WorldWideScience

Sample records for mares equus caballus

  1. Comparative endocrinological responses to short transportation of Equidae (Equus asinus and Equus caballus).

    Science.gov (United States)

    Fazio, Esterina; Medica, Pietro; Cravana, Cristina; Aveni, Francesca; Ferlazzo, Adriana

    2013-03-01

    In order to evaluate the effects of short transportation on β-endorphin, adrenocorticotropic hormone (ACTH) and cortisol changes, 12 healthy stallions of Equidae (Equus asinus and Equus caballus) were studied before and after transportation of 50 km. Blood samples were collected 1 week before transportation in basal conditions, immediately before loading and after transportation and unloading, on their arrival at the breeding station. Compared to basal and before values, donkeys showed an increase in circulating ACTH (P donkeys. Horses facing forward (direction of travel) showed higher (P donkeys; horses facing backward (the opposite direction of travel) showed lower (P donkeys and only of cortisol in horses, suggesting that transportation for donkeys may be more stressful than horses. © 2012 The Authors Animal Science Journal © 2012 Japanese Society of Animal Science.

  2. Identification and the primary structure of equine alpha-lactalbumin B and C (Equus caballus, Perissodactyla).

    Science.gov (United States)

    Godovac-Zimmermann, J; Shaw, D; Conti, A; McKenzie, H

    1987-04-01

    The presence of two new alpha-lactalbumins has been demonstrated in the colostrum of a single mare (Equus caballus, Persian Arab). They have been designated equine alpha-lactalbumin B and C, and that isolated previously from the milk of Australian horses (English Thoroughbred) as alpha-lactalbumin A. The primary structures of B/C have been determined by automatic Edman degradation of enzymatic cleavage of the oxidized protein. Cyanogen bromide cleavage of S-carbamoyl-methylated protein provided necessary overlapping peptides. Comparison of the sequences of B and C with that of A indicates 3 and 4 amino-acid exchanges, respectively. The phylogenetic difference of equine alpha-lactalbumin B/C from bovine alpha-lactalbumin B is indicated by 39 and 40 amino-acid exchanges, respectively. The structure-function relationship, calcium binding sites and variants of alpha-lactalbumin are discussed.

  3. Immunocontraception in wild horses (Equus caballus extends reproductive cycling beyond the normal breeding season.

    Directory of Open Access Journals (Sweden)

    Cassandra M V Nuñez

    Full Text Available BACKGROUND: Although the physiological effects of immunocontraceptive treatment with porcine zona pellucida (PZP have been well studied, little is known about PZP's effects on the scheduling of reproductive cycling. Recent behavioral research has suggested that recipients of PZP extend the receptive breeding period into what is normally the non-breeding season. METHODOLOGY/PRINCIPAL FINDINGS: To determine if this is the case, we compiled foaling data from wild horses (Equus caballus living on Shackleford Banks, North Carolina for 4 years pre- and 8 years post-contraception management with PZP (pre-contraception, n = 65 births from 45 mares; post-contraception, n = 97 births from 46 mares. Gestation lasts approximately 11-12 months in wild horses, placing conception at approximately 11.5 months prior to birth. Since the contraception program began in January 2000, foaling has occurred over a significantly broader range than it had before the contraception program. Foaling in PZP recipients (n = 45 births from 27 mares has consistently occurred over a broader range than has foaling in non-recipients (n = 52 births from 19 mares. In addition, current recipients of PZP foaled later in the year than did prior recipient and non-recipient mares. Females receiving more consecutive PZP applications gave birth later in the season than did females receiving fewer applications. Finally, the efficacy of PZP declined with increasing consecutive applications before reaching 100% after five consecutive applications. CONCLUSIONS/SIGNIFICANCE: For a gregarious species such as the horse, the extension of reproductive cycling into the fall months has important social consequences, including decreased group stability and the extension of male reproductive behavior. In addition, reproductive cycling into the fall months could have long-term effects on foal survivorship. Managers should consider these factors before enacting immunocontraceptive programs in new

  4. Differentiation of Meat Samples from Domestic Horses ( Equus caballus and Asiatic Wild Asses ( Equus hemionus Using a Species-Speci fi c Restriction Site in the Mitochondrial Cytochrome b Region

    Directory of Open Access Journals (Sweden)

    Ralph Kuehn

    2006-12-01

    Full Text Available Recent studies suggest that Asiatic wild asses ( Equus hemionus are being increasingly poached in a commercial fashion. Part of the meat is believed to reach the meat markets in the capital Ulaanbaatar. To test this hypothesis, we collected 500 meat samples between February and May 2006. To differentiate between domestic horse ( Equus caballus and wild ass meat, we developed a restriction fragment length polymorphism (RFLP assay based on the polymerase chain reaction (PCR. We ampli fi ed and sequenced a cytochrome b fragment (335 bp and carried out a multialignment of the generated sequences for the domestic horse, the Asiatic wild ass, the domestic donkey ( Equus asinus and the Przewalski’s horse ( Equus ferus przewalskii . We detected a species-speci fi c restriction site (AatII for the Asiatic wild ass, resulting in a speci fi c restriction fragment length polymorphism (RFLP band pattern. This RFLP assay represents a rapid and cost-effective method to detect wild ass meat. All of the 500 meat samples we collected and analysed within this pilot project proved to be domestic horsemeat as declared by the sales people. Thus, either the assumption that wild ass meat is sold as “cheap horse meat” is wrong, or we picked the wrong markets, products or season.

  5. Injection-Site Reactions in Wild Horses (Equus caballus) Receiving an Immunocontraceptive Vaccine

    Science.gov (United States)

    Roelle, James E.; Ransom, Jason I.

    2009-01-01

    The U.S. Geological Survey and the Bureau of Land Management are conducting research on the efficacy of the immunocontraceptive agent porcine zona pellucida (PZP) in reducing fertility of wild horses (Equus caballus). As an antigen, PZP stimulates antibody production when injected into many mammalian species. These antibodies bind to the external surface of the ovum, preventing fertilization. By itself, PZP is only weakly immunogenic and is therefore delivered with an adjuvant, most commonly one of the Freund adjuvants, designed to further stimulate antibody production. Freund's complete adjuvant (FCA) in particular is known to be very effective, but may also be associated with undesirable side effects such as formation of abscesses at injection sites. Such reactions may be exacerbated when accompanied by the additional trauma of a remotely delivered dart. Because horses in our three study herds were individually identifiable by color markings and harem association, we were able to monitor mares for injection-site reactions (abscesses, nodules, swelling, and stiffness) following inoculation with PZP. In 100 injections delivered by hand we observed a single nodule, two instances of swelling, and no other reactions. In two herds that received remotely delivered (dart) injections, the frequency of reactions was about 1 and 6 percent for abscesses, 25 percent for nodules (both herds), 11 and 33 percent for swelling, and 1 and 12 percent for stiffness. Abscesses were too infrequent to allow meaningful analysis of the relation to covariates, but for the other types of reactions we used logistic regression to examine the relation of occurrence to the delivery method (rifle or CO2-powered blowgun), adjuvant (FCA, Freund's modified adjuvant, and Freund's incomplete adjuvant), dart trauma (normal or abnormal), and age of mare. Abnormal dart trauma included cases where the dart hit bone or the needle broke off. We found strong evidence (odds ratio = 5.023, P = 0.001) for a

  6. Trained Quantity Abilities in Horses (Equus caballus: A Preliminary Investigation

    Directory of Open Access Journals (Sweden)

    Maria Elena Miletto Petrazzini

    2014-07-01

    Full Text Available Once believed to be a human prerogative, the capacity to discriminate between quantities now has also been reported in several vertebrates. To date, only two studies investigated numerical abilities in horses (Equus caballus but reported contrasting data. To assess whether horses can be trained to discriminate between quantities, I have set up a new experimental protocol using operant conditioning. One adult female was trained to discriminate between 1 and 4 (Test 1 in three different conditions: non-controlled continuous variables (numerical and continuous quantities that co-vary with number are simultaneously available, 50% controlled continuous variables (intermediate condition, and 100% controlled continuous variables (only numerical information available. The subject learned the discrimination in all conditions, showing the capacity to process numerical information. When presented with a higher numerical ratio (2 vs. 4, Test 2, the subject still discriminated between the quantities but its performance was statistically significant only in the non-controlled condition, suggesting that the subject used multiple cues in presence of a more difficult discrimination. On the whole, the results here reported encourage the use of this experimental protocol as a valid tool to investigate the capacity to process numerical and continuous quantities in horses in future research.

  7. Low plasma cortisol and fecal cortisol metabolite measures as indicators of compromised welfare in domestic horses (Equus caballus.

    Directory of Open Access Journals (Sweden)

    Jodi Pawluski

    Full Text Available The hypothalamic-pituitary-adrenal (HPA axis response to chronic stress is far from straight forward, particularly with regards to animal welfare. There are reports of no effect as well as both decreases and increases in cortisol after chronic stressors. Therefore, the first aim of the present study was to determine how measures of compromised welfare, such as chronic pain and haematological anomalies, related to cortisol levels in domestic horses (Equus caballus. Domestic horses are an informative model to investigate the impact of chronic stress (due to environment, pain, work, housing conditions… on the HPA axis. The second aim was to determine whether levels of fecal cortisol metabolites (FCM may be used as an indicator of welfare measures. The present study used fifty-nine horses (44 geldings and 15 mares, from three riding centres in Brittany, France. The primary findings show that horses whose welfare was clearly compromised (as indicated by an unusual ears backward position, presence of vertebral problems or haematological anomalies, e.g. anaemia also had lower levels of both FCM and plasma cortisol. This work extends our previous findings showing that withdrawn postures, indicators of depressive-like behavior in horses, are associated with lower plasma cortisol levels. We also found that evening plasma cortisol levels positively correlated with FCM levels in horses. Future research aims to determine the extent to which factors of influence on welfare, such as living conditions (e.g. single stalls versus group housing in pasture or paddocks, early life factors, and human interaction, act as mediators of cortisol levels in horses.

  8. Evolutionary constraints on equid domestication: Comparison of flight initiation distances of wild horses (Equus caballus ferus) and plains zebras (Equus quagga).

    Science.gov (United States)

    Brubaker, Alexali S; Coss, Richard G

    2015-11-01

    Habituation to humans was an essential component of horse (Equus caballus ferus) domestication, with the nondomestication of zebras (Equus quagga) possibly reflecting an adaptive constraint on habituation. We present the human hunting hypothesis, arguing that ancestral humans hunted African animals, including zebras, long enough to promote a persistent wariness of humans, whereas a briefer period of hunting horses in Central Asia influenced by glacial cycles was unlikely to produce an equally persistent wariness. An alternative habituation to humans hypothesis, prompted by field observations, posits that zebras can habituate well to nonthreatening humans given sufficient exposure. If so, other factors must account for zebra nondomestication. To examine these hypotheses, we compared the flight initiation distances (FIDs) of wild horses in the United States and plains zebras in Africa to a human approaching on foot (N = 87). We compared the flight behavior of both species at sites with low and high exposure to humans (mean humans/acre = .004 and .209, respectively). Analyses revealed a significant interaction (p = .0001) between equid species and level of human exposure. The mean FIDs of horses (146 m) and zebras (105 m) with low human exposure did not differ appreciably (p = .412), but these distances were substantially longer (p < .0001) than those of horses (17 m) and zebras (37 m) with high human exposure that did differ significantly (p < .0001). The finding that plains zebras habituate less completely to humans than horses do might reflect an adaptive response to historical hunting and partly explain their resistance to domestication. (c) 2015 APA, all rights reserved).

  9. Cognition and learning in horses (Equus caballus): What we know and why we should ask more.

    Science.gov (United States)

    Brubaker, Lauren; Udell, Monique A R

    2016-05-01

    Horses (Equus caballus) have a rich history in their relationship with humans. Across different cultures and eras they have been utilized for work, show, cultural rituals, consumption, therapy, and companionship and continue to serve in many of these roles today. As one of the most commonly trained domestic animals, understanding how horses learn and how their relationship with humans and other horses impacts their ability to learn has implications for horse welfare, training, husbandry and management. Given that unlike dogs and cats, domesticated horses have evolved from prey animals, the horse-human relationship poses interesting and unique scientific questions of theoretical value. There is still much to be learned about the cognition and behaviour of horses from a scientific perspective. This review explores current research within three related areas of horse cognition: human-horse interactions, social learning and independent learning in horses. Research on these topics is summarized and suggestions for future research are provided. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Domestic horses (Equus ferus caballus) fail to intuitively reason about object properties like solidity and weight.

    Science.gov (United States)

    Haemmerli, Sarah; Thill, Corinne; Amici, Federica; Cacchione, Trix

    2018-05-01

    From early infancy, humans reason about the external world in terms of identifiable, solid, cohesive objects persisting in space and time. This is one of the most fundamental human skills, which may be part of our innate conception of object properties. Although object permanence has been extensively studied across a variety of taxa, little is known about how non-human animals reason about other object properties. In this study, we therefore tested how domestic horses (Equus ferus caballus) intuitively reason about object properties like solidity and height, to locate hidden food. Horses were allowed to look for a food reward behind two opaque screens, only one of which had either the proper height or inclination to hide food rewards. Our results suggest that horses could not intuitively reason about physical object properties, but rather learned to select the screen with the proper height or inclination from the second set of 5 trials.

  11. Chromosomal assignment of six genes (EIF4G3, HSP90, RBBP6, IL8, TERT, and TERC) in four species of the genus Equus.

    Science.gov (United States)

    Vidale, Pamela; Piras, Francesca M; Nergadze, Solomon G; Bertoni, Livia; Verini-Supplizi, Andrea; Adelson, David; Guérin, Gérard; Giulotto, Elena

    2011-01-01

    We mapped six genes (EIF4G3, HSP90, RBBP6, IL8, TERT, and TERC) on the chromosomes of Equus caballus, Equus asinus, Equus grevyi, and Equus burchelli by fluorescence in situ hybridization. Our results add six type I markers to the cytogenetic map of these species and provide new information on the comparative genomics of the genus Equus. Copyright © Taylor & Francis Group, LLC

  12. Interspecific communication from people to horses (Equus ferus caballus) is influenced by different horsemanship training styles.

    Science.gov (United States)

    Dorey, Nicole R; Conover, Alicia M; Udell, Monique A R

    2014-11-01

    The ability of many domesticated animals to follow human pointing gestures to locate hidden food has led to scientific debate on the relative importance of domestication and individual experience on the origins and development of this capacity. To further explore this question, we examined the influence of different prior training histories/methods on the ability of horses (Equus ferus caballus) to follow a momentary distal point. Ten horses previously trained using one of two methods (Parelli™ natural horsemanship or traditional horse training) were tested using a standard object choice task. The results show that neither group of horses was initially able to follow the momentary distal point. However, after more experience with the point, horses previously trained using the Parelli natural horsemanship method learned to follow momentary distal points significantly faster than those previously trained with traditional methods. The poor initial performance of horses on distal pointing tasks, coupled with the finding that prior training history and experimental experience can lead to success on this task, fails to support the predictions of the domestication hypothesis and instead lends support to the two-stage hypothesis. (PsycINFO Database Record (c) 2014 APA, all rights reserved).

  13. First evidence of Equus asinus L. in the Chalcolithic disputes the Phoenicians as the first to introduce donkeys into the Iberian Peninsula

    DEFF Research Database (Denmark)

    Cardoso, João L.; Mouatt, Julia Thidamarth Vilstrup; Eisenmann, Véra

    2013-01-01

    Two equid species have been documented in the Pleistocene of the Iberian Peninsula, the horse Equus caballus, and the Eurasian hemione Equus hydruntinus. While the former survived the Holocene–Pleistocene until now, the timing for the extinction of the latter is unclear. Scarce, fragmented archae...

  14. Mitochondrial DNA evolution in the genus Equus.

    Science.gov (United States)

    George, M; Ryder, O A

    1986-11-01

    Employing mitochondrial DNA (mtDNA) restriction-endonuclease maps as the basis of comparison, we have investigated the evolutionary affinities of the seven species generally recognized as the genus Equus. Individual species' cleavage maps contained an average of 60 cleavage sites for 16 enzymes, of which 29 were invariant for all species. Based on an average divergence rate of 2%/Myr, the variation between species supports a divergence of extant lineages from a common ancestor approximately 3.9 Myr before the present. Comparisons of cleavage maps between Equus przewalskii (Mongolian wild horse) and E. caballus (domestic horse) yielded estimates of nucleotide sequence divergence ranging from 0.27% to 0.41%. This range was due to intraspecific variation, which was noted only for E. caballus. For pairwise comparisons within this family, estimates of sequence divergence ranged from 0% (E. hemionus onager vs. E. h. kulan) to 7.8% (E. przewalskii vs. E. h. onager). Trees constructed according to the parsimony principle, on the basis of 31 phylogenetically informative restriction sites, indicate that the three extant zebra species represent a monophyletic group with E. grevyi and E. burchelli antiquorum diverging most recently. The phylogenetic relationships of E. africanus and E. hemionus remain enigmatic on the basis of the mtDNA analysis, although a recent divergence is unsupported.

  15. Population viability analysis on domestic horse breeds (Equus caballus)

    DEFF Research Database (Denmark)

    Thirstrup, Janne Pia; Bach, Lars; Loeschcke, Volker

    2009-01-01

    simulation package was used for the population viability analysis. First, we investigated the future viability of these breeds based on present demographic and environmental parameters. Second, a sensitivity analysis revealed the most important variables for the viability of these breeds. Third, we examined...... concerning reproduction of the mares had the greatest impact, with the number of mares actively breeding being the most influential on the population forecasts. The results suggest that closing the Knabstrupper studbooks can be done only if increasing the number of mares actively breeding counteracts...... the loss of genetic variation attributable to such a management strategy. It is recommended, based on these results, that the number of Frederiksborg and Knabstrupper mares actively breeding must be increased to approximately 30% in the 2 breeds that are presently using only 13%, while leaving the third...

  16. Genetic diversity detection of the domestic horse (Equus caballus by genes associated with coat color

    Directory of Open Access Journals (Sweden)

    Luz Correa A

    2015-09-01

    Full Text Available Objective. To assess the population structure and genetic diversity in populations of domestic horse (Equus caballus in the municipality Cienaga de Oro-Córdoba (Colombia. Materials and methods. Random sampling were conducted between August and October 2013, in adult animals on farms seven districts, which was carried out phenotypic characterization of each animal, based on autosomal markers encoding morphological Extension (E , Agouti (A, Cream (C, White (W, Gray (G, Tobiano (TO, Overo (O and Roan (RN. Population genetic parameters: allele frequency, genetic diversity, gene flow, Hardy-Weinberg equilibrium and genetic distance were calculated through the program POPGENE 1.31; the genetic structure was assessed using the program FSTAT v. 2.9.3.2. Results. 341 individuals were analyzed in the seven populations studied, where the Extension gene Was the MOST faq frequently as the Overo and Tobiano genes showed the lowest values. Insignificant values of genetic variability and population recorded a global level, likewise, low genetic differentiation among populations, accompanied by a high gene flow was obtained; an excess of heterozygotes at population and global level was observed; to this is added the presence of Hardy-Weinberg equilibrium in all populations relative to the markers studied and low genetic distance values were reported. Conclusions. The populations are highly genetically related, a situation that may result from the existing geographical proximity between them, favoring genetic exchange and the establishment of a metapopulation.

  17. First evidence of autochthonous cases of Leishmania (Leishmania) infantum in horse (Equus caballus) in the Americas and mixed infection of Leishmania infantum and Leishmania (Viannia) braziliensis.

    Science.gov (United States)

    Soares, Isabel R; Silva, Soraia O; Moreira, Filipe Moraghi; Prado, Luan Gavião; Fantini, Priscila; Maranhão, Renata de Pino Albuquerque; da Silva Filho, José Monteiro; Melo, Maria Norma; Palhares, Maristela S

    2013-11-08

    This study reports the first evidence of infection by Leishmania infantum in Equus caballus in Americas and the first mixed infection of L. infantum/Leishmania braziliensis on this mammalian species in the world. The diagnoses was based on presence of parasites in lesions and bone marrow aspirates, their identification by using specific primers for L. infantum and L. braziliensis complexes and also serological methods IFAT and ELISA. The analysis of the PCR products suggested mixed infection in three animals. Further studies involving equine leishmaniasis are carrying out in order to clarify the dynamic of Leishmania sp. in this mammalian specie and their role in the transmission of those parasites in urban endemic area of Belo Horizonte, Minas Gerais State, Brazil. Copyright © 2013 Elsevier B.V. All rights reserved.

  18. Phylogeny of horse chromosome 5q in the genus Equus and centromere repositioning.

    Science.gov (United States)

    Piras, F M; Nergadze, S G; Poletto, V; Cerutti, F; Ryder, O A; Leeb, T; Raimondi, E; Giulotto, E

    2009-01-01

    Horses, asses and zebras belong to the genus Equus and are the only extant species of the family Equidae in the order Perissodactyla. In a previous work we demonstrated that a key factor in the rapid karyotypic evolution of this genus was evolutionary centromere repositioning, that is, the shift of the centromeric function to a new position without alteration of the order of markers along the chromosome. In search of previously undiscovered evolutionarily new centromeres, we traced the phylogeny of horse chromosome 5, analyzing the order of BAC markers, derived from a horse genomic library, in 7 Equus species (E. caballus, E. hemionus onager, E. kiang, E. asinus, E. grevyi, E. burchelli and E. zebra hartmannae). This analysis showed that repositioned centromeres are present in E. asinus (domestic donkey, EAS) chromosome 16 and in E. burchelli (Burchell's zebra, EBU) chromosome 17, confirming that centromere repositioning is a strikingly frequent phenomenon in this genus. The observation that the neocentromeres in EAS16 and EBU17 are in the same chromosomal position suggests that they may derive from the same event and therefore, E. asinus and E. burchelli may be more closely related than previously proposed; alternatively, 2 centromere repositioning events, involving the same chromosomal region, may have occurred independently in different lineages, pointing to the possible existence of hot spots for neocentromere formation. Our comparative analysis also showed that, while E. caballus chromosome 5 seems to represent the ancestral configuration, centric fission followed by independent fusion events gave rise to 3 different submetacentric chromosomes in other Equus lineages. (c) 2009 S. Karger AG, Basel.

  19. Uncoupling of satellite DNA and centromeric function in the genus Equus.

    Science.gov (United States)

    Piras, Francesca M; Nergadze, Solomon G; Magnani, Elisa; Bertoni, Livia; Attolini, Carmen; Khoriauli, Lela; Raimondi, Elena; Giulotto, Elena

    2010-02-12

    In a previous study, we showed that centromere repositioning, that is the shift along the chromosome of the centromeric function without DNA sequence rearrangement, has occurred frequently during the evolution of the genus Equus. In this work, the analysis of the chromosomal distribution of satellite tandem repeats in Equus caballus, E. asinus, E. grevyi, and E. burchelli highlighted two atypical features: 1) several centromeres, including the previously described evolutionary new centromeres (ENCs), seem to be devoid of satellite DNA, and 2) satellite repeats are often present at non-centromeric termini, probably corresponding to relics of ancestral now inactive centromeres. Immuno-FISH experiments using satellite DNA and antibodies against the kinetochore protein CENP-A demonstrated that satellite-less primary constrictions are actually endowed with centromeric function. The phylogenetic reconstruction of centromere repositioning events demonstrates that the acquisition of satellite DNA occurs after the formation of the centromere during evolution and that centromeres can function over millions of years and many generations without detectable satellite DNA. The rapidly evolving Equus species gave us the opportunity to identify different intermediate steps along the full maturation of ENCs.

  20. Uncoupling of satellite DNA and centromeric function in the genus Equus.

    Directory of Open Access Journals (Sweden)

    Francesca M Piras

    2010-02-01

    Full Text Available In a previous study, we showed that centromere repositioning, that is the shift along the chromosome of the centromeric function without DNA sequence rearrangement, has occurred frequently during the evolution of the genus Equus. In this work, the analysis of the chromosomal distribution of satellite tandem repeats in Equus caballus, E. asinus, E. grevyi, and E. burchelli highlighted two atypical features: 1 several centromeres, including the previously described evolutionary new centromeres (ENCs, seem to be devoid of satellite DNA, and 2 satellite repeats are often present at non-centromeric termini, probably corresponding to relics of ancestral now inactive centromeres. Immuno-FISH experiments using satellite DNA and antibodies against the kinetochore protein CENP-A demonstrated that satellite-less primary constrictions are actually endowed with centromeric function. The phylogenetic reconstruction of centromere repositioning events demonstrates that the acquisition of satellite DNA occurs after the formation of the centromere during evolution and that centromeres can function over millions of years and many generations without detectable satellite DNA. The rapidly evolving Equus species gave us the opportunity to identify different intermediate steps along the full maturation of ENCs.

  1. Zonadhesin D3-Polypeptides Vary among Species but Are Similar in Equus Species Capable of Interbreeding1

    OpenAIRE

    Tardif, Steve; Brady, Heidi A.; Breazeale, Kelly R.; Bi, Ming; Thompson, Leslie D.; Bruemmer, Jason E.; Bailey, Laura B.; Hardy, Daniel M.

    2009-01-01

    Zonadhesin is a rapidly evolving protein in the sperm acrosome that confers species specificity to sperm-zona pellucida adhesion. Though structural variation in zonadhesin likely contributes to its species-specific function, the protein has not previously been characterized in organisms capable of interbreeding. Here we compared properties of zonadhesin in several animals, including the horse (Equus caballus), donkey (E. asinus), and Grevy's zebra (E. grevyi) to determine if variation in zona...

  2. Age-Related Changes in Locomotor Performance Reveal a Similar Pattern for Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens.

    Science.gov (United States)

    Marck, Adrien; Berthelot, Geoffroy; Foulonneau, Vincent; Marc, Andy; Antero-Jacquemin, Juliana; Noirez, Philippe; Bronikowski, Anne M; Morgan, Theodore J; Garland, Theodore; Carter, Patrick A; Hersen, Pascal; Di Meglio, Jean-Marc; Toussaint, Jean-François

    2017-04-01

    Locomotion is one of the major physiological functions for most animals. Previous studies have described aging mechanisms linked to locomotor performance among different species. However, the precise dynamics of these age-related changes, and their interactions with development and senescence, are largely unknown. Here, we use the same conceptual framework to describe locomotor performances in Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens. We show that locomotion is a consistent biomarker of age-related changes, with an asymmetrical pattern throughout life, regardless of the type of effort or its duration. However, there is variation (i) among species for the same mode of locomotion, (ii) within species for different modes of locomotion, and (iii) among individuals of the same species for the same mode of locomotion. Age-related patterns are modulated by genetic (such as selective breeding) as well as environmental conditions (such as temperature). However, in all cases, the intersection of the rising developmental phase and the declining senescent phase reveals neither a sharp transition nor a plateau, but a smooth transition, emphasizing a crucial moment: the age at peak performance. This transition may define a specific target for future investigations on the dynamics of such biological interactions. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  3. Characterization of a Full-Length Endogenous Beta-Retrovirus, EqERV-Beta1, in the Genome of the Horse (Equus caballus

    Directory of Open Access Journals (Sweden)

    Antoinette C. van der Kuyl

    2011-06-01

    Full Text Available Information on endogenous retroviruses fixed in the horse (Equus caballus genome is scarce. The recent availability of a draft sequence of the horse genome enables the detection of such integrated viruses by similarity search. Using translated nucleotide fragments from gamma-, beta-, and delta-retroviral genera for initial searches, a full-length beta-retrovirus genome was retrieved from a horse chromosome 5 contig. The provirus, tentatively named EqERV-beta1 (for the first equine endogenous beta-retrovirus, was 10434 nucleotide (nt in length with the usual retroviral genome structure of 5’LTR-gag-pro-pol-env-3’LTR. The LTRs were 1361 nt long, and differed approximately 1% from each other, suggestive of a relatively recent integration. Coding sequences for gag, pro and pol were present in three different reading-frames, as common for beta-retroviruses, and the reading frames were completely open, except that the env gene was interrupted by a single stopcodon. No reading frame was apparent downstream of the env gene, suggesting that EqERV-beta1 does not encode a superantigen like mouse mammary tumor virus (MMTV. A second proviral genome of EqERV-beta1, with no stopcodon in env, is additionally integrated on chromosome 5 downstream of the first virus. Single EqERV-beta1 LTRs were abundantly present on all chromosomes except chromosome 24. Phylogenetically, EqERV-beta1 most closely resembles an unclassified retroviral sequence from cattle (Bos taurus, and the murine beta-retrovirus MMTV.

