in the 1930s as the USA was impacted by the Dust Bowl. Soil Taxonomy, one of the most widely utilized soil classification systems in the world, was developed from the 1950s through the 1970s under the guidance of G.D. Smith and with administrative support from C.E. Kellogg. American soil scientists, such as H. Jenny, R.W. Simonson, D.L. Johnson, and D. Watson-Stegner, developed influential models of soil genesis during the 20th Century, and the use of soil information expanded beyond agriculture to include issues such as land-use planning, soil geomorphology, and interactions between soils and human health.
Directory of Open Access Journals (Sweden)
Martemucci Giovanni
2012-09-01
Full Text Available Abstract Background and aims Milk contains numerous nutrients. The content of n-3 fatty acids, the n-6/n-3 ratio, and short- and medium-chain fatty acids may promote positive health effects. In Western societies, cow’s milk fat is perceived as a risk factor for health because it is a source of a high fraction of saturated fatty acids. Recently, there has been increasing interest in donkey’s milk. In this work, the fat and energetic value and acidic composition of donkey’s milk, with reference to human nutrition, and their variations during lactation, were investigated. We also discuss the implications of the acidic profile of donkey’s milk on human nutrition. Methods Individual milk samples from lactating jennies were collected 15, 30, 45, 60, 90, 120, 150, 180 and 210days after foaling, for the analysis of fat, proteins and lactose, which was achieved using an infrared milk analyser, and fatty acids composition by gas chromatography. Results The donkey’s milk was characterised by low fat and energetic (1719.2kJ·kg-1 values, a high polyunsaturated fatty acids (PUFA content of mainly α-linolenic acid (ALA and linoleic acid (LA, a low n-6 to n-3 FA ratio or LA/ALA ratio, and advantageous values of atherogenic and thrombogenic indices. Among the minor PUFA, docosahesaenoic (DHA, eicosapentanoic (EPA, and arachidonic (AA acids were present in very small amounts ( The fatty acid patterns were affected by the lactation stage and showed a decrease (P Conclusions The high level of unsaturated/saturated fatty acids and PUFA-n3 content and the low n-6/n-3 ratio suggest the use of donkey’s milk as a functional food for human nutrition and its potential utilisation for infant nutrition as well as adult diets, particular for the elderly.
DTMiner: identification of potential disease targets through biomedical literature mining.
Xu, Dong; Zhang, Meizhuo; Xie, Yanping; Wang, Fan; Chen, Ming; Zhu, Kenny Q; Wei, Jia
2016-12-01
Biomedical researchers often search through massive catalogues of literature to look for potential relationships between genes and diseases. Given the rapid growth of biomedical literature, automatic relation extraction, a crucial technology in biomedical literature mining, has shown great potential to support research of gene-related diseases. Existing work in this field has produced datasets that are limited both in scale and accuracy. In this study, we propose a reliable and efficient framework that takes large biomedical literature repositories as inputs, identifies credible relationships between diseases and genes, and presents possible genes related to a given disease and possible diseases related to a given gene. The framework incorporates name entity recognition (NER), which identifies occurrences of genes and diseases in texts, association detection whereby we extract and evaluate features from gene-disease pairs, and ranking algorithms that estimate how closely the pairs are related. The F1-score of the NER phase is 0.87, which is higher than existing studies. The association detection phase takes drastically less time than previous work while maintaining a comparable F1-score of 0.86. The end-to-end result achieves a 0.259 F1-score for the top 50 genes associated with a disease, which performs better than previous work. In addition, we released a web service for public use of the dataset. The implementation of the proposed algorithms is publicly available at http://gdr-web.rwebox.com/public_html/index.php?page=download.php The web service is available at http://gdr-web.rwebox.com/public_html/index.php CONTACT: jenny.wei@astrazeneca.com or kzhu@cs.sjtu.edu.cn Supplementary information: Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press.
Academy Sharing Knowledge (ASK). The NASA Source for Project Management Magazine. Volume 5
Post, Todd (Editor)
2001-01-01
How big is your project world? Is it big enough to contain other cultures, headquarters, hierarchies, and weird harpoon-like guns? Sure it is. The great American poet Walt Whitman said it best, 'I am large/I contain multitudes.' And so must you, Mr. and Ms. Project Manager. In this issue of ASK, we look outside the project box. See how several talented project managers have expanded their definition of project scope to include managing environments outside the systems and subsystems under their care. Here's a sampling of what we've put together for you this issue: In 'Three Screws Missing,' Mike Skidmore tells about his adventures at the Plesetek Cosmodrome in northern Russia. Ray Morgan in his story, 'Our Man in Kauai,' suggests we take a broader view of what's meant by 'the team.' Jenny Baer-Riedhart, the NASA program manager on the same Pathfinder solar-powered airplane, schools us in how to sell a program to Headquarters in 'Know Thyself--But Don't Forget to Learn About the Customer Too.' Scott Cameron of Proctor and Gamble talks about sharpening your hierarchical IQ in 'The Project Manager and the Hour Glass.' Mike Jansen in 'The Lawn Dart' describes how he and the 'voodoo crew' on the Space Shuttle Advanced Solid Rocket Motor program borrowed a harpoon-like gun from the Coast Guard to catch particles inside of a plume. These are just some of the stories you'll find in ASK this issue. We hope they cause you to stop and reflect on your own project's relationship to the world outside. We are also launching a new section this issue, 'There are No Mistakes, Only Lessons.' No stranger to ASK readers, Terry Little inaugurates this new section with his article 'The Don Quixote Complex.'
German, C. R.; Croff Bell, K. L.; Pallant, A.; Mirmalek, Z.; Jasanoff, S.; Rajan, K.
2014-12-01
This paper will discuss a new NSF-INSPIRE project that brings together research conducted in the fields of Ocean Sciences, Education & Human Resources and Computer and Information Science & Engineering. Specifically, our objective is to investigate new methods by which telepresence can be used to conduct cutting edge research and provide authentic educational experiences to undergraduate students, remotely. We choose to conduct this research in an Oceanographic context for two reasons: first with the move toward smaller research ships in the national Oceanographic research fleet, we anticipate that access to berth space at sea will continue to be at a premium. Any component of traditional oceanographic research that can be ported to shore without loss of effectiveness would be of immediate benefit to the Ocean Sciences. Equally, however, we argue that any improvements to work place and/or education practices that we can identify while delivering research and education from the bottom of the deep ocean should be readily mappable to any other scientific or engineering activities that seek to make use of telepresence in less extreme remote environments. Work on our TREET project, to-date, has included recruitment of 6 early career scientists keen to take advantage of the research opportunity provided, together with two senior science mentors with experience using Telepresence and a cohort of undergraduate students at three of the ECS partner Universities, spanning 4 time zones across the continental US. Following a 12-week synchronous on-line seminar series taught in Spring-Summer 2014, the entire team joined together at the Inner Space Center in Sept-Oct 2014 to participate, virtually, in a cruise of research and exploration to the Kick'Em Jenny underwater volcano and adjacent cold seep sites, conducted by the Ocean Exploration Trust's ROV Hercules aboard the Exploration Vessel Nautilus. Our presentation will include preliminary results from that cruise.
Spectral bodies, temporalised spaces: Agnès Varda's motile gestures of mourning and memorial.
Directory of Open Access Journals (Sweden)
Jenny Chamarette
2011-05-01
Full Text Available
Jenny" style="margin: 0cm 0cm 6pt;">Abstract: This article explores the dynamics of the ‘spectre’ or ‘spectral body’ of the auteurist figure of Agnès Varda, as a means of discussing the ethical practices of mourning and memorial in two of Varda’s recent moving image works. It further elaborates on the motifs of ‘spectral bodies’ and ‘temporalised spaces’ to negotiate memorial practices between and across film viewing, filmmaking and the filmmaker. It does so using two interrelated projects by Varda; one in the realm of the plastic arts (her exhibition of 2006 entitled L’Île et elle, with a particular focus on the installation Les Veuves de Noirmoutier (The Widows of Noirmoutier, 2005 and the other in film format for cinema distribution, her most recent film, Les Plages D’Agnès (The Beaches of Agnès, 2008. Drawing upon Jacques Derrida’s notion of the spectral return, or revenant, specifically in audio-visual media, I examine the processes of spectral embodiment and motile mourning at work in these autobiographical projects. The article concludes by reflecting upon the ethical possibilities of productive nostalgia and repetitive mourning, and how these gestures and sites of longing and bereavement offer an open and ludic space for shared flows and communities of affect and memory between filmmakers, artworks and audiences.
Jenny" style="margin: 0cm 0cm 6pt;">Résumé:
Directory of Open Access Journals (Sweden)
Bhaskar V
2014-03-01
Full Text Available Vaishnavi Bhaskar,1 Kathleen A McGraw,2 Kimon Divaris3 1Department of Health Policy and Management, Gillings School of Global Public Health, 2Health Sciences Library, 3Department of Pediatric Dentistry, School of Dentistry, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA Background: Dental caries, the most common childhood chronic disease, disproportionately affects vulnerable parts of the population and confers substantial impacts to children, families, and health systems. Because efforts directed toward oral health promotion and disease prevention are fundamentally superior to dental rehabilitation secondary to disease development, early preventive dental visits (EPDVs are widely advocated by professional and academic stakeholders. The aim of this comprehensive review was to critically review and summarize available evidence regarding the effectiveness of EPDVs in improving children's oral health outcomes. Materials and methods: A systematic literature search of the PubMed and Embase electronic databases was undertaken to identify peer-reviewed publications investigating the effectiveness of EPDVs on oral health outcomes, including clinical, behavioral, and cost end points up to October 30, 2013. Outcomes of the identified studies were abstracted and summarized independently by two investigators. Results: Four manuscripts met the inclusion criteria and were included in the review. All studies were conducted in the US and employed a retrospective cohort study design using public insurance-claims data, whereas one study matched claims files with kindergarten state dental surveillance data. That study found no benefit of EPDVs in future clinically determined dental caries levels in kindergarten. The other three studies found mixed support for an association of EPDVs with subsequent more preventive and fewer nonpreventive visits and lower nonpreventive service-related expenditures. Selection bias and a problem-driven dental care
Directory of Open Access Journals (Sweden)
McGraw T
2016-07-01
Full Text Available Thomas McGraw Global Medical Affairs, Merck & Co., Inc., Kenilworth, NJ, USA Purpose: To evaluate the safety and tolerability of aqueous solution concentrate (ASC of polyethylene glycol (PEG 3350 in patients with functional constipation.Patients and methods: The patients who met Rome III diagnostic criteria for functional constipation were randomized in this multicenter, randomized, placebo-controlled, single-blind study to receive once daily dose of PEG 3350 (17 g ASC or placebo solution for 14 days. The study comprised a screening period (visit 1, endoscopy procedure (visits 2 and 3, and follow-up telephone calls 30 days post-treatment. Safety end points included adverse events (AEs, clinical laboratory evaluations, vital signs, and others. The primary end points were the proportion of patients with abnormalities of the oral and esophageal mucosa, detected by visual and endoscopic examination of the oral cavity and esophagus, respectively, compared with placebo. A secondary objective was to compare the safety and tolerability of ASC by evaluating AEs or adverse drug reactions.Results: A total of 65 patients were enrolled in this study, 31 were randomized to PEG 3350 ASC and 34 were randomized to placebo, of which 62 patients completed the study. No patients in either group showed abnormalities in inflammation of the oral mucosa during visit 2 (before treatment or visit 3 (after treatment. Fewer abnormalities of the esophageal mucosa were observed in the PEG 3350 ASC group than in the placebo group on visit 3, with no significant difference in the proportion of abnormalities between the treatment groups. Overall, 40 treatment-emergent AEs were observed in 48.4% of patients treated with PEG 3350 ASC, and 41 treatment-emergent AEs were observed in 55.9% of patients treated with placebo – nonsignificant difference of -7.5% (95% CI: -21.3, 6.3 between treatment groups. No serious AEs or deaths were reported, and no patient discontinued because
Interstellar Explorer Observations of the Solar System's Debris Disks
Lisse, C. M.; McNutt, R. L., Jr.; Brandt, P. C.
2017-12-01
Planetesimal belts and debris disks full of dust are known as the "signposts of planet formation" in exosystems. The overall brightness of a disk provides information on the amount of sourcing planetesimal material, while asymmetries in the shape of the disk can be used to search for perturbing planets. The solar system is known to house two such belts, the Asteroid belt and the Kuiper Belt; and at least one debris cloud, the Zodiacal Cloud, sourced by planetisimal collisions and Kuiper Belt comet evaporative sublimation. However these are poorly understood in toto because we live inside of them. E.g., while we know of the two planetesimal belt systems, it is not clear how much, if any, dust is produced from the Kuiper belt since the near-Sun comet contributions dominate near-Earth space. Understanding how much dust is produced in the Kuiper belt would give us a much better idea of the total number of bodies in the belt, especially the smallest ones, and their dynamical collisional state. Even for the close in Zodiacal cloud, questions remain concerning its overall shape and orientation with respect to the ecliptic and invariable planes of the solar system - they aren't explainable from the perturbations caused by the known planets alone. In this paper we explore the possibilities of using an Interstellar Explorer telescope placed at 200 AU from the sun to observe the brightness, shape, and extent of the solar system's debris disk(s). We should be able to measure the entire extent of the inner, near-earth zodiacal cloud; whether it connects smoothly into an outer cloud, or if there is a second outer cloud sourced by the Kuiper belt and isolated by the outer planets, as predicted by Stark & Kuchner (2009, 2010) and Poppe et al. (2012, 2016; Figure 1). VISNIR imagery will inform about the dust cloud's density, while MIR cameras will provide thermal imaging photometry related to the cloud's dust particle size and composition. Observing at high phase angle by looking
Directory of Open Access Journals (Sweden)
Bucerzan S
2017-05-01
Full Text Available Simona Bucerzan,1 Diana Miclea,1,2 Radu Popp,2 Camelia Alkhzouz,1 Cecilia Lazea,1 Ioan Victor Pop,2 Paula Grigorescu-Sido1 1Emergency Hospital for Children, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, Romania; 2Department of Molecular Sciences, “Iuliu Hatieganu” University of Medicine and Pharmacy, Cluj-Napoca, Romania Introduction: Recent years have seen a shift in perspective on Turner syndrome, as it is no longer considered a significant disability due to therapeutic advances. The delay of diagnosis and the underdiagnosis are common in Turner syndrome, especially because of the great phenotypic variability and lack of firm diagnostic criteria.Aim: Our first aim was to assess the clinical and the cytogenetic characteristics and growth rate in growth hormone (GH-treated patients as compared to those with spontaneous growth. The second aim was to analyze the Y chromosomal sequences.Materials and methods: We analyzed 45 patients diagnosed with Turner syndrome in Genetic Pathology Centre of Cluj Emergency Children’s Hospital. We carried out a study of the clinical features, the correlations between the karyotype and the phenotype, and we also made a research of Y chromosome sequences.Results: The average age at diagnosis was 8.9±5.4 years. A significant association was observed between the number of external phenotypical abnormalities and internal malformations (r=0.45, particularly the cardiovascular ones (r=0.44. Patients treated with GH showed improvement in growth rate, with final stature significantly better than in untreated patients; benefits following treatment were greater if diagnosis was made before the age of 5 years. Thirteen percent of patients experienced spontaneous and complete puberty, whereas 30% experienced incomplete puberty. Patients with the 45,X genotype had a greater stature deficit and a higher incidence of cardiac malformations, compared with patients with 45,X/46,XX mosaic karyotype. Y
Pleistocene glaciation of the Jackson Hole area, Wyoming
Pierce, Kenneth L.; Licciardi, Joseph M.; Good, John M.; Jaworowski, Cheryl
2018-01-24
bouldery moraines that commonly enclose lakes. On the southern margin of the GYGS, prominent glacial outwash terraces define three phases of the Pinedale glaciation in Jackson Hole: Pinedale-1 (Pd-1) by Antelope Flats with subdued channel patterns on the east side of Jackson Hole; Pinedale-2 (Pd-2) by a large outwash fan that includes Baseline Flat on the west side of Jackson Hole with well-defined channel patterns; and Pinedale-3 (Pd-3) by The Potholes and other outwash fans farther up the Snake River in central Jackson Hole. During Pinedale glaciation, three glacial lobes of the GYGS fed into Jackson Hole, and the relative importance of these lobes changed dramatically through time. During the Pd-1 glaciation, the eastern Buffalo Fork lobe dominated whereas in Pd-2 and Pd-3 time the northern Snake River lobe dominated. This is consistent with migration of the GYGS center of ice mass westward and southward as glaciers built up towards the moisture source provided by storms moving northeastward up the eastern Snake River Plain. The recession of the eastern Buffalo Fork lobe in Pd-2 and Pd-3 times is consistent with an enlarged ice mass on the Yellowstone Plateau that placed the eastern part of the GYGS in a precipitation or snow shadow.In Pd-1 time, the Buffalo Fork lobe reached its maximum extent and was joined by the Pacific Creek lobe. This culmination may correlate with the ~21–18 ka ages of moraines in the Teton Range and nearby ranges. Three subdivisions of Pd-1 glaciation built moraines that are nearly or entirely covered by outwash almost 100 meters thick. In Pd-2 time, the Snake River lobe joined with the Pacific Creek lobe and built a large outwash fan south of the present-day Jackson Lake. Boulders on a moraine at the head of this fan are dated to 15.5 ± 0.5 ka. The relation between Teton glaciers and those of the GYGS is indicated by outwash from these Pd-2 moraines that partly buries outer Jenny Lake moraines dated to 15.2 ± 0.7 ka. East of the large
Intimacy’s Politics: New Directions in Caribbean Sexuality Studies
Directory of Open Access Journals (Sweden)
Vanessa Agard-Jones
2011-12-01
Full Text Available Review of: Pleasures and Perils: Girls’ Sexuality in a Caribbean Consumer Culture. Debra Curtis. New Brunswick NJ: Rutgers University Press, 2009. xii + 222 pp. (Paper US$ 23.95 Economies of Desire: Sex and Tourism in Cuba and the Dominican Republic. Amalia L. Cabezas. Philadelphia PA : Temple University Press, 2009. xii + 218 pp. (Paper US$ 24.95 Queer Ricans: Cultures and Sexualities in the Diaspora. Lawrence La Fountain-Stokes. Minneapolis: University of Minnesota Press, 2009. xxvii + 242 pp. (Paper US$ 22.50 [First paragraph] Over the last ten years the field of Caribbean Studies has seen a precipitous expansion of work on sexualities, as recent review essays by Jenny Sharpe and Samantha Pinto (2006 and Kamala Kempadoo (2009 have observed. The three books under review here, all based on dissertation research and all published in 2009, make important contributions to this growing literature. While each one approaches sexual politics from a distinctive disciplinary, geographic, and theoretical vantage point, all three ask readers to take seriously the central place that sexual desires and practices occupy in the lives of Caribbean people, both at home and in the diaspora. Caribbean sexuality studies are still sometimes thought of as belonging to a domain outside of, or auxiliary to “real” politics, but these studies demonstrate without hesitation how sexuality functions as an important prism through which we might understand broader debates about ethics, politics, and economics in the region. Building from the insights of feminist theorists who connect the “private” realm to community, national, and global geopolitics, they show that sex is intimately connected to certain freedoms – be they market, corporeal, or political – as well as to their consequences. Taken together, they consider sexual subjectivity, political economy, and cultural production in unexpected ways and point to exciting new directions for the
Neoadjuvant therapy for early-stage breast cancer: the clinical utility of pertuzumab
Directory of Open Access Journals (Sweden)
Gollamudi J
2016-02-01
Full Text Available Jahnavi Gollamudi,1,* Jenny G Parvani,2,* William P Schiemann,3 Shaveta Vinayak3,4 1Department of Internal Medicine, 2Department of Biomedical Engineering, 3Case Comprehensive Cancer Center, Case Western Reserve University, 4Department of Hematology and Oncology, University Hospitals Case Medical Center, Cleveland, OH, USA *These authors contributed equally to this work Abstract: Approximately 20% of breast cancer patients harbor tumors that overexpress human epidermal growth factor receptor 2 (HER2; also known as ErbB2, a receptor tyrosine kinase that belongs to the epidermal growth factor receptor family of receptor tyrosine kinases. HER2 amplification and hyperactivation drive the growth and survival of breast cancers through the aberrant activation of proto-oncogenic signaling systems, particularly the Ras/MAP kinase and PI3K/AKT pathways. Although HER2-positive (HER2+ breast cancer was originally considered to be a highly aggressive form of the disease, the clinical landscape of HER2+ breast cancers has literally been transformed by the approval of anti-HER2 agents for adjuvant and neoadjuvant settings. Indeed, pertuzumab is a novel monoclonal antibody that functions as an anti-HER2 agent by targeting the extracellular dimerization domain of the HER2 receptor; it is also the first drug to receive an accelerated approval by the US Food and Drug Administration for use in neoadjuvant settings in early-stage HER2+ breast cancer. Here, we review the molecular and cellular factors that contribute to the pathophysiology of HER2 in breast cancer, as well as summarize the landmark preclinical and clinical findings underlying the approval and use of pertuzumab in the neoadjuvant setting. Finally, the molecular mechanisms operant in mediating resistance to anti-HER2 agents, and perhaps to pertuzumab as well, will be discussed, as will the anticipated clinical impact and future directions of pertuzumab in breast cancer patients. Keywords: breast cancer
Directory of Open Access Journals (Sweden)
Stonecipher KG
2013-10-01
Full Text Available Karl G Stonecipher,1 Jenny Chia,2 Ahunna Onyenwenyi,2 Linda Villanueva,2 David A Hollander2 1TLC Laser Eye Centers, Greensboro, NC, 2Allergan, Inc., Irvine, CA, USA Background: Dry eye is a multifactorial, symptomatic disease associated with ocular surface inflammation and tear film hyperosmolarity. This study was designed to assess patterns of topical cyclosporine ophthalmic emulsion 0.05% (Restasis® use in dry eye patients and determine if there were any differences in use based on whether dry eye is physician-coded as a primary or nonprimary diagnosis. Methods: Records for adult patients with a diagnosis of dry eye at an outpatient visit from January 1, 2008 to December 31, 2009 were selected from Truven Health MarketScan® Research Databases. The primary endpoint was percentage of patients with at least one primary versus no primary dry eye diagnosis who filled a topical cyclosporine prescription. Data analyzed included utilization of topical corticosteroids, oral tetracyclines, and punctal plugs. Results: The analysis included 576,416 patients, accounting for 875,692 dry eye outpatient visits: 74.7% were female, 64.2% were ages 40-69 years, and 84.4% had at least one primary dry eye diagnosis. During 2008–2009, 15.9% of dry eye patients with a primary diagnosis versus 6.5% with no primary diagnosis filled at least one cyclosporine prescription. For patients who filled at least one prescription, the mean months’ supply of cyclosporine filled over 12 months was 4.44. Overall, 33.9% of dry eye patients filled a prescription for topical cyclosporine, topical corticosteroid, or oral tetracycline over 2 years. Conclusion: Patients with a primary dry eye diagnosis were more likely to fill a topical cyclosporine prescription. Although inflammation is key to the pathophysiology of dry eye, most patients seeing a physician for dry eye may not receive anti-inflammatory therapies. Keywords: corticosteroids, cyclosporine, dry eye syndromes
Baetge, Claire; Earnest, Conrad P; Lockard, Brittanie; Coletta, Adriana M; Galvan, Elfego; Rasmussen, Christopher; Levers, Kyle; Simbo, Sunday Y; Jung, Y Peter; Koozehchian, Majid; Oliver, Jonathan; Dalton, Ryan; Sanchez, Brittany; Byrd, Michael J; Khanna, Deepesh; Jagim, Andrew; Kresta, Julie; Greenwood, Mike; Kreider, Richard B
2017-02-01
While commercial dietary weight-loss programs typically advise exercise, few provide actual programing. The goal of this study was to compare the Curves Complete 90-day Challenge (CC, n = 29), which incorporates exercising and diet, to programs advocating exercise (Weight Watchers Points Plus (WW, n = 29), Jenny Craig At Home (JC, n = 27), and Nutrisystem Advance Select (NS, n = 28)) or control (n = 20) on metabolic syndrome (MetS) and weight loss. We randomized 133 sedentary, overweight women (age, 47 ± 11 years; body mass, 86 ± 14 kg; body mass index, 35 ± 6 kg/m 2 ) into respective treatment groups for 12 weeks. Data were analyzed using chi square and general linear models adjusted for age and respective baseline measures. Data are means ± SD or mean change ± 95% confidence intervals (CIs). We observed a significant trend for a reduction in energy intake for all treatment groups and significant weight loss for all groups except control: CC (-4.32 kg; 95% CI, -5.75, -2.88), WW (-4.31 kg; 95% CI, -5.82, -2.96), JC (-5.34 kg; 95% CI, -6.86, -3.90), NS (-5.03 kg; 95% CI, -6.49, -3.56), and control (0.16 kg, 95% CI, -1.56, 1.89). Reduced MetS prevalence was observed at follow-up for CC (35% vs. 14%, adjusted standardized residuals (adjres.) = 3.1), but not WW (31% vs. 28% adjres. = 0.5), JC (37% vs. 42%, adjres. = -0.7), NS (39% vs. 50% adjres. = -1.5), or control (45% vs. 55% adjres. = -1.7). While all groups improved relative fitness (mL·kg -1 ·min -1 ) because of weight loss, only the CC group improved absolute fitness (L/min). In conclusion, commercial programs offering concurrent diet and exercise programming appear to offer greater improvements in MetS prevalence and cardiovascular function after 12 weeks of intervention.
A continuous stochastic model for non-equilibrium dense gases
Sadr, M.; Gorji, M. H.
2017-12-01
While accurate simulations of dense gas flows far from the equilibrium can be achieved by direct simulation adapted to the Enskog equation, the significant computational demand required for collisions appears as a major constraint. In order to cope with that, an efficient yet accurate solution algorithm based on the Fokker-Planck approximation of the Enskog equation is devised in this paper; the approximation is very much associated with the Fokker-Planck model derived from the Boltzmann equation by Jenny et al. ["A solution algorithm for the fluid dynamic equations based on a stochastic model for molecular motion," J. Comput. Phys. 229, 1077-1098 (2010)] and Gorji et al. ["Fokker-Planck model for computational studies of monatomic rarefied gas flows," J. Fluid Mech. 680, 574-601 (2011)]. The idea behind these Fokker-Planck descriptions is to project the dynamics of discrete collisions implied by the molecular encounters into a set of continuous Markovian processes subject to the drift and diffusion. Thereby, the evolution of particles representing the governing stochastic process becomes independent from each other and thus very efficient numerical schemes can be constructed. By close inspection of the Enskog operator, it is observed that the dense gas effects contribute further to the advection of molecular quantities. That motivates a modelling approach where the dense gas corrections can be cast in the extra advection of particles. Therefore, the corresponding Fokker-Planck approximation is derived such that the evolution in the physical space accounts for the dense effects present in the pressure, stress tensor, and heat fluxes. Hence the consistency between the devised Fokker-Planck approximation and the Enskog operator is shown for the velocity moments up to the heat fluxes. For validation studies, a homogeneous gas inside a box besides Fourier, Couette, and lid-driven cavity flow setups is considered. The results based on the Fokker-Planck model are
VOLCANIC TSUNAMI GENERATING SOURCE MECHANISMS IN THE EASTERN CARIBBEAN REGION
Directory of Open Access Journals (Sweden)
George Pararas-Carayannis
2004-01-01
ée on Martinique, of Soufriere on St. Vincent and of the Kick’em Jenny underwater volcano near Grenada and provides an overall risk assessment of tsunami generation from volcanic sources in the Caribbean region.
Benefits of multidisciplinary teamwork in the management of breast cancer
Directory of Open Access Journals (Sweden)
Taylor C
2013-08-01
Full Text Available Cath Taylor,1 Amanda Shewbridge,2 Jenny Harris,1 James S Green3,4 1Florence Nightingale School of Nursing and Midwifery, King’s College London, London UK; 2Breast Cancer Services, Guy’s and St Thomas’ NHS Foundation Trust, London, UK; 3Department of Urology, Barts Health NHS Trust, London, UK; 4Department of Health and Social Care, London South Bank University, London, UK Abstract: The widespread introduction of multidisciplinary team (MDT-work for breast cancer management has in part evolved due to the increasing complexity of diagnostic and treatment decision-making. An MDT approach aims to bring together the range of specialists required to discuss and agree treatment recommendations and ongoing management for individual patients. MDTs are resource-intensive yet we lack strong (randomized controlled trial evidence of their effectiveness. Clinical consensus is generally favorable on the benefits of effective specialist MDT-work. Many studies have shown the benefits of receiving treatment from a specialist center, and evidence continues to accrue from comparative studies of clinical benefits of an MDT approach, including improved survival. Patients’ views of the MDT model of decision-making (and in particular its impact on involvement in decisions about their care have been under-researched. Barriers to effective teamwork and poor decision-making include excessive caseload, low attendance at meetings, lack of leadership, poor communication, role ambiguity, and failure to consider patients’ holistic needs. Breast cancer nurses have a key role in relation to assessing holistic needs, and their specialist contribution has also been associated with improved patient experience and quality of life. This paper examines the evidence for the benefits of MDT-work, in particular for breast cancer. Evidence is considered within a context of growing cancer incidence at a time of increased financial restraint, and it may now be important to
Mona Schweizer
2008-01-01
List of Catalan delegation: Prof. Ramon Moreno, Director-General for Research of the Catalan Science Ministry Prof. Jordi Marquet, Vice-Rector for Strategic Projects Dr. Ramon Noguera, Head of the Universitat Autonoma Research Park Project Prof. Enrique Fernández, SPC chair Prof. Ramon Pascual, President of the Catalan Light Source Synchrotron Lab Prof. Matteo Cavalli-Sforza, Director of IFAE-Barcelona
2003-02-01
This has been a successful textbook since publication of its first edition 11 years ago. This updated edition remains a useful resource for newcomers to palliative care in relation to cancer for nurses and other health professionals.
Kinetics of small particle activation in supersaturated vapors
Energy Technology Data Exchange (ETDEWEB)
McGraw, R.; Wang, J.
2010-08-29
We examine the nucleated (with barrier) activation of perfectly wetting (zero contact angle) particles ranging from bulk size down to one nanometer. Thermodynamic properties of the particles, coated with liquid layers of varying thickness and surrounded by vapor, are analyzed. Nano-size particles are predicted to activate at relative humidity below the Kelvin curve on crossing a nucleation barrier, located at a critical liquid layer thickness such that the total particle size (core + liquid layer) equals the Kelvin radius (Fig. 1). This barrier vanishes precisely as the critical layer thickness approaches the thin layer limit and the Kelvin radius equals the radius of the particle itself. These considerations are similar to those included in Fletcher's theory (Fletcher, 1958) however the present analysis differs in several important respects. Firstly, where Fletcher used the classical prefactor-exponent form for the nucleation rate, requiring separate estimation of the kinetic prefactor, we solve a diffusion-drift equation that is equivalent to including the full Becker-Doering (BD) multi-state kinetics of condensation/evaporation along the growth coordinate. We also determine the mean first passage time (MFPT) for barrier crossing (Wedekind et al., 2007), which is shown to provide a generalization of BD nucleation kinetics especially useful for barrier heights that are considerably lower than those typically encountered in homogeneous vapor-liquid nucleation, and make explicit comparisons between the MFPT and BD kinetic models. Barrier heights for heterogeneous nucleation are computed by a thermo-dynamic area construction introduced recently to model deliquescence and efflorescence of small particles (McGraw and Lewis, 2009). In addition to providing a graphical representation of the activation process that offers new insights, the area construction provides a molecular approach that avoids explicit use of the interfacial tension. Typical barrier profiles for
Volumetric runoff coefficients for experimental rural catchments in the Iberian Peninsula
Taguas, Encarnación V.; Molina, Cecilio; Nadal-Romero, Estela; Ayuso, José L.; Casalí, Javier; Cid, Patricio; Dafonte, Jorge; Duarte, Antonio C.; Farguell, Joaquim; Giménez, Rafael; Giráldez, Juan V.; Gómez, Helena; Gómez, Jose A.; González-Hidalgo, J. Carlos; Keizer, J. Jacob; Lucía, Ana; Mateos, Luciano; Rodríguez-Blanco, M. Luz; Schnabel, Sussane; Serrano-Muela, M. Pilar
2015-04-01
crucial for designing appropriate decision making tools for water management. REFERENCES Chow V.T., Maidment D.R. and Mays, L.W. 1988. Applied Hydrology. MCGraw Hill, Nueva York. Dhakal, N., Fang, X., Cleveland, T., Thompson, D., Asquith, W., and Marzen, L. (2012). "Estimation of Volumetric Runoff Coefficients for Texas Watersheds Using Land-Use and Rainfall-Runoff Data." Journal of Irrigation and Drainage Engineering, 1(2012):43-54. Schaake JC, Geyer JC,Knapp JW. 1967. Experimental examination of the rational method. J. Hydr.Div. 93(6),353-70
Jurkat, Tina; Kaufmann, Stefan; Voigt, Christiane; Zahn, Andreas; Schlager, Hans; Engel, Andreas; Bönisch, Harald; Dörnbrack, Andreas
2013-04-01
data from remote sensing instruments. Further, they will help to validate global chemistry-climate models to gain a better understanding of the trace gas distribution in the UT/LS. Marcy, T. P., Fahey, D. W., Gao, R. S., Popp, P. J., Richard, E. C., Thompson, T. L., Rosenlof, K. H., Ray, E. A., Salawitch, R. J., Atherton, C. S., Bergmann, D. J., Ridley, B. A., Weinheimer, A. J., Loewenstein, M., Weinstock, E. M., and Mahoney, M. J.: Quantifying stratospheric ozone in the upper troposphere with in situ measurements of HCl, Science, 304, 261-265, 2004.