  4. Study of early pregnancy factor (EPF) in equine (Equus caballus).

    Science.gov (United States)

    Ohnuma, K; Yokoo, M; Ito, K; Nambo, Y; Miyake, Y I; Komatsu, M; Takahashi, J

    2000-03-01

    Early pregnancy factor (EPF) is an immunosuppressive protein detected in the early pregnancy serum. We have already reported that we developed the rosette inhibition test for mare EPF and detected EPF in thoroughbreds. The aim of this study was to determine whether or not our method could be used clinically. The rosette inhibition test for equine EPF was carried out on serum from six nonpregnant and six pregnant Shetland ponies, a female and a male Chinese pony, and four nonpregnant and 13 pregnant thoroughbred mares. In the thoroughbreds sera were collected during the pregnancy period. Furthermore, we measured progesterone and detected pregnant mare serum gonadotrophin (PMSG) in order to confirm pregnancy of the Chinese pony 3 and 6 months after mating. In the nonpregnant Shetland ponies, the rosette inhibition titre (RIT) was 6.0+/-1.0 and EPF was negative. In contrast, in the pregnant ponies, the RIT was 9.2+/-0.4 and EPF was positive. Based on these results, we diagnosed pregnancy of the Chinese pony. The RIT of the female Chinese pony (3 months after mating) was above 10 and EPF was positive. Furthermore, we detected PMSG and progesterone in the serum of this pony. EPF appeared in the maternal blood circulation at 24-72 hr after mating, it was detected until the second trimester, and after that it disappeared from the maternal serum. The pony's EPF was detected by using the same rosette inhibition test as in the thoroughbred and was present from 24 to 72 hr after mating until the second trimester. The results indicated that our method was useful for pregnancy diagnosis of Equine.

  5. Short Communication Quick method for identifying horse (Equus caballus) and donkey (Equus asinus) hybrids.

    Science.gov (United States)

    Franco, M M; Santos, J B F; Mendonça, A S; Silva, T C F; Antunes, R C; Melo, E O

    2016-09-23

    The domestication of the Equus genus 5000-6000 years ago has influenced the history of human civilization. As soon as horse and donkey species had been domesticated, they were crossbred, producing humanity's first documented attempt at animal genome manipulation. Since then, the mule (male donkey x female horse) and the reciprocal cross (the hinny, male horse x female donkey) have been the most common equine hybrids in the world. Due to their hybrid vigor, mules and hinnies have been intensively used for carrying loads and people and for tilling the land. Despite their importance, visual distinction of mules and hinnies is difficult due to high phenotypic resemblance. However, the distinction between these two hybrids is of pivotal importance for equid breeders and ranchers. In this study, an easy, low-cost, effective, and fast multiplex-polymerase chain reaction method was developed to distinguish the maternal origin of mules and hinnies, targeting the hyper-variable mitochondrial DNA D-loop region. This methodology can help breeders, ranchers, animal science professionals, and researchers manage their equine herds with more confidence and precision.

  6. Practical Bias Correction in Aerial Surveys of Large Mammals: Validation of Hybrid Double-Observer with Sightability Method against Known Abundance of Feral Horse (Equus caballus) Populations.

    Science.gov (United States)

    Lubow, Bruce C; Ransom, Jason I

    2016-01-01

    Reliably estimating wildlife abundance is fundamental to effective management. Aerial surveys are one of the only spatially robust tools for estimating large mammal populations, but statistical sampling methods are required to address detection biases that affect accuracy and precision of the estimates. Although various methods for correcting aerial survey bias are employed on large mammal species around the world, these have rarely been rigorously validated. Several populations of feral horses (Equus caballus) in the western United States have been intensively studied, resulting in identification of all unique individuals. This provided a rare opportunity to test aerial survey bias correction on populations of known abundance. We hypothesized that a hybrid method combining simultaneous double-observer and sightability bias correction techniques would accurately estimate abundance. We validated this integrated technique on populations of known size and also on a pair of surveys before and after a known number was removed. Our analysis identified several covariates across the surveys that explained and corrected biases in the estimates. All six tests on known populations produced estimates with deviations from the known value ranging from -8.5% to +13.7% and corrected by our statistical models. Our results validate the hybrid method, highlight its potentially broad applicability, identify some limitations, and provide insight and guidance for improving survey designs.

  7. Zonadhesin D3-polypeptides vary among species but are similar in Equus species capable of interbreeding.

    Science.gov (United States)

    Tardif, Steve; Brady, Heidi A; Breazeale, Kelly R; Bi, Ming; Thompson, Leslie D; Bruemmer, Jason E; Bailey, Laura B; Hardy, Daniel M

    2010-02-01

    Zonadhesin is a rapidly evolving protein in the sperm acrosome that confers species specificity to sperm-zona pellucida adhesion. Though structural variation in zonadhesin likely contributes to its species-specific function, the protein has not previously been characterized in organisms capable of interbreeding. Here we compared properties of zonadhesin in several animals, including the horse (Equus caballus), donkey (E. asinus), and Grevy's zebra (E. grevyi) to determine if variation in zonadhesin correlates with ability of gametes to cross-fertilize. Zonadhesin localized to the apical acrosomes of spermatozoa from all three Equus species, similar to its localization in other animals. Likewise, in horse and donkey testis, zonadhesin was detected only in germ cells, first in the acrosomal granule of round spermatids and then in the developing acrosomes of elongating spermatids. Among non-Equus species, D3-domain polypeptides of mature, processed zonadhesin varied markedly in size and detergent solubility. However, zonadhesin D3-domain polypeptides in horse, donkey, and zebra spermatozoa exhibited identical electrophoretic mobility and detergent solubility. Equus zonadhesin D3-polypeptides (p110/p80 doublet) were most similar in size to porcine and bovine zonadhesin D3-polypeptides (p105). Sequence comparisons revealed that the horse zonadhesin precursor's domain content and arrangement are similar to those of zonadhesin from other large animals. Partial sequences of horse and donkey zonadhesin were much more similar to each other (>99% identity) than they were to orthologous sequences of human, pig, rabbit, and mouse zonadhesin (52%-72% identity). We conclude that conservation of zonadhesin D3-polypeptide properties correlates with ability of Equus species to interbreed.

  8. Initial study of wild horse and burro demography: determination of pregnancy and lactation rates in various herds. Final report

    International Nuclear Information System (INIS)

    Wolfe, M.L.; Ellis, L.C.

    1982-01-01

    Blood serum concentrations of reproductive hormones were used to estimate pregnancy rates in 558 wild and free-roaming horses (Equus caballus) from Nevada, Oregon, and Wyoming; and 165 burros from California. Levels of progesterone, pregnant mares' serum gonadotropin (PMSG), and estradiol 17B were determined by radioimmunoassay procedures. Based on comparison with the results of pregnancy diagnosis from rectal palpations (n =124), the following endocrine concentrations were established as criteria sufficient to indicate pregnancy: progesterone, 0.05 ng/ml; and/or PMSG, 3.0 mg/ml; and/or estradiol, 300 pg/ml. Estimated accuracy of pregnancy diagnoses from endocrine criteria was 80 to 85 percent. The mean incidence of pregnancy among mares sampled from Nevada, Oregon, and Wyoming was 58.4 percent, 69.2 percent, and 85.3 percent respectively

  9. Zonadhesin D3-Polypeptides Vary among Species but Are Similar in Equus Species Capable of Interbreeding1

    Science.gov (United States)

    Tardif, Steve; Brady, Heidi A.; Breazeale, Kelly R.; Bi, Ming; Thompson, Leslie D.; Bruemmer, Jason E.; Bailey, Laura B.; Hardy, Daniel M.

    2009-01-01

    Zonadhesin is a rapidly evolving protein in the sperm acrosome that confers species specificity to sperm-zona pellucida adhesion. Though structural variation in zonadhesin likely contributes to its species-specific function, the protein has not previously been characterized in organisms capable of interbreeding. Here we compared properties of zonadhesin in several animals, including the horse (Equus caballus), donkey (E. asinus), and Grevy's zebra (E. grevyi) to determine if variation in zonadhesin correlates with ability of gametes to cross-fertilize. Zonadhesin localized to the apical acrosomes of spermatozoa from all three Equus species, similar to its localization in other animals. Likewise, in horse and donkey testis, zonadhesin was detected only in germ cells, first in the acrosomal granule of round spermatids and then in the developing acrosomes of elongating spermatids. Among non-Equus species, D3-domain polypeptides of mature, processed zonadhesin varied markedly in size and detergent solubility. However, zonadhesin D3-domain polypeptides in horse, donkey, and zebra spermatozoa exhibited identical electrophoretic mobility and detergent solubility. Equus zonadhesin D3-polypeptides (p110/p80 doublet) were most similar in size to porcine and bovine zonadhesin D3-polypeptides (p105). Sequence comparisons revealed that the horse zonadhesin precursor's domain content and arrangement are similar to those of zonadhesin from other large animals. Partial sequences of horse and donkey zonadhesin were much more similar to each other (>99% identity) than they were to orthologous sequences of human, pig, rabbit, and mouse zonadhesin (52%–72% identity). We conclude that conservation of zonadhesin D3-polypeptide properties correlates with ability of Equus species to interbreed. PMID:19794156

  10. Variation in skin surface lipid composition among the Equidae.

    Science.gov (United States)

    Colton, S W; Downing, D T

    1983-01-01

    Skin surface lipids from Equus caballus, E. przewalskii, E. asinus, E. grevyi, E. hemionus onager and a mule (E. asinus/E. caballus) were analyzed in detail. In all species the surface lipid mixtures consisted of giant-ring lactones, cholesterol, cholesteryl esters and minor amounts of wax diesters. In E. caballus, the lactone hydroxyacids were entirely branched chained, while in E. asinus and E. grevyi they were almost exclusively straight chained. In E. przewalskii, the onager and the mule there were both straight and branched chain hydroxyacid lactones. These results are in harmony with published interpretations of the evolutionary relationships among Equus species.

  11. INLUÊNCIA DO TEMPO DE DESCANSO “ANTE MORTEM” E DIETA DE MELAÇO SOBRE OS NÍVEIS DE GLICOGÊNIO MUSCULAR NA CARNE DE EQÜINOS (Equus caballus INFLUENCE OF “ANTE MORTEM” RESTING TIME AND MOLASSES DIET UPON MUSCULAR GLYCOGEN LEVELS IN EQUINES MEAT (Equus caballus

    Directory of Open Access Journals (Sweden)

    César Augusto Garcia

    2007-09-01

    Full Text Available

    Foram coletadas 48 amostras de músculos tríceps braquial e bíceps femural de vinte e quatro eqüinos machos, sem raça definida, adultos e com pesos aproximadamente iguais. Antes do abate, os animais foram divididos em seis lotes que tiveram descanso ante mortem de zero, seis, quatorze, dezoito e vinte e quatro horas respectivamente. O lote de animais que descansou por dezoito horas foi subdividido em dois sublotes, sendo que um deles recebeu dieta de solução aquosa a 5% de melaço. Todos os outros animais só receberam água e ficaram em jejum. Não se observou influência sobre o pH. O glicogênio foi dosado pelos métodos de Pfluger e Nelson. O lote que apresentou menores índices de glicogênio foi o que descansou por zero hora, enquanto que o lote que apresentou maiores índices de glicogênio foi o que descansou por vinte e quatro horas.

    Influence of “ante mortem” resting time and molasses diet upon muscular glycogen levels in equines meat (Equus caballus were studied. Forty-eight samples of triceps brachial and biceps femoral muscles of twenty-four adults and hybrids equines with approximately the same weights were analyzed. The animals were divided before death, in six groups with “ante mortem” resting time of zero, six, fourteen, eighteen and twenty-four hours, respectively. The animal groups with eighteen hours of rest were divided in two sub-groups and one received water solution with 5% of molasses. Alteration in pH levels were not observed. The glycogen was measured by Pfluger and Nelson’s methods. The group with smaller glycogen level was the group with zero hour of “ante mortem” rest, while the group with higher glycogen levels was the group with twenty-four hours of rest.

  12. Recalibrating Equus evolution using the genome sequence of an early Middle Pleistocene horse.

    Science.gov (United States)

    Orlando, Ludovic; Ginolhac, Aurélien; Zhang, Guojie; Froese, Duane; Albrechtsen, Anders; Stiller, Mathias; Schubert, Mikkel; Cappellini, Enrico; Petersen, Bent; Moltke, Ida; Johnson, Philip L F; Fumagalli, Matteo; Vilstrup, Julia T; Raghavan, Maanasa; Korneliussen, Thorfinn; Malaspinas, Anna-Sapfo; Vogt, Josef; Szklarczyk, Damian; Kelstrup, Christian D; Vinther, Jakob; Dolocan, Andrei; Stenderup, Jesper; Velazquez, Amhed M V; Cahill, James; Rasmussen, Morten; Wang, Xiaoli; Min, Jiumeng; Zazula, Grant D; Seguin-Orlando, Andaine; Mortensen, Cecilie; Magnussen, Kim; Thompson, John F; Weinstock, Jacobo; Gregersen, Kristian; Røed, Knut H; Eisenmann, Véra; Rubin, Carl J; Miller, Donald C; Antczak, Douglas F; Bertelsen, Mads F; Brunak, Søren; Al-Rasheid, Khaled A S; Ryder, Oliver; Andersson, Leif; Mundy, John; Krogh, Anders; Gilbert, M Thomas P; Kjær, Kurt; Sicheritz-Ponten, Thomas; Jensen, Lars Juhl; Olsen, Jesper V; Hofreiter, Michael; Nielsen, Rasmus; Shapiro, Beth; Wang, Jun; Willerslev, Eske

    2013-07-04

    The rich fossil record of equids has made them a model for evolutionary processes. Here we present a 1.12-times coverage draft genome from a horse bone recovered from permafrost dated to approximately 560-780 thousand years before present (kyr BP). Our data represent the oldest full genome sequence determined so far by almost an order of magnitude. For comparison, we sequenced the genome of a Late Pleistocene horse (43 kyr BP), and modern genomes of five domestic horse breeds (Equus ferus caballus), a Przewalski's horse (E. f. przewalskii) and a donkey (E. asinus). Our analyses suggest that the Equus lineage giving rise to all contemporary horses, zebras and donkeys originated 4.0-4.5 million years before present (Myr BP), twice the conventionally accepted time to the most recent common ancestor of the genus Equus. We also find that horse population size fluctuated multiple times over the past 2 Myr, particularly during periods of severe climatic changes. We estimate that the Przewalski's and domestic horse populations diverged 38-72 kyr BP, and find no evidence of recent admixture between the domestic horse breeds and the Przewalski's horse investigated. This supports the contention that Przewalski's horses represent the last surviving wild horse population. We find similar levels of genetic variation among Przewalski's and domestic populations, indicating that the former are genetically viable and worthy of conservation efforts. We also find evidence for continuous selection on the immune system and olfaction throughout horse evolution. Finally, we identify 29 genomic regions among horse breeds that deviate from neutrality and show low levels of genetic variation compared to the Przewalski's horse. Such regions could correspond to loci selected early during domestication.

  13. Konik - taaselustatud tarpan / Ingrid Randlaht

    Index Scriptorium Estoniae

    Randlaht, Ingrid

    2011-01-01

    Koniku (equus caballus ferus) tagasiaretusprojektidest 19. sajandil looduses väljasurnud ulukhobuse tarpanite (equus ferus ferus) suunal. Kinnikasvamise tõttu hävinenud elupaikade ja looduskeskkondade taastamisesst Euroopas - Lätis, Poolas, Hollandis - ulukhobuste ja ka veiste ning punahirvedega

  14. Gene : CBRC-TTRU-01-0332 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 2| PREDICTED: similar to vomeronasal 1 receptor, k1 [Equus caballus] 5e-51 40% MTEVWSSLDCCTKFLRIRYSTVTILEIFF...LKPQTSTCVLPSFLFFWVINMLICIWIITNNETVTNASAAQPGYSPVYCKTKRGDYRESAVFQSAMLIRVFLCINLTVWTS

  15. Foaling rates in feral horses treated with the immunocontraceptive porcine zona pellucida

    Science.gov (United States)

    Ransom, J.I.; Roelle, J.E.; Cade, B.S.; Coates-Markle, L.; Kane, A.J.

    2011-01-01

    Locally abundant feral horses (Equus caballus) can rapidly deplete available resources. Fertility control agents present promising nonlethal tools for reducing their population growth rates. We tested the effect of 2 forms of the immunocontraceptive porcine zona pellucida (PZP) on foaling rates in 3 populations of feral horses in the western United States. A liquid form requiring annual boosters was administered at Little Book Cliffs Wild Horse Range, Mesa County (CO), and Pryor Mountain Wild Horse Range, Bighorn County (WY) and Carbon County (MT), and a time-release pellet form designed to produce 2 yr of infertility was administered at McCullough Peaks Herd Management Area, Park County (WY). Average foaling rates (foals born/mare-yr) from direct observation of untreated and treated female horses (mares), 2004-2008, were 60.1% (n = 153 mare-yr) versus 6.6% (n = 91 mare-yr) at Little Book Cliffs, and 62.8% (n = 129 mare-yr) versus 17.7% (n = 79 mare-yr) at Pryor Mountain, respectively. At McCullough Peaks, mean annual foaling rates from 2006 to 2008 were 75.0% (n = 48 mare-yr) for untreated mares and 31.7% (n = 101 mare-yr) for treated mares. Controlling for age of mares and pretreatment differences in fertility, PZP reduced foaling rates in all 3 herds. The pellets used at McCullough Peaks (produced by cold evaporation) were less effective than pellets used in a previous trial and produced by heat extrusion. Immunocontraception with PZP may be a useful tool in reducing fertility rates in some western United States feral horse herds, but population growth reduction will depend on timely access to mares for inoculation and the proportion of mares that can be successfully treated. ?? 2011 The Wildlife Society.

  16. Gene : CBRC-MMUR-01-1612 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1e-56 41% ref|XP_001497978.2| PREDICTED: similar to seven transmembrane helix receptor [Equus caballus] 5e-6...IPPVLRLACADTTEVEAIVFSSSALLILFTVMVILLSYAYILVTICSMRSLEAQGKALSTCASHLTIICLFYGTITFMYAQPSSHNSMEQNKVVSVVYTVVIPMLNPLIYSLRNKDVKHALKRRCQGKLPS ...

  17. A SEROLOGIC AND POLYMERASE CHAIN REACTION SURVEY OF EQUINE HERPESVIRUS IN BURCHELL'S ZEBRAS (EQUUS QUAGGA), HARTMANN'S MOUNTAIN ZEBRAS (EQUUS ZEBRA HARTMANNAE), AND THOMSON'S GAZELLES (EUDORCAS THOMSONII) IN A MIXED SPECIES SAVANNAH EXHIBIT.

    Science.gov (United States)

    Lopez, Karen M; Fleming, Gregory J; Mylniczenko, Natalie D

    2016-12-01

    Reports of equine herpesvirus (EHV) 1 and EHV-9 causing clinical disease in a wide range of species have been well documented in the literature. It is thought that zebras are the natural hosts of EHV-9 both in the wild and in captive collections. Concerns about potential interspecies transmission of EHV-1 and EHV-9 in a mixed species savannah exhibit prompted serologic and polymerase chain reaction surveys. Eighteen Burchell's zebras ( Equus quagga ), 11 Hartmann's mountain zebras ( Equus zebra hartmannae), and 14 Thomson's gazelles ( Eudorcas thomsonii ) cohabitating the same exhibit were examined for EHV-1 virus neutralization titers, and evidence of virus via EHV 1-5 polymerase chain reactions. None of the animals had previous exposure to vaccination with EHV-1 or EHV-4. All tested zebras had positive EHV-1 titers, ranging from 4 to 384. All zebras and Thomson's gazelles had negative polymerase chain reaction results for all targeted equine herpesviruses. EHV-9-specific assays are not available but EHV-1, EHV-4, and EHV-9 cross-react serologically. Positive serology results indicate a potential latent equine herpesvirus in the zebra population, which prompted initiation of an equine herpesvirus vaccine protocol, changes in pregnant zebra mare management, and equine herpesvirus polymerase chain reaction screening prior to shipment to or from the study site.

  18. Pre- and postnatal growth phenomena of Burchell's Zebra Equus Burchelli Antiquorum

    Directory of Open Access Journals (Sweden)

    G.L. Smuts

    1975-07-01

    Full Text Available Between 1969 and 1972 growth data were collected from 175 zebra Equus burchelli antiquorum and 138 zebra embryos and foetuses from the Central District of the Kruger National Park, Republic of South Africa. Statistical analysis of data indicated no significant difference between body mass of adult stallions (range == 267,3 to 373,3 kg; mean = 318,5 kg; n = 57 and adult non-pregnant mares (range = 272,6 to 386,9 kg; mean = 321,6 kg; n = 51 (t = 0,587. The heaviest zebra had a body mass of 429,4 kilogram. This was a pregnant mare carrying a 35,2 kg foetus. Von Bertalanffy growth curves indicated that shoulder heights in young zebra may reach the adult range by one year of age, the adult body mass range is, however, only attained after three years of age. These curves also showed that age classification of free roaming zebra is only reliable up to the age of about two years, after which individual variation is too great. Stallions were significantly taller at the shoulder than mares (mean = 1,8 cm (t = 2,032 and neck thickness was the only body dimension showing visible sexual dimorphism in adults. Here the stallion had a neck girth on average 8,1 cm greater than the mare. Regression equations for estimating body mass from body dimensions were calculated by using a standard logarithmic transformation and fitting a linear regression by the method of least squares and also by undertaking standard straight line linear regression analyses. Exponential curves obtained by the first method indicated that growth was not isometric (not linear and that the ratios of any of the dimensions of length to body mass were con- stantly changing, i.e. growth is allometric. Marked allometric growth differences existed between the two sexes except in the case of the heart girth-body mass relationship. Comparison of growth data from E. b. antiquorum with that of E. b. boehmi from Tanzania (Sachs 1967, indicates that E. b. antiquorum is considerably larger. Body masses

  19. The prevalence and transmission to exotic equids (Equus quagga antiquorum, Equus przewalskii, Equus africanus) of intestinal nematodes in contaminated pasture in two wild animal parks.

    Science.gov (United States)

    Epe, C; Kings, M; Stoye, M; Böer, M

    2001-06-01

    Wild equids maintained in large enclosures may suffer from helminth diseases because common hygiene practices have only limited effects on parasite populations. Weekly monitoring of helminth prevalences and pasture infestation was performed for 1 yr in several extensive maintenance systems of two wildlife parks with similar climates to determine when veterinary intervention to control parasites would be useful. We also sought evidence of natural immunogenic reactions among herds of Chapman zebras (Equus quagga antiquorum), Przewalski's horses (Equus przewalskii) and dwarf donkeys (Equus asinus africanus). Fecal and vegetation samples and cultures for third-stage larvae revealed permanent egg shedding in the three species and pasture infestation during the warm, moist periods (July-September) in all enclosures. Stable social structure and low equid population density may be sufficient to make prophylaxis unnecessary in adults, whereas biotic and abiotic environmental factors such as crowding, animal transfers, social integration of subadults, and weaning stress may facilitate temporary severe infections of individuals. Biweekly helminth monitoring is a useful diagnostic tool for extensive management of exotic equids.

  20. Non-surgical sterilisation methods may offer a sustainable solution to feral horse (Equus caballus) overpopulation.

    Science.gov (United States)

    Hall, Sally Elizabeth; Nixon, Brett; Aitken, R John

    2017-09-01

    Feral horses are a significant pest species in many parts of the world, contributing to land erosion, weed dispersal and the loss of native flora and fauna. There is an urgent need to modify feral horse management strategies to achieve public acceptance and long-term population control. One way to achieve this is by using non-surgical methods of sterilisation, which are suitable in the context of this mobile and long-lived species. In this review we consider the benefits of implementing novel mechanisms designed to elicit a state of permanent sterility (including redox cycling to generate oxidative stress in the gonad, random peptide phage display to target non-renewable germ cells and the generation of autoantibodies against proteins essential for conception via covalent modification) compared with that of traditional immunocontraceptive approaches. The need for a better understanding of mare folliculogenesis and conception factors, including maternal recognition of pregnancy, is also reviewed because they hold considerable potential in providing a non-surgical mechanism for sterilisation. In conclusion, the authors contend that non-surgical measures that are single shot and irreversible may provide a sustainable and effective strategy for feral horse control.

  1. Fishery of the Green Jack Caranx caballus (Osteichytes: Carangidae in Las Perlas Archipelago, Pacific Panama

    Directory of Open Access Journals (Sweden)

    James M. Mair

    2012-09-01

    Full Text Available Green Jacks, Caranx caballus, are distributed along the Eastern Pacific coast. In Panama, C. caballus was heavily fished around Las Perlas Archipelago to sustain local markets until 2007, when the archipelago was declared a marine protected area. This first study in Panama, analyzed a sample of 4 990 individuals from Las Perlas, obtained monthly from June 2005 to June 2006, from landings at the central fish market. Average total length was 36.1±6.4cm and optimum length 38.9cm. Approximately 68% of fish lengths were within ±10% of the optimal length but only six (15% were considered mega-spawners. The von Bertalanffy parameters describe a long-lived and fast growing species, while mortality rates revealed that C. caballus is under high fishing pressure. Standard length at which half of the population is mature was 38.8cm, and the size at which individuals matured massively, 33cm. Only 10-13% of the fish were immature. C. caballus reproduces two to three times per year, with peaks in December, April, and probably September, and recruits to the population at least twice per year. Catch per unit effort (CPUE was best predicted by minimum annual values of the Multivariate ENSO/ LNSO Index (MEI (R²=0.54. Results show that C. caballus in Pacific Panama is overfished. We recommend the raising of the minimum capture/landing size of this species in order to increase the proportion of megaspawners in the population and guarantee the sustainability of this resource.

  2. Effects of feral free-roaming horses on semi-arid rangeland ecosystems: an example from the sagebrush steppe

    Science.gov (United States)

    Feral horses (Equus caballus) are viewed as a symbol of freedom and power; however, they are also a largely unmanaged, non-native grazer in North America, South America, and Australia. Information on their influence on vegetation and soil characteristics in semi-arid rangelands has been limited by ...

  3. The MC1R and ASIP Coat Color Loci May Impact Behavior in the Horse

    Science.gov (United States)

    Jacobs, Lauren N.; Staiger, Elizabeth A.; Albright, Julia D.