Directory of Open Access Journals (Sweden)
Fanny WS Ko
2008-12-01
Full Text Available Fanny WS Ko1, Ting-Fan Leung2, Gary WK Wong2, Jenny Ngai1, Kin W To1, Susanna Ng1, David SC Hui11Department of Medicine and Therapeutics; 2Department of Pediatrics, The Chinese University of Hong Kong, Hong KongBackground: Assessment of airway inflammation in the clinical course of acute exacerbations of chronic obstructive pulmonary disease (AECOPD may advance our understanding of the pathogenesis and treatment.Objectives: To assess airway inflammation in patients during the course of AECOPD by serial analyses of their exhaled breath condensates (EBC.Methods: Twenty-six patients with AECOPD (22 males, mean[SD] percentage predicted forced expiratory volume in one second (FEV1 44.8 [14.3], 11 with stable COPD, and 14 age and sex-matched healthy controls were studied. Patients with AECOPD were treated with systemic steroid and antibiotic for 7 days. EBC was collected from each patient with AECOPD on Day 5, 14, 30, and 60 post-hospitalization using EcoScreen (VIASYS Healthcare, USA during tidal breathing over 10 minutes. Concentrations of tumor necrosis factor-α (TNF-α, leukotriene B4 (LTB4, and interleukin-8 (IL-8 were measured by enzyme-linked immunosorbent assay.Results: The median (IQR of TNF-α level on Day 5 was 5.08 (3.80–6 .32 pg/ml, which was lower than on Day 14 (5.84 [4.91–9.14] pg/ml, p = 0.017, Day 30 (6.14 [3.82–7.67] pg/ml, p = 0.045, and Day 60 (5.60 [4.53–8.80] pg/ml, p = 0.009. On Day 60, subjects receiving inhaled corticosteroid (ICS had a lower level of TNF-α than those who were not (4.82 [4.06–5.65] vs 7.66 [5.48–10.9] pg/ml, p = 0.02. EBC LTB4 level did not change significantly during recovery from AECOPD whereas IL-8 was mostly undetectable.Conclusions: EBC TNF-α level was low in patients receiving systemic steroid and antibiotic therapy for AECOPD. These findings suggest a potential role for serial EBC TNF-α for noninvasive monitoring of disease activity.Keywords: COPD, exacerbation, exhaled breath
The StarDate Black Hole Encyclopedia Website blackholes.stardate.org
Gebhardt, Karl; Benningfield, D.; Preston, S.
2013-01-01
The StarDate Black Hole Encyclopedia website was developed over the past seven years to provide an extensive but easy-to-read resource for the public and students. A Spanish-language version, Enciclopedia de agujeros negros, is also available at blackholes.radiouniverso.org. Evaluation shows that the sites are used by the public, students, and astronomy professionals, and the site is among the top references in most web searches for individual black holes. The site comprises seven major subsections: Basics, Directory, Research, History, Pop Culture, News, and Resources. The Basics section introduces black holes, explains how they are discovered and studied, and covers their basis in the theory of gravity. This section also includes a six-minute video introduction, “Black Holes: Stranger than Fiction.” The Directory section contains extensive descriptions of more than 80 well-known stellar, intermediate, and supermassive black holes as well as images and vital statistics of each. The Research section takes a look at three NSF-funded projects, including the work of Andrea Ghez, Karl Gebhardt and Jenny Greene, and the LIGO project. The History section provides a timeline of black holes from Isaac Newton to the present. Some of the best and worst roles played by black holes in films, TV shows, and books are included in the Pop Culture section (and pop culture references and images are sprinkled through the rest of the site). An archive of news reports about black holes is available in the News section, which provides links to the original stories or press releases. And the Resources section offers FAQs, articles from StarDate magazine and radio programs, activities for students that are tied to national standards, a glossary, and a reading list of books and websites. We have conducted both quantitative and qualitative evaluation on the black hole websites. This material is based upon work supported by the National Science Foundation under Grant No. 0935841. Any
Directory of Open Access Journals (Sweden)
Duncan I
2012-04-01
Full Text Available Michael Taitel1, Jenny Jiang1, Kristi Rudkin2, Susan Ewing2, Ian Duncan 1Clinical Outcomes and Analytics, Walgreens, 2Corporate Innovation Team, Walgreens, Deerfield, Illinois, USAPurpose: To evaluate the impact of a community-based pharmacist-led face-to-face counseling program on medication adherence for patients who were new to therapy (NTT for statin medications.Patients and methods: This retrospective cohort study evaluated a program that was implemented in 76 national community pharmacies located in the midwest USA. It consisted of two face-to-face patient counseling sessions with a pharmacist that addressed patient barriers to adherence. A group of 2056 NTT statin patients was identified between September 1, 2010 and October 31, 2010, and was followed for 12 months. The intervention group consisted of 586 patients, and the comparison group comprised 516 patients. Outcomes were measured using the continuous medication possession ratio (MPR, categorical MPR, and medication persistency.Results: After adjusting for covariates, the intervention group had statistically greater MPR than the comparison group at every month measured. For example, at 12 months the intervention group had a MPR of 61.8% (CI, 54.5%–69.2% and the comparison group had a MPR of 56.9% (CI, 49.5%–64.3%; this 4.9% difference is significant (P < 0.01. The 12 month categorical MPR also showed significant differences between groups (χ2 = 6.12, P < 0.05; 40.9% of the intervention group and 33.7% of comparison group had a MPR greater than or equal to 80%. Finally, the intervention group had significantly greater persistency with their medication therapy than the comparison group at 60, 90, 120, and 365 days.Conclusion: Patients who participated in brief face-to-face counseling sessions with a community pharmacist at the beginning of statin therapy demonstrated greater medication adherence and persistency than a comparison group. This brief targeted intervention at the
Directory of Open Access Journals (Sweden)
Jan M. Lindsay
2018-04-01
Full Text Available We report on the process of generating the first suite of integrated volcanic hazard zonation maps for the islands of Dominica, Grenada (including Kick ‘em Jenny and Ronde/Caille, Nevis, Saba, St. Eustatius, St. Kitts, Saint Lucia, and St Vincent in the Lesser Antilles. We developed a systematic approach that accommodated the range in prior knowledge of the volcanoes in the region. A first-order hazard assessment for each island was used to develop one or more scenario(s of likely future activity, for which scenario-based hazard maps were generated. For the most-likely scenario on each island we also produced a poster-sized integrated volcanic hazard zonation map, which combined the individual hazardous phenomena depicted in the scenario-based hazard maps into integrated hazard zones. We document the philosophy behind the generation of this suite of maps, and the method by which hazard information was combined to create integrated hazard zonation maps, and illustrate our approach through a case study of St. Vincent. We also outline some of the challenges we faced using this approach, and the lessons we have learned by observing how stakeholders have interacted with the maps over the past ~10 years. Based on our experience, we recommend that future map makers involve stakeholders in the entire map generation process, especially when making design choices such as type of base map, use of colour and gradational boundaries, and indeed what to depict on the map. We also recommend careful consideration of how to evaluate and depict offshore hazard of island volcanoes, and recommend computer-assisted modelling of all phenomena to generate more realistic hazard footprints. Finally, although our systematic approach to integrating individual hazard data into zones generally worked well, we suggest that a better approach might be to treat the integration of hazards on a case-by-case basis to ensure the final product meets map users' needs. We hope that
Directory of Open Access Journals (Sweden)
Torén K
2017-11-01
Full Text Available Kjell Torén,1 Jenny Vikgren,2 Anna-Carin Olin,1 Annika Rosengren,3 Göran Bergström,3 John Brandberg2 1Section of Occupational and Environmental Medicine, Institute of Medicine, Sahlgrenska Academy, 2Department of Radiology, Institute of Clinical Sciences, 3Department of Molecular and Clinical Medicine, Institute of Medicine, Sahlgrenska Academy, University of Gothenburg, Gothenburg, Sweden Background: The aim of this study was to estimate the occupational burden of airflow limitation, chronic airflow limitation, COPD, and emphysema.Materials and methods: Subjects aged 50–64 years (n=1,050 were investigated with forced expiratory volume in 1 s (FEV1 and forced vital capacity (FVC. Airflow limitation was defined as FEV1/FVC <0.7 before bronchodilation. Chronic airflow limitation was defined after bronchodilation either according to the Global Initiative for Chronic Obstructive Lung Disease (GOLD as FEV1/FVC <0.7 or according to the lower limit of normal (LLN approach as FEV1/FVC < LLN. COPD was defined as chronic airflow limitation (GOLD in combination with dyspnea, wheezing, or chronic bronchitis. Emphysema was classified according to findings from computed tomography of the lungs. Occupational exposure was defined as self-reported occupational exposure to vapor, gas, dust, or fumes (VGDF. Odds ratios (OR were calculated in models adjusted for age, gender, and smoking; population-attributable fractions and 95% CI were also calculated.Results: There were significant associations between occupational exposure to VGDF and COPD (OR 2.7, 95% CI 1.4–51, airflow limitation (OR 1.8, 95% CI 1.3–2.5, and emphysema (OR 1.8, 95% CI 1.1–3.1. The associations between occupational exposure to VGDF and chronic airflow limitation were weaker, and for the OR, the CIs included unity. The population-attributable fraction for occupational exposure to VGDF was 0.37 (95% CI 0.23–0.47 for COPD and 0.23 (95% CI 0.05–0.35 for emphysema.Conclusion: The
Lane, Stuart; Baetz, Nico; Borgeaud, Laure; Verrecchia, Eric; Vittoz, Pascal
2014-05-01
Ecosystem succession in Alpine environments has been a focus of research for many decades. Following from the classic ideas of Jenny (1941, 1961), following perturbation, an ecosystem (flora, fauna and soil) should evolve as a function of time at a rate conditioned by external variables (relief, climate, geology). More recently, biogeomorphologists have focused upon the notion of co-evolution of geomorphic processes with ecosystems over very short through to very long (evolutionary) time-scales. Alpine environments have been a particular focus of models of co-evolution, as a means of understanding the rate of plant colonization of previously glaciated terrain. However, work in this field has tended to adopt an over simplified view of the relationship between perturbation and succession, including: how the landform and ecosystem itself conditions the impact of a perturbation to create a complex spatial impact; and how perturbations are not simply ecosystem destroyers but can be a significant source of ecosystem resources. What this means is that at the within landform scale, there may well be a complex and dynamic topographic and sedimentological template that co-evolves with the development of soil, flora and fauna. In this paper, we present and test conceptual models for such co-evolution for an Alpine alluvial fan and an Alpine piedmont braided river. We combine detailed floristic inventory with soil inventory, survey of edaphic variables above and below ground (e.g. vertical and lateral sedimentological structure, using electrical resistance tomography) and the analysis of historical aerial imagery. The floristic inventory shows the existence of a suite of distinct plant communities within each landform. Time since last perturbation is not a useful explanatory variable of the spatial distribution of these communities because: (1) perturbation impacts are spatially variable, as conditioned by the extent distribution of topographic, edaphic and ecological
International Nuclear Information System (INIS)
Anon.
1995-01-01
In Greek mythology, Atlas was a Titan who had to hold up the heavens with his hands as a punishment for having taken part in a revolt against the Olympians. For LHC, the ATLAS detector will also have an onerous physics burden to bear, but this is seen as a golden opportunity rather than a punishment. The major physics goal of CERN's LHC proton-proton collider is the quest for the long-awaited£higgs' mechanism which drives the spontaneous symmetry breaking of the electroweak Standard Model picture. The large ATLAS collaboration proposes a large general-purpose detector to exploit the full discovery potential of LHC's proton collisions. LHC will provide proton-proton collision luminosities at the aweinspiring level of 1034 cm2 s~1, with initial running in at 1033. The ATLAS philosophy is to handle as many signatures as possible at all luminosity levels, with the initial running providing more complex possibilities. The ATLAS concept was first presented as a Letter of Intent to the LHC Committee in November 1992. Following initial presentations at the Evian meeting (Towards the LHC Experimental Programme') in March of that year, two ideas for generalpurpose detectors, the ASCOT and EAGLE schemes, merged, with Friedrich Dydak (MPI Munich) and Peter Jenni (CERN) as ATLAS cospokesmen. Since the initial Letter of Intent presentation, the ATLAS design has been optimized and developed, guided by physics performance studies and the LHC-oriented detector R&D programme (April/May, page 3). The overall detector concept is characterized by an inner superconducting solenoid (for inner tracking) and large superconducting air-core toroids outside the calorimetry. This solution avoids constraining the calorimetry while providing a high resolution, large acceptance and robust detector. The outer magnet will extend over a length of 26 metres, with an outer diameter of almost 20 metres. The total weight of the detector is 7,000 tonnes. Fitted with its end
Byers, Nina; Williams, Gary
2010-12-01
Foreword Freeman J. Dyson; Introduction Nina Byers; 1. Hertha Aryton 1854-1923 Joan Mason; 2. Margaret Maltby 1860-1944 Peggy Kidwell; 3. Agnes Pockels 1862-1935 Gary A. Williams; 4. Marie Curie 1867-1934 A. Pais; 5. Henrietta Leavitt 1868-1921 Jean L. Turner; 6. Harriet Brooks 1876-1933 C. W. Wong; 7. Lise Meitner 1878-1968 Ruth Lewin Sime; 8. Emmy Noether 1882-1935 Nina Byers; 9. Inge Lehmann 1888-1993 Bruce A. Bolt; 10. Marietta Blau 1894-1970 Leopold Halpern and Maurice M. Shapiro; 11. Hertha Sponer 1895-1968 Helmut Rechenberg; 12. Irene Joliot-Curie 1897-1956 Hélène Langevin-Joliot and Pierre Radvanyi; 13. Katherine Burr Blodgett 1898-1979 Gary A. Williams; 14. Cecilia Payne Gaposchkin 1900-1979 Vera C. Rubin; 15. Mary Cartwright 1900-1998 Freeman J. Dyson; 16. Bertha Jeffreys 1903-1999 Ruth M. Williams; 17. Kathleen Yardley Lonsdale1903-1971 Judith Milledge; 18. Maria Goeppert Mayer 1906-1972 Steven A. Moszkowski; 19. Helen Megaw 1907-2002 A. Michael Glazer and Christine Kelsey; 20. Yvette Cauchois 1908-1999 Christiane Bonnelle; 21. Marguerite Perey 1909-1975 Jean-Pierre Adloff and George B. Kauffman; 22. Dorothy Crowfoot Hodgkin 1910-1994 Jenny P. Glusker; 23. Gertrude Scharff Goldhaber 1911-1998 Alfred Scharff Goldhaber; 24. Chien Shiung Wu 1912-1997 Noemie Bencze-Koller; 25. Margaret E. Burbidge 1919 Virginia Trimble; 26. Phyllis Freier 1921-1992 Cecil J. Waddington; 27. Rosalyn S. Yalow 1921 M. S. Dresselhaus and F. A. Stahl; 28. Esther Conwell 1922 Lewis Rothberg; 29. Cecile Dewitt-Morette 1922 Bryce DeWitt; 30. Yvonne Choquet-Bruhat 1923 James W. York Jr.; 31. Vera Rubin 1928 Robert J. Rubin; 32. Mildred S. Dresselhaus 1930 G. Dresselhaus and F. A. Stahl; 33. Myriam Sarachik 1933 Jonathan R. Friedman; 34. Juliet Lee-Franzini 1933 Paolo Franzini; 35. Helen T. Edwards 1936 John Peoples; 36. Mary K. Gaillard 1939 Andreszej Buras; 37. Renata Kallosh 1943 Andrei Linde and Michael Gutperle; 38. Jocelyn Bell Burnell 1943 Ferdinand V. Coroniti and Gary A
Evaluation of the flipped classroom approach in a veterinary professional skills course
Directory of Open Access Journals (Sweden)
Moffett J
2014-11-01
Full Text Available Jenny Moffett,1 Aileen C Mill2 1Ross University School of Veterinary Medicine, West Farm, St Kitts, West Indies; 2Modelling Suite, School of Biology, Newcastle University, Newcastle upon Tyne, UK Background: The flipped classroom is an educational approach that has had much recent coverage in the literature. Relatively few studies, however, use objective assessment of student performance to measure the impact of the flipped classroom on learning. The purpose of this study was to evaluate the use of a flipped classroom approach within a medical education setting to the first two levels of Kirkpatrick and Kirkpatrick's effectiveness of training framework. Methods: This study examined the use of a flipped classroom approach within a professional skills course offered to postgraduate veterinary students. A questionnaire was administered to two cohorts of students: those who had completed a traditional, lecture-based version of the course (Introduction to Veterinary Medicine [IVM] and those who had completed a flipped classroom version (Veterinary Professional Foundations I [VPF I]. The academic performance of students within both cohorts was assessed using a set of multiple-choice items (n=24 nested within a written examination. Data obtained from the questionnaire were analyzed using Cronbach's alpha, Kruskal–Wallis tests, and factor analysis. Data obtained from student performance in the written examination were analyzed using the nonparametric Wilcoxon rank sum test. Results: A total of 133 IVM students and 64 VPF I students (n=197 agreed to take part in the study. Overall, study participants favored the flipped classroom approach over the traditional classroom approach. With respect to student academic performance, the traditional classroom students outperformed the flipped classroom students on a series of multiple-choice items (IVM mean =21.4±1.48 standard deviation; VPF I mean =20.25±2.20 standard deviation; Wilcoxon test, w=7,578; P<0
Discovering the essence of soil
Frink, D.
2012-04-01
Science, and what it can learn, is constrained by its paradigms and premises. Similarly, teaching and what topics can be addressed are constrained by the paradigms and premises of the subject matter. Modern soil science is founded on the five-factor model of Dokuchaev and Jenny. Combined with Retallack's universal definition of soil as geologic detritus affected by weathering and/or biology, modern soil science emphasizes a descriptive rather than an interpretive approach. Modern soil science however, emerged from the study of plants and the need to improve crop yields in the face of chronic and wide spread famine in Europe. In order to teach that dirt is fascinating we must first see soils in their own right, understand their behavior and expand soil science towards an interpretive approach rather than limited as a descriptive one. Following the advice of James Hutton given over two centuries ago, I look at soils from a physiological perspective. Digestive processes are mechanical and chemical weathering, the resulting constituents reformed into new soil constituents (e.g. clay and humus), translocated to different regions of the soil body to serve other physiological processes (e.g. lamellae, argillic and stone-line horizons), or eliminated as wastes (e.g. leachates and evolved gasses). Respiration is described by the ongoing and diurnal exchange of gasses between the soil and its environment. Circulatory processes are evident in soil pore space, drainage capacity and capillary capability. Reproduction of soil is evident at two different scales: the growth of clay crystals (with their capacity for mutation) and repair of disturbed areas such as result from the various pedo-perturbations. The interactions between biotic and abiotic soil components provide examples of both neurological and endocrine systems in soil physiology. Through this change in perspective, both biotic and abiotic soil processes become evident, providing insight into the possible behavior of
Directory of Open Access Journals (Sweden)
Harris J
2014-08-01
Full Text Available Jenny Harris,1 James SA Green,2,3 Nick Sevdalis,4 Cath Taylor1 1Florence Nightingale School of Nursing and Midwifery, King's College London, London, UK; 2Department of Urology, Whipps Cross University Hospital, London, UK; 3Department of Health and Social Care, London South Bank University, London, UK; 4Department of Surgery and Cancer, Imperial College London, London, UK Background: Multidisciplinary team (MDT working is well established as the foundation for providing cancer services in the UK and elsewhere. A core activity is the weekly meeting (or case conference/tumor boards where the treatment recommendations for individual patients are agreed. Evidence suggests that the quality of team working varies across cancer teams, and this may impact negatively on the decision-making process, and ultimately patient care. Feedback on performance by expert observers may improve performance, but can be resource-intensive to implement. This proof of concept study sought to: develop a structured observational assessment tool for use by peers (managers or clinicians from the local workforce and explore its usability; assess the feasibility of the principle of observational assessment by peers; and explore the views of MDT members and observers about the utility of feedback from observational assessment. Methods: For tool development, the content was informed by national clinical consensus recommendations for best practice in cancer MDTs and developed in collaboration with an expert steering group. It consisted of ten subdomains of team working observable in MDT meetings that were rated on a 10-point scale (very poor to very good. For observational assessment, a total of 19 peer observers used the tool (assessing performance in 20 cancer teams from four hospitals. For evaluation, telephone interviews with 64 team members and all peer observers were analyzed thematically. Results: The tool was easy to use and areas for refinement were identified. Peer
Van der Mispel, Celien; Poppe, Louise; Crombez, Geert; Verloigne, Maïté; De Bourdeaudhuij, Ilse
2017-07-11
% CI=1.23-4.08) and younger adults (OR: 1.02, 95% CI=1.00-1.04). Furthermore, younger adults were less likely to return to the website for the first follow-up after one week (OR: 1.03, 95% CI=1.01-1.04). This study informs us that eHealth interventions should avoid the use of extensive questionnaires and that users should be provided with a rationale for several components (eg, making an action plan and completing questions). Furthermore, future interventions should focus first on motivating users for the behavior change before guiding them through action planning. Though, this study provides no evidence for removal of one of the self-regulation techniques based on attrition rates. Finally, strong efforts are needed to motivate male users and younger adults to complete eHealth interventions. ©Celien Van der Mispel, Louise Poppe, Geert Crombez, Maïté Verloigne, Ilse De Bourdeaudhuij. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 11.07.2017.
Bioenergy costs and potentials with special attention to implications for the land system
Popp, A.; Lotze-Campen, H.; Dietrich, J.; Klein, D.; Bauer, N.; Krause, M.; Beringer, T.; Gerten, D.
2011-12-01
In the coming decades, an increasing competition for global land and water resources can be expected, due to rising demand for agricultural products, goals of nature conservation, and changing production conditions due to climate change. Especially biomass from cellulosic bioenergy crops, such as Miscanthus or poplar, is being proposed to play a substantial role in future energy systems if climate policy aims at stabilizing greenhouse gas (GHG) concentration at low levels. However, the potential of bioenergy for climate change mitigation remains unclear due to large uncertainties about future agricultural yield improvements, land availability for biomass plantations, and implications for the land system. In order to explore the cost-effective contribution of bioenergy to a low carbon transition with special attention to implications for the land system, we present a modeling framework with detailed biophysical and economic representation of the land and energy sector: We have linked the global dynamic vegetation and water balance model LPJmL (Bondeau et al. 2007, Rost et al. 2008), the global land and water use model MAgPIE (Lotze-Campen et al. 2008, Popp et al. 2010), and the global energy-economy-climate model ReMIND (Leimbach et al. 2009). In this modeling framework LPJmL supplies spatially explicit (0.5° resolution) agricultural yields as well as carbon and water stocks and fluxes. Based on this biophysical input MAgPIE delivers cost-optimized land use patterns (0.5° resolution), associated GHG emissions and rates of future yield increases in agricultural production. Moreover, shadow prices are calculated for irrigation water (as an indicator for water scarcity), food commodities, and bioenergy (as an indicator for changes in production costs) under different land use constraints such as forest conservation for climate change mitigation and as a contribution to biodiversity conservation. The energy-economy-climate model ReMIND generates the demand for
Goetz, Maren; Müller, Mitho; Matthies, Lina Maria; Hansen, Jenny; Doster, Anne; Szabo, Akos; Pauluschke-Fröhlich, Jan; Abele, Harald; Sohn, Christof; Wallwiener, Markus; Wallwiener, Stephanie
2017-05-26
highly frequented source of information. Expectations and usability requirements for those applications are also high, thus posing a challenge to interdisciplinary service providers. Patients' attitude toward integrating apps in routine care settings was positive with a favorable influence on patient empowerment. Health care professionals should guide pregnant women toward a successful integration of these educational tools in pregnancy care. ©Maren Goetz, Mitho Müller, Lina Maria Matthies, Jenny Hansen, Anne Doster, Akos Szabo, Jan Pauluschke-Fröhlich, Harald Abele, Christof Sohn, Markus Wallwiener, Stephanie Wallwiener. Originally published in JMIR Mhealth and Uhealth (http://mhealth.jmir.org), 26.05.2017.
Directory of Open Access Journals (Sweden)
Magowe MK
2014-04-01
Full Text Available Mabel KM Magowe,1 Jenny H Ledikwe,2,3 Ishmael Kasvosve,1 Robert Martin,2 Kabo Thankane,3 Bazghina-werq Semo2,31Faculty of Health Sciences, University of Botswana, Gaborone, Botswana; 2Department of Global Health, University of Washington, Seattle, Washington, USA; 3Botswana International Training and Education Center for Health, Gaborone, BotswanaPurpose: To address the shortage of laboratory scientists in Botswana, an innovative, one-year academic bridging program was initiated at the University of Botswana, to advance diploma-holding laboratory technicians towards becoming laboratory scientists holding Bachelor’s degrees. An evaluation was conducted, which described the outcomes of the program and the lessons learned from this novel approach to meeting human resource needs.Methods: This was a cross-sectional, mixed-methods evaluation. Qualitative interviews were conducted with graduates of the Bachelor of Science (BSc Medical Laboratory Sciences (MLS bridging program, along with the graduates’ current supervisors, and key informants who were involved in program development or implementation. The quantitative data collected included a written questionnaire, completed by program graduates, with a retrospective pre-test/post-test survey of graduates’ confidence, in terms of key laboratory competencies.Results: The BSc MLS bridging program produced thirty-three laboratory scientists over 3 years. There was a significant increase in confidence among graduates, for specified competencies, after the program (P<0.05. Graduates reported acquiring new skills and, often, accepting new responsibilities at their former workplace, particularly in relationship to leadership and management. Five graduates enrolled in advanced degree programs. Most graduates assumed increased responsibility. However, only two graduates were promoted after completing the training program. The lessons learned include: the importance of stakeholder involvement, the need for
Directory of Open Access Journals (Sweden)
Liao TV
2017-05-01
Full Text Available T Vivian Liao,1 Marina Rabinovich,2 Prasad Abraham,2 Sebastian Perez,3 Christiana DiPlotti,4 Jenny E Han,5 Greg S Martin,5 Eric Honig5 1Department of Pharmacy Practice, College of Pharmacy, Mercer Health Sciences Center, 2Department of Pharmacy and Clinical Nutrition, Grady Health System, 3Department of Surgery, Emory University, 4Pharmacy, Ingles Markets, 5Department of Medicine, Emory University, Atlanta, GA, USA Purpose: Patients in the intensive care unit (ICU are at an increased risk for medication errors (MEs and adverse drug events from multifactorial causes. ME rate ranges from 1.2 to 947 per 1,000 patient days in the medical ICU (MICU. Studies with the implementation of electronic health records (EHR have concluded that it significantly reduced overall prescribing errors and the number of errors that caused patient harm decreased. However, other types of errors, such as wrong dose and omission of required medications increased after EHR implementation. We sought to compare the number of MEs before and after EHR implementation in the MICU, with additional evaluation of error severity.Patients and methods: Prospective, observational, quality improvement study of all patients admitted to a single MICU service at an academic medical center. Patients were evaluated during four periods over 2 years: August–September 2010 (preimplementation; period I, January–February 2011 (2 months postimplementation; period II, August–September 2012 (21 months postimplementation; period III, and January–February 2013 (25 months postimplementation; period IV. All medication orders and administration records were reviewed by an ICU clinical pharmacist and ME was defined as a deviation from established standards for prescribing, dispensing, administering, or documenting medication. The frequency and classification of MEs were compared between groups by chi square; p<0.05 was considered significant.Results: There was a statistically significant increase
Improved data for integrated modeling of global environmental change
Lotze-Campen, Hermann
2011-12-01
The assessment of global environmental changes, their impact on human societies, and possible management options requires large-scale, integrated modeling efforts. These models have to link biophysical with socio-economic processes, and they have to take spatial heterogeneity of environmental conditions into account. Land use change and freshwater use are two key research areas where spatial aggregation and the use of regional average numbers may lead to biased results. Useful insights can only be obtained if processes like economic globalization can be consistently linked to local environmental conditions and resource constraints (Lambin and Meyfroidt 2011). Spatially explicit modeling of environmental changes at the global scale has a long tradition in the natural sciences (Woodward et al 1995, Alcamo et al 1996, Leemans et al 1996). Socio-economic models with comparable spatial detail, e.g. on grid-based land use change, are much less common (Heistermann et al 2006), but are increasingly being developed (Popp et al 2011, Schneider et al 2011). Spatially explicit models require spatially explicit input data, which often constrains their development and application at the global scale. The amount and quality of available data on environmental conditions is growing fast—primarily due to improved earth observation methods. Moreover, systematic efforts for collecting and linking these data across sectors are on the way (www.earthobservations.org). This has, among others, also helped to provide consistent databases on different land cover and land use types (Erb et al 2007). However, spatially explicit data on specific anthropogenic driving forces of global environmental change are still scarce—also because these cannot be collected with satellites or other devices. The basic data on socio-economic driving forces, i.e. population density and wealth (measured as gross domestic product per capita), have been prepared for spatially explicit analyses (CIESIN, IFPRI
Directory of Open Access Journals (Sweden)
--- Various Authors
2017-10-01
. Gentilino, F. Macchini, E. Villamor, F. MoscaABS 7. β3-ADRENOCEPTOR REGULATION OF NITRIC OXIDE IN THE CORD VASCULAR SYSTEM • G. Cavallaro, A. Griggio, L. Provitera, G. Raffaeli, I. Amodeo, S. Gulden, G. Zuanetti, D. Lattuada, G. Ercoli, S. Gatti, E. Villamor, F. MoscaABS 8. BIG DATA ANALYSES FOR CONTINUOUS EVALUATION OF PHARMACOTHERAPY: A PROOF OF PRINCIPLE WITH DOXAPRAM FOR PRETERM INFANTS • R. Flint, W. van Weteringen, S. Völler, J. Poppe, B. Koch, R. de Groot, D. Tibboel, C. Knibbe, I. Reiss, S. Simons, DINO Research groupABS 9. ADRIN 1 METHODOLOGY STUDY: ADVERSE DRUG REACTIONS IN NEONATES: WHAT ARE THE BEST WAYS TO EVALUATE SUSPECTED ADVERSE DRUG REACTIONS IN NEONATES? • E. Roberts, D. Hawcutt, J.J. Kirkham, M.A. TurnerABS 10. LARGE DIFFERENCES IN OFF-LABEL AND NEONATAL DRUG USE STILL EXIST: TIME FOR CONSENSUS? • R. Flint, F. Van Beek, P. Andriessen, P. Degraeuwe, D. Liem, I. Reiss, R. de Groot, D. Tibboel, D. Burger, S. Simons; DINO study group
Directory of Open Access Journals (Sweden)
Kurmi OP
2018-03-01
Full Text Available Om P Kurmi,1 Liming Li,2 Kourtney J Davis,3 Jenny Wang,1 Derrick A Bennett,1 Ka Hung Chan,1 Ling Yang,1 Yiping Chen,1 Yu Guo,4 Zheng Bian,4 Junshi Chen,5 Liuping Wei,6 Donghui Jin,7 Rory Collins,1 Richard Peto,1 Zhengming Chen1 On behalf of the China Kadoorie Biobank collaborative group 1Clinical Trial Service and Epidemiological Studies Unit, Nuffield Department of Population Health, University of Oxford, Oxford, UK; 2Department of Epidemiology, School of Public Health, Peking University Health Science Center, Beijing, China; 3Real World Evidence and Epidemiology, GlaxoSmithKline, Collegeville, PA, USA; 4Chinese Academy of Medical Sciences, Beijing China; 5China National Center for Food Safety Risk Assessment, Beijing, China; 6NCDs Prevention and Control Department, Liuzhou CDC, Liuzhou, China; 7NCDs Prevention and Control Department, Hunan CDC, Changsha, China Background: China has high COPD rates, even among never-regular smokers. Little is known about nonrespiratory disease risks, especially vascular morbidity and mortality after developing airflow obstruction (AFO in Chinese adults. Objective: We aimed to investigate the prospective association of prevalent AFO with major vascular morbidity and mortality. Materials and methods: In 2004–2008, a nationwide prospective cohort study recruited 512,891 men and women aged 30–79 years from 10 diverse localities across China, tracking cause-specific mortality and coded episodes of hospitalization for 9 years. Cox regression yielded adjusted HRs for vascular diseases comparing individuals with spirometry-defined prevalent AFO at baseline to those without. Results: Of 489,382 participants with no vascular disease at baseline, 6.8% had AFO, with prevalence rising steeply with age. Individuals with prevalent AFO had significantly increased vascular mortality (n=1,429, adjusted HR 1.29, 95% CI 1.21–1.36. There were also increased risks of hemorrhagic stroke (n=823, HR 1.18, 95% CI 1.09–1
Directory of Open Access Journals (Sweden)
Jutzeler CR
2018-04-01
Full Text Available Catherine R Jutzeler,1–3 Freda M Warner,1,2 Jacquelyn J Cragg,1,3 Jenny Haefeli,4 J Scott Richards,5 Sven R Andresen,6 Nanna B Finnerup,7,8 Catherine Mercier,9 John LK Kramer1,2 1Faculty of Medicine, ICORD, University of British Columbia, Vancouver, BC, Canada; 2Faculty of Education, School of Kinesiology, University of BC, Vancouver, BC, Canada; 3Faculty of Medicine, Spinal Cord Injury Center, University Hospital Balgrist, University of Zurich, Zurich, Switzerland; 4Weill Institute for Neurosciences, Department of Neurological Surgery, Brain and Spinal Injury Center, University of California, San Francisco, CA, USA; 5Department of Physical Medicine and Rehabilitation, University of Alabama at Birmingham, Birmingham, AL, USA; 6Spinal Cord Injury Centre of Western Denmark, Department of Neurology, Regional Hospital of Viborg, Viborg, Denmark; 7Danish Pain Research Centre, Department of Clinical Medicine, Aarhus University, Aarhus, Denmark; 8Department of Neurology, Aarhus University Hospital, Aarhus, Denmark; 9Center for Interdisciplinary Research in Rehabilitation and Social Integration, Québec, QC, Canada Background: Understanding factors associated with high placebo responses in clinical trials increases the likelihood of detecting a meaningful treatment effect. The aim of the present study was to identify subject-level factors that contribute to placebo variability in patients with neuropathic pain due to spinal cord injury (SCI.Methods: Multiple regression analysis of patient data from randomized, double-blind, placebo-controlled trials (duration >4 weeks involving individuals with SCI was performed. Patient demographics, as well as injury and pain characteristics were examined for their association with changes in pain rating from baseline to the end of the trial (i.e., placebo response. The overall effect of individual predictors was quantified with meta-analysis statistics.Results: A total of 276 patients with SCI from six studies were
Mayes, M. T.; Marin-Spiotta, E.; Ozdogan, M.; Erdogan, M. A.