    2016-01-01

    Shared signaling pathways utilized by melanocytes and neurons result in pleiotropic traits of coat color and behavior in many mammalian species. For example, in humans polymorphisms at MC1R cause red hair, increased heat sensitivity, and lower pain tolerance. In deer mice, rats, and foxes, ASIP polymorphisms causing black coat color lead to more docile demeanors and reduced activity. Horse (Equus caballus) base coat color is primarily determined by polymorphisms at the Melanocortin-1 Receptor (MC1R) and Agouti Signaling Protein (ASIP) loci, creating a black, bay, or chestnut coat. Our goal was to investigate correlations between genetic loci for coat color and temperament traits in the horse. We genotyped a total of 215 North American Tennessee Walking Horses for the 2 most common alleles at the MC1R (E/e) and ASIP (A/a) loci using previously published PCR and RFLP methods. The horses had a mean age of 10.5 years and comprised 83 geldings, 25 stallions, and 107 mares. To assess behavior, we adapted a previously published survey for handlers to score horses from 1 to 9 on 20 questions related to specific aspects of temperament. We utilized principle component analysis to combine the individual survey scores into 4 factors of variation in temperament phenotype. A factor component detailing self-reliance correlated with genotypes at the ASIP locus; black mares (aa) were more independent than bay mares (A_) (P = 0.0063). These findings illuminate a promising and novel animal model for future study of neuroendocrine mechanisms in complex behavioral phenotypes. PMID:26884605

  4. Oxytocin, vasopressin, prostaglandin F(2alpha), luteinizing hormone, testosterone, estrone sulfate, and cortisol plasma concentrations after sexual stimulation in stallions.

    Science.gov (United States)

    Veronesi, M C; Tosi, U; Villani, M; Govoni, N; Faustini, M; Kindahl, H; Madej, A; Carluccio, A

    2010-03-01

    This experiment was designed to determine the effects of sexual stimulation on plasma concentrations of oxytocin (OT), vasopressin (VP), 15-ketodihydro-PGF(2alpha) (PG-metabolite), luteinizing hormone (LH), testosterone (T), estrone sulfate (ES), and cortisol (C) in stallions. Semen samples were collected from 14 light horse stallions (Equus caballus) of proven fertility using a Missouri model artificial vagina. Blood samples were collected at 15, 12, 9, 6, and 3 min before estrous mare exposure, at erection, at ejaculation, and at 3, 6, and 9 min after ejaculation. Afterwards, blood sampling was performed every 10 min for the following 60 min. Sexual activity determined an increase in plasma concentrations of OT, VP, C, PG-metabolite, and ES and caused no changes in LH and T concentrations. The finding of a negative correlation between C and VP at erection, and between C and T before erection and at the time of erection, could be explained by a possible inhibitory role exerted by C in the mechanism of sexual arousal described for men. Copyright 2010 Elsevier Inc. All rights reserved.

  5. Mitochondrial DNA genetic variations among four horse populations in Egypt

    Directory of Open Access Journals (Sweden)

    Othman E. Othman

    2017-12-01

    It is concluded that sequence analysis of mtDNA control region is still the most informative tool for the identification of genetic biodiversity and phylogeny of different horse breeds and populations. The horse populations reared in Egypt possess low genetic diversity and all of them are belonged to Equus caballus breed.

  6. Origin and differentiation of a special fragment from Capra hircus ...

    African Journals Online (AJOL)

    Administrator

    2011-09-07

    Sep 7, 2011 ... regions of the special fragment in the GenBank of NCBI. A total number of 80 fragments with identity ... recombined during the long period of evolution within and among species, and might be related to ..... and their association to coat color phenotypes in horses (Equus caballus). Mammalian Genome, 12: ...

  7. Displacement-length ratios and contractional strains of lunar wrinkle ridges in Mare Serenitatis and Mare Tranquillitatis

    Science.gov (United States)

    Li, Bo; Ling, Zongcheng; Zhang, Jiang; Chen, Jian; Ni, Yuheng; Liu, Chunli

    2018-04-01

    Wrinkle ridges are complex thrust faults commonly found in lunar mare basalts and caused by compressional stresses from both local basin and global Moon. In this paper, we select 59 single wrinkle ridges in Mare Serenitatis and 39 single wrinkle ridges in Mare Tranquillitatis according to WAC mosaic image. For each wrinkle ridge, several topographic profiles near its midpoint are generated to measure its height and maximum displacement (Dmax) through LOLA DEM data. Then we make 2D plots of displacement-length (L) for ridge population in the two maria. The Dmax-L ratios (γ) are derived by a linear fit method according to the D-L data. The γ value (2.13 × 10-2) of ridges in Mare Tranquillitatis is higher than the γ value (1.73 × 10-2) of ridges in Mare Serenitatis. In the last, the contractional strains (ε) in Mare Serenitatis and Mare Tranquillitatis are estimated to be ∼0.36% and 0.14% (assuming the fault plane dip θ is 25°). The values of the free-air gravity anomalies in Mare Serenitatis range from 78 to 358 mGal higher than those of the gravity anomalies in Mare Tranquillitatis which range from -70 to 120 mGal. The average thickness of basalts in Mare Tranquillitatis is 400 m, while that of basalts in Mare Serenitatis is 798 m. Moreover, the average age for ridge group in Mare Serenitatis is bigger than the wrinkle ridge's age in Mare Tranquillitatis. The formation of ridge group in Mare Serenitatis takes longer time than that in Mare Serenitatis. Therefore, we think the higher value of gravity anomalies, thicker basaltic units and longer formation time for wrinkle ridge in Mare Serenitatis maybe result in the higher value of contractional strain, although the formation of Tranquillitatis basin is earlier than that of Serenitatis basin.

  8. Standing sedation in captive zebra (Equus grevyi and Equus burchellii).

    Science.gov (United States)

    Hoyer, Mark; de Jong, Sara; Verstappen, Frank; Wolters, Marno

    2012-03-01

    Nine Grevy's zebras (Equus grevyi) and three Burchell's zebras (Equus burchellii) were immobilized in a standing position a total of 70 times for minor, nonpainful procedures over a 9-yr period. Standing sedation was successfully obtained with a combination of detomidine and butorphanol on 47 occasions (67.1%). Detomidine i.m. (median 0.10 mg/kg; range: 0.07-0.21) was administered by dart, followed 10 min later by butorphanol i.m. (median 0.13 mg/kg; range 0.04-0.24). The dosages were varied depending on the initial demeanor of the animal. On 23 occasions (32.9%), small amounts of etorphine (median 2.5 microg/kg; range 1.1-12.3 microg/kg) plus acepromazine (median 10 microg/kg; range 4.4-50 microg/kg) (as in Large Animal-Immobilon) had to be administered i.m. to gain sufficient sedation. In these latter cases, the animals were either excited or known for their aggressive character. The zebras were sufficiently immobilized for the length of most procedures (<45 min) without supplementation. At the end of the procedure, the animals were given atipamezole (2 mg per 1 mg detomidine used) and naltrexone (0.1 mg/kg) to reverse the sedative effects, irrespective of whether etorphine was used or not. Standing sedation, using the combination of the alpha-2 agonist detomidine and the partial agonist-antagonist opioid butorphanol (in some cases supplemented with etorphine + acepromazine), proved to be a very efficacious and safe method to be used in zebras under zoo conditions for short-lasting, nonpainful procedures.

  9. Vertical movement in mare basins: relation to mare emplacement, basin tectonics, and lunar thermal history

    International Nuclear Information System (INIS)

    Solomon, S.C.

    1979-01-01

    The spatial and temporal relationships of linear rilles and mare ridges in the Serenitatis basin region of the moon are explained by a combination of lithospheric flexure in response to basin loading by basalt fill and a time-dependent global stress due to the thermal evolution of the lunar interior. The pertinent tectonic observations are the radial distance of basin concentric rilles or graben from the mare center; the location and orientation of mare ridges, interpreted as compressive features; and the restriction of graben formation to times older than 3.6 +- 0.2 b.y. ago, while ridge formation continued after emplacement of the youngest mare basalt unit (approx.3 b.y. ago). The locations of the graben are consistent with the geometry of the mare basalt load expected from the dimensions of multiring basins for values of the thickness of the elastic lithosphere beneath Serenitatis in the range 25--50 km at 3.6--3.8 b.y. ago. The locations and orientations of mare ridges are consistent with the load inferred from surface mapping and subsurface radar reflections for values of the elastic lithosphere thickness near 100 km at 3.0--3.4 b.y. ago. The thickening of the lithosphere beneath a major basin during the evolution of mare volcanism is thus clearly evident in the tectonics. The cessation of rille formation and the prolonged period of ridge formation are attributed to a change in the global horizontal thermal stress from extension to compression as the moon shifted from net expansion to overall cooling and contraction. Severe limits as placed on the range of possible lunar thermal histories. The zone of horizontal extensional stresses peripheral to mare loads favors the edge of mare basins as the preferred sites for mare basalt magma eruption in the later stages of mare fill, although subsidence may lead to accumulation of such young lavas in basin centers

  10. The effect of dietary protein on reproduction in the mare. II. Growth of foals, body mass of mares and serum protein concentration of mares during the anovulatory, transitional and pregnant periods

    Directory of Open Access Journals (Sweden)

    F.E. Van Niekerk

    1997-07-01

    Full Text Available The effect of 4 different diets, in terms of protein quantity and quality, on total serum protein (TSP, albumin and globulin was investigated. Non-pregnant mares that were not lactating (n = 36, pregnant mares that had foaled (n = 24 and their foals (n = 24 were used in this study. Daily total protein intake had no effect on blood protein concentrations in the mares. Total protein intake and quality (available essential amino-acids did affect the body mass of mares during lactation. When mares were fed the minimum recommended (National Research Council 1989 total daily protein, foal mass decreased by approximately 25 % at weaning compared to the foals whose dams were on a higher level of protein intake. The TSP concentrations of foals at birth were on average 10 g/ℓ lower than those of the mares. Albumin concentrations of foals during the first 60 days of life were on average 2-3 g/ℓ lower than those of the mares. Globulin concentrations of foals were approximately 5 g/ℓ lower than those of mares at weaning.

  11. Status of Groundwater Levels and Storage Volume in the Equus Beds Aquifer Near Wichita, Kansas, January 2009

    Science.gov (United States)

    Hansen, Cristi V.

    2009-01-01

    Beginning in the 1940s, the Wichita well field was developed in the Equus Beds aquifer in southwestern Harvey County and northwestern Sedgwick County to supply water to the city of Wichita (Williams and Lohman, 1949). In addition to supplying drinking water to the largest city in Kansas, the other primary use of water from the Equus Beds aquifer is to irrigate crops in this agriculture-dominated part of south-central Kansas (Rich Eubank, Kansas Department of Agriculture, Division of Water Resources, oral commun., 2008). The decline of water levels in the aquifer were noted soon after the development of the Wichita well field began (Williams and Lohman, 1949). As water levels in the aquifer decline, the volume of water stored in the aquifer decreases and less water is available to supply future needs. For many years the U.S. Geological Survey (USGS), in cooperation with the city of Wichita, has monitored these changes in water levels and the resulting changes in storage volume in the Equus Beds aquifer as part of Wichita's effort to effectively manage this resource. In 2007, the city of Wichita began using Phase I of the Equus Beds Aquifer Storage and Recovery (ASR) project for large-scale artificial recharge of the Equus Beds aquifer. The ASR project uses water from the Little Arkansas River - either pumped from the river directly or from wells in the riverbank that obtain their water from the river by induced infiltration - as the source of artificial recharge to the Equus Beds aquifer (City of Wichita, 2009).

  12. Pattern of faecal 20-oxopregnane and oestrogen concentrations during pregnancy in wild plains zebra mares.

    Science.gov (United States)

    Ncube, Hlengisizwe; Duncan, Patrick; Grange, Sophie; Cameron, Elissa Z; Barnier, Florian; Ganswindt, Andre

    2011-07-01

    Regulative endocrine mechanisms influence the reproductive behaviour and success of mammals, but they have been studied predominantly in domestic and captive animals. The study aims at describing the pattern of faecal 20-oxopregnane and oestrogen concentrations during pregnancy in wild plains zebra Equus quagga chapmani. Data were collected during wet and dry seasons 2007-2009. Enzyme Immunoassays were used to determine 20-oxopregnane and oestrogen concentrations in faecal samples (n=74) collected from individual mares (n=32) whose dates of foaling were known through long-term monitoring. Hormonal profiles were described with a General Additive Model (GAM: Hormone ∼ Days to Foaling). Faecal 20-oxopregnanes have a complex cycle during pregnancy (GAM, n=70, R(2)=0.616, p200 ng/g DW) of faecal 20-oxopregnanes associated with high (>160 ng/g DW) faecal oestrogen levels indicate mid-pregnancy in c.90% of cases (16/17). High faecal 20-oxopregnanes (>200 ng/g DW) and low faecal oestrogen levels (<160 ng/g DW) indicate late pregnancy, again in c.90% of cases. Two faecal samples would allow the stage of pregnancy to be determined with confidence. Copyright © 2011 Elsevier Inc. All rights reserved.

  13. Placentation in the plains zebra (Equus quagga).

    Science.gov (United States)

    Allen, W R Twink; Stansfield, Fiona; Wilsher, Sandra

    2017-10-01

    The placenta and fetal gonads of 12 pregnant plains zebra (Equus quagga), estimated to be between 81 and 239 days of gestation, were examined. The diffuse, microcotyledonary zebra placenta appeared, developmentally, to be 3-4 weeks behind its counterpart in horse pregnancy and this, together with the presence of small and long-lived endometrial cups, low levels of zebra chorionic gonadotrophin in maternal serum and few accessory corpora lutea in the maternal ovaries during the first half of gestation, made zebra pregnancy more similar to donkey than horse pregnancy. Zebra fetal gonads enlarged after 80 days of gestation and their interstitial cells stained positively for 3β hydroxysteroid dehydrogenase and 17,20 lyase steroid enzymes while the trophoblast stained for aromatase. This confirmed that zebra fetal gonads, like those of the horse and donkey, can synthesise C19 androgens, which can then be aromatised by the placenta to C18 oestrogens. It is remarkable that such unusual feto-placental mechanisms of production of gonadotrophic and steroid hormones has persisted unchanged within the genus Equus despite the many physical adaptations and the considerable loss of chromosomes that have occurred during the evolution of its member species.

  14. Prevalence and characteristics of foal rejection in Arabian mares.

    Science.gov (United States)

    Juarbe-Díaz, S V; Houpt, K A; Kusunose, R

    1998-09-01

    Separate surveys of Thoroughbred, Paint, and Arabian mare owners revealed a higher than expected rate of foal rejection in Arabian mares. A behavioural history form was submitted by owners of foal rejecting and nonrejecting Arabian mares, and maternal behaviour and management practices compared. Four generation pedigrees of rejecting and nonrejecting Arabian mares were also examined. Foal rejecting mares were more likely to avoid, threaten, squeal at, chase, bite, and kick their foals post partum than nonrejecting mares. Nonrejecting mares were more likely to lick, nicker and defend their foals post partum than rejecting mares. No statistically significant relationship was found between foal rejection and the type of breeding method (natural vs. artificial insemination), the presence of people at birth, the presence of nearby horses at birth, or assistance of the first nursing bout. The presence at least once of 1 of 2 related sires was statistically higher in the pedigrees of rejecting vs. nonrejecting mares. Inherited and learned or environmental factors are likely to affect the expression of foal rejection behaviour.

  15. Evolutionary movement of centromeres in horse, donkey, and zebra.

    Science.gov (United States)

    Carbone, Lucia; Nergadze, Solomon G; Magnani, Elisa; Misceo, Doriana; Francesca Cardone, Maria; Roberto, Roberta; Bertoni, Livia; Attolini, Carmen; Francesca Piras, Maria; de Jong, Pieter; Raudsepp, Terje; Chowdhary, Bhanu P; Guérin, Gérard; Archidiacono, Nicoletta; Rocchi, Mariano; Giulotto, Elena

    2006-06-01

    Centromere repositioning (CR) is a recently discovered biological phenomenon consisting of the emergence of a new centromere along a chromosome and the inactivation of the old one. After a CR, the primary constriction and the centromeric function are localized in a new position while the order of physical markers on the chromosome remains unchanged. These events profoundly affect chromosomal architecture. Since horses, asses, and zebras, whose evolutionary divergence is relatively recent, show remarkable morphological similarity and capacity to interbreed despite their chromosomes differing considerably, we investigated the role of CR in the karyotype evolution of the genus Equus. Using appropriate panels of BAC clones in FISH experiments, we compared the centromere position and marker order arrangement among orthologous chromosomes of Burchelli's zebra (Equus burchelli), donkey (Equus asinus), and horse (Equus caballus). Surprisingly, at least eight CRs took place during the evolution of this genus. Even more surprisingly, five cases of CR have occurred in the donkey after its divergence from zebra, that is, in a very short evolutionary time (approximately 1 million years). These findings suggest that in some species the CR phenomenon could have played an important role in karyotype shaping, with potential consequences on population dynamics and speciation.

  16. 33 CFR 334.1100 - San Pablo Bay, Carquinez Strait, and Mare Island Strait in vicinity of U.S. Naval Shipyard, Mare...

    Science.gov (United States)

    2010-07-01

    ... part of the Navy Yard, Mare Island, south of the causeway between the City of Vallejo and Mare Island... Commander, Mare Island Naval Shipyard, Vallejo, California, shall navigate, anchor or moor in this area. [26...

  17. Apollo 15 mare units and their petrogenesis

    International Nuclear Information System (INIS)

    Binder, A.A.

    1985-01-01

    Samples from 12 different mare sites were identified and classified among the Apollo 15 samples. The genesis of the Apollo 15 mare units is summarized given the general model of mare basalt source regions and of more basalt genesis derived from a synthesis of the major oxide/major mineral, compatible siderophile, and incompatible trace element data and isotopic ratios of the Rb/Sr and Sm/Nd systems

  18. Inflammation and fertility in the mare

    DEFF Research Database (Denmark)

    Christoffersen, Mette; Troedsson, Mats H.T.

    2017-01-01

    -inflammatory factors is required for resolving the breeding-induced inflammation within 24–36 hr in the reproductively healthy mare, whereas a subpopulation of mares is susceptible to development of a persistent infection that can interfere with fertility. The aetiology of persistent endometritis can be either...... bacterial or semen-induced and both scenarios can threaten the establishment of pregnancy. Several factors associated with susceptibility to persistent endometritis have been identified including altered innate immune response in the early inflammatory process, reduced myometrial contractions and impaired......) and bacterial endometritis in the mare....

  19. Low genetic diversity of the endangered Indian wild ass Equus ...

    Indian Academy of Sciences (India)

    DEVENDRA KHAIRE

    (Equus hemionus khur) belongs to an endangered wild species/subspecies of wild ... species of the Asiatic wild asses, E. hemionus and E. kiang, have been described on .... 57.9. Tseng et al. (2010). 5 -TCA CCC ACT AAA TCT CAA ATC C-3.

  20. Animal and plant remains in a tomb in test-pit 1/05, outside the fortified imperial palace Felix Romuliana

    Directory of Open Access Journals (Sweden)

    Dimitrijević Vesna

    2007-01-01

    Full Text Available During the excavations of a tomb located outside the defence walls of the imperial palace, Felix Romuliana, animal and plant remains were collected the analysis of which is the subject of the present study. The faunal remains include the bones and teeth of domestic animals - mule (Equus caballus x Equus asinus, domestic ox (Bos taurus, sheep (Ovis aries, sheep or goat (Ovis/Capra, pig (Sus domesticus and dog (Canis familiaris, a few remains of wild animals - red deer (Cervus elaphus and fox (Vulpes vulpes, and bone of a bird. Until now, no remains of mule have been discovered on sites originating from the classical period at the territory of Serbia. As for plant remains, pieces of carbonized oak wood (Quercus and maple wood (Acer were found, as well as a carbonized seed of a cultivated grapevine (Vitis vinifera vinifera and a tiny fruit of goosegrass (Galium aparine.

  1. Poppea's bath liquor: the secret proteome of she-donkey's milk.

    Science.gov (United States)

    Cunsolo, Vincenzo; Muccilli, Vera; Fasoli, Elisa; Saletti, Rosaria; Righetti, Pier Giorgio; Foti, Salvatore

    2011-09-06

    Donkey's milk is today categorized among the best mother's milk substitute for allergic newborns, due to its much reduced or absent allergenicity, coupled to excellent palatability and nutritional value. However, up to the present, only a handful of proteins had been characterized, just about the standard eight to ten major ones known in all types of milk. By exploiting the combinatorial peptide ligand library technology, and treating large volumes (up to 300 mL) of defatted, de-caseinized (whey) milk, we have been able to identify 106 unique gene products, by far the largest description so far of this precious nutrient. Due to poor knowledge of the donkey's genetic asset, only 10% of the proteins could be identified by consulting the data base of Equus asinus; the largest proportion (70%) could be identified by homology with the proteins of Equus caballus. Copyright © 2011 Elsevier B.V. All rights reserved.

  2. Groundwater-level and storage-volume changes in the Equus Beds aquifer near Wichita, Kansas, predevelopment through January 2015

    Science.gov (United States)

    Whisnant, Joshua A.; Hansen, Cristi V.; Eslick, Patrick J.

    2015-10-01

    Development of the Wichita well field began in the 1940s in the Equus Beds aquifer to provide the city of Wichita, Kansas, a new water-supply source. After development of the Wichita well field began, groundwater levels began to decline. Extensive development of irrigation wells that began in the 1970s also contributed to substantial groundwater-level declines. Groundwater-level declines likely enhance movement of brine from past oil and gas production near Burrton, Kansas, and natural saline water from the Arkansas River into the Wichita well field. Groundwater levels reached a historical minimum in 1993 because of drought conditions, irrigation, and the city of Wichita’s withdrawals from the aquifer. In 1993, the city of Wichita adopted the Integrated Local Water Supply Program to ensure that Wichita’s water needs would be met through the year 2050 and beyond as part of its efforts to manage the part of the Equus Beds aquifer Wichita uses. A key component of the Integrated Local Water Supply Program was the Equus Beds Aquifer Storage and Recovery project. The Aquifer Storage and Recovery project’s goal is to store and eventually recover groundwater and help protect the Equus Beds aquifer from oil-field brine water near Burrton, Kansas, and saline water from the Arkansas River. Since 1940, the U.S. Geological Survey has monitored groundwater levels and storage-volume changes in the Equus Beds aquifer to provide data to the city of Wichita in order to better manage its water supply.

  3. Investigating determinants of yawning in the domestic ( Equus caballus) and Przewalski ( Equus ferus przewalskii) horses

    Science.gov (United States)

    Górecka-Bruzda, Aleksandra; Fureix, Carole; Ouvrard, Anne; Bourjade, Marie; Hausberger, Martine

    2016-10-01

    Yawning is rare in herbivores which therefore may be an interesting group to disentangle the potential function(s) of yawning behaviour. Horses provide the opportunity to compare not only animals living in different conditions but also wild versus domestic species. Here, we tested three hypotheses by observing both domestic and Przewalski horses living in semi-natural conditions: (i) that domestic horses may show an elevated rate of yawning as a result of the domestication process (or as a result of life conditions), (ii) that individuals experiencing a higher level of social stress would yawn more than individuals with lower social stress and (iii) that males would yawn more often than females. The study involved 19 Przewalski horses (PHs) and 16 domestic horses (DHs) of different breeds living in large outdoor enclosures. The results showed that there was no difference between the PH and DH in yawning frequency (YF). PHs exhibited much higher levels of social interactions than DHs. There was a positive correlation between yawning frequency and aggressive behaviours in PHs, especially males, supporting the idea that yawning may be associated with more excitatory/stressful social situations. A correlation was found between yawning frequency and affiliative behaviours in DHs, which supports the potential relationship between yawning and social context. Finally, the entire males, but not castrated males, showed much higher levels of yawning than females in both species. The intensity (rather than the valence) of the interaction may be important in triggering yawning, which could therefore be a displacement activity that helps reduce tension.

  4. Brazilian donkeys (Equus asinus) have a low exposure to Neospora spp.

    Science.gov (United States)

    Galvão, Cynthia Maria Morais de Queiroz; Rezende-Gondim, Mariana Marrega; Chaves, Ana Carla Rodrigues; Schares, Gereon; Ribas, Jorge Raimundo Lins; Gondim, Luís Fernando Pita

    2015-01-01

    Donkeys (Equus asinus) are closely related to horses and are known to be infected by several equine pathogens. Neospora caninum and Neospora hughesi are protozoan parasites that infect horses, but they were not confirmed in donkeys up to this date. The aim of this study was to evaluate the exposure of donkeys (Equus asinus) to Neospora spp. using tachyzoites of N. caninum as antigen and employing two common serologic methods, IFAT and immunoblot. Sera from 500 donkeys were obtained from 30 municipalities in Bahia state and tested by IFAT. Two of 500 sera were positive for Neospora spp. by IFAT with antibody titers of 100, and recognized a 37kDa antigen in immunoblot. Approximately 22% of the samples showed strong apical reactions and/or incomplete fluorescence, what may cause confusion in the interpretation of IFAT. We concluded that Neospora spp. are possibly of minor importance for Brazilian donkeys. Future studies are necessary to prove that Neospora spp. can naturally infect donkeys.

  5. Brazilian donkeys (Equus asinus have a low exposure to Neospora spp.

    Directory of Open Access Journals (Sweden)

    Cynthia Maria Morais de Queiroz Galvão

    Full Text Available Donkeys (Equus asinus are closely related to horses and are known to be infected by several equine pathogens. Neospora caninum and Neospora hughesi are protozoan parasites that infect horses, but they were not confirmed in donkeys up to this date. The aim of this study was to evaluate the exposure of donkeys (Equus asinus to Neospora spp. using tachyzoites of N. caninum as antigen and employing two common serologic methods, IFAT and immunoblot. Sera from 500 donkeys were obtained from 30 municipalities in Bahia state and tested by IFAT. Two of 500 sera were positive for Neospora spp. by IFAT with antibody titers of 100, and recognized a 37kDa antigen in immunoblot. Approximately 22% of the samples showed strong apical reactions and/or incomplete fluorescence, what may cause confusion in the interpretation of IFAT. We concluded that Neospora spp. are possibly of minor importance for Brazilian donkeys. Future studies are necessary to prove that Neospora spp. can naturally infect donkeys.

  6. Effect of intrauterine autoplasma application on mare fertility

    OpenAIRE

    ŠTĚRBOVÁ, Hana

    2010-01-01

    The objective of this study was to evaluate the effect of intrauterine plasma infusion on conceiving rate in selected group of mares during the breeding seasons 2008 and 2009. The fresh sperm insemination was followed by the infusion of self-plasma and subsequently the successivity of the insemination was compared with the control group of mares. Next, there were observed following factors which could influence the effectiveness of conceiving: age of the mares, number of insemination doses, s...

  7. Apollo 15 mare volcanism: constraints and problems

    International Nuclear Information System (INIS)

    Delano, J.W.

    1985-01-01

    The Apollo 15 landing site contains more volcanics in the form of crystalline basalts and pristine glasses, which form the framework for all models dealing with the mantle beneath that site. Major issues on the petrology of the mare source regions beneath that portion of Mare Imbrium are summarized

  8. Zygomycetes from herbivore dung in the ecological reserve of Dois Irmãos, Northeast Brazil

    Directory of Open Access Journals (Sweden)

    André Luiz Cabral Monteiro de Azevedo Santiago

    2011-03-01

    Full Text Available Thirty-eight taxa of Zygomycetes distributed in 15 genera were recorded from tapir (Tapirus terrestris, camel (Camelus bactrianus, horse (Equus caballus, deer (Cervus elaphus, agouti (Dasyprocta aguti, donkey (Equus asinus, llama (Llama glama and waterbuck (Kobus ellipsiprymnus dung collected at the Reserva Ecológica de Dois Irmãos located in Recife, State of Pernambuco, Northeast Brazil. The samples were collected on a monthly basis from June 2005 to May 2006, taken to the laboratory and incubated in moist chambers. Higher number of taxa was observed in the excrements of tapir, followed by deer and donkey. The highest number of species was detected for Mucor, followed by Pilobolus. Statistical analyses showed significant differences in richness of Zygomycetes taxa between the herbivore dung types. Differences of species composition, however, were weak. Seasonality influenced the Zygomycetes species composition but not its richness. Variations in taxa composition between ruminants and non-ruminants dung were non significant.