2011-12-01
In ecosystems where intensive farming and grazing have been occurring for millennia, there is poor understanding of how present-day soil biogeochemical properties relate to factors associated with soil parent materials (e.g. texture, mineralogy), and the net effects of long-term land use practices. Soil organic carbon (SOC) and total soil nitrogen (TN) are important for their roles in maintaining soil structure, moisture, fertility and contributing to carbon sequestration. Our research used a state factor approach (Jenny 1981) to study effects of soil parent materials and land use practices on SOC, TN, and other properties across thirty-five sites in the Konya Basin, an arid region in south-central Turkey farmed and grazed for over 8,000 years. This project is one of the first to study land use impacts on soils at a landscape scale (500 km2) in south-central Turkey, and incorporate geospatial data (e.g. a satellite imagery-derived land cover map we developed) to aid selection of field sites. Focusing on the plough layer (0-25cm) in two depth intervals, we compared effects of agriculture, orchard cultivation and grazing land use practices and clay-loam alluvial, sandy-loam volcanic and lacustrine clay soils on soil properties using standard least squares regression analyses. SOC and TN depended strongly on parent materials, but not on land use. Averaged across both depth intervals, alluvial soil SOC and TN concentrations (19.4 ± 1.32 Mg/ha SOC, 2.86 ± 1.23 Mg/ha TN) were higher and significantly different than lacustrine (9.72 ± 3.01 Mg/ha SOC, 1.57 ± 0.69 Mg/ha TN) and volcanic soil concentrations (7.40 ± 1.72 Mg/ha SOC, 1.02 ± 0.35 Mg/ha TN). Land use significantly affected SOC and TN on alluvial soils, but not on volcanic or lacustrine soils. Our results demonstrate the potential for land use to have different effects on different soils in this region. Our data on SOC, TN and other soil properties illustrate patterns in regional SOC and TN variability not
Directory of Open Access Journals (Sweden)
Weigl K
2018-01-01
Full Text Available Korbinian Weigl,1,2 Jenny Chang-Claude,3,4 Phillip Knebel,5 Li Hsu,6 Michael Hoffmeister,1 Hermann Brenner1,2,7 1Division of Clinical Epidemiology and Aging Research, German Cancer Research Center (DKFZ, Heidelberg, 2German Cancer Consortium (DKTK, German Cancer Research Center (DKFZ, Heidelberg, 3Unit of Genetic Epidemiology, German Cancer Research Center (DKFZ, Heidelberg, 4University Cancer Center Hamburg, University Medical Center Hamburg-Eppendorf, Hamburg, 5Department for General, Visceral and Transplantation Surgery, University Heidelberg, Heidelberg, Germany; 6Public Health Sciences Division, Fred Hutchinson Cancer Research Center, Seattle, WA, USA; 7Division of Preventive Oncology, German Cancer Research Center (DKFZ and National Center for Tumor Diseases (NCT, Heidelberg, Germany Background and aim: Family history (FH and genetic risk scores (GRSs are increasingly used for risk stratification for colorectal cancer (CRC screening. However, they were mostly considered alternatively rather than jointly. The aim of this study was to assess the potential of individual and joint risk stratification for CRC by FH and GRS.Patients and methods: A GRS was built based on the number of risk alleles in 53 previously identified single-nucleotide polymorphisms among 2,363 patients with a first diagnosis of CRC and 2,198 controls in DACHS [colorectal cancer: chances for prevention through screening], a population-based case-control study in Germany. Associations between GRS and FH with CRC risk were quantified by multiple logistic regression.Results: A total of 316 cases (13.4% and 214 controls (9.7% had a first-degree relative (FDR with CRC (adjusted odds ratio [aOR] 1.86, 95% CI 1.52–2.29. A GRS in the highest decile was associated with a 3.0-fold increased risk of CRC (aOR 3.00, 95% CI 2.24–4.02 compared with the lowest decile. This association was tentatively more pronounced in older age groups. FH and GRS were essentially unrelated, and their
Müller, Andre Matthias; Maher, Carol A; Vandelanotte, Corneel; Hingle, Melanie; Middelweerd, Anouk; Lopez, Michael L; DeSmet, Ann; Short, Camille E; Nathan, Nicole; Hutchesson, Melinda J; Poppe, Louise; Woods, Catherine B; Williams, Susan L; Wark, Petra A
2018-04-18
papers originated from high-income countries (96.90%, 1659/1717), in particular the United States (48.83%, 836/1712). Most papers were trials and studied physical activity. Beginning in 2013, research on Generation 2 technologies (eg, smartphones, wearables) sharply increased, while research on Generation 1 (eg, text messages) technologies increased at a reduced pace. Reviews accounted for 20 of the 42 highly-cited papers (n=19 systematic reviews). Social media, smartphone apps, and wearable activity trackers used to encourage physical activity, less sedentary behavior, and/or healthy eating were the focus of 14 highly-cited papers. This study highlighted the rapid growth of the eHealth and mHealth physical activity, sedentary behavior, and diet research field, emphasized the sizeable contribution of research from high-income countries, and pointed to the increased research interest in Generation 2 technologies. It is expected that the field will grow and diversify further and that reviews and research on most recent technologies will continue to strongly impact the field. ©Andre Matthias Müller, Carol A Maher, Corneel Vandelanotte, Melanie Hingle, Anouk Middelweerd, Michael L Lopez, Ann DeSmet, Camille E Short, Nicole Nathan, Melinda J Hutchesson, Louise Poppe, Catherine B Woods, Susan L Williams, Petra A Wark. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 18.04.2018.
Directory of Open Access Journals (Sweden)
Schnetter Reinhard
1976-09-01
Full Text Available Im Páramo de Cruz Verde bei Bogotá wurden Untersuchungen über die klimatischen und edaphischen Bedingungen in einer Höhenlage von etwa 3300 - 3400 m durchgeführt. Die Temperatur in 1 m Tiefe betrug 10,3°C In den frühen Nachmittagsstunden wurden in 1 m Höhe Lufttemperaturen zwischen 9° C und 12,8° C bestimmt . Messungen der Globalstrahlung ergaben bei bedecktem Himmel fürdieselben Tagesstunden Werte zwischen 0,19 und 0,51 cal/cm2 min. Die WindgeschWindigkeit schwankt normalerweise zwischen 2 und 4 m/sec. Der Wind weht vornehmlich aus südöstlicher Richtung. Die jährliche Gesamtniederschlagsmenge betrug etwa 1800 mm. Dertrockenste Monat war der Februar (1971: 51,3 mm, 1972: 61 mm, die feuchtesten Monate Juni (1972: 296,9 mm und Juli (1971:248,1 mm. Als Bodentypen wurden nach JENNY flachgründige"andine Humusböden" und fiefgründige "Humusböden der Paramos" unterschieden. Danebentreten an nassen Stellen Moorböden auf. Die Böden zeichnen sich durch einen hohen Kohlenstoffgehalt in den oberen Bodenschichten aus. Die Stickstoffgehalte liegen zwischen 0,97 und 1,60 g/100 g trockenen Bodens. Die pH. Werte streuen in den oberen Bodenschichten zwischen 3,5 und 5,2. Mit zunehmender Tiefe steigen sie an und liegen in 1 m Tiefezwischen 4,5 und 6,1. Die niedrigste Wasserkapazität wurde für einen flachgründigen Boden unter der Calamagrostis effusa-Spiranthes vaginata - Gesellschaft bestimmt (84% des trockenen Bodens, die höchste für Moorboden unterder Diplostephium revolutum - Gesellschaft (1020% des trockenen Bodens. Die Wassergehalte der Böden zeirgen niederschlagsabhängige Schwankungen, die am auffälligsten in der Calamagrostis effusa - Spiranthes vaginata. Gesellschaft waren, wo auch die niedrigsten absoluten Wassergehalte gefunden wurden (18% des Bodenfrischgewichts. Nur im immer wassergesättigten Moorboden unter der Diplostephium revolutum - Gesellschaft sind derartige witterungsbedingte Schwankungen nicht nachweisbar
Measuring distance “as the horse runs”: Cross-scale comparison of terrain-based metrics
Buttenfield, Barbara P.; Ghandehari, M; Leyk, S; Stanislawski, Larry V.; Brantley, M E; Qiang, Yi
2016-01-01
Distance metrics play significant roles in spatial modeling tasks, such as flood inundation (Tucker and Hancock 2010), stream extraction (Stanislawski et al. 2015), power line routing (Kiessling et al. 2003) and analysis of surface pollutants such as nitrogen (Harms et al. 2009). Avalanche risk is based on slope, aspect, and curvature, all directly computed from distance metrics (Gutiérrez 2012). Distance metrics anchor variogram analysis, kernel estimation, and spatial interpolation (Cressie 1993). Several approaches are employed to measure distance. Planar metrics measure straight line distance between two points (“as the crow flies”) and are simple and intuitive, but suffer from uncertainties. Planar metrics assume that Digital Elevation Model (DEM) pixels are rigid and flat, as tiny facets of ceramic tile approximating a continuous terrain surface. In truth, terrain can bend, twist and undulate within each pixel.Work with Light Detection and Ranging (lidar) data or High Resolution Topography to achieve precise measurements present challenges, as filtering can eliminate or distort significant features (Passalacqua et al. 2015). The current availability of lidar data is far from comprehensive in developed nations, and non-existent in many rural and undeveloped regions. Notwithstanding computational advances, distance estimation on DEMs has never been systematically assessed, due to assumptions that improvements are so small that surface adjustment is unwarranted. For individual pixels inaccuracies may be small, but additive effects can propagate dramatically, especially in regional models (e.g., disaster evacuation) or global models (e.g., sea level rise) where pixels span dozens to hundreds of kilometers (Usery et al 2003). Such models are increasingly common, lending compelling reasons to understand shortcomings in the use of planar distance metrics. Researchers have studied curvature-based terrain modeling. Jenny et al. (2011) use curvature to generate
Bennett, Sophia Elizabeth
2017-01-01
Were present: M. Chungong, IPU Secretary General; S. de Mistura, Special Envoy – Syria; C. Friis Bach, UNECE Executive Secretary; F. Gianotti, CERN Director-General; A. González, ITC Executive Director; F. Gurry, WIPO Director General; V. Kuvshinov, ICDO Secretary-General; M. Møller, UNOG Director-General; N. Seth, UNITAR Secretary-General; E. A. Sy, IFRC Secretary-General; P. Taalas, WMO Secretary-General; G. Verburg, SUN - Coordinator of the Scaling Up Nutrition (SUN) Movement.
Ploeg, Jenny; Markle-Reid, Maureen; Valaitis, Ruta; McAiney, Carrie; Duggleby, Wendy; Bartholomew, Amy; Sherifali, Diana
2017-07-28
outcome of anxiety; 2 of these found significant reductions in anxiety. Other significant results of the interventions were seen in the outcomes of caregiver gain (ie, positive aspects of caregiving), knowledge, bonding, reduction of anger-hostility, and negative mood. Based on this review, it is not possible to determine which interventions were most effective since studies differed in their design, sample, and intervention. Study results suggest that Web-based interventions may result in reduced depressive symptoms, anxiety, and stress or distress among informal caregivers of adults with chronic conditions in the community. This is the first review assessing the impact of Web-based technologies on mental health, general caregiving outcomes, and general health for caregivers of adults with chronic conditions living in the community. Further rigorous research is needed that includes adequately powered studies examining the critical components of the intervention and the dosage needed to have an effect. ©Jenny Ploeg, Maureen Markle-Reid, Ruta Valaitis, Carrie McAiney, Wendy Duggleby, Amy Bartholomew, Diana Sherifali. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 28.07.2017.
Fagher, Kristina; Jacobsson, Jenny; Dahlström, Örjan; Timpka, Toomas; Lexell, Jan
2017-11-29
requested, as the athletes perceived that injuries and illnesses often occurred because of the impairment. Options for description of multifactorial incidents including an injury, an illness, and the impairment were also insufficient. Few technical issues were encountered, but athletes with visual impairment reported usability difficulties with the speech synthesizer. An incidence rate of 1.8 injuries and 1.7 illnesses per 100 hours of athlete exposure were recorded. The weekly pain prevalence was 56% and the impairment contributed to 20% of the reported incidents. The novel eHealth-based application for self-reported SRIIPS developed and tested in this pilot study was generally feasible and usable. With some adaptation to accommodate Paralympic athletes' prerequisites and improved technical support for athletes with visual impairment, this application can be recommended for use in prospective studies of SRIIPS. ClinicalTrials.gov NCT02788500; https://clinicaltrials.gov/ct2/show/NCT02788500 (Archived by WebCite at http://www.webcitation.org/6v56OqTeP). ©Kristina Fagher, Jenny Jacobsson, Örjan Dahlström, Toomas Timpka, Jan Lexell. Originally published in JMIR Human Factors (http://humanfactors.jmir.org), 29.11.2017.
Directory of Open Access Journals (Sweden)
Ekerstad N
2016-12-01
Full Text Available Niklas Ekerstad,1,2 Björn W Karlson,3 Synneve Dahlin Ivanoff,4 Sten Landahl,5 David Andersson,6 Emelie Heintz,7 Magnus Husberg,2 Jenny Alwin2 1Department of Cardiology, NU (NÄL-Uddevalla Hospital Group, Trollhattan, 2Division of Health Care Analysis, Department of Medical and Health Sciences, Linköping University, Linköping, 3Department of Molecular and Clinical Medicine, Institute of Medicine, 4Centre for Ageing and Health, AGECAP, Department of Health and Rehabilitation, 5Department of Geriatrics, Sahlgrenska Academy, University of Gothenburg, Gothenburg, 6Division of Economics, Department of Management and Engineering, Linköping University, Linköping, 7Health Outcomes and Economic Evaluation Research Group, Medical Management Centre, Department of Learning, Informatics, Management and Ethics, Karolinska Institutet, Stockholm, Sweden Objective: The aim of this study was to investigate whether the acute care of frail elderly patients in a comprehensive geriatric assessment (CGA unit is superior to the care in a conventional acute medical care unit. Design: This is a clinical, prospective, randomized, controlled, one-center intervention study. Setting: This study was conducted in a large county hospital in western Sweden. Participants: The study included 408 frail elderly patients, aged ≥75 years, in need of acute in-hospital treatment. The patients were allocated to the intervention group (n=206 or control group (n=202. Mean age of the patients was 85.7 years, and 56% were female. Intervention: This organizational form of care is characterized by a structured, systematic interdisciplinary CGA-based care at an acute elderly care unit. Measurements: The primary outcome was the change in health-related quality of life (HRQoL 3 months after discharge from hospital, measured by the Health Utilities Index-3 (HUI-3. Secondary outcomes were all-cause mortality, rehospitalizations, and hospital care costs. Results: After adjustment by
Space Archeology Overview at Gordion: 2010 to 2012
Tucker, Compton J.; Slayback, Daniel; Nigro, Joseph D.; Yager, Karina A.
2014-01-01
In fiscal years 2010, 2011, and 2012, Compton Tucker was the principal investigator of a NASA Space Archaeology project that worked at Gordion, in Central Turkey. Tucker was assisted by an excellent team of co-workers including Joseph Nigro and Daniel Slayback of Science Systems Applications Incorporated, Jenny Strum of the University of New Mexico, and Karina Yager, a post doctoral fellow at NASA/GSFC. This report summaries their research activities at Gordion for the field seasons of 2010, 2011, and 2012. Because of the possible use of our findings at Gordion for tomb robbing there and/or the encouragement of potential tomb robbers using our geophysical survey methods to locate areas to loot, we have not published any of our survey results in the open literature nor placed any of these results on any web sites. These 2010- 2012 survey results remain in the confidential archives of the University of Pennsylvania's University Museum of Archaeology and Anthropology, the group that leads the Gordion Excavation and Research Project. Excavations are planned for 2013 at Gordion, including several that will be based upon the research results in this report. The site of Gordion in central Turkey, famous as the home of King Midas, whose father's intricately tied knot gave the site its name, also served as the center of the Phrygian kingdom that ruled much of Central Anatolia in Asia Minor during the early first millennium B.C. Gordion has been a University of Pennsylvania Museum of Archaeology and Anthropology excavation project since 1950, yet the site is incompletely published despite six decades of research. The primary obstacles related to the site and its preservation were two problems that NASA technology could address: (1) critical survey errors in the hundreds of maps and plans produced by the earlier excavators, most of which used mutually incompatible geospatial referencing systems, that prevented any systematic understanding of the site; and (2) agricultural
McFadyen, Tameka; Wolfenden, Luke; Wiggers, John; Tindall, Jenny; Yoong, Sze Lin; Lecathelinais, Christophe; Gillham, Karen; Sherker, Shauna; Rowland, Bosco; McLaren, Nicola; Kingsland, Melanie
2017-06-30
-based alcohol management program was significantly associated with perceived ease of use (P=.02, RR 1.4, CI 1.0-2.9), perceived usefulness (P=.03, RR 1.5, CI 1.0-6.8) and club size (P=.02, RR 0.8, CI 0.5-0.9). The most useful features of such a program included the perceived ability to complete program requirements within users' own time, complete program accreditation assessment and monitoring online, develop tailored action plans, and receive email reminders and prompts to complete action. A Web-based alcohol management approach to support sports clubs in the implementation of recommended alcohol management policies appears both feasible and acceptable. Future research should aim to determine if such intended use leads to actual use and club implementation of alcohol management policies. ©Tameka McFadyen, Luke Wolfenden, John Wiggers, Jenny Tindall, Sze Lin Yoong, Christophe Lecathelinais, Karen Gillham, Shauna Sherker, Bosco Rowland, Nicola McLaren, Melanie Kingsland. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 30.06.2017.
Directory of Open Access Journals (Sweden)
Harris MF
2016-01-01
Full Text Available Mark F Harris,1 Jenny Advocat,2 Benjamin F Crabtree,3 Jean-Frederic Levesque,1,4 William L Miller,5 Jane M Gunn,6 William Hogg,7 Cathie M Scott,8 Sabrina M Chase,9 Lisa Halma,10 Grant M Russell11 1Center for Primary Health Care and Equity, University of New South Wales, Sydney, NSW, 2Southern Academic Primary Care Research Unit, School of Primary Health Care, Monash University, Notting Hill, VIC, Australia; 3Department of Family Medicine and Community Health, Rutgers Robert Wood Johnson Medical School, New Brunswick, NJ, USA; 4Bureau of Health Information, NSW Government, Sydney, NSW, Australia; 5Department of Family Medicine, Lehigh Valley Health Network, Allentown, PA, USA; 6Department of General Practice, The University of Melbourne, Melbourne, VIC, Australia; 7The CT Lamont Primary Care Research Center, The University of Ottawa, Ottawa, ON, 8Alberta Centre for Child, Family, and Community Research, University of Calgary, AB, Canada; 9Rutgers University, Rutgers School of Nursing, Rutgers, NJ, USA; 10Alberta Health Services, Lethbridge, AB, Canada; 11School of Primary Health Care, Monash University, Notting Hill, VIC, Australia Context: A key aim of reforms to primary health care (PHC in many countries has been to enhance interprofessional teamwork. However, the impact of these changes on practitioners has not been well understood.Objective: To assess the impact of reform policies and interventions that have aimed to create or enhance teamwork on professional communication relationships, roles, and work satisfaction in PHC practices.Design: Collaborative synthesis of 12 mixed methods studies.Setting: Primary care practices undergoing transformational change in three countries: Australia, Canada, and the USA, including three Canadian provinces (Alberta, Ontario, and Quebec.Methods: We conducted a synthesis and secondary analysis of 12 qualitative and quantitative studies conducted by the authors in order to understand the impacts and how they
International Nuclear Information System (INIS)
Maeder, U.; Dolder, F.; Jenni, A.; Schwyn, B.; Frieg, B.; Eul, A.
2012-01-01
Document available in extended abstract form only. Designs for deep geologic disposal of radioactive waste foresee cementitious materials as structural elements, backfill or waste matrix. Interactions near interfaces are driven by chemical gradients in pore water and resultant diffusive transport, and are predicted to lead to mineralogical alterations in the barrier system, which in turn influences properties like swelling pressure, permeability, or specific retention in case of clay materials. Reactive transport modelling predictions and laboratory and in situ studies revealed significant alteration in both cement and clay-stone. An increase in porosity in the cement close to the interface, and clogging in the clay-stone adjacent to the interface is commonly predicted and observed. The Cement-Clay Interaction (CI) Experiment at the Mont Terri Underground Laboratory (St. Ursanne, Switzerland) aims at demonstrating some of the processes at interfaces to be expected at a realistic spatial scale and under saturated conditions. A duration of 20 years is foreseen during which reaction progress should become measurable and thus comparable to laboratory experiments and modelling predictions. Companion studies address cement hydration, and develop new high-resolution techniques for phase identification using μ-X-ray diffraction at the Paul Scherrer Institut. The field experiment at Mont Terri comprises two vertical boreholes (384 mm diameter, up to 9 m length) in Opalinus Clay (OPA) filled with layers of three different concretes and bentonite. The concrete formulations are based on three different binders: Portland cement (OPC), ESDRED cement designed for repository applications (40% of cement substituted by silica fume), and low alkali cement (LAC, containing slag and nano-silica). The characterisation of the three concrete-OPA interfaces after 2 years of alteration are presented in a companion contribution (Jenni et al.). A key issue is the repeat recovery of
International Nuclear Information System (INIS)
Jones, Eric D.
1999-01-01
In the world of computer-based data acquisition and control, the graphical interface program LabVIEW from National Instruments is so ubiquitous that in many ways it has almost become the laboratory standard. To date, there have been approximately fifteen books concerning LabVIEW, but Professor Essick's treatise takes on a completely different tack than all of the previous discussions. In the more standard treatments of the ways and wherefores of LabVIEW such as LabVIEW Graphical Programming: Practical Applications in Instrumentation and Control by Gary W. Johnson (McGraw Hill, NY 1997), the emphasis has been instructing the reader how to program LabVIEW to create a Virtual Instrument (VI) on the computer for interfacing to a particular instruments. LabVIEW is written in ''G'' a graphical programming language developed by National Instruments. In the past the emphasis has been on training the experimenter to learn ''G''. Without going into details here, ''G'' incorporates the usual loops, arithmetic expressions, etc., found in many programming languages, but in an icon (graphical) environment. The net result being that LabVIEW contains all of the standard methods needed for interfacing to instruments, data acquisition, data analysis, graphics, and also methodology to incorporate programs written in other languages into LabVIEW. Historically, according to Professor Essick, he developed a series of experiments for an upper division laboratory course for computer-based instrumentation. His observation was that while many students had the necessary background in computer programming languages, there were students who had virtually no concept about writing a computer program let alone a computer- based interfacing program. Thus the beginnings of a concept for not only teaching computer- based instrumentation techniques, but aiso a method for the beginner to experience writing a com- puter program. Professor Essick saw LabVIEW as the ''perfect environment in which to
Directory of Open Access Journals (Sweden)
Kurmi OP
2015-03-01
Full Text Available Om P Kurmi,1 Liming Li,2,3 Jenny Wang,1 Iona Y Millwood,1 Junshi Chen,4 Rory Collins,1 Yu Guo,2 Zheng Bian,2 Jiangtao Li,5 Biyun Chen,6 Kaixu Xie,7 Weifan Jia,8 Yali Gao,9 Richard Peto,1 Zhengming Chen1 On behalf of the China Kadoorie Biobank Collaborative Group 1Nuffield Department of Population Health, Clinical Trial Service Unit and Epidemiological Studies Unit (CTSU, University of Oxford, Oxford, UK; 2Department of Epidemiology and Biostatistics, School of Public Health, Peking University, 3Chinese Academy of Medical Sciences, Dong Cheng District, 4China National Center for Food Safety Risk Assessment, Beijing, 5NCDs Prevention and Control Department, Huixian CDC, Huixian, Henan, 6NCDs Prevention and Control Department, Hunan CDC, Changsha, 7NCDs Prevention and Control Department, Tongxiang CDC, Zhejiang, 8NCDs Prevention and Control Department, Liuyang CDC, Baiyikengdao, Liuyang, Changsha, Hunan, 9NCDs Prevention and Control Department, Sichuan CDC, Sichuan, Mainland China Purpose: In adult Chinese men, smoking prevalence is high, but little is known about its association with chronic respiratory disease, which is still poorly diagnosed and managed. Methods: A nationwide study recruited 0.5 million men and women aged 30–79 years during 2004–2008 from ten geographically diverse areas across the Mainland China. Information was collected from each participant regarding smoking and self-reported physician diagnosis of chronic bronchitis/emphysema (CB/E, along with measurement of lung function indices. Logistic regression was used to yield sex-specific odds ratios (ORs relating smoking to airflow obstruction (AFO, defined as forced expiratory volume in 1 second (FEV1/forced vital capacity (FVC <0.7 and CB/E, adjusting for age, areas, education, and income. Results: Overall 74% of men were ever regular smokers; among them, 7.2% had AFO compared with 5.4% in never-smokers, yielding an OR of 1.42 (95% confidence interval [CI]: 1.34–1
Hay, Jennifer L; Berwick, Marianne; Zielaskowski, Kate; White, Kirsten Am; Rodríguez, Vivian M; Robers, Erika; Guest, Dolores D; Sussman, Andrew; Talamantes, Yvonne; Schwartz, Matthew R; Greb, Jennie; Bigney, Jessica; Kaphingst, Kimberly A; Hunley, Keith; Buller, David B
2017-04-25
average-risk personalized genomic testing for melanoma risk findings, and examine predictors of sun protection at 3 months as the outcome. These findings will be used to develop messages for groups that receive average-risk feedback. Aim 2 will compare rates of test consideration in Hispanics versus non-Hispanics, including consideration of testing pros and cons and registration of a decision to either accept or decline testing. Aim 3 will examine personalized genomic testing for melanoma risk feedback comprehension, recall, satisfaction, and cancer-related distress in those who undergo testing, and whether these outcomes differ by ethnicity (Hispanic vs non-Hispanic), or sociocultural or demographic factors. Final outcome data collection is anticipated to be complete by October 2017, at which point data analysis will commence. This study has important implications for personalized genomics in the context of melanoma risk, and may be broadly applicable as a model for delivery of personalized genomic feedback for other health conditions. ©Jennifer L Hay, Marianne Berwick, Kate Zielaskowski, Kirsten AM White, Vivian M Rodríguez, Erika Robers, Dolores D Guest, Andrew Sussman, Yvonne Talamantes, Matthew R Schwartz, Jennie Greb, Jessica Bigney, Kimberly A Kaphingst, Keith Hunley, David B Buller. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 25.04.2017.
Gimbel, Ronald; Shi, Lu; Williams, Joel E; Dye, Cheryl J; Chen, Liwei; Crawford, Paul; Shry, Eric A; Griffin, Sarah F; Jones, Karyn O; Sherrill, Windsor W; Truong, Khoa; Little, Jeanette R; Edwards, Karen W; Hing, Marie; Moss, Jennie B
2017-03-06
Diabetes Self-care Activities Measure scores, clinical measures, comorbid conditions, health services resource consumption, and technology system usage statistics. We have completed phase 1 data collection. Formal analysis of phase 1 data has not been completed. We have obtained institutional review board approval and began phase 1 research in late fall 2016. The study hypotheses suggest that patients can, and will, improve their activation in chronic care management. Improved activation should translate into improved diabetes self-care. Expected benefits of this research to the scientific community and health care services include improved understanding of how to leverage mHealth technology to activate patients living with type 2 diabetes in self-management behaviors. The research will shed light on implementation strategies in integrating mHealth into the clinical workflow of the PCMH setting. ClinicalTrials.gov NCT02949037. https://clinicaltrials.gov/ct2/show/NCT02949037. (Archived by WebCite at http://www.webcitation.org/6oRyDzqei). ©Ronald Gimbel, Lu Shi, Joel E Williams, Cheryl J Dye, Liwei Chen, Paul Crawford, Eric A Shry, Sarah F Griffin, Karyn O Jones, Windsor W Sherrill, Khoa Truong, Jeanette R Little, Karen W Edwards, Marie Hing, Jennie B Moss. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 06.03.2017.
Modeling non-Fickian dispersion by use of the velocity PDF on the pore scale
Kooshapur, Sheema; Manhart, Michael
2015-04-01
combining the Taylor expansion of velocity increments, du, and the Langevin equation for point particles we obtained the components of velocity fluxes which point to a drift and diffusion behavior in the velocity space. Thus a partial differential equation for the velocity PDF has been formulated that constitutes an advection-diffusion equation in velocity space (a Fokker-Planck equation) in which the drift and diffusion coefficients are obtained using the velocity conditioned statistics of the derivatives of the pore scale velocity field. This has been solved by both a Random Walk (RW) model and a Finite Volume method. We conclude that both, these methods are able to simulate the velocity PDF obtained by DNS. References [1] D. W. Meyer, P. Jenny, H.A.Tschelepi, A joint velocity-concentration PDF method for traqcer flow in heterogeneous porous media, Water Resour.Res., 46, W12522, (2010). [2] Nowak, W., R. L. Schwede, O. A. Cirpka, and I. Neuweiler, Probability density functions of hydraulic head and velocity in three-dimensional heterogeneous porous media, Water Resour.Res., 44, W08452, (2008) [3] D. W. Meyer, H. A. Tchelepi, Particle-based transport model with Markovian velocity processes for tracer dispersion in highly heterogeneous porous media, Water Resour. Res., 46, W11552, (2010)
Redmond, Nakeva; Harker, Laura; Bamps, Yvan; Flemming, Shauna St Clair; Perryman, Jennie P; Thompson, Nancy J; Patzer, Rachel E; Williams, Nancy S DeSousa; Arriola, Kimberly R Jacob
2017-11-30
were considered unique entries and could be considered for analyses. With respect to recruitment, 517 of the 772 valid entries (67.0%) of participants were recruited from a Web recruiter. Regarding dose received, no videos from the intervention website were watched in their entirety, and the average viewing duration was 17 seconds over the minimum. With respect to context, context analysis provided us with valuable insights into factors in the Internet environment that may have affected study implementation. Although only active for a brief period of time, the Craigslist website advertisement may have contributed the largest volume of fraudulent responses. We determined fraud and low uptake to be serious threats to this study and further confirmed the importance of conducting a process evaluation to identify such threats. We suggest checking participants' IP addresses before study initiation, selecting software that allows for automatic duplicate protection, and tightening minimum requirements for intervention uptake. Further research is needed to understand how process evaluation models can be used to monitor implementation of Web-based studies. ©Nakeva Redmond, Laura Harker, Yvan Bamps, Shauna St. Clair Flemming, Jennie P Perryman, Nancy J Thompson, Rachel E Patzer, Nancy S DeSousa Williams, Kimberly R Jacob Arriola. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 30.11.2017.
Directory of Open Access Journals (Sweden)
Mirko Jurak
2010-12-01
Full Text Available purpose of this study is to explore the influence of William Shakespeare on Slovene playwrights in the period between 1876, which marks the appearance of Jurčič - Levstik's Tugomer, and the 1930s, when Oton Župančič published his tragedy Veronika Deseniška (Veronika of Desenice, 1924 and, a few years later, Bratko Kreft his history, Celjski grofje (The Counts of Celje, 1932. Together with Cankar's works all of the plays discussed in this study deal with one of the well-known Slovene myths. In the previous number of Acta Neophilologica I published my study on the first Slovene tragedy Miss Jenny Love, which was published in Augsburg in 1780.1 The Romantic period, which followed this publication, was in Slovenia and elsewhere in Europe mainly characterized by the appearance of poetry, with a few exceptions of plays which were primarily intended for reading and not for the stage (Closet Drama. Let me mention here that in the Romantic period some of the finest Slovene poetry was written by France Prešeren (1800-1849, and although some of his friends suggested he should also attempt to write a play, his closest achievement to drama was his epic poem Krst pri Savici (Baptism at the Savica River, 1836, which is also often considered by literary historians as a predecessor of later Slovene dramatic literature. Although many Slovene authors who wrote their works in the nineteenth century knew Shakespeare's plays, they still found it easier to express themselves in prose. The first Slovene novel is Josip Jurčič's Deseti brat (The Tenth Brother, which was published in 1866, ten years earlier than his play Tugomer (Tugomer. However,Jurčičʹs tragedy Tugomer was artistically very much improved by the adaptation made by Fran Levstik, whose text has been since considered as the ʺtrueʺ version of this play. Further editions and adaptations of this play definitely prove that several Slovene authors have found the subject-matter of this play worthy
Vital capacity and COPD: the Swedish CArdioPulmonary bioImage Study (SCAPIS
Directory of Open Access Journals (Sweden)
Torén K
2016-05-01
Full Text Available Kjell Torén,1 Anna-Carin Olin,1 Anne Lindberg,2 Jenny Vikgren,3 Linus Schiöler,1 John Brandberg,3 Åse Johnsson,3 Gunnar Engström,4 H Lennart Persson,5 Magnus Sköld,6 Jan Hedner,7 Eva Lindberg,8 Andrei Malinovschi,8 Eeva Piitulainen,9 Per Wollmer,9 Annika Rosengren,10 Christer Janson,8 Anders Blomberg,2 Göran Bergström10 1Section of Occupational and Environmental Medicine, Department of Molecular and Clinical Medicine, Institute of Medicine, Sahlgrenska Academy, University of Gothenburg, Gothenburg, 2Department of Public Health and Clinical Medicine, Division of Medicine/Respiratory Medicine, Umeå University, Umeå, 3Department of Radiology, Institute of Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg, 4Department of Clinical Science, Malmö, Lund University, Lund, 5Department of Respiratory Medicine and Department of Medicine and Health Sciences, Linköping University, Linköping, 6Respiratory Medicine Unit, Department of Medicine Solna, Center for Molecular Medicine, Karolinska Institutet, Stockholm, 7Department of Internal Medicine/Lung Medicine, Institute of Medicine, Sahlgrenska Academy, University of Gothenburg, Gothenburg, 8Department of Medical Sciences, Clinical Physiology and Respiratory, Allergy and Sleep Research, Uppsala University, Uppsala, 9Department of Translational Medicine, Lund University, Malmö, 10Department of Molecular and Clinical Medicine, Institute of Medicine, Sahlgrenska Academy, University of Gothenburg, Gothenburg, Sweden Background: Spirometric diagnosis of chronic obstructive pulmonary disease (COPD is based on the ratio of forced expiratory volume in 1 second (FEV1/vital capacity (VC, either as a fixed value <0.7 or below the lower limit of normal (LLN. Forced vital capacity (FVC is a proxy for VC. The first aim was to compare the use of FVC and VC, assessed as the highest value of FVC or slow vital capacity (SVC, when assessing the FEV1/VC ratio in a general population
Directory of Open Access Journals (Sweden)
Stout DA
2012-11-01
Full Text Available David A Stout,1,2 Jennie Yoo,2 Adriana Noemi Santiago-Miranda,3 Thomas J Webster1,41School of Engineering, 2Division of Biology and Medicine, Brown University, Providence, RI, 3Department of Chemical Engineering, University of Puerto Rico, Mayagües, PR, 4Department of Orthopedics, Brown University, Providence, RI, USABackground: Recent advances in nanotechnology (materials with at least one dimension between 1 nm and 100 nm have led to the use of nanomaterials in numerous medical device applications. Recently, nanomaterials have been used to create innovative biomaterials for cardiovascular applications. Specifically, carbon nanofibers (CNF embedded in poly(lactic-co-glycolic-acid (PLGA have been shown to promote cardiomyocyte growth compared with conventional polymer substrates, but the mechanisms involved in such events remain unknown. The aim of this study was to determine the basic mechanism of cell growth on these novel nanocomposites.Methods: CNF were added to biodegradable PLGA (50:50 PGA:PLA weight ratio to increase the conductivity, mechanical and cytocompatibility properties of pure PLGA. For this reason, different PLGA to CNF ratios (100:0, 75:25, 50:50, 25:75, and 0:100 wt% with different PLGA densities (0.1, 0.05, 0.025, and 0.0125 g/mL were used, and their compatibility with cardiomyocytes was assessed.Results: Throughout all the cytocompatibility experiments, cardiomyocytes were viable and expressed important biomarkers, including cardiac troponin T, connexin-43, and alpha-sarcomeric actin (α-SCA. Adhesion and proliferation experiments indicated that a PLGA density of 0.025 g/mL with a PLGA to CNF ratio of 75:25 and 50:50 (wt% promoted the best overall cell growth, ie, a 55% increase in cardiomyocyte density after 120 hours compared with pure PLGA and a 75% increase compared with the control at the same time point for 50:50 (wt%. The PLGA:CNF materials were conductive, and their conductivity increased as greater amounts of CNF
VMO Team
2011-01-01
The minister of education and science, Dimitri Shashkini, visited CERN to sign an agreement on behalf of Georgia. The signature by the minister reflects both Georgia’s interest in expanding its co-operation with CERN and the new responsibility of the ministry of education and science for funding scientific activities. The agreement will provide enhanced participation of Georgian scientists in CERN’s projects, either directly or through Georgia’s membership in JINR.