  9. Zygomycetes From Herbivore Dung in the Ecological Reserve of Dois IrmÃOs, Northeast Brazil

    Science.gov (United States)

    de Azevedo Santiago, André Luiz Cabral Monteiro; Botelho Trufem, Sandra Farto; Malosso, Elaine; dos Santos, Paulo Jorge Parreira; de Queiroz Cavalcanti, Maria Auxiliadora

    2011-01-01

    Thirty-eight taxa of Zygomycetes distributed in 15 genera were recorded from tapir (Tapirus terrestris), camel (Camelus bactrianus), horse (Equus caballus), deer (Cervus elaphus), agouti (Dasyprocta aguti), donkey (Equus asinus), llama (Llama glama) and waterbuck (Kobus ellipsiprymnus) dung collected at the Reserva Ecológica de Dois Irmãos located in Recife, State of Pernambuco, Northeast Brazil. The samples were collected on a monthly basis from June 2005 to May 2006, taken to the laboratory and incubated in moist chambers. Higher number of taxa was observed in the excrements of tapir, followed by deer and donkey. The highest number of species was detected for Mucor, followed by Pilobolus. Statistical analyses showed significant differences in richness of Zygomycetes taxa between the herbivore dung types. Differences of species composition, however, were weak. Seasonality influenced the Zygomycetes species composition but not its richness. Variations in taxa composition between ruminants and non-ruminants dung were non significant. PMID:24031609

  10. Investigating attentional processes in depressive-like domestic horses (Equus caballus).

    Science.gov (United States)

    Rochais, C; Henry, S; Fureix, C; Hausberger, M

    2016-03-01

    Some captive/domestic animals respond to confinement by becoming inactive and unresponsive to external stimuli. Human inactivity is one of the behavioural markers of clinical depression, a mental disorder diagnosed by the co-occurrence of symptoms including deficit in selective attention. Some riding horses display 'withdrawn' states of inactivity and low responsiveness to stimuli that resemble the reduced engagement with their environment of some depressed patients. We hypothesized that 'withdrawn' horses experience a depressive-like state and evaluated their level of attention by confronting them with auditory stimuli. Five novel auditory stimuli were broadcasted to 27 horses, including 12 'withdrawn' horses, for 5 days. The horses' reactions and durations of attention were recorded. Non-withdrawn horses reacted more and their attention lasted longer than that of withdrawn horses on the first day, but their durations of attention decreased over days, but those of withdrawn horses remained stable. These results suggest that the withdrawn horses' selective attention is altered, adding to already evidenced common features between this horses' state and human depression. Copyright © 2016. Published by Elsevier B.V.

  11. Desarrollo de resistencia a la insulina en caballos (Equus caballus)

    DEFF Research Database (Denmark)

    Gandarillas, Mónica; Matus, José Tomás; Márquez-Hernández, Roberto I.

    2015-01-01

    In horses, insulin resistance is associated with several comorbidities such as obesity, laminitis, colic and osteochondrosis. The multifactorial causes of insulin resistance in horses have been addressed, which include genetic and environmental factors. As a consequence of these factors, the cell...

  12. Effect of ovarian hormones on the phagocytic response of ovariectomized mares.

    Science.gov (United States)

    Ganjam, V K; McLeod, C; Klesius, P H; Washburn, S M; Kwapien, R; Brown, B; Fazeli, M H

    1982-01-01

    The reaction between ovarian hormones and experimental uterine infection (Streptococcus zooepidemicus) was investigated in 3 groups, each containing 6 ovariectomized mares. Group 1 served as controls ('anoestrus'), Group 2 mares were injected with oestrogen ('oestrus') and Group 3 with progesterone ('dioestrus') over a period of 5 weeks. All mares received an intrauterine inoculation of the bacteria 1 week after the start of hormonal treatment, and the results of the challenge were examined by endometrial biopsy and swabs once weekly. At the end of Week 1 no bacteria were recovered from the mares in Group 2. Group 1 mares were free of bacteria at the end of Week 2 but all Group 3 mares remained infected at least for the total period examined. Streptococcal phagocytosis was quantitated by chemiluminescence. Before the challenge-inoculation, phagocytosis was not significantly different in the 3 groups of mares. Bacterial cultures were negative for all three groups. However, within 48 h after infection, there was a significant increase (P less than 0.01) in phagocytosis in Group 2 and a significant suppression (P less than 0.05) in Group 3 mares. Patterns of streptococcal clearance from the uterus closely paralleled the changes in the magnitude of chemiluminescence response. The results suggest that ovarian hormonal status can modulate the phagocytic response in episodes of streptococcal-induced endometritus in mares.

  13. Mare Pork: emotsionaalsed kangid on kõige tõhusamad / Mare Pork

    Index Scriptorium Estoniae

    Pork, Mare, 1950-

    2010-01-01

    Kliinilise psühholoogia professor Mare Pork tutvustab vestluses raamatut: Neale, Stephen; Spencer-Arnell, Lisa; Wilson, Liz. Emotsionaalse intelligentsuse treening : kuidas tõsta tippjuhi, arengutreeneri ja iseendaga tehtava töö tulemuslikkust. [Tallinn] : Äripäev, 2009

  14. The effect of dietary protein on reproduction in the mare. III. Ovarian and uterine changes during the anovulatory, transitional and ovulatory periods in the non-pregnant mare

    Directory of Open Access Journals (Sweden)

    F.E. Van Niekerk

    1997-07-01

    Full Text Available In the main experiment the total daily protein intake and quality (essential amino-acids was varied in 4 groups of mares. The incidence of oestrus in mares during the transitional period was unaffected by protein nutrition. Ovarian activity, as evaluated by follicular development and size of the ovaries, was affected. Mares that received low-quality protein (Groups 1 and 2 had a higher number of smaller follicles (<10 mm that developed during the transitional period compared to mares on a high-quality protein intake (Groups 3 and 4. The mares that received the high quality protein ovulated 2-3 weeks earlier in the breeding season in a synchronised period of 4-5 weeks compared to a period of 6-8 weeks in Groups 1 and 2. The duration of the subsequent oestrous cycles was not affected. There was no difference in the diameter of the largest follicle of mares between groups on the day before ovulation. In a separate experiment, 5 maiden Anglo-Arab mares, 4-5 years of age, were slaughtered at different stages during the anovulatory, transitional and ovulatory periods of the breeding cycle. The morphology of the ovaries and uteri of these mares was described and photographed for use as guidelines when comparing ovarian changes and follicular activity of mares.

  15. Poor horse traders: large mammals trade survival for reproduction during the process of feralization

    Science.gov (United States)

    Grange, Sophie; Duncan, Patrick; Gaillard, Jean-Michel

    2009-01-01

    We investigated density dependence on the demographic parameters of a population of Camargue horses (Equus caballus), individually monitored and unmanaged for eight years. We also analysed the contributions of individual demographic parameters to changes in the population growth rates. The decrease in resources caused a loss of body condition. Adult male survival was not affected, but the survival of foals and adult females decreased with increasing density. Prime-aged females maintained high reproductive performance at high density, and their survival decreased. The higher survival of adult males compared with females at high density presumably results from higher investment in reproduction by mares. The high fecundity in prime-aged females, even when at high density, may result from artificial selection for high reproductive performance, which is known to have occurred in all the major domestic ungulates. Other studies suggest that feral ungulates including cattle and sheep, as these horses, respond differently from wild ungulates to increases in density, by trading adult survival for reproduction. As a consequence, populations of feral animals should oscillate more strongly than their wild counterparts, since they should be both more invasive (as they breed faster), and more sensitive to harsh environmental conditions (as the population growth rate of long-lived species is consistently more sensitive to a given proportional change in adult survival than to the same change in any other vital rate). If this principle proves to be general, it has important implications for management of populations of feral ungulates. PMID:19324787

  16. A lectin histochemical study to detect variation in glycosylation at the feto-maternal interface in three interbreeding equine species.

    Science.gov (United States)

    Jones, Carolyn J P; Allen, W R Twink; Wilsher, Sandra

    2017-10-01

    In this study, we compare glycosylation at the fetomaternal interface in 3 equine species: horse, donkey and zebra, all of which can interbreed to produce hybrids, to assess their glycan similarities and differences. Sections cut from 3 specimens of horse (Equus caballus) placenta (50, 200 and 280 days gestation), one donkey (Equus asinus) placenta (65 cm crown-rump length) and 5 specimens of zebra (Equus quagga) placentae (81-239 days gestation) were stained with a panel of 24 biotinylated lectins using an avidin-peroxidase revealing system. There were only slight quantitative differences in the lectin histochemistry at the feto-maternal interface between all three specimens; zebra placentae expressed more α2,6-linked sialic acid, with α1,2fucosyl residues at the microvillous interface. However, zebra trophoblast showed histological differences from the other two species, with polarised cells, prominent supranuclear Golgi bodies, and fewer intracellular granules. Our findings appear to confirm the hypothesis that closely related, interbreeding species with epitheliochorial placentae express similar glycans at the feto-maternal interface, thereby supporting the existence of a placental glycocode. We also observed intraspecies evolutionary diversion to be associated with a different histological architecture and the absence of significant intracellular granules. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Sotsiaaltöö koolis / Mare Leino

    Index Scriptorium Estoniae

    Leino, Mare, 1961-

    2000-01-01

    Rets. rmt. : Leino, Mare. Õpetaja sotsiaaltöö tegijana : sotsiaalpedagoogika : monograafia = Teacher as a social worker : social pedagogic : a monograph / Mare Leino ; Tallinna Pedagoogikaülikool. Tallinn : Tallinna Pedagoogikaülikooli Kirjastus, 2000. 146 lk. : ill. - (Acta Universitatis Scientiarum Socialium et Artis Educandi Tallinnensis. A, Humaniora =Proceedings of the Tallinn University of Social and Educational Sciences. A, Humaniora = Tallinna Pedagoogikaülikooli toimetised. A, Humaniora, 1023-1064 ; 18). Bibliogr. lk. 136-146. Kokkuv. inglise keeles

  18. Ultrastructure of Sarcocystis bertrami sarcocysts from naturally infected donkey (Equus asinus) from Egypt

    Science.gov (United States)

    There is considerable confusion concerning Sarcocystis species in equids. Little is known of Sarcocystis infections in donkeys (Equus asinus). Here we describe the structure of Sarcocystis bertrami-like from the donkey by light and transmission electron microscopy (LM, TEM). Nineteen sarcocysts fro...

  19. LESIONES CUTANEAS PARASITARIAS EN EL ASNO EQUUS ASINUS DE CHORONI, ESTADO ARAGUA, VENEZUELA

    DEFF Research Database (Denmark)

    Morales, Abelardo; Garcia, Francisco; Rossini, Mario

    2010-01-01

    Three donkeys (Equus asinus Linnaeus, 1758), two males and a female sex, between 5-8 years of old, in athletic shape, in Choroni, Aragua, Venezuela were examined. Clinical examination evidenced hirsute hair and moderate body condition. Nodular dermatitis like skin lesions showed crusted erythemat...

  20. Reproductive Performance of Arabian and Thoroughbred Mares under Subtropical Conditions of Pakistan.

    Science.gov (United States)

    Warriach, H M; Memon, M A; Ahmad, N; Norman, S T; Ghafar, A; Arif, M

    2014-07-01

    Breeding records of 57 Arabian and 66 Thoroughbred mares were analysed to assess their reproductive performance under the subtropical conditions of Pakistan. The Arabian mares showed significantly higher conception rates (p500±32 days) was significantly (psummer (June to August) months. Age of mares affected the conception rates, as mares at ages 3 to 7 and 8 to 12 years of ages had significantly higher conception rates (psummer months.

  1. Mitochondrial genome sequence of the Tibetan wild ass (Equus kiang).

    Science.gov (United States)

    Luo, Yongjun; Chen, Yu; Liu, Fuyu; Jiang, Chunhua; Gao, Yuqi

    2011-02-01

    The Tibetan wild ass, or kiang (Equus kiang) is endemic to the cold and hypoxic (4000-7000 m above sea level) climates of the montane and alpine grasslands of the Tibetan Plateau. We report here the complete nucleotide sequence of the E. kiang mitochondrial genome. Our results show that E. kiang mitochondrial DNA is 16,634 bp long, and predicted to encode all the 37 genes that are typical for vertebrates.

  2. [Evaluation of immunoglobulin G concentration in colostrum of mares by ELISA, refractometry and colostrometry].

    Science.gov (United States)

    Venner, Monica; Markus, R G; Strutzberg-Minder, K; Nogai, K; Beyerbach, M; Klug, E

    2008-01-01

    In 360 samples of colostrum and 36 samples of blood of warmblood mares, the concentration of immunoglobulin G (IgG) was evaluated in the post partal period with an ELISA and the results were compared to values obtained with 2 field methods--refractometry and colostrometry. A significant correlation (p refractometry (r = +0.93). So both field-methods seem suitable for evaluation of the colostral IgG-concentration in mares. Further the kinetic of the IgG concentration in colostrum, the volume of colostrum and the total amount of IgG was measured in the 12 hours post partum (p.p.) in each half udder of 36 mares of different parity. Immediately p.p. primiparous mares have a greater mean concentration of IgG (68 mg/ml) than multiparous mares (51 mg/ml). However, multiparous mares have a mean colostral volume of 1020 ml whereas, in primiparous mares, a mean volume of 527 ml was determined within the first three hours p.p. As a result of this the total amount of IgG was lower in primiparous (31.5 g) than in multiparous mares (48.5 g). A significant decrease of IgG concentration was measured in multiparous mares in the 1.5 hours following partum versus 3 hours in primiparous mares. The mean IgG concentration in the blood serum of the 36 mares immediately p.p. was 13.4 +/- 3.6 mg/ml. No significant correlation was observed between values of IgG concentration in the blood and in the colostrum of the mares.

  3. Genetic diversity of piroplasms in plains zebra (Equus quagga burchellii) and Cape mountain zebra (Equus zebra zebra) in South Africa.

    Science.gov (United States)

    Bhoora, Raksha; Buss, Peter; Guthrie, Alan J; Penzhorn, Barend L; Collins, Nicola E

    2010-11-24

    Seventy EDTA blood samples collected from plains zebra (Equus quagga burchellii) and Cape mountain zebra (Equus zebra zebra) were screened for the presence of piroplasm parasite DNA using quantitative T. equi-specific and B. caballi-specific TaqMan real-time PCR (qPCR) tests. T. equi parasite DNA was detected in 60 samples, 19 of which were also positive for B. caballi. Approximately 1480bp of the piroplasm 18S rRNA gene was amplified and sequenced from 17 samples, while the V4 hypervariable region of the 18S rRNA gene was amplified, cloned and sequenced from 31 samples. BLASTN analysis revealed that all of the sequences obtained were most similar to T. equi genotypes and not B. caballi genotypes. Although Babesia parasites were present in some of these samples, as indicated by qPCR, the parasitaemia may have been too low to allow detection by cloning of PCR products from a mixed infection. Sequence analyses of both the full-length and the V4 hypervariable region of the T. equi 18S rRNA gene revealed the existence of 13 new T. equi sequences from zebra, confirming the existence of sequence heterogeneity in the rRNA genes of the parasites that cause equine piroplasmosis, and further suggesting that there may be additional, as yet unidentified, T. equi and B. caballi 18S rRNA sequences present in the horse and zebra populations in South Africa. The occurrence of previously unrecognized sequence variation could pose a potential problem in the implementation of diagnostic tests targeting the 18S rRNA gene. Copyright © 2010 Elsevier B.V. All rights reserved.

  4. Investigating the stratigraphy of Mare Imbrium flow emplacement with Earth-based radar

    Science.gov (United States)

    Morgan, G. A.; Campbell, B. A.; Campbell, D. B.; Hawke, B. R.

    2016-08-01

    The lunar maria are the product of extensive basaltic volcanism that flooded widespread portions of the Moon's surface. Constraining mare volcanic history therefore provides a window into the endogenic processes responsible for shaping the Moon. Due to the low magma viscosity and the associated thin nature of lava units, the majority of mare surface structures are masked and subdued by impact regolith. Subtle individual mare flow morphologies, coupled with spatial limitations in the use of crater size distributions to distinguish surface units close in age, restrict our understanding of mare stratigraphy. Earth-based 70 cm wavelength (P band) radar can reveal features beneath the regolith and highlight very subtle changes in the ilmenite content of the flows, providing a unique means to map mare units. Here we map volcanic units in Mare Imbrium using high-resolution (200 m/pixel), Earth-based P band data. Situated within the heat-producing potassium, rare earth element, and phosphorus terrane, Mare Imbrium experienced some of the most long-lived (and recent) lunar volcanism, and its surface exhibits a significant diversity of basaltic chemistry. Our investigation identifies at least four distinct stages of volcanic activity, originating from multiple sources within Imbrium. The most recent of these stages comprises extensive, yet relatively thin volcanic flow units that left remnant kipukas of older mare material distributed across much of the basin. From a future mission perspective, it may be possible to collect samples expressing a wide range in age from small areas of Mare Imbrium. Our map also places important constraints on the interpretation of the Chang'e-3 Lunar Penetrating Radar measurements.

  5. Mare Pork : Koolitus olgu puhkus ja pingutus / Mare Pork ; interv. Urve Vilk

    Index Scriptorium Estoniae

    Pork, Mare

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 12. märts lk. 16-17. Koolitaja Mare Pork leiab, et töös võiks olla rohkem lõbu ja loovust ning koolitus võiks olla nii korralik pingutus kui ka korralik puhkus täis-ümberlülitusega

  6. Determinants of gestation length in Thoroughbred mares on German stud farms.

    Science.gov (United States)

    Ewert, Mareike; Lüders, Imke; Böröcz, Jozsef; Uphaus, Hubert; Distl, Ottmar; Sieme, Harald

    2018-04-01

    The aim of the present study was to analyze the effects of stallion and mare, their ages, and maternal lineage on the gestation length (GL) in Thoroughbreds. In addition, additive genetic effects of the dam, stallion and fetus were analyzed. Data were taken from 1993 through 2009, and included 16,226 pregnancies from 5959 Th oroughbred mares mated with 290 different stallions. All analyses were performed using linear mixed models. The GL ranged from 306 to 390 days, with a mean length of 347.0 ± 14.4 days. Mating of mares with stallions aged 17 years and older resulted in a significantly longer GL compared to younger stallions. Furthermore, the GL significantly increased with the increasing age of the mares, and the GL was longer with male foals. The month and year of breeding, as well as the mare´s breeding history (parity and reproductive status) also affected GL. The mare and stallion themselves explained 18% and 4% of the variance in GL. Coefficients of inbreeding of mares and foals had no significant effect on GL. The heritability for the GL was 0.17 for the dam and 0.006 for the fetus, whereas an additive genetic paternal effect was not estimable. The relative proportions among the additive genetic and permanent environmental contributions of the dam were 76.5% and 23.5%. A maternal lineage effect was not obvious. Copyright © 2018 Elsevier B.V. All rights reserved.

  7. MARES: Navigation, Control and On-board Software

    OpenAIRE

    Aníbal Matos; Nuno Cruz

    2009-01-01

    MARES, or Modular Autonomous Robot for Environment Sampling, is a 1.5m long AUV, designed and built by the Ocean Systems Group. The vehicle can be programmed to follow predefined trajectories, while collecting relevant data with the onboard sensors. MARES can dive up to 100m deep, and unlike similar-sized systems, has vertical thrusters to allow for purely vertical motion in the water column. Forward velocity can be independently defined, from 0 to 2 m/s. Major application areas include pollu...

  8. Biometria de pontes de miocárdio em muares (Equus caballus x Equus asinus – Linnaeus 1758

    Directory of Open Access Journals (Sweden)

    André Luiz C. Ribeiro

    2009-06-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2009v22n3p177 O presente estudo objetivou estudar a freqüência, largura e localização, especialmente no que diz respeito à posição e vasculotopia, das pontes de miocárdio sobre os ramos ventriculares das artérias coronárias direita e esquerda em muares, através da biometria. Estas informações podem contribuir na compreensão das doenças cardíacas, principalmente aquelas relacionadas à circulação coronariana, e na elucidação da importância e funcionalidade das pontes de miocárdio em animais submetidos ou não a esforços físicos. Para isso utilizou-se o muar (n = 30 como modelo, por ser este muitas vezes submetido a extenuantes exercícios físicos de tração. As pontes de miocárdio em muar ocorreram em 76,6% dos corações, o seu número variou de 1 a 7, sendo que foram mais freqüentemente encontradas na porção apical dos corações (37,5% e em igual freqüência sobre os ramos das artérias coronárias direita e esquerda.

  9. CYTOLOGY PULMONARY IN HORSES (EQUUS CABALLUS MAINTAINED THE FIELD OR STABLED

    Directory of Open Access Journals (Sweden)

    W. F. Fortes Júnior

    2016-11-01

    Full Text Available Tracheobronchial secretion was collected by endoscopy (Welch-AllynÒ, 200cm long and 9mm diameter, from equines with different ages, races and sex, for posterior cytological analysis. Thirty-six equines were divided into two groups (Group I = stabled, n = 18; Group II = field regimen, n = 18. Animals of Group I (age = 3.5 years were lodged in the Tarumã´s Jockey Club in Curitiba, Parana State. The equines of Group II always were maintained at field condition (never were stabled, in the farm located in Jacarezinho, Paraná State. Following endoscopic exams, tracheobronchial secretion smears were stained by Pappenhein´s method and submitted to cytological analysis. Group I had higher frequency of tracheal discharge than Group II. The cytological analysis showed more presence of macrophages (58.8%, foamy cells (2.3%, body giant cells (0.2%, neutrophils (4.57%, eosinophils (0.7% and Curshmann´s spirals (0.04% on 3 of the 18 animals. The cytological analysis of Group II showed higher frequency of ciliated epithelial cells than Group I, and no Curshmann´s spirals were observed. In conclusion, data showed that horses stabled had more cytological alterations than the animals maintained at field, therefore more tracheobronchial complications. Thus, the care of place where horse are stabled have influence on development of respiratory diseases, may predispose to affections as Chronic Obstructive Pulmonary Disease and Exercise-Induced Pulmonary Hemorrhage, as well athletic horses may be never reach their full respiratory potential.

  10. Identification of Novel Equine (Equus caballus Tendon Markers Using RNA Sequencing

    Directory of Open Access Journals (Sweden)

    Jan M. Kuemmerle

    2016-11-01

    Full Text Available Although several tendon-selective genes exist, they are also expressed in other musculoskeletal tissues. As cell and tissue engineering is reliant on specific molecular markers to discriminate between cell types, tendon-specific genes need to be identified. In order to accomplish this, we have used RNA sequencing (RNA-seq to compare gene expression between tendon, bone, cartilage and ligament from horses. We identified several tendon-selective gene markers, and established eyes absent homolog 2 (EYA2 and a G-protein regulated inducer of neurite outgrowth 3 (GPRIN3 as specific tendon markers using RT-qPCR. Equine tendon cells cultured as three-dimensional spheroids expressed significantly greater levels of EYA2 than GPRIN3, and stained positively for EYA2 using immunohistochemistry. EYA2 was also found in fibroblast-like cells within the tendon tissue matrix and in cells localized to the vascular endothelium. In summary, we have identified EYA2 and GPRIN3 as specific molecular markers of equine tendon as compared to bone, cartilage and ligament, and provide evidence for the use of EYA2 as an additional marker for tendon cells in vitro.

  11. Esteatosis en un burro (Equus asinus. Primer reporte en Colombia

    Directory of Open Access Journals (Sweden)

    José Cardona Á.

    2011-12-01

    Full Text Available Se describe un caso de esteatosis en un burro (Equus asinus, castrado, de 15 años de edad, procedente del municipio de San Antero (Córdoba, Colombia, al cual se le detectó ligamento nucal engrosado, duro y doloroso, dando la impresión de un doble cuello y edemas subcutáneos indurados en pared costal, abdominal y pectoral. Tambiénpresentó masas duras en la unión de músculos semimembranoso y semitendinoso. Por todo lo anterior, mostró dificultad para realizar movimientos coordinados del cuello, nuca y de traslado. Estos hallazgos obedecen principalmente a una deficiencia de selenio y vitamina E, sirviendo como parámetro diagnóstico para la identificación de esta enfermedad en equinos, por lo cual se determinó la actividad eritrocitica de la enzima glutatión peroxidada (GSH-Px, arrojando resultados muy bajos. Este cuadro es también conocido en equinos como enfermedad de la grasa amarilla o esteatitis, que produce degeneración del tejido adiposo, siendo reemplazado por tejido conectivo con depósitos de calcio. Puede estar asociada a miodegeneración nutricional o distrófica (enfermedad del músculo blanco. Es el primer reporte de esta enfermedad en burros(Equus asinus que se hace en Colombia.

  12. Temporal feeding pattern may influence reproduction efficiency, the example of breeding mares.

    Directory of Open Access Journals (Sweden)

    Haifa Benhajali

    Full Text Available Discomfort in farm animals may be induced by inappropriate types or timing of food supplies. Thus, time restriction of meals and lack of roughage have been shown to be one source of emergence of oral stereotypies and abnormal behaviour in horses which have evolved to eat high-fibre diets in small amounts over long periods of time. This feeding pattern is often altered in domestic environment where horses are often fed low fibre meals that can be rapidly consumed. This study aimed at determining the effect of the temporal pattern of feeding on reproductive efficiency of breeding mares, One hundred Arab breeding mares were divided into two groups that differed only in the temporal pattern of roughage availability: only at night for the standard feeding pattern group (SFP mares, night and day for the "continuous feeding" group (CF mares. The total amount of roughage provided was the same as the CF mares received half of the hay during the day while in paddock (haynets. Mares were tested for oestrus detection by teasing with one stallion and were then examined clinically by rectal palpations and ultrasound before being mated naturally or inseminated by fresh or frozen semen. Multivariate logistic regression was used to analyse data. The treatment affected significantly the reproductive efficiency of the mares with fewer oestrus abnormalities (p = 0.0002 and more fertility (p = 0.024 in CF mares (conception rate = 81% versus 55% in SFP mares. Ensuring semi-continous feeding by providing roughage may be a way of fulfilling the basic physiological needs of the horses' digestive system, reducing stress and associated inhibitors of reproduction. To our knowledge, this study provides the first evidence of an impact of temporal feeding patterns on reproductive success in a Mammal. Temporal patterns of feeding may be a major and underestimated factor in breeding.

  13. IL26 gene inactivation in Equidae.

    Science.gov (United States)

    Shakhsi-Niaei, M; Drögemüller, M; Jagannathan, V; Gerber, V; Leeb, T

    2013-12-01

    Interleukin-26 (IL26) is a member of the IL10 cytokine family. The IL26 gene is located between two other well-known cytokines genes of this family encoding interferon-gamma (IFNG) and IL22 in an evolutionary conserved gene cluster. In contrast to humans and most other mammals, mice lack a functional Il26 gene. We analyzed the genome sequences of other vertebrates for the presence or absence of functional IL26 orthologs and found that the IL26 gene has also become inactivated in several equid species. We detected a one-base pair frameshift deletion in exon 2 of the IL26 gene in the domestic horse (Equus caballus), Przewalski horse (Equus przewalskii) and donkey (Equus asinus). The remnant IL26 gene in the horse is still transcribed and gives rise to at least five alternative transcripts. None of these transcripts share a conserved open reading frame with the human IL26 gene. A comparative analysis across diverse vertebrates revealed that the IL26 gene has also independently been inactivated in a few other mammals, including the African elephant and the European hedgehog. The IL26 gene thus appears to be highly variable, and the conserved open reading frame has been lost several times during mammalian evolution. © 2013 The Authors, Animal Genetics © 2013 Stichting International Foundation for Animal Genetics.