Hydro-mechanical and gas transport properties of bentonite blocks - role of interfaces
International Nuclear Information System (INIS)
Popp, Till; Roehlke, Christopher; Salzer, Klaus; Gruner, Matthias
2012-01-01
Document available in extended abstract form only. The long-term safety of the disposal of nuclear waste is an important issue in all countries with a significant nuclear programme. Repositories for the disposal of high-level and long-lived radioactive waste generally rely on a multi-barrier system to isolate the waste from the biosphere. The multi-barrier system typically comprises the natural geological barrier provided by the repository host rock and its surroundings and an engineered barrier system (EBS), i.e. the backfilling and sealing of shafts and galleries to block any preferential path for radioactive contaminants. Because gas will be created in a radioactive waste repository performance assessment requires quantification of the relevancy of various potential pathways. Referring to the sealing plugs it is expected that in addition to the matrix properties of the sealing material conductive discrete interfaces inside the sealing elements itself and to the host rock may act not only as mechanical weakness planes but also as preferential gas pathways (Popp, 2009). For instance despite the assumed self sealing capacity of bentonite inherent existing interfaces may be reopened during gas injection. Our lab investigations are aiming on a comprehensive hydro-mechanical characterization of interfaces in bentonite buffers, i.e. (1) between prefabricated bentonite blocks itself and (2) on mechanical contacts of bentonite blocks and concrete to various host rocks, i.e. granite. We used as reference material pre-compacted bentonite blocks consisting of a sand clay-bentonite mixture but the variety of bentonite-based buffer materials has to be taken in mind. The blocks were manufactured in the frame work of the so-called dam - project 'Sondershausen', i.e. a German research project performed between 1997 and 2002. The blocks have a standard size of (250 x 125 x 62.5) mm. Approximately 500 t of such bentonite blocks have been produced and assembled in underground drift
The Emphasizing Metonymy and Its Relation Whit Ambiguity of Text
Directory of Open Access Journals (Sweden)
Amir Saleh Masoomi
2016-05-01
holy scripture like the Quran? What is the position of this combined tool in Arabic language?  Such questions prompted us to study the validity of this linguistic phenomenon by using of descriptive-analytical method and explain its effect on perception of reader. On the basis of data of this article, the emphasizing metonymy in contrary to its illogical appearance could be an acceptable phenomenon in the tradition of Arabic language.  References  1. Holy Quran , Fuladvand, Mohammad Mahdi & Payande, Abul Qasem (trans..  2. Abouhayan, Mohamed ibn Youssef (1998. Irteshaf az-Zarab min Lisan al-Arab. Osman Mohammed Rajab and Ramadan Abdaltwab (Emend.. Cairo: Khanji library.  3. ------------------------------------------ (2001.Tafsir al- Bahr al-Mohit. Adel Ahmed Abdol-Mowjood and Ali Mohamed Moawad (Emend.. Beirut: House of scientific books.  4. Astrabadi, Radhi ad-Din Muhammad ibn al-Hasan (1996. Sharh ar-Razi al-Kafyah. Yusuf Hassan Omar (Emend.. Benghazi: University Publications of Garyounes.  5. Azhari, Muhammad bin Ahmad (2001. Tahzib al- loghah. Mohamed Awad terrifying (Emend.. Beirut: House of Revival of Islamic Heritage.  6. Farazdak, Bin Hammam Ghalib (1987. Diwan of Farazdaq. Ali Faour (Emend.. Beirut: House of scientific books.  7. Ibn Abi al-Esba, Abdul Azim ibn al-vahid (1963. Tahrir al-Tahbir fi sana'at al-sher va al-nathr va bayan ejaz alquran. Hafni Mohammad Sharaf (Emend.. Cairo: grope of Revival of Islamic Heritage .  8. Ibn Ashur, Muhammad Tahir (1997. Al-Tahrir va al- Tahbir. Tunisia: Dar Sahnoun for publication and distribution.  9. Ibn Jenni, Abul Fath Othman ibn Jenni (1952. Al-Khasa'es. Mohammad Ali al-Najar (Emend.. Beirut: Book World.  10. Jmaha, Muhammad ibn Salaam (n.d.. Tabaghat al-Fohul al-sho'ara. Mahmoud Mohamed Shaker (Emend.. Jiddah: Dar al-madani.  11. Khatib Qazwini, Muhammad ibn Abd or-Rahman (n.d.. Al-Talkhis fi Olum al-Balaghah. Abdulrahman Albrkoqa (explain. Egypt: Arab Thought House
Directory of Open Access Journals (Sweden)
Zairin Zain
2014-07-01
Structures Work. Mc.Graw Hill Company Inc. New York Zain, Zairin; Indra Wahyu Fajar. 2014. Tahapan Konstruksi Rumah Tradisional Suku Melayu Di Kota Sambas Kalimantan Barat. Jurnal Langkau Betang Volume 1 Nomor 1 Tahun 2014. Program Studi Arsitektur Fakultas Teknik Universitas Tanjungpura dan Pusat Studi Disain Universitas Tanjungpura. Pontianak Zain, Zairin. 2013. The Anatomy of traditional Dwellings: Comparative Study between Malay and Dayak Indigenous Architecture in West Kalimantan. LAP Lambert Academic Publishing/AV Akademikerverlag GmbH & Co. KG. Saarbrücken. Germany Zain, Zairin. 2012a. Pengaruh Aspek Eksternal Pada Rumah Melayu Tradisional di Kota Sambas. Jurnal NALARs, Vol 11 No 2 Juli 2012. Universitas Muhammadiyah Jakarta. Jakarta Zairin Zain. 2012b. Analisis Bentuk dan Ruang pada Rumah Melayu Tradisional di Kota Sambas, Kalimantan Barat. Jurnal NALARs Volume 11 No. 2 Universitas Muhammadiyah Jakarta. Jakarta
Directory of Open Access Journals (Sweden)
Laurent Cordonier
2011-10-01
Full Text Available Pour les sociologues, l’explication de l’action ne peut reposer sur la nature première de l’esprit (les mécanismes universels de détection et de traitement de l’information dont les sciences cognitives prétendent rendre compte mais sur sa nature seconde (les raisons d’agir plus ou moins collectives qui le meublent. Même les paradigmes sociologiques les plus opposés s’accordent pour traiter le social et le culturel comme le résultat d’un patient travail de dénaturalisation qui creuse un fossé incompressible entre l’ordre réducteur des causes naturelles et l’ordre respectable, de facture mentale ou sociale, des raisons, entre les instincts de base de l’organisme et la logique de haut-niveau des significations partagées et des normes culturelles Or, l’objectif du naturalisme est précisément le dépassement de la rupture interne entre l’humain et l’animal, entre l’histoire culturelle et l’histoire biologique. Il vise à harmoniser, dans le sens de « rendre compatible », les hypothèses et les résultats des sciences sociales avec ceux des sciences naturelles, entreprise qui incite la sociologie à expliciter et à réviser les modèles cognitifs et anthropologiques auxquels elle fait implicitement appel. Un des apports potentiels des sciences cognitives et, plus généralement, du naturalisme est donc d’améliorer, de remplacer ou de falsifier, au sens poppérien du terme, les modèles cognitifs et les conceptions anthropologiques sur lesquels se basent les sciences de la société.Toward a social naturalism. Between social sciences and cognitive sciencesFor sociologists, action explanation cannot rely on «the first nature» of the mind (the universal information processing that cognitive sciences claim to account for but on its «second nature» (the more or less collective reasons for acting that furnish it. Even the most opposite sociological paradigms agree to see the social and the cultural as
Lütkenhaus, N.; Shields, A. J.
2009-04-01
distribution network in Vienna M Peev, C Pacher, R Alléaume, C Barreiro, J Bouda, W Boxleitner, T Debuisschert, E Diamanti, M Dianati, J F Dynes, S Fasel, S Fossier, M Fürst, J-D Gautier, O Gay, N Gisin, P Grangier, A Happe, Y Hasani, M Hentschel, H Hübel, G Humer, T Länger, M Legré, R Lieger, J Lodewyck, T Lorünser, N Lütkenhaus, A Marhold, T Matyus, O Maurhart, L Monat, S Nauerth, J-B Page, A Poppe, E Querasser, G Ribordy, S Robyr, L Salvail, A W Sharpe, A J Shields, D Stucki, M Suda, C Tamas, T Themel, R T Thew, Y Thoma, A Treiber, P Trinkler, R Tualle-Brouri, F Vannel, N Walenta, H Weier, H Weinfurter, I Wimberger, Z L Yuan, H Zbinden and A Zeilinger Stable quantum key distribution with active polarization control based on time-division multiplexing J Chen, G Wu, L Xu, X Gu, E Wu and H Zeng Controlling passively quenched single photon detectors by bright light Vadim Makarov Information leakage via side channels in freespace BB84 quantum cryptography Sebastian Nauerth, Martin Fürst, Tobias Schmitt-Manderbach, Henning Weier and Harald Weinfurter Standardization of quantum key distribution and the ETSI standardization initiative ISG-QKD Thomas Länger and Gaby Lenhart Entangled quantum key distribution with a biased basis choice Chris Erven, Xiongfeng Ma, Raymond Laflamme and Gregor Weihs Finite-key analysis for practical implementations of quantum key distribution Raymond Y Q Cai and Valerio Scarani Field test of a continuous-variable quantum key distribution prototype S Fossier, E Diamanti, T Debuisschert, A Villing, R Tualle-Brouri and P Grangier Physics and application of photon number resolving detectors based on superconducting parallel nanowires F Marsili, D Bitauld, A Gaggero, S Jahanmirinejad, R Leoni, F Mattioli and A Fiore Device-independent quantum key distribution secure against collective attacks Stefano Pironio, Antonio Acín, Nicolas Brunner, Nicolas Gisin, Serge Massar and Valerio Scarani 1310 nm differential-phase-shift QKD system using
Benedix, G. K.; McCoy, T. J.; Keil, K.
1995-09-01
IAB irons are the largest group of iron meteorites, exhibit a large range of siderophile element concentrations in their metal, and commonly contain silicate inclusions with roughly chondritic composition. They are closely related to IIICD irons [1,2] and their inclusions resemble winonaites [3]. It has been suggested that IAB's and IIICD's formed in individual impact melt pools [4,2] on a common parent body. However, it has also been suggested that fractional crystallization [5,6] of a S-saturated core could produce the observed siderophile element trends. Metal composition is correlated with silicate inclusion mineralogy in IIICD's [1], indicating reactions between solid silicates and the metallic magma in a core. These trends observed in IIICD's differ from those in IAB's, suggesting different parent bodies. A bi-modal grouping, based primarily on mineralogy and mineral abundances, was suggested for IAB inclusions [7]. However, recent recoveries of several new silicate-bearing IAB's, along with the emergence of new ideas on their origins, prompted a comprehensive study to document more fully the range of inclusions within IAB irons, to examine possible correlations between the compositions of the metallic host and the silicate inclusions, and to elucidate the origin of IAB irons. We are studying troilite-graphite-silicate inclusions in 24 IAB irons with Ni concentrations ranging from 6.6-25.0%. These include Odessa and Copiapo types [7], newly recovered meteorites (e.g., Lueders [8]) and meteorites with extreme Ni contents (e.g., Jenny's Creek, 6.8%; San Cristobal, 25.0% [9]). The inclusions exhibit a range of textures from recrystallized to partial melts (e.g., Caddo County [10]). Rigorous classification [7] is hampered by heterogeneities between group meteorites, between different samples of distinct meteorites, and within individual inclusions. While intergroup heterogeneities make comparisons between the suite of IAB's somewhat difficult, some general trends
Directory of Open Access Journals (Sweden)
Redactie KITLV
2003-07-01
. -Ivelaw L. Griffith, Anthony Payne ,Charting Caribbean Development. Gainesville: University Press of Florida, 2001. xi + 284 pp., Paul Sutton (eds -Ransford W. Palmer, Irma T. Alonso, Caribbean economies in the twenty-first century. Gainesville: University Press of Florida, 2002. 232 pp. -Glenn R. Smucker, Jennie Marcelle Smith, When the hands are many: Community organization and social change in rural Haiti. Ithaca NY: Cornell University Press, 2001. xii + 229 pp. -Kevin Birth, Nancy Foner, Islands in the city: West Indian migration to New York. Berkeley: University of California Press, 2001. viii + 304 pp. -Joy Mahabir, Viranjini Munasinghe, Callaloo or tossed salad? East Indians and the cultural politics of identity in Trinidad. Ithaca NY: Cornell University Press, 2001. xv + 315 pp. -Stéphane Goyette, Robert Chaudenson, Creolization of language and culture. Revised in collaboration with Salikoko S. Mufwene. London: Routledge, 2001. xxi + 340 pp.
Griswold, Julia P.; Pierson, Thomas C.; Bard, Joseph A.
2018-05-09
inundation zones accompanying this report, shown in two different map perspectives, is intended to augment (not replace) the existing hazard maps for Mount Adams (W.E. Scott and others, 1995; Vallance, 1999). The maps in this report show potential areas of inundation by lahars of different initial volumes, which are determined by a computer model, LAHARZ (Iverson and others, 1998; Schilling, 1998). One map sheet presents LAHARZ-determined inundation areas on a normal plan-view shaded-relief map of the study area; the other gives an oblique perspective of the landscape with raised topography, as if one were viewing the landscape at an angle from an aircraft (Jenny and Patterson, 2007). LAHARZ was developed after the original hazard maps (based only on mapping of geologic deposits) were made. Predicted inundation zones on these maps provide an alternative approach to estimation of areas that could be inundated as lahars of different volumes pass through the valley. However, there is considerable uncertainty in the exact location of the hazard-zone boundaries shown on these maps, as well as on earlier maps.
Physical data of soil profiles formed on late Quaternary marine terraces near Santa Cruz, California
Munster, Jennie; Harden, Jennifer W.