  14. SOME SERUM BIOCHEMICAL CONSTITUENTS OF MARES DURING DIFFERENT PHASES OF REPRODUCTIVE CYCLE

    Directory of Open Access Journals (Sweden)

    F. Ali, L. A. Lodhi, Z. I. Qureshi, H. A. Samad and R. U. Shahid1.

    2004-07-01

    Full Text Available Serum glucose, total proteins, calcium and inorganic phosphorus were determined in estrual, pregnant, infertile and regular breeder mares, each group comprising of 10 animals. The mares were grouped on the basis of rectal examination, history and records. There was a significant (P0.05 difference in the serum phosphorus levels among all the groups of mares.

  15. Research on Donkey Populations (Equus Asinus in Banat

    Directory of Open Access Journals (Sweden)

    Marcel Matiuti

    2011-05-01

    Full Text Available Research has been made in what concerns the bodily development of donkeys (Equus asinus in Banat, on a number of 94 specimens. The results have shown a great variety in body measures, colours and hues. The Banat Donkey comes from different areas in Romania, Europe or Levant. In 2010 in Banat there were approx. 1000 donkey specimens, 98% of which pertained to shepherds. In the case of this species the mating occurs naturally, and a selection has never been made. Their meat and milk are only rarely consumed by some communities, even if their milk is highly appreciated in the European Union.

  16. Characteristics in mineral compositions of lunar latest mare volcanism revealed from spectral data

    Science.gov (United States)

    Kato, S.; Morota, T.; Yamaguchi, Y.; Watanabe, S.; Otake, H.; Ohtake, M.; Nimura, T.

    2016-12-01

    Lunar mare basalts provide insights into the composition and thermal history of the lunar mantle. According to crater counting analysis with remote sensing data, the ages of mare basalts suggest a first peak of magma activity at 3.2-3.8 Ga and a second peak at 2 Ga. In order to understand the mechanism for causing the second peak and its magma source, we reassess the correlation between the titanium contents and the eruption ages of mare basalt units using the compositional and chronological data updated by SELENE (Kaguya). In the Procellarum KREEP Terrane, where the latest mare basalt units are concentrated, an increase in the mean titanium content is observed in the Eratosthenian Period, as reported by previous studies. We found that, however, a rapid increase in mean titanium content occurred near 2.3 Ga. This result suggests that the magma source of the mare basalts changed at this particular age. Moreover, the high-titanium basaltic eruptions are correlated with the second peak in mare volcanism at 2 Ga. The latest mare volcanism may have been induced by a super-hot plume originating from the core-mantle boundary. In this study, to reveal the difference between the volcanic activities before and after 2.3 Ga, we developed the method to estimate the mineral components and elemental compositions of lunar mare basalts by using the Kaguya Spectral Profiler data. We will introduce the detail of the method and discuss about the difference between the mineral compositions of mare basalts before and after 2.3 Ga based on our preliminary results.

  17. HORMONETHERAPY IN MARE

    Directory of Open Access Journals (Sweden)

    A. L. M. Marinho

    2015-06-01

    Full Text Available When compared with other domestic animals the equine species is that present the minors reproductive indices. Besides some parameters of estrous cycle are variable to we consider each mare individually, what hinders the reproductive handling, these females respond the alterations of seasonality, this fact limits in reproduction its potential. Therefore, the uses of innovative reproductive biotechnologies and hormonal protocols have shown indispensable for the producers who wish to increase the reproductive rate of this species. Hormontherapy has shown great efficiency in handling the estrous cycle of these females. Thus, this literature review aimed to perform an update regarding hormonal protocols used in the equine species. Dealt with the main hormones used to control the estrous cycle of mares, as prostaglandin F2a (PGF2α, estrogens, progestogens, human chorionic gonadotropin (hCG, the gonadotropin-releasing hormone (GnRH, equine pituitary extract (EPE, the purified equine follicle stimulating hormone (eFSH and oxytocin. It became evident that the knowledge of hormontherapy applied in equine reproduction is of utmost importance, allowing higher profitability by improving the reproductive efficiency of animals of high genetic value, generating benefits for both the professional as to the owner

  18. Experimental exposure of pregnant mares to the asinine-94 strain of equine arteritis virus

    Directory of Open Access Journals (Sweden)

    J.T. Paweska

    1997-07-01

    Full Text Available Clinical, virological and serological responses were evaluated in 10 pregnant mares after different challenge exposures to the asinine-94 strain of equine arteritis virus (EAV. The outcome of maternal infection on the progeny was also investigated. Mares were inoculated intranasally (n = 4, intramuscularly (n = 2, intravenously (n = 1, or contact-exposed (n = 3. All inoculated mares developed pyrexia, 5 showed mild clinical signs related to EAV infection and 2 remained asymptomatic. Viraemia was detected in all the inoculated animals and shedding of virus from the respiratory tract occurred in 6. Five mares were re-challenged intranasally 7 and 15 weeks after inoculation. Clinical signs of the disease in these mares were limited to mild conjunctivitis. After re-challenge, virus was recovered from buffy coat cultures of 2 mares 2-6 days after re-infection. EAV was not recovered from colostrum and milk samples during the 1st week post partum. All inoculated mares seroconverted to EAV 8-12 days post inoculation and also seroconverted after re-challenge. No clinical signs of EAV infection were observed in the 3 mares kept in close contact during the post-inoculation and re-challenge periods. Serum neutralising antibody to the virus was detected in 1 in-contact mare only, while a detectable concentration of specific IgG was found by ELISA in the colostrum of 1 of the other in-contact mares. Eight of the mares gave birth to clinically normal foals, although 1 was born prematurely. Shortly after birth, 7 foals developed fever and variable clinical signs; 5 foals became septicaemic and 3 of them died 2-5 days after birth, while the remaining 2 were euthanased at 1 month of age. EAV was not recovered from the placenta, from buffy coat fractions of blood collected from foals immediately after birth and 1-3 days later, or from a range of tissues taken from the 3 foals that died and 2 that were euthanased. Virus was not isolated from tissues collected from

  19. Mare Crisium - Regional stratigraphy and geologic history. [from spectral reflectivities of Lunik 24 samples

    Science.gov (United States)

    Adams, J. B.; Head, J. W., III; Mccord, T. B.; Pieters, C.; Zisk, S.

    1978-01-01

    Spectral reflectance measurements of five Luna 24 samples and new telescopic reflectance spectra of 10-20 km areas of seven sites in Mare Crisium have been used to calibrate multispectral images of mare units. Based on these data, three major mare units are defined in the Crisium basin and their stratigraphy is interpreted. The oldest mare unit is exposed in the ejecta of the craters Picard and Peirce and along the outer edge of the southeastern part of the basin. The next younger unit includes the Luna 24 site and generally follows a topographic annulus along the basin margin. The youngest mare unit occupies the central part of the basin. It is concluded that subsidence occurred throughout the emplacement of mare units, including extensive warping and downfaulting of the inner part of the Crisium basin.

  20. Male harassment influences female movements and associations in Grevy's zebra (Equus grevyi)

    OpenAIRE

    Siva R. Sundaresan; Ilya R. Fischhoff; DI Rubenstein

    2007-01-01

    In traditional models for social organization, female movements and association patterns track resource distribution, whereas males track females. More recently, this model has been expanded to include feedback effects of male behavior, especially sexual harassment, on female decisions. In Grevy's zebra (Equus grevyi), males defend territories containing resources attractive to females, who form unstable groups. Past research has explained female behavior based on resource distribution and ne...

  1. Aberrations in uterine contractile patterns in mares with delayed uterine clearance after administration of detomidine and oxytocin.

    Science.gov (United States)

    von Reitzenstein, Marcela; Callahan, Megan A; Hansen, Peter J; LeBlanc, Michelle M

    2002-09-01

    An experiment was conducted to determine whether the uterotonic effects of oxytocin, a drug used to treat mares that have a delay in uterine clearance were affected by the sedative detomidine (an alpha2-agonist), a drug used to treat fractious mares. An additional objective was to identify propagation patterns of uterine contractions and determine whether these patterns differed between normal mares and mares with delayed uterine clearance (DUC). Intrauterine pressure was measured in five reproductively normal mares and four mares with DUC during estrus using an 8-F Milar catheter with two discrete pressure sensors. Mares received one of three treatments in random order: detomidine (0.001 mg/kg; i.v.); detomidine followed in 10 min by oxytocin (10 IU; i.v.); and saline (0.9% NaCl 0.5 ml; i.v.) followed in 10 min by oxytocin. All treatments induced waves of contractions; however, only three mares with DUC exhibited contractions after administration of detomidine. Normal mares experienced more uterine contractions (P detomidine before oxytocin increased the number of contractions (P Detomidine had no effect in mares with delayed clearance. All mares had more propagating than non-propagating uterine contractions (74 +/- 8 versus 25 +/- 8%, respectively). Normal mares exhibited a normal propagation pattern more frequently (P detomidine increased the number (P detomidine augmented the uterotonic effect of oxytocin in normal mares but not in mares with DUC. Data suggest that mares with DUC have a defect in myoelectrical signaling and a decrease in the contractile strength of the uterine muscle.

  2. Yoghurt fermentation trials utilizing mare milk: comparison with cow milk

    Directory of Open Access Journals (Sweden)

    R. Giangiacomo

    2011-03-01

    Full Text Available Mare milk shows a very interesting nutritional composition, similar to human milk. Whey protein fraction represents about 50% of total proteins, with a good amount of essential amino acids, and high lysozyme concentration (Jauregui-Adell, 1975. Mare milk contains essential fatty acids, progenitors of ω3 and ω6, higher than cow milk (Csapò et al., 1995; Curadi et al., 2002. In east european countries mare milk is utilized in dietetics and therapeutics for gastroenteric and cardiac pathologies (Sharmanov et al., 1982; Mirrakimov et al., 1986, or as a drink obtained from lactic and alcoholic fermentation (Koumiss...

  3. Naming Lunar Mare Basalts: Quo Vadimus Redux

    Science.gov (United States)

    Ryder, G.

    1999-01-01

    Nearly a decade ago, I noted that the nomenclature of lunar mare basalts was inconsistent, complicated, and arcane. I suggested that this reflected both the limitations of our understanding of the basalts, and the piecemeal progression made in lunar science by the nature of the Apollo missions. Although the word "classification" is commonly attached to various schemes of mare basalt nomenclature, there is still no classification of mare basalts that has any fundamental grounding. We remain basically at a classification of the first kind in the terms of Shand; that is, things have names. Quoting John Stuart Mill, Shand discussed classification of the second kind: "The ends of scientific classification are best answered when the objects are formed into groups respecting which a greater number of propositions can be made, and those propositions more important than could be made respecting any other groups into which the same things could be distributed." Here I repeat some of the main contents of my discussion from a decade ago, and add a further discussion based on events of the last decade. A necessary first step of sample studies that aims to understand lunar mare basalt processes is to associate samples with one another as members of the same igneous event, such as a single eruption lava flow, or differentiation event. This has been fairly successful, and discrete suites have been identified at all mare sites, members that are eruptively related to each other but not to members of other suites. These eruptive members have been given site-specific labels, e.g., Luna24 VLT, Apollo 11 hi-K, A12 olivine basalts, and Apollo 15 Green Glass C. This is classification of the first kind, but is not a useful classification of any other kind. At a minimum, a classification is inclusive (all objects have a place) and exclusive (all objects have only one place). The answer to "How should rocks be classified?" is far from trivial, for it demands a fundamental choice about nature

  4. Creatinine concentrations of accumulated intrauterine fluid to confirm the clinical diagnosis of urometra in mares.

    Science.gov (United States)

    Schnobrich, M R; Gordon, D L; Scoggin, C F; Bradecamp, E A; Canisso, I F

    2017-03-25

    Urine pooling, as a persistent condition, is a cause of infertility in mares due to endometrial inflammation and sperm toxicity. Identification of urometra can be challenging in mares presenting with the condition intermittently, or when urine flows into the uterus but is undetectable in the vagina. Currently, there are no reported objective methods to confirm the clinical diagnosis of urine contamination in intrauterine-fluid accumulations. Since creatinine is present in high concentrations in urine and does not diffuse across cell membranes, creatinine concentration should be increased in mares with urometra, but negligible in normal and mares with intrauterine fluid accumulation (non-urometra cases). To test this hypothesis, creatinine concentrations of intrauterine fluid were measured in mares with a clinical diagnosis of urine accumulation (n=9) or intrauterine fluid containing no urine (n=10). Results showed that creatinine concentrations (mg/dl) were significantly higher in mares that had a clinical diagnosis of urometra (42.8±12.6, range 4.1-109.2) compared with those that did not (0.38±0.1, range 0-0.9). Also, two mares after urethral extension surgery demonstrated a remarkable reduction in creatinine concentrations. This study highlights an undocumented approach to confirm a clinical diagnosis of urometra in mares; the authors anticipate that testing for creatinine in the uterine fluid of mares may become a standard tool for identifying urometra in mares and confirming the success of urogenital surgeries. British Veterinary Association.

  5. Next Generation Semiconductor Based Sequencing of the Donkey (Equus asinus) Genome Provided Comparative Sequence Data against the Horse Genome and a Few Millions of Single Nucleotide Polymorphisms

    Science.gov (United States)

    Bertolini, Francesca; Scimone, Concetta; Geraci, Claudia; Schiavo, Giuseppina; Utzeri, Valerio Joe; Chiofalo, Vincenzo; Fontanesi, Luca

    2015-01-01

    Few studies investigated the donkey (Equus asinus) at the whole genome level so far. Here, we sequenced the genome of two male donkeys using a next generation semiconductor based sequencing platform (the Ion Proton sequencer) and compared obtained sequence information with the available donkey draft genome (and its Illumina reads from which it was originated) and with the EquCab2.0 assembly of the horse genome. Moreover, the Ion Torrent Personal Genome Analyzer was used to sequence reduced representation libraries (RRL) obtained from a DNA pool including donkeys of different breeds (Grigio Siciliano, Ragusano and Martina Franca). The number of next generation sequencing reads aligned with the EquCab2.0 horse genome was larger than those aligned with the draft donkey genome. This was due to the larger N50 for contigs and scaffolds of the horse genome. Nucleotide divergence between E. caballus and E. asinus was estimated to be ~ 0.52-0.57%. Regions with low nucleotide divergence were identified in several autosomal chromosomes and in the whole chromosome X. These regions might be evolutionally important in equids. Comparing Y-chromosome regions we identified variants that could be useful to track donkey paternal lineages. Moreover, about 4.8 million of single nucleotide polymorphisms (SNPs) in the donkey genome were identified and annotated combining sequencing data from Ion Proton (whole genome sequencing) and Ion Torrent (RRL) runs with Illumina reads. A higher density of SNPs was present in regions homologous to horse chromosome 12, in which several studies reported a high frequency of copy number variants. The SNPs we identified constitute a first resource useful to describe variability at the population genomic level in E. asinus and to establish monitoring systems for the conservation of donkey genetic resources. PMID:26151450

  6. Next Generation Semiconductor Based Sequencing of the Donkey (Equus asinus Genome Provided Comparative Sequence Data against the Horse Genome and a Few Millions of Single Nucleotide Polymorphisms.

    Directory of Open Access Journals (Sweden)

    Francesca Bertolini

    Full Text Available Few studies investigated the donkey (Equus asinus at the whole genome level so far. Here, we sequenced the genome of two male donkeys using a next generation semiconductor based sequencing platform (the Ion Proton sequencer and compared obtained sequence information with the available donkey draft genome (and its Illumina reads from which it was originated and with the EquCab2.0 assembly of the horse genome. Moreover, the Ion Torrent Personal Genome Analyzer was used to sequence reduced representation libraries (RRL obtained from a DNA pool including donkeys of different breeds (Grigio Siciliano, Ragusano and Martina Franca. The number of next generation sequencing reads aligned with the EquCab2.0 horse genome was larger than those aligned with the draft donkey genome. This was due to the larger N50 for contigs and scaffolds of the horse genome. Nucleotide divergence between E. caballus and E. asinus was estimated to be ~ 0.52-0.57%. Regions with low nucleotide divergence were identified in several autosomal chromosomes and in the whole chromosome X. These regions might be evolutionally important in equids. Comparing Y-chromosome regions we identified variants that could be useful to track donkey paternal lineages. Moreover, about 4.8 million of single nucleotide polymorphisms (SNPs in the donkey genome were identified and annotated combining sequencing data from Ion Proton (whole genome sequencing and Ion Torrent (RRL runs with Illumina reads. A higher density of SNPs was present in regions homologous to horse chromosome 12, in which several studies reported a high frequency of copy number variants. The SNPs we identified constitute a first resource useful to describe variability at the population genomic level in E. asinus and to establish monitoring systems for the conservation of donkey genetic resources.

  7. Reproductive performance of Friesian mares after retained placenta and manual removal of the placenta

    NARCIS (Netherlands)

    Sevinga, M; Hesselink, JW; Barkema, H.W.

    2002-01-01

    Because the incidence of retained placenta in Friesian mares is estimated to be high, and no reports have been published on the reproductive performance of Friesian mares after retained placenta, we studied postpartum reproductive performance in Friesian brood mares with (n = 54) and without (n =

  8. Influence of stage of lactation and year season on composition of mares' colostrum and milk and method and time of storage on vitamin C content in mares' milk.

    Science.gov (United States)

    Markiewicz-Kęszycka, Maria; Czyżak-Runowska, Grażyna; Wójtowski, Jacek; Jóźwik, Artur; Pankiewicz, Radosław; Łęska, Bogusława; Krzyżewski, Józef; Strzałkowska, Nina; Marchewka, Joanna; Bagnicka, Emilia

    2015-08-30

    Mares' milk is becoming increasingly popular in Western Europe. This study was thus aimed at investigating the impact of stage of lactation and season on chemical composition, somatic cell count and some physicochemical parameters of mares' colostrum and milk, and at developing a method for the determination of vitamin C (ascorbic acid) in mares' milk and to determine its content in fresh and stored milk. The analysis conducted showed an effect of the stage of lactation on contents of selected chemical components and physicochemical parameters of mares' milk. In successive lactation periods levels of fat, cholesterol, energy value, citric acid and titratable acidity decreased, whereas levels of lactose and vitamin C, as well as the freezing point, increased. Analysis showed that milk produced in autumn (September, October, November) had a higher freezing point and lower concentrations of total solids, protein, fat, cholesterol, citric acid and energy value in comparison to milk produced in summer (June, July, August). Mares' milk was characterised by low somatic cell count throughout lactation. In terms of vitamin C stability the most advantageous method of milk storage was 6-month storage of lyophilised milk. In general, the results confirmed that mares' milk is a raw material with a unique chemical composition different from that produced by other farm animals. © 2014 Society of Chemical Industry.

  9. Seroprevalence of West Nile Virus in feral horses on Sheldon National Wildlife Refuge, Nevada, United States

    Science.gov (United States)

    Franson, J. Christian; Hofmeister, Erik K.; Collins, Gail H.; Dusek, Robert J.

    2011-01-01

    We screened 1,397 feral horses (Equus caballus) on Sheldon National Wildlife Refuge, Nevada, United States, for IgM and IgG against flavivirus during 2004–2006, 2008, and 2009. Positive serum samples were tested for neutralizing antibodies to West Nile virus (WNV) and St. Louis encephalitis virus (SLEV). One animal was positive for antibody against WNV in 2004, but all others tested in 2004–2006 were negative. In 2008 and 2009, we found evidence of increasing seropositive horses with age, whereas seroprevalence of WNV decreased from 19% in 2008 to 7.2% in 2009. No horses were positive for antibody against SLEV. Being unvaccinated, feral horses can be useful for WNV surveillance.

  10. Faune magdalénienne de la Grande Grotte de Labastide. (Hautes - Pyrénées, France.

    Directory of Open Access Journals (Sweden)

    André Clot

    1988-01-01

    Full Text Available La cueva de Labastide (Altos Pirineos, francia ha proporcionado una fauna del Magdaleniense medio (datada en 14.260 ± 440 BP, con especies de gran tamaño, el caballo (Equus caballus cf. gallicus, el bisonte y el uro, el reno. Algunos restos señalan la presencia de la cabra de los Pirineos y del sarrio, sin embargo el ciervo está ausente. Entre los carnívoros, se deben anotar numerosos huesos de zorro   común, y algunos de restos de zorro polar, de línce nórdico y de gato montés. Unos treinta restos pertenecen al glotón, pocas veces citado en los Pirineos.

  11. Villa Rocca al Mares = Villa in Rocca al Mare / Raul Vaiksoo ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Vaiksoo, Raul, 1955-

    2011-01-01

    Tallinnas Loigu t. 3 asuva villa arhitektuursest lahendusest. Majas on kasutatud palju klaasi, konstruktsioonid on avatud. Arhitekt Raul Vaiksoo, kaasautor Kristo Vaiksoo, sisearhitektid Raul Vaiksoo ja Krista Aren (Raul Vaiksoo Arhitektuuribüroo). Raul Vaiksoo pälvis Rocca al Mare villa eest EK arhitektuuri sihtkapitali 2010. a. arhitektuuripreemia

  12. Mare Orientale: Widely Accepted Large Impact or a Regular Tectonic Depression?

    Science.gov (United States)

    Kochemasov, G. G.

    2018-04-01

    Mare Orientale is one of the critical features on Moon surface explaining its tectonics. The impact origin of it is widely accepted, but an attentive examination shows that this large Mare is a part of endogenous tectonic structure, not a random impact.

  13. [A case of 63,X/64,XX mosaicism in a subfertile pony mare].

    Science.gov (United States)

    Pieńkowska-Schelling, A; Handler, J; Neuhauser, S; Schelling, C

    2016-04-01

    The present case report describes a 6-year old subfertile pony mare, which became pregnant after the eleventh artificial insemination. The examination of the ovaries and the uterus did not reveal any abnormal clinical findings and the mare showed a regular oestrous cycle. Based on cytogenetic and molecular genetic analyses it became possible to elucidate the observed subfertility. The mosaic karyotype of the mare consisted of 63,X (20%) and 64,XX (80%) cells. A PCR analysis failed to amplify sequences from the equine SRY gene. The observed classic 63,X/64,XX mosaicism is a plausible explanation for the subfertility of the mare.

  14. Miks tuli "Kevade" läinud aastal teisiti / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2008-01-01

    "Aasta rosina" auhinna võitnud Oskar Lutsu "Kevade" kommenteeritud kooliväljaandest "Kui Arno isaga koolimajja jõudis..." (Tallinn : Ilo, 2007), mille koostasid Aili Kalavus ja Mare Müürsepp ning illustreeris Mare Hunt

  15. Karyotypic relationships among Equus grevyi, Equus burchelli and domestic horse defined using horse chromosome arm-specific probes.

    Science.gov (United States)

    Musilova, P; Kubickova, S; Zrnova, E; Horin, P; Vahala, J; Rubes, J

    2007-01-01

    Using laser microdissection we prepared a set of horse chromosome arm-specific probes. Most of the probes were generated from horse chromosomes, some of them were derived from Equus zebra hartmannae. The set of probes were hybridized onto E. grevyi chromosomes in order to establish a genome-wide chromosomal correspondence between this zebra and horse. The use of arm-specific probes provided us with more information on the mutual arrangement of the genomes than we could obtain by means of whole-chromosome paints generated by flow sorting, even if we used reciprocal painting with probe sets from both species. By comparison of our results and results of comparative mapping in E. burchelli, we also established the chromosomal correspondence between E. grevyi and E. burchelli, providing evidence for a very close karyotypic relationship between these two zebra species. Establishment of the comparative map for E. grevyi contributes to the knowledge of the karyotypic phylogeny in the Equidae family.

  16. Presencia de Hippidion y Equus (Amerhippus (Mammalia, Perissodactyla y su distribución en el Pleistoceno superior de Chile

    Directory of Open Access Journals (Sweden)

    Frassinetti, D.

    2000-12-01

    Full Text Available Fossil remains belonging to Equidae fram Chilean localities are described and taxonomically determined. Equus (Amerhippus and Hippidion species are identified; its geographic distribution in Chile and relations with others South American Equidae are given; a Late Pleistocene age is regarded for them. Stratigraphic and paleoecological considerations are also included.Se describen y sitúan taxonómicamente los restos de équidos de las localidades chilenas. Se identifican distintas especies de Equus (Amerhippus e Hippidion, señalando su distribución geográfica y relaciones con otros équidos sudamericanos, además de referirlos al Pleistoceno superior. Se analiza su situación estratigráfica así como consideraciones de tipo paleoecológico.

  17. Status of groundwater levels and storage volume in the Equus Beds aquifer near Wichita, Kansas, January 2006 to January 2010

    Science.gov (United States)

    Hansen, Cristi V.; Aucott, Walter R.

    2010-01-01

    A part of the Equus Beds aquifer in southwestern Harvey County and northwestern Sedgwick County was developed to supply water to residents of Wichita and for irrigation in south-central Kansas. Groundwater pumping for city and agricultural use caused water levels to decline in a large part of the aquifer northwest of Wichita. In 1965, the city of Wichita began using water from Cheney Reservoir in addition to water from the Equus Beds aquifer to meet the city's increasing demand for water. Irrigation pumpage in the area increased substantially during the 1970s and 1980s and contributed to the water-level declines. Water-level declines reached their maximum to date in October 1992.

  18. Unraveling the sequence and structure of the protein osteocalcin from a 42 ka fossil horse

    Science.gov (United States)

    Ostrom, Peggy H.; Gandhi, Hasand; Strahler, John R.; Walker, Angela K.; Andrews, Philip C.; Leykam, Joseph; Stafford, Thomas W.; Kelly, Robert L.; Walker, Danny N.; Buckley, Mike; Humpula, James

    2006-04-01

    We report the first complete amino acid sequence and evidence of secondary structure for osteocalcin from a temperate fossil. The osteocalcin derives from a 42 ka equid bone excavated from Juniper Cave, Wyoming. Results were determined by matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-MS) and Edman sequencing with independent confirmation of the sequence in two laboratories. The ancient sequence was compared to that of three modern taxa: horse ( Equus caballus), zebra ( Equus grevyi), and donkey ( Equus asinus). Although there was no difference in sequence among modern taxa, MALDI-MS and Edman sequencing show that residues 48 and 49 of our modern horse are Thr, Ala rather than Pro, Val as previously reported (Carstanjen B., Wattiez, R., Armory, H., Lepage, O.M., Remy, B., 2002. Isolation and characterization of equine osteocalcin. Ann. Med. Vet.146(1), 31-38). MALDI-MS and Edman sequencing data indicate that the osteocalcin sequence of the 42 ka fossil is similar to that of modern horse. Previously inaccessible structural attributes for ancient osteocalcin were observed. Glu 39 rather than Gln 39 is consistent with deamidation, a process known to occur during fossilization and aging. Two post-translational modifications were documented: Hyp 9 and a disulfide bridge. The latter suggests at least partial retention of secondary structure. As has been done for ancient DNA research, we recommend standards for preparation and criteria for authenticating results of ancient protein sequencing.

  19. Environmental impact on faecal glucocorticoid metabolite concentrations in Grevy's Zebra (Equus grevyi)

    OpenAIRE

    Yarnell, K; Walker, SL

    2017-01-01

    The non-invasive nature of faecal glucocorticoid metabolite (FGM) assessment means that sample collection is on an opportunistic basis and samples cannot always be collected immediately upon defection during field studies. Faeces that have been exposed to heat and moisturemay not accurately reflect levels of FGM. Our study exposed male (n=3) and female (n=3) Grevy's zebra (Equus grevyi) faeces to six environmental conditions to simulate a range of weather and seasonal patterns (temperate clim...

  20. The effect of dietary protein on reproduction in the mare. IV. Serum progestagen, FSH, LH and melatonin concentrations during the anovulatory, transitional and ovulatory periods in the non-pregnant mare

    Directory of Open Access Journals (Sweden)

    F.E. Van Niekerk

    1997-07-01

    Full Text Available The effect of total protein intake and protein quality on the serum concentrations of certain reproductive hormones during the anovulatory, transitional and ovulatory periods were studied in 36 Anglo-Arab mares. High-quality protein stimulated FSH and LH production during the late transitional period. Serum progestagen and melatonin concentrations were unaffected by the quality of protein nutrition during the anovulatory period. Mares receiving high-quality protein exhibited a 10-14-day cyclical pattern of FSH release approximately 4-6 weeks earlier than the mares fed the lower-quality protein diet, and also ovulated 3-4 weeks earlier than the mares on the lower-quality protein diet. Progesterone concentrations during the 1st oestrous cycle after the anovulatory period were unaffected by protein quality in the diet.

  1. Behavioral and Transcriptomic Fingerprints of an Enriched Environment in Horses (Equus caballus.

    Directory of Open Access Journals (Sweden)

    Léa Lansade

    Full Text Available The use of environmental enrichment (EE has grown in popularity over decades, particularly because EE is known to promote cognitive functions and well-being. Nonetheless, little is known about how EE may affect personality and gene expression. To address this question in a domestic animal, 10-month-old horses were maintained in a controlled environment or EE for 12 weeks. The control horses (n = 9 lived in individual stalls on wood shaving bedding. They were turned out to individual paddocks three times a week and were fed three times a day with pellets or hay. EE-treated horses (n = 10 were housed in large individual stalls on straw bedding 7 hours per day and spent the remainder of the time together at pasture. They were fed three times a day with flavored pellets, hay, or fruits and were exposed daily to various objects, odors, and music. The EE modified three dimensions of personality: fearfulness, reactivity to humans, and sensory sensitivity. Some of these changes persisted >3 months after treatment. These changes are suggestive of a more positive perception of the environment and a higher level of curiosity in EE-treated horses, explaining partly why these horses showed better learning performance in a Go/No-Go task. Reduced expression of stress indicators indicated that the EE also improved well-being. Finally, whole-blood transcriptomic analysis showed that in addition to an effect on the cortisol level, the EE induced the expression of genes involved in cell growth and proliferation, while the control treatment activated genes related to apoptosis. Changes in both behavior and gene expression may constitute a psychobiological signature of the effects of enrichment and result in improved well-being. This study illustrates how the environment interacts with genetic information in shaping the individual at both the behavioral and molecular levels.

  2. Behavioral and Transcriptomic Fingerprints of an Enriched Environment in Horses (Equus caballus).

    Science.gov (United States)

    Lansade, Léa; Valenchon, Mathilde; Foury, Aline; Neveux, Claire; Cole, Steve W; Layé, Sophie; Cardinaud, Bruno; Lévy, Frédéric; Moisan, Marie-Pierre

    2014-01-01

    The use of environmental enrichment (EE) has grown in popularity over decades, particularly because EE is known to promote cognitive functions and well-being. Nonetheless, little is known about how EE may affect personality and gene expression. To address this question in a domestic animal, 10-month-old horses were maintained in a controlled environment or EE for 12 weeks. The control horses (n = 9) lived in individual stalls on wood shaving bedding. They were turned out to individual paddocks three times a week and were fed three times a day with pellets or hay. EE-treated horses (n = 10) were housed in large individual stalls on straw bedding 7 hours per day and spent the remainder of the time together at pasture. They were fed three times a day with flavored pellets, hay, or fruits and were exposed daily to various objects, odors, and music. The EE modified three dimensions of personality: fearfulness, reactivity to humans, and sensory sensitivity. Some of these changes persisted >3 months after treatment. These changes are suggestive of a more positive perception of the environment and a higher level of curiosity in EE-treated horses, explaining partly why these horses showed better learning performance in a Go/No-Go task. Reduced expression of stress indicators indicated that the EE also improved well-being. Finally, whole-blood transcriptomic analysis showed that in addition to an effect on the cortisol level, the EE induced the expression of genes involved in cell growth and proliferation, while the control treatment activated genes related to apoptosis. Changes in both behavior and gene expression may constitute a psychobiological signature of the effects of enrichment and result in improved well-being. This study illustrates how the environment interacts with genetic information in shaping the individual at both the behavioral and molecular levels.

  3. The effect of dietary protein on reproduction in the mare. VI. Serum progestagen concentrations during pregnancy

    Directory of Open Access Journals (Sweden)

    F.E. Van Niekerk

    1998-07-01

    Full Text Available Sixty-four Thoroughbred and Anglo-Arab mares aged 6-12 years were used, of which 40 were non-lactating and 24 lactating. Foals from these 24 mares were weaned at the age of 6 months. Non-lactating and lactating mares were divided into 4 dietary groups each. The total daily protein intake and the protein quality (essential amino-acid content differed in the 4 groups of non-lactating and 4 groups of lactating mares. The mares were covered and the effect of the quantity and quality of dietary protein on serum progestagen concentrations during pregnancy was studied. A sharp decline in serum progestagen concentrations was recorded in all dietary groups from Days 18 to 40 of pregnancy, with some individual mares reaching values of less than 4 ng/mℓ. Serum progestagen concentrations recorded in some of the non-lactating mares on the low-quality protein diet increased to higher values (p<0.05 than those of mares in the other 3 dietary groups at 35-140 days of pregnancy. A similar trend was observed for the lactating mares on a low-quality protein diet at 30-84 days of pregnancy. No such trends were observed in any of the other dietary groups. High-quality protein supplementation increased serum progestagen concentrations during the 1st 30 days of pregnancy. Lactation depressed serum progestagen concentrations until after the foals were weaned.

  4. Influence of composition of feed and lactation period on mineral composition of Mare's

    Directory of Open Access Journals (Sweden)

    Miroslav Fišera

    2018-03-01

    Full Text Available Normal 0 21 false false false CS X-NONE X-NONE Effects of lactation period and feed on essential minerals composition of mare's milk were studied. Average Ca, P, Na and Mg concentrations in feed DM were 0.66, 4.30, 0.13 and 2.21 g.kg-1 of DM (dry matter, respectively. In regard to milk all elements concentrations were not similar to each other due to the changes of the lactation day differences. Average Ca, P, Na and Mg concentrations (in DM caused by breed differences and lactation days were 1.95, 1.08, 0.53 and 0.22 g.kg-1, respectively. During the milk period, a high-quality feed were maintaining the major mineral composition of mare's milk in 1.5 - 2 times higher amount than milk of mare fed with pasture and a low-quality feed. The colostrum stage of mare was much shorter than other animals, the mare's milk on the 2nd day of lactation showed properties of initial milk in which its composition, particularly in minerals, were two times higher when compare to that on milk periods that was started from 5th day after parturition. It seemed that some factors, except well physiological conditions, such as mare's age, number of foaling, sex of foal etc. did not affect milk nutrient composition.

  5. Soome Citycon ostis Eesti omanikelt Rocca al Mare kaubanduskeskuse / Kadri Masing

    Index Scriptorium Estoniae

    Masing, Kadri

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 27. juuli lk. 4. Rocca al Mare kaubanduskeskuse soomlastest uued omanikud hakkavad laiendama sealset kaubanduspinda, mille arendamiseks on ette nähtud 3 aastat ning sellest peaks saama Eesti üks suurimaid müügikeskusi. Vt. samas: Konkurendid rõõmustavad. Lisa: Uus omanik tahab muuta Rocca al Mare suurimaks

  6. The Thickness and Volume of Young Basalts Within Mare Imbrium

    Science.gov (United States)

    Chen, Yuan; Li, Chunlai; Ren, Xin; Liu, Jianjun; Wu, Yunzhao; Lu, Yu; Cai, Wei; Zhang, Xunyu

    2018-02-01

    Basaltic volcanism is one of the most important geologic processes of the Moon. Research on the thickness and volume of late-stage basalts of Mare Imbrium helps better understand the source of lunar volcanism and eruption styles. Based on whether apparent flow fronts exist or not, the late-stage basalts within Mare Imbrium were divided into two groups, namely, Upper Eratosthenian basalts (UEm) and Lower Eratosthenian basalts (LEm). Employing the topographic profile analysis method for UEm and the crater excavation technique for LEm, we studied the thickness and distribution of Eratosthenian basalts in Mare Imbrium. For the UEm units, their thicknesses were estimated to be 16-34 (±2) m with several layers of individual lava ( 8-13 m) inside. The estimated thickness of LEm units was 14-45(±1) m, with a trend of reducing thickness from north to south. The measured thickness of late-stage basalts around the Chang'E-3 landing site ( 37 ± 1 m) was quite close to the results acquired by the lunar penetrating radar carried on board the Yutu Rover ( 35 m). The total volume of the late-stage basalts in Mare Imbrium was calculated to be 8,671 (±320) km3, which is 4 times lower than that of Schaber's estimation ( 4 × 104 km3). Our results indicate that the actual volume is much lower than previous estimates of the final stage of the late basaltic eruption of Mare Imbrium. Together, the area flux and transport distance of the lava flows gradually decreased with time. These results suggest that late-stage volcanic evolution of the Moon might be revised.

  7. 33 CFR 334.1160 - San Pablo Bay, Calif.; target practice area, Mare Island Naval Shipyard, Vallejo.

    Science.gov (United States)

    2010-07-01

    ... practice area, Mare Island Naval Shipyard, Vallejo. 334.1160 Section 334.1160 Navigation and Navigable... REGULATIONS § 334.1160 San Pablo Bay, Calif.; target practice area, Mare Island Naval Shipyard, Vallejo. (a..., Mare Island Naval Shipyard, Vallejo, California, will conduct target practice in the area at intervals...

  8. Tracey Emin - 20 aastat vabadust / Mare Tralla

    Index Scriptorium Estoniae

    Tralla, Mare, 1967-

    2008-01-01

    Edinburghi kunstifestivali "Fringe" raames Šoti moodsa kunsti rahvusgaleriis kuni 9. XI avatud Tracey Emini retrospektiivist "Tracey Emini 20 aastat". Kunstnikust ja tema loomingust. Festivali programmi oli valitud ka Mare Tralla projekt "Kaitstud"

  9. Estrus, ovulation, and serum progesterone, estradiol, and LH concentrations in mares after an increased photoperiod during winter.

    Science.gov (United States)

    Oxender, W D; Noden, P A; Hafs, H D

    1977-02-01

    On December 11, 1974, 15 seasonally anestrous mares were assigned at random to 1 of 3 experimental groups: outdoor-control, indoor-control, or indoor light-treated (a 16-hour photo-period). This experiment was terminated on April 21, 1975. The five mares in the indoor light-treated group ovulated 59.0+/-6.9 days later, which was 74 days earlier (P less than 0.01) than 2 of the 5 outdoor-controls (the other 3 ovulated after April 21 during a subsequent experiment) and 50 days earlier (P less than 0.05) than the indoor-controls. Durations of the 1st estrus for the 3 groups of mares were 13.3+/-3.6, 8.4+/-2.0, and 6.0+/-1.0 days for the indoor light-treated, indoor-control, and outdoor-control groups, respectively. The indoor light-treated mares averaged 4.2 estrous cycles before April 21, the indoor-control mares averaged 1.4 estrous cycles, and 2 of 5 outdoor-control mares ovulated 1 time during the experiment. The peripheral blood luteinizing hormone (LH), estradiol, and progesterone concentrations were minimal during winter anestrous. The hormone changes normally associated with estrous cycle activity in mares--maximal estradiol and luteinizing hormone concentrations near ovulation and maximal progesterone concentration during diestrus--were observed in all mares beginning at the 1st estrus. Hair loss was observed earlier in the light-treated mares, than in either of the other groups. In conclusion, a 16-hour photo-period initiated in early December for anestrous brood mares caused endocrinologically normal estrous cycles to begin within 2 months. This may allow breeding and foaling considerably earlier than normally expected.

  10. Stratigraphy and structural evolution of southern Mare Serenitatis - A reinterpretation based on Apollo Lunar Sounder Experiment data

    Science.gov (United States)

    Sharpton, V. L.; Head, J. W., III

    1983-01-01

    Two subsurface reflecting horizons have been detected by the Apollo Lunar Sounder Experiment (ALSE) in the southern Mare Serenitatis which appear to be regolith layers more than 2 m thick, and are correlated with major stratigraphic boundaries in the southeastern Mare Serenitatis. The present stratigraphic boundaries in the southeastern Mare Serenitatis. The present analysis implies that the lower horizon represents the interface between the earliest mare unit and the modified Serenitatis basin material below. The depth of volcanic fill within Serenitatis is highly variable, with an average thickness of mare basalts under the ALSE ground track of 1.6 km. Comparisons with the Orientale basin topography suggests that a major increaae in load thickness could occur a few km basinward of the innermost extent of the traverse. The history of volcanic infilling of Mare Serenitatis was characterized by three major episodes of volcanism.

  11. Tundetargad meeskonnad on head suhtekorraldajad / Mare Pork

    Index Scriptorium Estoniae

    Pork, Mare

    2003-01-01

    Psühholoogiaprofessor Mare Pork defineerib meeskonna emotsionaalse intelligentsuse mõiste ja kirjeldab kõrge EQ-ga meeskonna tunnuseid. Lisad: Mis arendab meeskonna EQ-d?; Meeskonna emotsionaalne intelligentsus EQ nelja komponendi järgi

  12. Presumptive red maple (Acer rubrum) toxicosis in Grevy's zebra (Equus grevyi).

    Science.gov (United States)

    Weber, M; Miller, R E

    1997-03-01

    Two female Grevy's zebras (Equus grevyi), one juvenile and one adult, were treated for hemolytic anemia. The juvenile survived, but the adult animal, which also had methemoglobinemia, was euthanized after it failed to recover from anesthesia. Significant pathologic findings in the adult zebra included generalized icterus, hemoglobinuric nephrosis, and paracentral hepatic necrosis. Serum titers for known infectious causes of anemia were negative. Examination of the zebra holding areas revealed two hybrid red maple (Acer sp.) trees. There was no known exposure to other hemolytic agents. This is the first report of probable red maple-induced hemolysis in zebra.

  13. Neutrophil extracellular traps formation by bacteria causing endometritis in the mare.

    Science.gov (United States)

    Rebordão, M R; Carneiro, C; Alexandre-Pires, G; Brito, P; Pereira, C; Nunes, T; Galvão, A; Leitão, A; Vilela, C; Ferreira-Dias, G

    2014-12-01

    Besides the classical functions, neutrophils (PMNs) are able to release DNA in response to infectious stimuli, forming neutrophil extracellular traps (NETs) and killing pathogens. The pathogenesis of endometritis in the mare is not completely understood. The aim was to evaluate the in vitro capacity of equine PMNs to secrete NETs by chemical activation, or stimulated with Streptococcus equi subspecies zooepidemicus (Szoo), Escherichia coli (Ecoli) or Staphylococcus capitis (Scap) strains obtained from mares with endometritis. Ex vivo endometrial mucus from mares with bacterial endometritis were evaluated for the presence of NETs. Equine blood PMNs were used either without or with stimulation by phorbol-myristate-acetate (PMA), a strong inducer of NETs, for 1-3h. To evaluate PMN ability to produce NETs when phagocytosis was impaired, the phagocytosis inhibitor cytochalasin (Cyt) was added after PMA. After the addition of bacteria, a subsequent 1-h incubation was carried out in seven groups. NETs were visualized by 4',6-diamidino-2-phenylindole (DAPI) and anti-histone. Ex vivo samples were immunostained for myeloperoxidase and neutrophil elastase. A 3-h incubation period of PMN + PMA increased NETs (p Ecoli or Scap (p < 0.05). Ex vivo NETs were present in mares with endometritis. Scanning electron microscopy showed the spread of NETs formed by smooth fibers and globules that can be aggregated in thick bundles. Formation of NETs and the subsequent entanglement of bacteria suggest that equine NETs might be a complementary mechanism in fighting some of the bacteria causing endometritis in the mare. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  14. Hemoperitoneum secondary to cecocolic dilation in a pregnant mare

    Directory of Open Access Journals (Sweden)

    Alejandro R. Palomar

    2017-06-01

    Full Text Available Hemoperitoneum is known as the abnormal accumulation of blood within the abdominal cavity, most commonly caused by gastrointestinal bleeding, abdominal abscesses, liver tumors, migration of parasitic larvae (Strongylus vulgaris, direct trauma and blood clotting disorders. Lethargy, anorexia, weakness, muscle twitching, sweating, hyperthermia, tachycardia, tachypnea, and the accumulation of free fluid in the abdomen were the most commonly recorded signs. In this report, a pregnant mare was diagnosed with hemoperitoneum secondary to cecocolic dilatation, due to corn ingestion. The protocol for clinical treatment and tests varies in similar reported cases. Due to this, the present report discusses the outcome of a clinical case and suggests a medical protocol -based on evidence – for treatment in a pregnant mare. The treatment was aimed to stop the bleeding, while normalize or maintain a stable blood pressure and provide supportive therapy. The mare presented colic pains due to fermentation of the corn, which were solved in few hours. The final abdominal ultrasonogram showed intra-abdominal hypoechoic fluid and living fetus.

  15. Equine alpha-fetoprotein levels in Lipizzaner mares with normal pregnancies and with pregnancy loss.

    Science.gov (United States)

    Vincze, Boglárka; Gáspárdy, András; Kulcsár, Margit; Baska, Ferenc; Bálint, Ádám; Hegedűs, György Tamás; Szenci, Ottó

    2015-12-01

    Alpha-fetoprotein has proved to be a good indicator of fetal well-being in human medicine for decades. Although this molecule is present in most of the mammalian species including horses, reference values in healthy and high-risk pregnant mares have not yet been published. The aim of the present study was to determine whether equine alpha-fetoprotein (eqAFP) is a good indicator of complicated pregnancies in Lipizzaner mares. A total of 111 serum samples from 30 mares have been analyzed for eqAFP levels throughout gestation (Days 60-325). After the pregnancy was confirmed, 23 mares had normal pregnancies with viable foals, six had late embryonic loss, and one of the mares aborted in the ninth gestational month. Equine alpha-fetoprotein concentrations significantly differed in the normal group (72.93 ± 49.25 pg/mL; mean ± standard deviation) and in the complicated pregnancy loss group (152 ± 36.48 pg/mL; mean ± standard deviation). The mares' age, gestational age, and the conception rate significantly affected the alpha-fetoprotein concentrations in the normal group. Furthermore, notable individual differences occurred in eqAFP concentrations between mares. Equine alpha-fetoprotein seems to be an important indicator of fetal well-being in horses, but there are still some unanswered questions (levels in foals of different age, ponies, and draft horses) regarding this serum protein. Large-scale studies are needed to assess the specificity, sensitivity, and reliability of this test as a possible future diagnostic tool for fetal well-being in horses. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Retained placenta in Friesian mares : reproductive performance after foal heat breeding versus breeding in a subsequent heat

    NARCIS (Netherlands)

    Sevinga, M; Hesselink, JW; Barkema, H.W.

    2001-01-01

    Postpartum reproductive performance was studied in 54 Friesian brood mares with and 50 without retained placenta. Retained placenta was defined as failure to expel all fetal membranes within 3 hours after the delivery of the foal. The group of mares with retained placenta was subdivided into mares

  17. Histological features of the placenta and their relation to the gross and data from Thoroughbred mares

    Directory of Open Access Journals (Sweden)

    Fernanda M. Pazinato

    Full Text Available Abstract: The placenta is a transitory organ that originates from maternal and fetal tissues, the function of which is transporting nutrients from the mother to the fetus. The aim of this study was describe the histological features of placentas in healthy Thoroughbred mares at foaling and evaluate their relation with the gross placental and data of these mares. For this study 188 Thoroughbred mares were used. It was performed clinical observation for signs of placentitis during daily health checks and ultrasonic examination monthly to assess the fetus and placenta. All of the mares that exhibited clinical signs of placentitis were treated during gestation. The parturition was assisted, the placentas were grossly evaluated and samples were collected immediately after expulsion. The following data were considered for each mare: age, gestational age, number of parturition, time for placental expulsion, umbilical-cord length, placental weight and clinical signs of placentitis. Histological evaluation of the placentas revealed extensive cytoplasmic vacuolization of the epithelial areolar cells, presence of inflammatory infiltrates and hypoplasia-atrophy of the microcotyledons. Most of the gross placental findings were consistent with the histological results. In conclusion the mares with a vacuolated placental chorionic epithelium were older and had experienced a larger number of births. Great part of the mares with inflammatory infiltrates did not showed any clinical signs of placentitis during gestation.

  18. EFFECT OF TWO PROTOCOLS OF CRYOPRESERVATION ON FERTILIZING CAPACITY OF STALLION (Equus caballus SEMEN EFECTO DE DOS PROTOCOLOS DE CRIOPRESERVACIÓN SOBRE LA CAPACIDAD FECUNDANTE DE SEMEN EQUINO (Equus caballus

    Directory of Open Access Journals (Sweden)

    Giovanni Restrepo Betancur

    2012-06-01

    Full Text Available Abstract. Semen cryopreservation is a fundamental process for the development of biotechnologies for assisted reproduction in horses. The use of cryopreservation techniques with changes in concentrations and the nature of the cryoprotectant, as well as, the different types of vials for storage of semen, have become an alternative to improve the protocols used. The objective of this work was to evaluate the effect of two protocols of cryopreservation (freezing and vitrification on the fertilizing capacity of stallion semen. The study was conducted with horses of the Criollo Colombiano breed. For freezing was used a extender supplemented with egg yolk (4% and dimethyl formamide (5%, and 0.5 mL straws as vials, whereas for vitrification, the extender was supplemented with egg yolk (8% and dimethyl formamide (8%, and cryovials were used as carriers. As post thaw parameters were evaluated: progressive motility, vitality, normal morphology and integrity of the plasma membrane through the hypoosmotic swelling test (HOS. For statistical evaluation was fitted a generalized linear model (GLM and means were compared by the Tukey test. Were found average percentages of progressive motility, vitality, normal morphology and HOS of 41.6 ± 11.8 and 37 ± 8.5, 54.3 ± 10.2 and 52.3 ± 7.8, 83.1 ± 5.4 and 83.6 ± 5.8, 41.7 ± 9.8 and 38.9 ± 3.6, for cryopreserved semen by freezing and vitrification, respectively. There were no statistically significant differences (P ≤ 0.05 between treatments for any of the parameters evaluated. The fertilizing capacity of equine semen cryopreserved by vitrification is comparable to that obtained by conventional freezing.Resumen. La criopreservación de semen es un proceso fundamental en el desarrollo de biotecnologías para la reproducción asistida en equinos. El uso de diferentes técnicas de criopreservación con cambios en las concentraciones y la naturaleza de los crioprotectores, así como en los diferentes tipos de soportes para el almacenamiento del semen, se ha constituido en una alternativa para mejorar los protocolos empleados. El objetivo de este trabajo fue evaluar el efecto de dos protocolos de criopreservación (congelación y vitrificación, sobre la capacidad fecundante del semen equino. El estudio se realizó con equinos de la raza Criollo Colombiano. Para la congelación se empleó un diluyente suplementado con de yema de huevo (4% y dimetilformamida (5%, y pajillas de 0,5 mL como soportes; mientras que para la vitrificación, el diluyente fue suplementado con yema de huevo (8% y dimetilformamida (8% y se usaron crioviales como soportes. Post-descongelación, se evaluaron los parámetros: movilidad progresiva, vitalidad, morfología normal e integridad de la membrana plasmática (HOS. Para la evaluación estadística se ajustó un modelo lineal generalizado (GLM y las medias se compararon por la prueba de Tukey. Se encontraron porcentajes promedio de movilidad progresiva, vitalidad, morfología normal y HOS de 41,6±11,8 y 37,0±8,5, 54,3±10,2 y 52,3±7,8, 83,1±5,4 y 83,6±5,8, 41,7±9,8 y 38,9±3,6, para el semen criopreservado por congelación y vitrificación, respectivamente. No se encontraron diferencias estadísticamente significativas (P ≤ 0,05 entre los tratamientos para ninguno de los parámetros evaluados. La capacidad fecundante del semen equino criopreservado por vitrificación es equiparable a la obtenida por congelación convencional.

  19. Heavy metals pollution influences the soil of Baia Mare city Roumania

    International Nuclear Information System (INIS)

    Dumitrescu, L.; Petrescu, L.; Stanescu, L.F.; Bilal, E.

    2010-01-01

    For a connection between the environment close by industrial area and residential area; where the consequences heavy metal pollution are more acute, we had drawn samples inside Romplumb S.A. factory in Baia Mare city (Romania), the main heavy metal pollution agent, close by this factory, cross roads, areas close by parks and areas far off the main pollution agent. These samples had drawn both on the surface soil and 15 cm depth. In this subchapter we will present the analyses types and the results of these analyses taking into account the chemistry composition of drawing samples. A half of each sample was crushed very fine for ICP, XRF. From uncrushed half a part was crushed at 2 accordance with ICP results and these distributions on maps, we can see that the biggest heavy metals amount is in N-E of Baia Mare (zone I) due to the main pollution factor, Romplumb S.A... The pollution for zone II is not as big as zone I. Heavy metals in this zone are due to emission released by Romplumb S.A. and Phonix S.A. which are carry by air and due to the cross roads. The high amount of heavy metal from Baia Mare soils affects more and more people health. Health Direction Baia Mare made a lot of investigation on Baia Mare Soil. The results of these investigations are: - The hope life is smaller with 2,2 years than usual - Mortality is bigger with 10-15% than usual - Avitaminoza D*2 is 65-95% - Metabolism diseases due to Pb are frequent with 40-60%

  20. Water quality of the Little Arkansas River and Equus Beds Aquifer before and concurrent with large-scale artificial recharge, south-central Kansas, 1995-2012

    Science.gov (United States)

    Tappa, Daniel J.; Lanning-Rush, Jennifer L.; Klager, Brian J.; Hansen, Cristi V.; Ziegler, Andrew C.

    2015-01-01

    The city of Wichita artificially recharged about 1 billion gallons of water into the Equus Beds aquifer during 2007–2012 as part of Phase I recharge of the Artificial Storage and Recovery project. This report, prepared in cooperation by the U.S. Geological Survey and the city of Wichita, Kansas, summarizes Little Arkansas River (source-water for artificial recharge) andEquus Beds aquifer water quality before (1995–2006) and during (2007–2012) Artificial Storage and Recovery Phase I recharge. Additionally, aquifer water-quality distribution maps are presented and water-quality changes associated with Phase I recharge timing are described.