2002-01-01
Margarita Sandstone. The Santa Cruz Mudstone is a thin to medium-bedded siliceous mudstone with nonsiliceous mudstone and siltstone and minor amounts of sandstone. The siliceous nature implies organic deposition in a quiescent, deep-water environment. Bedrock is mantled by 1–4 meters of medium to coarse-grained regressive beach sediment and fluvial deposits from the Ben Lomond Mountains. Terrace age increases with elevation above sea level, and weathering of primary minerals increases with age. The suite of soils formed on the terraces is referred to as a soil chronosequence. Soil chronosequences, important tools in characterizing natural weathering rates, are defined as a group of soils that differ in age and therefore in duration of weathering but have similar climatic conditions, vegetation, geomorphic position, and parent material (Jenny, 1941; Birkland, 1999). Soils are frequently useful indicators of geomorphic age (Muhs, 1982; Switzer and others, 1988) and are a function of pedogenic and/or eolian processes. Some aspects of soil development can be episodic but when viewed on large time scales can be perceived as continuous (Switzer and others, 1988). The age of the soil may be constrained by the age of the deposit, since soil formation generally commences when deposition has ceased (Birkland, 1999). Dating of the terraces provides an unprecedented opportunity to study weathering and soil-formation rates (Perg and others, 2001; Hanks and others, 1984; Bradley and Griggs, 1976; Bradley and Addicott, 1968; Bradley, 1956). Ages of the terraces recently dated by cosmogenic radionuclide are, starting with the youngest, 65, 92, 137, 139, and 226 k.y. (Perg and others, 2001). However, these ages are much younger than recent radiometric dates on mollusk shells (Muhs, U.S. Geological Survey, personal communication, 2002; Bradley and Addicott, 1968). For this study, soils were sampled on five terraces. Terrace one in the Lighthouse Field along Westcliff in Santa Cruz was the
Perrin, Mathieu; De Noblet-Ducoudré, Nathalie; Strada, Susanna; Stéfanon, Marc; Torre, André
2016-04-01
scope of solutions to be considered in the spatial planning field. Regional meteorology/climatology has demonstrated over the past decades that changes in land-uses and/or land cover may have substantial impacts on a) mean regional/local climate (Lobell & Bonfils, 2008), b) the magnitude and duration of extreme events (e.g. Marshall et al., 2004, Davin et al., 2014), c) air quality and therefore human's and ecosystems' health (e.g. Corchnoy et al. 1992, Hewitt et al., 2009). Such studies support the hypothesis that a careful regional climate modelling may help to refine the global climate projections and assess the local benefits or drawbacks of various land use/land cover policies. There is however a lack of studies at such spatial scales (from local to regional) to carefully quantify the impacts realistic land scenarios may have on atmospheric conditions (e.g. temperature, humidity, air quality, winds, incoming radiation). We have started to think about ways to evaluate those at the French national scale. That implies the choice of ad-hoc models, scenarios, data for evaluation, … that we will discuss. Our proposal is that in fine the regulation of the atmospheric boundary layer (where we live) may be considered as a service that land uses/cover/management may impact and that we need to study as much as other ecosystem services are. ____________ References: Bulkeley, H. (2006) A changing climate for spatial planning? In: Planning Theory and Practice, 7(2): 203-214. Corchnoy, S.B.; Arey, J.; Atkinson, R. (1992) Hydrocarbon emission from twelve urban shade trees of the Los Angeles, California, air basin. In: Atmospheric Environment, 26B(3): 339-348. Davoudi, S.; Crawford, Jenny; Mehmood, A. (2009) Planning for Climate Change: Strategies for Mitigation and Adaptation for Spatial Planners. London: Earthscan, 344 p. Davin, E. L.; Seneviratne, S. I.; Ciais, P.; Olioso, A.; Wang, T. (2014) Preferential cooling of hot extremes from cropland albedo management, Proceedings of
Elastic Knee Sleeves Limit Anterior Tibial Translation in Healthy Females
Directory of Open Access Journals (Sweden)
Robert Csapo, Simona Hosp, Ramona Folie, Robert Eberle, Michael Hasler, Werner Nachbauer
2016-03-01
aspect of the shank, just distal of the patella, recorded the anterior displacement of the tibia. Displacements were continuously recorded but only the discrete values coinciding with 50, 100, 150, 200 and 250 N were extracted for statistical analyses. The GNRB® system features a measurement accuracy of 0.1 mm and has been shown to be a valid tool for measurements of anterior knee laxity (Jenny et al., 2013. To control inadvertent coactivation of hamstring muscles, which may bias the results of arthrometry measurements (Steele et al., 1994, the integrated electromyographic (EMG activity of the biceps femoris and semitendinosus muscle was simultaneously recorded and normalized to additional recordings obtained during maximal voluntary contraction (MVC. These tests confirmed that, during arthrometry measurements, the EMG activities of biceps femoris and semitendinosus muscle were negligible and remained below 3% of MVC levels at all times. To assess measurement reliability, tests were repeated twice under both experimental conditions: first without and then after application of a light elastic knee sleeve (Cellacare Genu, Lohmann & Rauscher, Rengsdorf, Germany. According to the manufacturer’s information, this sleeve can be used for a variety of indications including injury prevention. Test-retest reliability of arthrometry measurements was excellent, as reflected by low typical measurement errors (0.08 mm and high correlation coefficients (r = 0.99, p < 0.001. Analysis of results (Figure 1 by factorial ANOVA revealed that the elastic sleeve tested in this study reduced the anterior displacement of the tibia by a small (max. 0.7 mm on average yet statistically significant amount (F(1,9 = 22.88, p = 0.001, r = 0.98. In an attempt to better understand the degree of protection provided by the sleeve, we determined its material properties by appending weight discs (2.5-15 kg, in steps of 2.5 kg to its dorsal aspect and measuring the resulting elongation. The resulting force
CERN prepares for the LHC and beyond
Energy Technology Data Exchange (ETDEWEB)
Rodgers, Peter
2000-05-01
of physicists are preparing the two detectors for the LHC. Both ATLAS and CMS have the same basic structure: an inner tracker to measure the paths of electrically charged particles; a calorimeter to measure the energy of charged and neutral particles; and a spectrometer to track muons, the only particles apart from neutrinos that will reach the outer region of the detector. The construction of the magnet will drive the rest of the schedule, says CMS spokesperson Michel Della Negra. The magnet will be tested around March 2004 and, if all goes well, the detector will be lowered 100 metres below ground. A major challenge for CMS is its scintillator crystals. The L3 detector at LEP used bismuth germanium oxide (BGO) crystals, explains Della Negra, but BGO is too slow for the LHC and would not survive the intense radiation levels either. That is why a new crystal material, lead tungstate, had to be developed specially for the LHC. Moreover, CMS needs 11 m{sup 3} of lead tungstate about 80 000 crystals whereas L3 needed only 1 m{sup 3} of BGO. Half of the crystals will come from Russia and half from China. One of the major challenges when building the detectors is to ensure that the electronics for the inner tracker can survive the intense radiation produced there, and also take up as little volume inside the detector as possible, explains Peter Jenni,spokesperson for ATLAS. Many of the components for ATLAS have already been built, he says. For instance, 12 of the 64 modules needed for the barrel of the hadronic tile calorimeter have been completed and are now at CERN. ATLAS is budgeted to cost SwFr 475m. Both collaborations are also now looking closely at the issue of computing and how to cope with the enormous amounts of data that will flow from the LHC detectors. Although fundamental physics is CERN's top priority, the lab has started to pay more attention to technology transfer in recent years. ''Technology transfer has always happened at CERN, but now
CERN prepares for the LHC and beyond
International Nuclear Information System (INIS)
Rodgers, Peter
2000-01-01
structure: an inner tracker to measure the paths of electrically charged particles; a calorimeter to measure the energy of charged and neutral particles; and a spectrometer to track muons, the only particles apart from neutrinos that will reach the outer region of the detector. The construction of the magnet will drive the rest of the schedule, says CMS spokesperson Michel Della Negra. The magnet will be tested around March 2004 and, if all goes well, the detector will be lowered 100 metres below ground. A major challenge for CMS is its scintillator crystals. The L3 detector at LEP used bismuth germanium oxide (BGO) crystals, explains Della Negra, but BGO is too slow for the LHC and would not survive the intense radiation levels either. That is why a new crystal material, lead tungstate, had to be developed specially for the LHC. Moreover, CMS needs 11 m 3 of lead tungstate about 80 000 crystals whereas L3 needed only 1 m 3 of BGO. Half of the crystals will come from Russia and half from China. One of the major challenges when building the detectors is to ensure that the electronics for the inner tracker can survive the intense radiation produced there, and also take up as little volume inside the detector as possible, explains Peter Jenni, spokesperson for ATLAS. Many of the components for ATLAS have already been built, he says. For instance, 12 of the 64 modules needed for the barrel of the hadronic tile calorimeter have been completed and are now at CERN. ATLAS is budgeted to cost SwFr 475m. Both collaborations are also now looking closely at the issue of computing and how to cope with the enormous amounts of data that will flow from the LHC detectors. Although fundamental physics is CERN's top priority, the lab has started to pay more attention to technology transfer in recent years. ''Technology transfer has always happened at CERN, but now it is more proactive and explicit'', says Juan Antonio Rubio, head of CERN's newly created education and technology transfer
Maximilien Brice
2011-01-01
During his visit he toured the ATLAS underground experimental area with Giora Mikenberg of the ATLAS collaboration, Weizmann Institute of Sciences and Israeli industrial liaison office, Rolf Heuer, CERN’s director-general, and Fabiola Gianotti, ATLAS spokesperson. The president also visited the CERN computing centre and met Israeli scientists working at CERN.
The 26th International Physics Olympiad: On top down under!
1996-01-01
As they opened the plane door on arrival at Canberra it was like stepping inside a freezer. I had escaped from the heatwave in Britain to experience winter in Australia. I have not found anyone who believes that there was really frost! The Australian welcome did its best to combat the cold, however, and Professor Rod Jury had soon introduced our guides and got us settled in on the campus of Canberra University. The British team of five students, selected through the British Physics Olympiad, were: Alan Bain of Birkenhead School, Chris Blake of King Edward VI School, Southampton, Richard Davies of Dulwich College, Tom Down of Embley Park School, Romsey and Chris Webb of Royal Grammar School, Worcester. The two Leaders of the party were Cyril Isenberg of the University of Kent and Guy Bagnall of Harrow School. Chris Robson of St Bee's School and myself from Stoke on Trent Sixth form College were interested Observers and Guy's wife, Jenny, completed the party. For the old hands there were many friendships stretching back years to renew, and with 51 countries this year many new ones to be made. Â Photo Figure 1. Photograph taken by C Robson of the British Physics Team immediately after the Awards Ceremony in Canberra in July 1995. From left to right: Chris Webb, Richard Davies, Tom Down, Alan Bain and Chris Blake. In addition to the confusion caused by the Sun being in the North and the Moon appearing to lie on its back, we had to get used to the flocks of chattering parrots browsing on the lawns and the kangaroos on campus! Everyone was presented with a boomerang and there were several sessions introducing the art of throwing them, even in the dark! The Opening Ceremony was colourful and a good mix of ceremony and fun with the Aboriginal entertainment and the Flame of Science to be lit. This was followed by my first examiners' meeting. Once the questions have been introduced no one is allowed to leave the group until ten hours later when the students are in bed! The
Directory of Open Access Journals (Sweden)
Francis Jeffry Pelletier
2010-12-01
Full Text Available Strawson (1959 described ‘descriptive metaphysics’, Bach (1986a described ‘natural language metaphysics’, Sapir (1929 and Whorf (1940a,b, 1941 describe, well, Sapir-Whorfianism. And there are other views concerning the relation between correct semantic analysis of linguistic phenomena and the “reality” that is supposed to be thereby described. I think some considerations from the analyses of the mass-count distinction can shed some light on that very dark topic.ReferencesBach, Emmon. 1986a. ‘Natural Language Metaphysics’. In Ruth Barcan Marcus, G.J.W. Dorn & Paul Weingartner (eds. ‘Logic, Methodology, and Philosophy of Science, VII’, 573–595. Amsterdam: North Holland.Bach, Emmon. 1986b. ‘The Algebra of Events’. Linguistics and Philosophy 9: 5–16.Berger, Peter & Luckmann, Thomas. 1966. The Social Construction of Reality: A Treatise in the Sociology of Knowledge. New York: Doubleday.Boroditsky, Lera, Schmidt, Lauren & Phillips, Webb. 2003. ‘Sex, Syntax, and Semantics’. In Dedre Gentner & Susan Goldin-Meadow (eds. ‘Language in Mind: Advances in the Study of Language and Cognition’, 59–80. Cambridge, MA: MIT Press.Cheng, L. & Sybesma, R. 1999. ‘Bare and Not-So-Bare Nouns and the structure of NP’. Linguistic Inquiry 30: 509–542.http://dx.doi.org/10.1162/002438999554192Chierchia, Gennaro. 1998a. ‘Reference to Kinds across Languages’. Natural Language Semantics 6: 339–405.http://dx.doi.org/10.1023/A:1008324218506Chierchia, Gennaro. 1998b. ‘Plurality of Mass Nouns and the Notion of ‘Semantic Parameter’ ’. In S. Rothstein (ed. ‘Events and Grammar’, 53–103. Dordrecht: Kluwer.Chierchia, Gennaro. 2010. ‘Mass Nouns, Vagueness and Semantic Variation’. Synthèse 174: 99–149.http://dx.doi.org/10.1007/s11229-009-9686-6Doetjes, Jenny. 1997. Quantifiers and Selection: On the Distribution of Quantifying Expressions in French, Dutch and English. Ph.D. thesis, University of Leiden, Holland
Main Parameters of Soil Quality and it's Management Under Changing Climate
László Phd, M., ,, Dr.
2009-04-01
). Gregorich et al. (1994) state that "soil quality is a composite measure of both a soil's ability to function and how well it functions, relative to a specific use." Increasingly, contemporary discussion of soil quality includes the environmental cost of production and the potential for reclamation of degraded soils (Várallyay, 2005). Reasons for assessing soil quality in an agricultural or managed system may be somewhat different than reasons for assessing soil quality in a natural ecosystem. In an agricultural context, soil quality may be managed, to maximize production without adverse environmental effect, while in a natural ecosystem, soil quality may be observed, as a baseline value or set of values against which future changes in the system may be compared (Várallyay, 1994; Cook and Hendershot, 1996; Németh, 1996; Malcolm, 2000; Márton et al. 2007). Soil quality has historically been equated with agricultural productivity, and thus is not a new idea. Soil conservation practices to maintain soil productivity are as old as agriculture itself, with documentation dating to the Roman Empire (Jenny, 1961). The Storie Index (Storie, 1932) and USDA Land Capability Classification (Klingebiel and Montgomery, 1973) were developed to separate soils into different quality classes. Soil quality is implied in many decisions farmers make about land purchases and management, and in the economic value rural assessors place on agricultural land for purposes of taxation. Beginning in the 1930s, soil productivity ratings were developed in the United States and elsewhere to help farmers select crops and management practices that would maximize production and minimize erosion or other adverse environmental effects (Huddleston, 1984). These rating systems are important predecessors of recent attempts to quantitatively assess soil quality. In the 1970s, attempts were made to identify and protect soils of the highest productive capacity by defining "prime agricultural lands" (Miller, 1979
Directory of Open Access Journals (Sweden)
Ugur Demiray
2013-01-01
guidelines training either by traditional or by an Internet-based CME. In the 23th article, again from Turkey. Written by Mehmet FIRAT from Department of Distance Education, Anadolu University, Eskisehir, on. In this study, these two conditions faced by digital natives were compared, and some suggestions have been put forward for the digital native learners. The 24th article written by Mohammad Imam FARISI on “OER on The Asian Mega Universities: Developments, Motives, Openness, and Sustainability”, from Faculty of Education, Department of Social Studies Universitas Terbuka - Surabaya Regional Office, INDONESIA. This study focuses on the developments, motives, openness, and sustainability of OER at the six MUs official websites in Asia. The article 25th is titled as “R Vitual Classroom Participant Views For Effective Synchronous Education Process”, is written by Selçuk KARAMAN, Melike AYDEMIR, Gürkan YILDIRIM from Atatürk University, Erzurum and Sevda KUÇUK from Istanbul University, Istanbul, TURKEY. The aim of this study is to determine the key components which make VC sessions effective in terms of environment and method. Determination of these components and their effects through experiences of VC is important to improve the design and management of VC sessions. In this case study, VC experiences at theology bachelor’s completion degree distance education program are examined. The 27th article is about “Meaningful Engagement in Facebook Learning Environments: Merging Social And Academic Lives” written by Jenny WANG, Chun-Fu C. Lin, Wei-Chieh W. Yu, & Emily Wu, Yuin Taiwan. This study compared the effectiveness of different learning environments between interactive Facebook instructional method and non-Facebook instructional method for undergraduate students. Two outcome dimensions were measured: student grades and learning engagement. Article 27 written by Sangeeta MALIK from Symbiosis Centre for Distance Learning Pune, Maharashtra, INDIA on Distance
Directory of Open Access Journals (Sweden)
Ugur Demiray
Internet-based CME.In the 23th article, again from Turkey. Written by Mehmet FIRAT from Department of Distance Education, Anadolu University, Eskisehir, on. In this study, these two conditions faced by digital natives were compared, and some suggestions have been put forward for the digital native learners.The 24th article written by Mohammad Imam FARISI on “OER on The Asian Mega Universities: Developments, Motives, Openness, and Sustainability”, from Faculty of Education, Department of Social Studies Universitas Terbuka - Surabaya Regional Office, INDONESIA. This study focuses on the developments, motives, openness, and sustainability of OER at the six MUs official websites in Asia.12The article 25th is titled as “R Vitual Classroom Participant Views For Effective Synchronous Education Process”, is written by Selçuk KARAMAN, Melike AYDEMIR, Gürkan YILDIRIM from Atatürk University, Erzurum and Sevda KUÇUK from Istanbul University, Istanbul, TURKEY. The aim of this study is to determine the key components which make VC sessions effective in terms of environment and method. Determination of these components and their effects through experiences of VC is important to improve the design and management of VC sessions. In this case study, VC experiences at theology bachelor’s completion degree distance education program are examined.The 27th article is about “Meaningful Engagement in Facebook Learning Environments: Merging Social And Academic Lives” written by Jenny WANG, Chun-Fu C. Lin, Wei-Chieh W. Yu, & Emily Wu, Yuin Taiwan. This study compared the effectiveness of different learning environments between interactive Facebook instructional method and non-Facebook instructional method for undergraduate students. Two outcome dimensions were measured: student grades and learning engagement.Article 27 written by Sangeeta MALIK from Symbiosis Centre for Distance Learning Pune, Maharashtra, INDIA on Distance Educator: A Multiskill Personality, In this article
2014-01-01
living systems. B.15 High-resolution Orbitrap Characterization of Preferential Chain Pairing in Co-expressed Bispecific Antibody Production by MS Under Native and Acidic Conditions Luis Schachner, Jianhui Zhou, Luke McCarty, Diego Ellerman, Michael Dillon, Christoph Spiess, Jennie Lill, Paul Carter, Wendy Sandoval Departments of Protein Chemistry and Antibody Engineering, Genentech, Inc., South San Francisco, CA, USA Bispecific antibodies possess the characteristics and binding specificity of two distinct monoclonal antibodies, and as such can bind to two targets or epitopes simultaneously. Bispecific antibodies have recently received great attention for their promising results in clinical trials or potential new modes to deliver therapeutics. Generation of a bispecific antibody by co-expression of two light and heavy chains, would result in several mispaired species. While the “knobs-into-holes” technology enables efficient hetero-dimerization of the two heavy chains, the presumed random mispairing of the light chains has not been studied in detail as technologies to readily characterize and quantify the heterodimer species were missing. Using an anti-IL-4/IL-13, a bispecific antibody, which targets the IL-4 and IL-13 cytokines involved in type 2 cytokine-induced inflammation, we describe a mass spectrometry characterization assay under native and acidic conditions for co-expressed bispecific antibodies using an Exactive Plus Extended Mass Range (EMR) Orbitrap instrument. The high mass resolving power of the EMR Orbitrap allows unambiguous identification of all light and heavy chain pairing variants in a mixture of bispecific antibodies randomly assembled in vivo upon co-expression. Using the EMR Orbitrap technology, we identify and characterize the preferential pairing of the anti-IL-13 light chain to its cognate heavy chain. This unexpected, non-random pairing may be leveraged to guide the design of a single-cell solution for the production of bispecific