  1. In vitro screening of mare's milk antimicrobial effect and antiproliverative activity.

    Science.gov (United States)

    Guri, Anilda; Paligot, Michele; Crèvecoeur, Sebastien; Piedboeuf, Benoit; Claes, Jonathan; Daube, Georges; Corredig, Milena; Griffiths, M W; Delcenserie, Veronique

    2016-01-01

    The aims of this study were to examine the effect of mare's milk on virulence gene expression of Salmonella Typhimurium and observe its potential activity on proliferation of adenocarcinoma Caco-2 cells. Different supernatants of mare's milk, raw or heat-treated at 65°C for 15 s or 30 min, were studied. The changes in hilA gene expression of Salmonella Typhimurium in presence of mare's milk supernatants were assessed using a reporter luminescent strain. A significant decrease in hilA gene expression was observed with all tested supernatants. Virulence gene expression was then assessed using qPCR on a wild-type strain of Salmonella Typhimurium. A significant decrease of hilA and ssrB2 gene expression was observed with raw milk supernatants but not with heat-treated supernatants. The same supernatants were administered to Caco-2 cells to measure their proliferation rate. A significant reduction of proliferative effect was observed only with raw milk supernatants. This study reports that raw mare's milk was able to modulate virulence gene expression of Salmonella Typhimurium and exerts antiproliferative effects on Caco-2 cells. These results may offer new approaches for promoting gastrointestinal health. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. Relationship between the latest activity of mare volcanism and topographic features of the Moon

    Science.gov (United States)

    Kato, Shinsuke; Morota, Tomokatsu; Yamaguchi, Yasushi; Watanabe, Sei-ichiro; Otake, Hisashi; Ohtake, Makiko

    2016-04-01

    Lunar mare basalts provide insights into compositions and thermal history of lunar mantle. According to crater counting analysis with remote sensing data, the model ages of mare basalt units indicate a second peak of magma activity at the end of mare volcanism (~2 Ga), and the latest eruptions were limited in the Procellarum KREEP Terrane (PKT), which has high abundances of heat-producing elements. In order to understand the mechanism for causing the second peak and its magma source, we examined the correlation between the titanium contents and eruption ages of mare basalt units using compositional and chronological data updated by SELENE/Kaguya. Although no systematic relationship is observed globally, a rapid increase in mean titanium (Ti) content occurred at 2.3 Ga in the PKT, suggesting that the magma source of mare basalts changed at that time. The high-Ti basaltic eruption, which occurred at the late stage of mare volcanism, can be correlated with the second peak of volcanic activity at ~2 Ga. The latest volcanic activity can be explained by a high-Ti hot plume originated from the core-mantle boundary. If the hot plume was occurred, the topographic features formed by the hot plume may be remained. We calculated the difference between topography and selenoid and found the circular feature like a plateau in the center of the PKT, which scale is ~1000 km horizontal and ~500 m vertical. We investigated the timing of ridge formation in the PKT by using stratigraphic relationship between mare basalts and ridges. The ridges were formed before and after the high-Ti basaltic eruptions and seem to be along with the plateau. These results suggest that the plateau formation is connected with the high-Ti basaltic eruptions.

  3. Tall-building development process in downtown Maringá-PR, Brazil

    Directory of Open Access Journals (Sweden)

    José Roberto Machado

    2012-02-01

    Full Text Available This work describes the urbanization process taking place in the city of Maringá, in the context of the tallbuilding development at its main economic axis, the city center. This research aims to conduct an in-depth analysis of the role played by the housing industry in the development of tall buildings at downtown Maringá, the origin of the capital associated to such process, and the rationale for building them in Zone 1 (downtown. This is also analyzed considering local environmental information and infrastructural considerations involved in this process.

  4. Juhid otsustavad saatuste üle / Mare Pork

    Index Scriptorium Estoniae

    Pork, Mare

    2001-01-01

    Ilmunud ka: Spekter, nr. 1, 2002, lk. 25-26. Psühholoogiaprofessor ja juhtimiskonsultant Mare Pork sellest, et tunded mõjutavad juhte rohkem, kui nad seda tajuvad ning, et juhid mõjutavad omakorda inimsaatusi. Erinevatest meetoditest juhtide hindamiseks, 360o tagasiside meetod

  5. Where was the 1898 Mare Island Earthquake? Insights from the 2014 South Napa Earthquake

    Science.gov (United States)

    Hough, S. E.

    2014-12-01

    The 2014 South Napa earthquake provides an opportunity to reconsider the Mare Island earthquake of 31 March 1898, which caused severe damage to buildings at a Navy yard on the island. Revising archival accounts of the 1898 earthquake, I estimate a lower intensity magnitude, 5.8, than the value in the current Uniform California Earthquake Rupture Forecast (UCERF) catalog (6.4). However, I note that intensity magnitude can differ from Mw by upwards of half a unit depending on stress drop, which for a historical earthquake is unknowable. In the aftermath of the 2014 earthquake, there has been speculation that apparently severe effects on Mare Island in 1898 were due to the vulnerability of local structures. No surface rupture has ever been identified from the 1898 event, which is commonly associated with the Hayward-Rodgers Creek fault system, some 10 km west of Mare Island (e.g., Parsons et al., 2003). Reconsideration of detailed archival accounts of the 1898 earthquake, together with a comparison of the intensity distributions for the two earthquakes, points to genuinely severe, likely near-field ground motions on Mare Island. The 2014 earthquake did cause significant damage to older brick buildings on Mare Island, but the level of damage does not match the severity of documented damage in 1898. The high intensity files for the two earthquakes are more over spatially shifted, with the centroid of the 2014 distribution near the town of Napa and that of the 1898 distribution near Mare Island, east of the Hayward-Rodgers Creek system. I conclude that the 1898 Mare Island earthquake was centered on or near Mare Island, possibly involving rupture of one or both strands of the Franklin fault, a low-slip-rate fault sub-parallel to the Rodgers Creek fault to the west and the West Napa fault to the east. I estimate Mw5.8 assuming an average stress drop; data are also consistent with Mw6.4 if stress drop was a factor of ≈3 lower than average for California earthquakes. I

  6. Prevalence of Theileria equi and Babesia caballi as well as the identification of associated ticks in sympatric Grevy's zebras (Equus grevyi) and donkeys (Equus africanus asinus) in northern Kenya.

    Science.gov (United States)

    Hawkins, Elaine; Kock, Richard; McKeever, Declan; Gakuya, Francis; Musyoki, Charles; Chege, Stephen M; Mutinda, Mathew; Kariuki, Edward; Davidson, Zeke; Low, Belinda; Skilton, Robert A; Njahira, Moses N; Wamalwa, Mark; Maina, Elsie

    2015-01-01

    The role of equine piroplasmosis as a factor in the population decline of the Grevy's zebra is not known. We determined the prevalence of Babesia caballi and Theileria equi in cograzing Grevy's zebras (Equus grevyi) and donkeys (Equus africanus asinus) in northern Kenya and identified the associated tick vectors. Blood samples were taken from 71 donkeys and 16 Grevy's zebras from March to May 2011. A nested PCR reaction using 18s ribosomal (r)RNA primers on 87 blood spots showed 72% (51/71; 95% confidence interval [CI] 60.4-81.0%) of donkeys and 100% (16/16; 95% CI, 77.3-100%) of Grevy's zebras were T. equi positive. No samples were positive for B. caballi. Sequence comparison using the National Center for Biotechnology Information's basic local alignment search tool identified homologous 18s rRNA sequences with a global geographic spread. The T. equi-derived sequences were evaluated using Bayesian approaches with independent Metropolis-coupled Markov chain Monte Carlo runs. The sequences clustered with those found in Sudan, Croatia, Mongolia, and the US, with statistical support greater than 80% for the two main clades. Hyalomma tick species were found on both donkeys and Grevy's zebras, whereas Rhipicephalus pulchellus was found exclusively on Grevy's zebras and Hyalomma marginatum rupfipes on donkeys. The prevalence of T. equi was 100% in Grevy's zebras and 72% in donkeys with common tick vectors identified. Our results suggest that donkeys and Grevy's zebras can be asymptomatic carriers and that piroplasmosis is endemic in the study area.

  7. Lunar mare TiO2 abundances estimated from UV/Vis reflectance

    Science.gov (United States)

    Sato, Hiroyuki; Robinson, Mark S.; Lawrence, Samuel J.; Denevi, Brett W.; Hapke, Bruce; Jolliff, Bradley L.; Hiesinger, Harald

    2017-11-01

    The visible (400-700 nm) and near-infrared (700-2800 nm) reflectance of the lunar regolith is dominantly controlled by variations in the abundance of plagioclase, iron-bearing silicate minerals, opaque minerals (e.g., ilmenite), and maturation products (e.g., agglutinate glass, radiation-produced rims on soil grains, and Fe-metal). The same materials control reflectance into the near-UV (250-400 nm) with varying degrees of importance. A key difference is that while ilmenite is spectrally neutral in the visible to near-infrared, it exhibits a diagnostic upturn in reflectance in the near-UV, at wavelengths shorter than about 450 nm. The Lunar Reconnaissance Orbiter Wide Angle Camera (WAC) filters were specifically designed to take advantage of this spectral feature to enable more accurate mapping of ilmenite within mare soils than previously possible. Using the reflectance measured at 321 and 415 nm during 62 months of repeated near-global WAC observations, first we found a linear correlation between the TiO2 contents of the lunar soil samples and the 321/415 nm ratio of each sample return site. We then used the coefficients from the linear regression and the near-global WAC multispectral mosaic to derive a new TiO2 map. The average TiO2 content is 3.9 wt% for the 17 major maria. The highest TiO2 values were found in Mare Tranquillitatis (∼12.6 wt%) and Oceanus Procellarum (∼11.6 wt%). Regions contaminated by highland ejecta, lunar swirls, and the low-TiO2 maria (e.g., Mare Frigoris, the northeastern units of Mare Imbrium) exhibit very low TiO2 values (2.6 Ga), whereas only medium to high TiO2 values (average = 6.8 wt%, minimum = 4.5 wt%) are found for younger mare units (<2.6 Ga).

  8. The symbiotic intestinal ciliates and the evolution of their hosts.

    Science.gov (United States)

    Moon-van der Staay, Seung Yeo; van der Staay, Georg W M; Michalowski, Tadeusz; Jouany, Jean-Pierre; Pristas, Peter; Javorský, Peter; Kišidayová, Svetlana; Varadyova, Zora; McEwan, Neil R; Newbold, C Jamie; van Alen, Theo; de Graaf, Rob; Schmid, Markus; Huynen, Martijn A; Hackstein, Johannes H P

    2014-04-01

    The evolution of sophisticated differentiations of the gastro-intestinal tract enabled herbivorous mammals to digest dietary cellulose and hemicellulose with the aid of a complex anaerobic microbiota. Distinctive symbiotic ciliates, which are unique to this habitat, are the largest representatives of this microbial community. Analyses of a total of 484 different 18S rRNA genes show that extremely complex, but related ciliate communities can occur in the rumen of cattle, sheep, goats and red deer (301 sequences). The communities in the hindgut of equids (Equus caballus, Equus quagga), and elephants (Elephas maximus, Loxodonta africanus; 162 sequences), which are clearly distinct from the ruminant ciliate biota, exhibit a much higher diversity than anticipated on the basis of their morphology. All these ciliates from the gastro-intestinal tract constitute a monophyletic group, which consists of two major taxa, i.e. Vestibuliferida and Entodiniomorphida. The ciliates from the evolutionarily older hindgut fermenters exhibit a clustering that is specific for higher taxa of their hosts, as extant species of horse and zebra on the one hand, and Africa and Indian elephant on the other hand, share related ciliates. The evolutionary younger ruminants altogether share the various entodiniomorphs and the vestibuliferids from ruminants. Copyright © 2014 Elsevier GmbH. All rights reserved.

  9. Identification of copy number variants in horses

    KAUST Repository

    Doan, R.

    2012-03-01

    Copy number variants (CNVs) represent a substantial source of genetic variation in mammals. However, the occurrence of CNVs in horses and their subsequent impact on phenotypic variation is unknown. We performed a study to identify CNVs in 16 horses representing 15 distinct breeds (Equus caballus) and an individual gray donkey (Equus asinus) using a whole-exome tiling array and the array comparative genomic hybridization methodology. We identified 2368 CNVs ranging in size from 197 bp to 3.5 Mb. Merging identical CNVs from each animal yielded 775 CNV regions (CNVRs), involving 1707 protein- and RNA-coding genes. The number of CNVs per animal ranged from 55 to 347, with median and mean sizes of CNVs of 5.3 kb and 99.4 kb, respectively. Approximately 6% of the genes investigated were affected by a CNV. Biological process enrichment analysis indicated CNVs primarily affected genes involved in sensory perception, signal transduction, and metabolism. CNVs also were identified in genes regulating blood group antigens, coat color, fecundity, lactation, keratin formation, neuronal homeostasis, and height in other species. Collectively, these data are the first report of copy number variation in horses and suggest that CNVs are common in the horse genome and may modulate biological processes underlying different traits observed among horses and horse breeds.

  10. Klõsheiko, Mare Vint, effid / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2005-01-01

    Tallinna Kinomajas esilinastusid 28. okt. kolm uut dokumentaalfilmi eesti kunstnikest : "F.F.F.F. läheb laiali" (Kuukulgur Film 2005, rezh. Marko Raat, "Mare Vint" (Exitfilm 2005, rezh. Anri Rulkov) ja "Jaan Klõsheiko" (Estonia Film 2005, rezh.-d Eve Ester, Igor Ruus)

  11. Towards a typology of the mares sandstone of Mallorca Concept, characterization and stratigraphy

    International Nuclear Information System (INIS)

    Mas Gornals, C.

    2017-01-01

    The mares sandstone has traditionally been the most representative and characteristic building stone on the island of Mallorca, used practically exclusively as construction material for centuries, since the abandonment of stone-and-mortar walls, until its progressive disuse with the appearance of the re-enforced concrete, which finally eclipsed its use. Such emblematic buildings for the island, as Bellver Castle, the Cathedral, La Lonja or the old city walls of Palma, bear witness to this. In Mallorca, the mares sandstone is quarried in the open air or in subterranean galleries. Vernacular architecture has always used the most accessible appropriate materials, and in the case of the mares sandstone, its abundance, sufficient softness, which facilitates its extraction, Together with sufficient hardness to confer solidity and durability in constructions, converge. The lack of specific scientific and geological data published about the different types of mares in Mallorca, added to the recent resurgence of technical, applied and landscape interest in this stone, have made a revision of its definition, characterization and classification necessary. [es

  12. Green glass vitrophyre 78526 - An impact of very low-Ti mare basalt composition

    Science.gov (United States)

    Warner, R. D.; Taylor, G. J.; Kiel, K.; Planner, H. H.; Nehru, C. E.; Ma, M.-S.; Schmitt, R. A.

    1978-01-01

    Rake sample 78526 is an 8.77 g rock consisting primarily of vitrophyric pale green glass with subordinate mineral and lithic relics. Petrographic and compositional evidence leads to the following conclusions: (1) the bulk composition represents that of a mixture formed by impact melting of at least two different textural and compositional varieties of VLT mare basalt that are now present in the rock as lithic relics and a poorly defined low-Ti mare basalt component observed in thin section only in the form of isolated mineral relics; (2) the admixed VLT mare basalts had REE abundances lower than those found in other mare basalts (but probably higher than emerald green glass) and REE patterns showing significant enrichment of the heavy relative to light REE's, suggesting that they were derived by comparatively high degrees of partial melting of a clinopyroxene-rich source region; and (3) the impact melt supercooled to produce the vitrophyre, with rather sharply contrasting textural domains present in the vitrophyre resulting from differences in nucleation kinetics and degrees of supercooling in various portions of the sample.

  13. Effect of β-carotene integration to Italian trotter mares in peripartum

    Directory of Open Access Journals (Sweden)

    A. Falaschini

    2011-03-01

    Full Text Available In Italy trotter horses begin racing activity in the summer, two years after their birth year, so that the foals born in the first months of the year are better developed than those born in late spring-summer. As it is known, mares are characterised by an oestrus cyclic activity, which founds its best time in spring. The management of trotter mares tries to anticipate the foaling at first months of the year and therefore the next oestrus cycle, too...

  14. How does the suppression of energy supplementation affect herbage intake, performance and parasitism in lactating saddle mares?

    Science.gov (United States)

    Collas, C; Fleurance, G; Cabaret, J; Martin-Rosset, W; Wimel, L; Cortet, J; Dumont, B

    2014-08-01

    Agroecology opens up new perspectives for the design of sustainable farming systems by using the stimulation of natural processes to reduce the inputs needed for production. In horse farming systems, the challenge is to maximize the proportion of forages in the diet, and to develop alternatives to synthetic chemical drugs for controlling gastrointestinal nematodes. Lactating saddle mares, with high nutritional requirements, are commonly supplemented with concentrates at pasture, although the influence of energy supplementation on voluntary intake, performance and immune response against parasites has not yet been quantified. In a 4-month study, 16 lactating mares experimentally infected with cyathostome larvae either received a daily supplement of barley (60% of energy requirements for lactation) or were non-supplemented. The mares were rotationally grazed on permanent pastures over three vegetation cycles. All the mares met their energy requirements and maintained their body condition score higher than 3. In both treatments, they produced foals with a satisfying growth rate (cycle 1: 1293 g/day; cycle 2: 1029 g/day; cycle 3: 559 g/day) and conformation (according to measurements of height at withers and cannon bone width at 11 months). Parasite egg excretion by mares increased in both groups during the grazing season (from 150 to 2011 epg), independently of whether they were supplemented or not. This suggests that energy supplementation did not improve mare ability to regulate parasite burden. Under unlimited herbage conditions, grass dry matter intake by supplemented mares remained stable around 22.6 g DM/kg LW per day (i.e. 13.5 kg DM/al per day), whereas non-supplemented mares increased voluntary intake from 22.6 to 28.0 g DM/kg LW per day (13.5 to 17.2 kg DM/al per day) between mid-June and the end of August. Hence total digestible dry matter intake and net energy intake did not significantly differ between supplemented and non-supplemented mares during the

  15. Male, female and management risk factors for non-return to service in Dutch mares.

    NARCIS (Netherlands)

    Buiten, van A.; Westers, P.; Colenbrander, B.

    2003-01-01

    The "effect" of stallion, mare and management-related factors on the odds of pregnancy per cycle in the horse were identified and quantified from the breeding records of Dutch Warmblood (n=4491), Friesian (n=1467) and Shetland-pony mares (n=3267) mated either naturally or by artificial insemination

  16. The cosmopolitan maternal heritage of the Thoroughbred racehorse breed shows a significant contribution from British and Irish native mares.

    Science.gov (United States)

    Bower, M A; Campana, M G; Whitten, M; Edwards, C J; Jones, H; Barrett, E; Cassidy, R; Nisbet, R E R; Hill, E W; Howe, C J; Binns, M

    2011-04-23

    The paternal origins of Thoroughbred racehorses trace back to a handful of Middle Eastern stallions, imported to the British Isles during the seventeenth century. Yet, few details of the foundation mares were recorded, in many cases not even their names (several different maternal lineages trace back to 'A Royal Mare'). This has fuelled intense speculation over their origins. We examined mitochondrial DNA from 1929 horses to determine the origin of Thoroughbred foundation mares. There is no evidence to support exclusive Arab maternal origins as some historical records have suggested, or a significant importation of Oriental mares (the term used in historic records to refer to Middle East and western Asian breeds including Arab, Akhal-Teke, Barb and Caspian). Instead, we show that Thoroughbred foundation mares had a cosmopolitan European heritage with a far greater contribution from British and Irish Native mares than previously recognized.

  17. The systematic position of Equus hydruntinus, an extinct species of Pleistocene equid⋆

    Science.gov (United States)

    Burke, Ariane; Eisenmann, Vera; Ambler, Graeme K.

    2003-05-01

    Palaeolithic people commonly hunted Equus hydruntinus, an extinct species of equid whose cursorial body proportions suggest an adaptation to semi-arid conditions. Despite the frequency with which it is encountered in fossil deposits, only partial cranial remains have been reported until now. As a result, the systematic affiliation of the species remains a subject of controversy. Two nearly complete E. hydruntinus crania are presented here for the first time. These skulls show that E. hydruntinus is a distinct species, more closely related to the hemiones (Asiatic asses) than to any other equid. This suggests that the social organisation of E. hydruntinus followed one of two known equid sociotypes: resource defense territoriality.

  18. Inoculação experimental de Equus asinus com Leishmania chagasi Cunha & Chagas, 1937 Experimental infection of Equus asinus with Leishmania chagasi Cunha & Chagas, 1937

    Directory of Open Access Journals (Sweden)

    Elúzio José Lima Cerqueira

    2003-12-01

    Full Text Available Quatro Equus asinus foram inoculados com promastigotas de Leishmania chagasi Cunha & Chagas, 1937 e acompanhados durante 12 meses através de: pesquisa de amastigotas em esfregaços e culturas de sangue periférico em fragmentos de tecido do lábio inferior, medula óssea, baço e fígado e de testes de ELISA e TRALd. Estes foram positivos nos 8º, 10º e 12º meses após a inoculação. O exame histopatológico pós necropsia, demonstrou discreto número de amastigotas no fígado de dois dos eqüídeos inoculados. Apesar de desafiados com elevado número de promastigotas, os animais não desenvolveram infecções patentes e não infectaram experimentalmente a vetora Lutzomya longipalpis. Os resultados induzem a acreditar que os eqüídeos são desprovidos de importância como reservatórios na cadeia de transmissão da leishmaniose visceral, embora sirvam como boa fonte de alimentação sangüínea e proliferação da vetora Lutzomyia longipalpis.Four Equus asinus were challenged with promastigotes of Leishmania chagasi Cunha & Chagas, 1937, and followed up for 12 months. They were observed by means of direct testing for promastigotes in smears and culture of peripheral blood, fragments from inferior lip, bone marrow, spleen and liver and the immunological assays ELISA and TRALd. The post-necropsy histological examination demonstrated a small number of amastigotes in the liver of two animals. ELISA and TRALd tests were positive at the 8th, 10th and 12th month after inoculation. The results suggest that the donkeys were able to overcome the experimental leishmanial infection and did not infect the vector Lutzomyia longipalpis in the laboratory. Consequently they can not be considered an important reservoir in the epidemiological chain of transmission of visceral leishmaniasis, although they represent an important blood source for the vector and its proliferation.

  19. CHARACTERIZATION OF LACTIC ACID BACTERIA ISOLATED FROM SUMBAWA MARE MILK

    Directory of Open Access Journals (Sweden)

    Nengah Sujaya

    2008-06-01

    Full Text Available A study was carried out to isolate and characterize lactic acid bacteria (LAB from the Sumbawa mares milk The Isolation of LAB was conducted in Man Rogosa Sharpe (MRS agar. The isolates were characterized by standard methods, such as Gram staining, cell morphology study and fermentation activities. The ability of the isolates to inhibit some pathogenic bacteria was studied by dual culture assay. Isolates showing the widest spectrum of inhibiting pathogenic bacteria were further identified using API 50 CHL. The results showed that Sumbawa mare milk was dominated by lactobacilli and weisella/leuconostoc. As many as 26 out 36 isolates belong to homofermentative lactobacilli and another 10 isolates belong to both heterofermentative lactobacilli and weissella or leuconostoc. Twenty four isolates inhibited the growth of Escherichia coli 25922, Shigela flexneri, Salmonella typhimurium, and Staphylococcus aureus 29213. Two promising isolates with the widest spectrum of inhibiting pathogenic bacteria, Lactobacillus sp. SKG34 and Lactobacillus sp. SKG49, were identified respectively as Lactobacillus rhamnosus SKG34 and Lactobacillus ramnosus SKG49. These two isolates were specific strains of the sumbawa mare milk and are very potential to be developed as probiotic for human.

  20. Hadley Rille, lava tubes and mare volcanism at the Apollo 15 site

    International Nuclear Information System (INIS)

    Greeley, R.; Spudis, P.D.

    1985-01-01

    Hadley Rille appears to be a collapsed lava tube/channel, whose formation history may be more intimately related to the mare units sampled at 15 than was previously thought. More work is needed relating samples and observations from Apollo 15 to the rille and its geologic evolution. As the only sinuous rille visited during the Apollo missions, Hadley Rille represents a data source that is directly applicable to the deciphering of processes involved in lunar mare volcanism

  1. Laparoscopic application of PGE2 to re-establish oviducal patency and fertility in infertile mares: a preliminary study.

    Science.gov (United States)

    Allen, W R; Wilsher, S; Morris, L; Crowhurst, J S; Hillyer, M H; Neal, H N

    2006-09-01

    Mares are occasionally encountered that consistently fail to conceive when inseminated, naturally or artificially, with fertile stallion semen in the absence of any identifiable pathology of either the structure or function of their reproductive tract. Temporary blockage of the oviducts by accumulations of naturally occurring oviducal masses may be preventing oviducal transport of the embryo to the uterus. Mares, with known reproductive histories, that had exhibited inexplicable failure of conception were treated by laparoscopically guided administration of PGE2-laced triacetin gel directly onto the surface of their oviducts. Fifteen mares age 10-21 years that had exhibited inexplicable failure of conception during 1-4 years were treated, of which 14 (93%) conceived within the same or subsequent breeding season. The high success rate of this treatment supports the tentative diagnosis of oviducal obstruction in these mares and indicates that blockage of the mare's oviducts may occur in the form of a moveable accumulation of debris rather than from permanent fibrous adhesions resulting from salpingitis. This laparoscopic application of PGE2 to the oviducts constitutes a sound and practical method of restoring fertility in mares suffering oviducal obstruction and further studies involving the procedure are warranted.

  2. Endoscopic-assisted resection of a pedunculated uterine leiomyoma with maximal tissue preservation in a cow and a mare.

    Science.gov (United States)

    Schneeweiss, Wilfried; Krump, Lea; Metcalfe, Lucy; Ryan, Eoin; Beltman, Marijke; Jahns, Hanne; David, Florent

    2015-02-01

    To report successful minimally invasive treatment of a uterine leiomyoma in a cow and a mare. Clinical report. Limousine cow (n = 1), Thoroughbred mare (n = 1). A 10-year-old cow and an 18-year-old mare were presented for difficulties in breeding and infertility, respectively. Examination of the reproductive tract revealed the presence of a large mass attached to the uterine wall via a wide and short peduncle in both cases. The mass expanded into the uterine lumen in the mare and into the abdomen in the cow. Both masses were removed using a minimally invasive endoscopic approach and a vessel-sealing and dividing device. Minimally invasive surgical resection of a subserosal and a submucosal leiomyoma with maximal sparing of uterine tissue resulted in a short convalescence period and apparent return to breeding function in a cow and a mare. Use of a vessel-sealing and dividing device provided excellent hemostasis and decreased tissue handling. Leiomyoma with short, wide, and thick peduncles were treated successfully in a cow and a mare with minimally invasive endoscopic approaches aiming at maximal uterine tissue preservation. © Copyright 2014 by The American College of Veterinary Surgeons.

  3. Demography of the Pryor Mountain wild horses, 1993-2007

    Science.gov (United States)

    Roelle, James E.; Singer, Francis J.; Zeigenfuss, Linda C.; Ransom, Jason I.; Coates-Markle, Linda; Schoenecker, Kathryn A.

    2010-01-01

    Wild horses (Equus caballus) at Pryor Mountain were studied by direct observation from 1993 through 2007. All horses present were individually identifiable on the basis of coat coloration, head and leg markings, gender, and band associations. Of the 609 horses either present prior to foaling in 1993 or born since, ages were precisely known for 491 (observed as a foal). Ages for 52 horses were estimated through tooth eruption and wear patterns, and for the remaining 66 horses through body size, morphology, and anecdotal evidence concerning when they were present on the range. At varying intensities, never less than 30 days per year, all horses were inventoried and their band associations noted. Foals were paired with dams based on observations of attachment during the early days and weeks of life. Year of death was determined by identification of the carcass where possible. In the absence of finding a carcass, an animal that was not observed for 2 years was considered to have died in the year that it went missing. Animals that were removed from the herd and mares that were part of a contraception study were excluded from calculations of survival and foaling rates, respectively, as appropriate. The average prefoaling population over the 15 years of the study was 148.8 animals (range = 120-187), and the annual foal crop averaged 32.1 (range = 23-40). Large removals (19-60 animals) in four years helped maintain the herd at this level; apparent growth rate (calculated as though removals had not occurred) was 9.6 percent annually (? = 1.096, range = 0.977-1.220). This annual growth rate is relatively low compared to that for many western horse herds, at least in part because of a decline in foal survival. Sex ratio of the foal crop varied widely among years, but pooled across years did not differ from 50:50. Sex ratio in the herd changed mostly as a result of removals. The average age of both males and females in the herd increased during the course of the study. Annual

  4. Cardiac evaluation of anesthetized Grevy's zebras (Equus grevyi).

    Science.gov (United States)

    Adin, Darcy B; Maisenbacher, Herbert W; Ojeda, Nyurka; Fiorello, Christine V; Estrada, Amara H; Prosek, Robert; Citino, Scott B

    2007-02-01

    To determine ECG and echocardiographic measurements in healthy anesthetized Grevy's zebras (Equus grevyi). 20 healthy zebras. Auscultation, base-apex ECG, and echocardiography were performed on anesthetized zebras. Low-grade systolic murmurs were detected in the left basilar region in 4 of 20 zebras. Evaluation of ECGs from 19 zebras revealed sinus rhythm with a predominantly negative QRS complex and a mean +/- SD heart rate of 67 +/- 10 beats/min. Echocardiograms of sufficient image quality were obtained for 16 zebras. Interventricular septal thickness in diastole, left ventricular chamber in diastole and systole, left atrial diameter, and left ventricular mass were significantly and moderately correlated with estimated body weight (r values ranged from 0.650 to 0.884). Detectable swirling of blood in the right and sometimes the left ventricles was detected in 9 of 16 zebras, whereas physiologic regurgitation of blood was detected for the aortic valve in 3 zebras, pulmonary valve in 2 zebras, mitral valve in 2 zebras, and tricuspid valve in 1 zebra. Results of this study provide reference information for use in the cardiac evaluation of anesthetized Grevy's zebras.

  5. Halicephalobus gingivalis (Nematoda) infection in a Grevy's zebra (Equus grevyi).

    Science.gov (United States)

    Isaza, R; Schiller, C A; Stover, J; Smith, P J; Greiner, E C

    2000-03-01

    A 6-yr-old female Grevy's zebra (Equus grevyi) with a disseminated rhabditiform nematode infection is described. Antemortem clinical signs were limited to blindness and abnormal behavior believed to be caused by a recurrent nematode-induced uveitis. Histologic examination of the kidneys, heart, eyes, uterus, and lymph nodes revealed granulomas containing multiple sections of rhabditiform nematodes. Most of the recovered nematodes were larval stages with only a few adult females noted. The adults measured 243-297 microm x 11-16 microm (x = 269 x 14 microm). The distinctive rhabditiform esophagi had corpus:isthmus:bulb proportions of 19:11:5. On the basis of adult morphology, the nematode was identified as Halicephalobus gingivalis. This is the first report of this parasite in a zebra and indicates that this parasitic granulomatous disease should be considered in zebras with neurologic disease.

  6. Seroepidemiology of Sarcocystis neurona and Neospora hughesi infections in domestic donkeys (Equus asinus) in Durango, Mexico

    OpenAIRE

    Alvarado-Esquivel, Cosme; Howe, Daniel K.; Yeargan, Michelle R.; Alvarado-Esquivel, Domingo; Alfredo Zamarripa-Barboza, Jos?; Dubey, Jitender P.

    2017-01-01

    There is currently no information regarding Sarcocystis neurona and Neospora hughesi infections in donkeys in Mexico. Here, we determined the presence of antibodies against S. neurona and N. hughesi in donkeys in the northern Mexican state of Durango. Serum samples of 239 domestic donkeys (Equus asinus) were assayed for S. neurona and N. hughesi antibodies using home-made enzyme-linked immunoassays; six (2.5%) of the 239 donkeys tested seropositive for S. neurona. The seroprevalence of S. neu...

  7. Uterine involution in colombian fine pace mares, measured by ultrasonography and endometrial cytology

    Directory of Open Access Journals (Sweden)

    Germán Ramírez

    2006-06-01

    Full Text Available Today, there still exists a controversial issue, as to the high incidence of early embryonic death in mares, mated on the first post partum oestrus. The purpose of this study was first, to determine the post partum period of uterine involution in fine pace Colombian mares using endometrial cytology and ultra sonograph. Secondly, to determine the relation between the neutrophil percentages found in cytology and the echogenicity of accumulated intrauterine fluid during the first 30 post partum days. Twenty (n=20 mares were examined beginning on the 6th post partum day and on alternate days, up to the 30th day. All subjects were grazing Kikuyo grass (Pennisetum clandestinum at la Sabana de Bogotá, 2.600 meters over sea level, 4 º north latitude and with an average temperature of 13 º C. From the 3rd postpartum day, all 20 mares were exposed to 2 healthy stallions, to establish their heat behaviour. Ten of them, following complete randomization, were inseminated on the first postpartum heat, while the others were inseminated on the second post partum heat. Genital examination was carried out by a technician, who did not know the reproductive history of any of the experimental mares. Examinations included rectal palpation, ultra sonograph (Pie Medical 480, linear array, 5 MHz, vaginal swabs and endometrial cytology. Uterine dimension was recorded by rectal palpation and ultra sonograph, it was included the uterine horn dimensions (tip, middle, and corporo-cornual junction of previously gravid and non gravid uterus. Intrauterine fluid detection was performed by the use of an echogenicity scale. Ovaric structures were recorded (preovulatory follicles and ovulation. Pregnancy diagnosis was performed on day 15 post ovulation and then confirmed on day 40. Endometrial cytology samples were taken from uterus after the perineal area was disinfected using non covered isopos with a Pollanski speculum. Smears specimens were fixed with metil alcohol for 15

  8. Expression of oxytocin receptors is greatly reduced in the placenta of heavy mares with retained fetal membranes due to secondary uterine atony.

    Science.gov (United States)

    Rapacz-Leonard, A; Raś, A; Całka, J; Janowski, T E

    2015-09-01

    Fetal membrane retention can be a life-threatening condition and its incidence exceeds 50% in heavy draught mares. Although fetal membrane retention is commonly treated with repeated injections of oxytocin, based on the suggestion that it is caused mainly by secondary atony of the uterus, this treatment sometimes fails. This led us to ask if expression of oxytocin receptors differs in mares that retain fetal membranes due to secondary uterine atony. To determine whether expression of oxytocin receptors in equine placental tissues differs when heavy draught mares expel fetal membranes or retain them because of secondary uterine atony. Controlled study using archived tissues. Placental biopsies (containing the endometrium and allantochorion) were taken from 8 heavy draught mares during parturition. Four mares expelled fetal membranes shortly after foaling (control mares) and 4 mares retained them (expulsion time was >3 h from delivery). The 4 mares that retained fetal membranes had secondary atony of the uterus. The amount of oxytocin receptors was estimated by measuring the intensity of western blot bands. The presence and location of oxytocin receptors were determined by immunocytochemistry. Oxytocin receptor expression was nearly 50 times less intense in mares with placenta retention due to secondary atony of the uterus and immunocytochemical staining was barely visible. In the control mares, oxytocin receptors were found in both epithelial and endothelial cells of the placenta and staining was most intense where the endometrium contacts the allantochorion. Inadequate expression of oxytocin receptors may be a cause of uterine atony leading to fetal membrane retention. © 2015 EVJ Ltd.

  9. Influences of immunocontraception on time budgets, social behavior, and body condition in feral horses

    Science.gov (United States)

    Ransom, J.I.; Cade, B.S.; Hobbs, N.T.

    2010-01-01

    Managers concerned with shrinking habitats and limited resources for wildlife seek effective tools for limiting population growth in some species. Fertility control is one such tool, yet little is known about its impacts on the behavioral ecology of wild, free-roaming animals. We investigated influences of the immunocontraceptive porcine zona pellucida (PZP) on individual and social behavior in bands of feral horses (Equus caballus) in three discrete populations and used 14 hierarchical mixed effect models to gain insight into the influences of PZP treatment on feral horse behavior. A model of body condition was the strongest predictor of feeding, resting, maintenance, and social behaviors, with treated females allocating their time similarly to control females. Time spent feeding declined 11.4% from low condition to high condition females (F1,154 = 26.427, P modifications in feral horses.

  10. Determining Home Range and Preferred Habitat of Feral Horses on the Nevada National Security Site Using Geographic Information Systems

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Ashley V. [Univ. of Denver, CO (United States)

    2014-05-30

    Feral horses (Equus caballus) are free-roaming descendants of domesticated horses and legally protected by the Wild and Free-Roaming Horses and Burros Act of 1971, which mandates how feral horses and burros should be managed and protected on federal lands. Using a geographic information system to determine the home range and suitable habitat of feral horses on the federally managed Nevada National Security Site can enable wildlife biologists in making best management practice recommendations. Home range was estimated at 88.1 square kilometers. Site suitability was calculated for elevation, forage, slope, water presence and horse observations. These variables were combined in successive iterations into one polygon. Suitability rankings established that 85 square kilometers are most suitable habitat, with 2,052 square kilometers of good habitat 1,252 square kilometers of fair habitat and 122 square kilometers of least suitable habitat.

  11. Adaptive evolution of the mitochondrial ND6 gene in the domestic horse.

    Science.gov (United States)

    Ning, T; Xiao, H; Li, J; Hua, S; Zhang, Y P

    2010-01-26

    Mitochondria play a crucial role in energy metabolism through oxidative phosphorylation. Organisms living at high altitudes are potentially influenced by oxygen deficits and cold temperatures. The severe environmental conditions can impact on metabolism and direct selection of mitochondrial DNA. As a wide-ranging animal, the domestic horse (Equus caballus) has developed various morphological and physiological characteristics for adapting to different altitudes. Thus, this is a good species for studying adaption to high altitudes at a molecular level. We sequenced the complete NADH dehydrogenase 6 gene (ND6) of 509 horses from 24 sampling locations. By comparative analysis of three horse populations living at different altitudes (>2200 m, 1200-1700 m, and horses was found distributed on the selected branches. We conclude that the high-altitude environment has directed adaptive evolution of the mitochondrial ND6 gene in the plateau horse.

  12. The effect of early handling of foals on their reaction to handling, humans and novelty, and the foal-mare relationship

    DEFF Research Database (Denmark)

    Søndergaard, Eva; Jago, J.

    2010-01-01

    at a mean age of 14 days. The approach and leave behaviour of mare-foal pairs were observed at pasture during week 5 to evaluate their relationship. Mares of H foals were less active in keeping the pair together than mares of C foals (GLM: F1,33 = 6.81; P 

  13. Toonart Rääski ja Aivar Riisalu firma ostab Rocca al Mare Suurhalli / Kristina Traks

    Index Scriptorium Estoniae

    Traks, Kristina, 1976-

    2003-01-01

    Ilmunud ka: Delovõje Vedomosti 22. okt. lk. 7. Rocca al Mare Suurhalli aktsionärid otsustasid müüa suurhalli hotelliärimehe Toonart Rääski ja meelelahutusettevõtja Aivar Riisaluga seotud firmale Neckman Group. Diagramm: Lemminkäinen Eesti, Neckman Groupi, Eesti riigi ja Tallinna linna osalused Rocca al Mare Suurhallis

  14. The cosmopolitan maternal heritage of the Thoroughbred racehorse breed shows a significant contribution from British and Irish native mares

    Science.gov (United States)

    Bower, M. A.; Campana, M. G.; Whitten, M.; Edwards, C. J.; Jones, H.; Barrett, E.; Cassidy, R.; Nisbet, R. E. R.; Hill, E. W.; Howe, C. J.; Binns, M.

    2011-01-01

    The paternal origins of Thoroughbred racehorses trace back to a handful of Middle Eastern stallions, imported to the British Isles during the seventeenth century. Yet, few details of the foundation mares were recorded, in many cases not even their names (several different maternal lineages trace back to ‘A Royal Mare’). This has fuelled intense speculation over their origins. We examined mitochondrial DNA from 1929 horses to determine the origin of Thoroughbred foundation mares. There is no evidence to support exclusive Arab maternal origins as some historical records have suggested, or a significant importation of Oriental mares (the term used in historic records to refer to Middle East and western Asian breeds including Arab, Akhal-Teke, Barb and Caspian). Instead, we show that Thoroughbred foundation mares had a cosmopolitan European heritage with a far greater contribution from British and Irish Native mares than previously recognized. PMID:20926431

  15. LANDSLIDES INCIDENCE IN THE PIEDMONT OF BAIA MARE URBAN AREA (CASE STUDIES

    Directory of Open Access Journals (Sweden)

    S. ZAHARIA

    2012-12-01

    Full Text Available The landslides incidence in the piedmont of baia mare urbana area cae studies. The General Urban Plan (GUP of Baia Mare municipality requires the study of expected susceptibility for landslides in order to build infrastructure within sustainable development conditions. The complexity and diversity of local geographic area factors, strongly affected by the human pressure, favours the triggering and extension of slope processes in the municipality’s piedmont area. To prevent some major imbalances it is imperative to implement some adequate measures based on in-depth studies.

  16. A construção da cidade de Maringá – 1947 a 1982

    Directory of Open Access Journals (Sweden)

    Fabiola Castelo de Souza Cordovil

    2011-06-01

    Full Text Available

    Apresentamos algumas linhas de análise da tese de doutorado intitulada “A Aventura Planejada: engenharia e urbanismo na construção de Maringá – 1947 a 1982” que se dividiu em duas partes. A primeira denomina-se “A criação de Maringá: projeto e história” e constitui-se por dois capítulos. A segunda parte intitula-se “Construir e administrar: técnica e política na construção da cidade” e compõe-se de sete capítulos, sendo um para cada gestão estudada, de 1953 a 1982. Na primeira parte estudamos o contexto regional no qual se formou Maringá e analisamos o seu plano inicial. A segunda parte refere-se especificamente às realizações das administrações municipais. Divide-se em sete capítulos, abarcando as primeiras sete gestões. Em três décadas e meia reconstituímos o processo de construção da cidade e a constituição da cultura técnico-profissional municipal.

    Abstract

    This text presents an analysis of the Ph. D. dissertation entitled “A Aventura Planejada: engenharia e urbanismo na construção de Maringá – 1947 a 1982” — “The Planned Adventure: Engineering and Urban Planning in the Building of Maringá.” The dissertation is divided into two parts. The first is called "A criação de Maringá: projeto e história"—“The Creation of Maringá,” and it consists of two chapters. The second part is entitled "Construir e administrar: técnica e política na construção da cidade” — “To Build and to Administer: Technique and Politics in the Building of the City,” and consists of seven chapters, one for each administration studied, from 1953 to 1982. In the first part we study the regional context in which

  17. Moon Diver: A Discovery Mission Concept for Understanding the History of the Mare Basalts Through the Exploration of a Lunar Mare Pit

    Science.gov (United States)

    Kerber, L.; Nesnas, I.; Keszthelyi, L.; Head, J. W.; Denevi, B.; Hayne, P. O.; Mitchell, K.; Ashley, J. W.; Whitten, J. L.; Stickle, A. M.; Parness, A.; McGarey, P.; Paton, M.; Donaldson-Hanna, K.; Anderson, R. C.; Needham, D.; Isaacson, P.; Jozwiak, L.; Bleacher, J.; Parcheta, C.

    2018-04-01

    Moon Diver is a Discovery-class mission concept designed to explore a lunar mare pit. It would be the first mission to examine an in-place bedrock stratigraphy on the Moon, and the first to venture into the subsurface of another planetary body.

  18. Avaliação de ruído na região central de Maringá e Universidade Estadual de Maringá - DOI: 10.4025/actascitechnol.v32i1.1919

    Directory of Open Access Journals (Sweden)

    Luiza Helena Costa Dutra Sousa

    2009-12-01

    Full Text Available Neste trabalho realizou-se o mapeamento acústico para salas de aulas, laboratórios e biblioteca pertencentes à Universidade Estadual de Maringá, bem como para a região central da cidade de Maringá, Estado do Paraná. Na primeira etapa do trabalho, realizou-se estudo e revisão bibliográfica sobre os parâmetros de interesse quando se deseja qualificar uma sala ou ambiente quanto ao seu nível de ruído, bem como o levantamento dos principais pontos a serem estudados. A segunda etapa compreendeu as medições in locu desses parâmetros, executadas conforme normas ABNT, ISO e recomendações da literatura. Por último, analisaram-se, estatisticamente, os dados para que pudessem ser comparados com os valores estipulados por leis vigentes. Após análise dos dados obtidos, pode-se perceber que a maioria dos pontos apresentou-se acima dos valores permitidos por lei, principalmente em relação à cidade de Maringá, e alguns trechos apresentaram-se com níveis de ruído bastante elevados. Com relação à Universidade Estadual de Maringá, grande parte dos pontos apresentou-se acima do permitido, mas em alguns casos apresentaram excelente qualidade.

  19. Toxoplasma gondii seroprevalence in donkeys (Equus asinus) from the U.S.A. and isolation of T. gondii from cats on donkey farms

    Science.gov (United States)

    Donkeys (Equus asinus) are used as companion animals, in leisure activities as working animals, for onotherapy, and their meat and milk is used for human consumption in certain countries. Here we report first serological survey for Toxoplasma gondii in donkeys in the U.S.A. Serum samples were collec...

  20. Prevalence of Toxoplasma gondii antibodies in domestic donkeys (Equus asinus) in Durango, Mexico slaughtered for human consumption

    OpenAIRE

    Alvarado-Esquivel, Cosme; Alvarado-Esquivel, Domingo; Dubey, Jitender P

    2015-01-01

    Background Nothing is known about Toxoplasma gondii prevalence in donkeys in Mexico. Meat from donkey is consumed by humans in Mexico and also exported to other countries. We sought to determine the presence of antibodies against T. gondii in 239 domestic donkeys (Equus asinus) for slaughter in Durango, Mexico using the modified agglutination test (MAT). Donkeys were sampled in four premises (trade centers) where donkeys were gather for shipment to abattoirs in other Mexican states. Results A...

  1. Estudio clínico e histopatológico del Sarcoide Fibroblastico en burros (Equus Asinus) en Colombia

    OpenAIRE

    Cardona Álvarez, José; Vargas Viloria, Marlene; Perdomo Ayola, Sandra

    2013-01-01

    El objetivo de este trabajo fue estudiar los aspectos clínicos e histopatológicos del sarcoide fibroblástico (SF) en burros (Equus asinus) del departamento de Córdoba, Colombia. Dicho estudio fue de tipo descriptivo, no probabilístico, en animales de conveniencia. Se utilizaron siete burros con SF diagnosticados clínica e histopatológicamente en diferentes explotaciones ganaderas del Departamento. Al describir las lesiones se observó apariencia exofítica fibrovascular, pa...

  2. Earth-based and Galileo SSI multispectral observations of eastern mare serenitatis and the Apollo 17 landing site

    Science.gov (United States)

    Hiesinger, H.; Jaumann, R.; Neukum, G.

    1993-01-01

    Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.

  3. Coumestrol and its metabolite in mares' plasma after ingestion of phytoestrogen-rich plants: potent endocrine disruptors inducing infertility.

    Science.gov (United States)

    Ferreira-Dias, G; Botelho, M; Zagrajczuk, A; Rebordão, M R; Galvão, A M; Bravo, P Pinto; Piotrowska-Tomala, K; Szóstek, A Z; Wiczkowski, W; Piskula, M; Fradinho, M J; Skarzynski, D J

    2013-10-01

    Phytoestrogens exist in plants that are present in forages fed to horses. They may compete with 17-β estradiol and influence the estrous cycle. Therefore, the objective was to determine whether coumestrol from clover-mixed pastures is present in mare's plasma after their ingestion (experiment I), and when this phytoestrogen was present in mare's plasma after ingestion (experiment II). The effect of a long-term ingestion of phytoestrogens on estrous cycle disruption was assessed (experiment III; clinical case). Experiment I was carried out in nonpregnant anestrous and cyclic Lusitano mares (n = 14) kept on clover and grass-mixed pastures, and supplemented with concentrate and hay or cereal straw. Blood and feedstuff were obtained from November to March. In experiment II, stabled cyclic Lusitano mares (n = 6) were fed for 14 days with increasing amounts of alfalfa pellets (250 g to 1 kg/day). Sequential blood samples were obtained for 8 hours after feed intake on Day 0 (control) and on Days 13 and 14 (1 kg/day alfalfa pellets). Experiment III mares were fed with a mixture of alfalfa and clover haylage for 5 months (group 1; n = 4) or for 9 months (group 2; n = 12). Estrous cycle was determined on the basis of plasma estradiol (E2), progesterone (P4), and ultrasound (experiment III). Concentrations of phytoestrogen coumestrol and its metabolite methoxycoumestrol were determined by high-performance liquid chromatography coupled with mass spectrometry. Phytoestrogens decreased in pasture from November until March (P haylage) than in group 1, after haylage withdrawal (P < 0.001). These data show that in the mare, coumestrol and its metabolite increase in blood after ingestion of estrogenic plants and can influence reproduction in mares as potent endocrine disruptors. Copyright © 2013 Elsevier Inc. All rights reserved.

  4. Improved Discrimination of Volcanic Complexes, Tectonic Features, and Regolith Properties in Mare Serenitatis from Earth-Based Radar Mapping

    Science.gov (United States)

    Campbell, Bruce A.; Hawke, B. Ray; Morgan, Gareth A.; Carter, Lynn M.; Campbell, Donald B.; Nolan, Michael

    2014-01-01

    Radar images at 70 cm wavelength show 4-5 dB variations in backscatter strength within regions of relatively uniform spectral reflectance properties in central and northern Mare Serenitatis, delineating features suggesting lava flow margins, channels, and superposition relationships. These backscatter differences are much less pronounced at 12.6 cm wavelength, consistent with a large component of the 70 cm echo arising from the rough or blocky transition zone between the mare regolith and the intact bedrock. Such deep probing is possible because the ilmenite content, which modulates microwave losses, of central Mare Serenitatis is generally low (2-3% by weight). Modeling of the radar returns from a buried interface shows that an average regolith thickness of 10m could lead to the observed shifts in 70 cm echo power with a change in TiO2 content from 2% to 3%. This thickness is consistent with estimates of regolith depth (10-15m) based on the smallest diameter for which fresh craters have obvious blocky ejecta. The 70 cm backscatter differences provide a view of mare flow-unit boundaries, channels, and lobes unseen by other remote sensing methods. A localized pyroclastic deposit associated with Rima Calippus is identified based on its low radar echo strength. Radar mapping also improves delineation of units for crater age dating and highlights a 250 km long, east-west trending feature in northern Mare Serenitatis that we suggest is a large graben flooded by late-stage mare flows.

  5. Geologic structure of the eastern mare basins. [lunar basalts

    Science.gov (United States)

    Dehon, R. A.; Waskom, J. D.

    1976-01-01

    The thickness of mare basalts in the eastern maria are estimated and isopachs of the basalts are constructed. Sub-basalt basin floor topography is determined, and correlations of topographic variations of the surface with variations in basalt thickness or basin floor topography are investigated.

  6. 33 CFR 334.1170 - San Pablo Bay, Calif.; gunnery range, Naval Inshore Operations Training Center, Mare Island...

    Science.gov (United States)

    2010-07-01

    ... range, Naval Inshore Operations Training Center, Mare Island, Vallejo. 334.1170 Section 334.1170... Operations Training Center, Mare Island, Vallejo. (a) The Danger Zone. A sector in San Pablo Bay delineated..., Vallejo, California, will conduct gunnery practice in the area during the period April 1 through September...

  7. Gestational length in Carthusian broodmares: effects of breeding season, foal gender, age of mare, year of parturition, parity and sire.

    Science.gov (United States)

    Satué, K; Felipe, M; Mota, J; Muñoz, A

    2011-01-01

    The length of gestation in Carthusian broodmares was calculated on the basis of 339 spontaneous full-term deliveries taking place in the 8-year period 1998-2005 from 158 broodmares and 29 stallions in a major farm of Spanish horses of Carthusian strain in southern Spain. Ultrasonography was used to determine follicular dehiscence, 1st day of pregnancy and to confirm conception in mares. Mean GL was 332.4 +/- 12.1 days, and a normal interval of 297-358 days was established for this breed. GL records were grouped on the basis of foal sex (colts or fillies), mating month (between November and January; February and April; May and July), age of the mare (4 to 7 years; 8 to 12 years; 13 to 17 years), breeding year, stallion and parity (primiparous vs. multiparous). GLs were 12.9 days shorter in mares mated between May and July than those mated between November and January and 15.3 days in mares mated between February and April (p < 0.001). Mares aged between 8-12 years had 5.3 days shorter GLs than those aged between 13-17 years (p < 0.05). Pregnancy was significantly 5.7 days longer when the mare gave birth to colts than fillies (p < 0.05). GL was 14.5 days longer in primiparous than in multiparous mares ( p < 0.001). No statistical differences in GL were found between the studied years. This study shows the influence of certain stallion on GL.

  8. Considerations on the extreme flood produced in Ral Mare Basin (Retezat Mountains, Romania)

    International Nuclear Information System (INIS)

    Barbuc, Mihai

    2004-01-01

    The aim of this paper is to illustrate the major impact of an extreme flood on the landscape, on the upper basin of Raul Mare, from Retezat Mountains, Romania, and what means 'hazardous phenomenon'. Romania is one of the European countries most severely affected by natural hazards, which have a big social and economic impact. Between them, floods are the very frequent and have one of the most important effects on settlements, agriculture and communications. Raul mare has three main sources: Lapusnicul Mare, Lapusnicul Mic and Raul Ses. Its springs from glacier lakes, at high altitude, over 2000 m, and have torrential and narrow valleys. In present, their conflence, at Gura Apelor, is covered by an anthropic lake, formed behind of a great dam, 173 m high. This dam had a major role to attenuate and to fail to control the extreme flood from July 1990 and, at the same time, to reduce significantly, the damages in Hateg depression, a low area with many settlements and economic objectives. Behind of the Gura Apelor kake, the Lapusnicul Mare and Mic valleys, the flush flood covered the whole channel, the effects on the landscape-devastating, and the flood probability, between 0,1 -0,1 %. The maps, graphics and pictures presented in this paper will emphasize the situation before and after the event. Furthermore, some standard forms used to be filled in by authorities for immediate and unitary recording of extreme phenomena are presented.(Author)

  9. Immunoassay of sexual steroids for fertility control in cows, sows and mares. Part 1

    International Nuclear Information System (INIS)

    Han Sun Choi

    1987-01-01

    The immunological determination of oestrogens in faeces as a method of pregnancy diagnosis in cows, sows and mares, and the stability of oestrogens in faeces was tested. During 8 days storage at -20 0 to +37 0 C the concentration of oestrogen in faeces was not significantly influenced. During 2 oestrous cycles blood was taken daily of 8 cows and the concentration of progesterone (P4), dehydroepiandrosterone (DHA), androstenedione (AD), epitestosterone (Epi) and testosterone (T) in plasma was determined by radioimmunoassay (RIA). The average concentration of DHA in the blood of cows was 650±71 pg/ml, that of AD 77±8 pg/ml to 122±29 pg/ml (x-bar ± SD). The concentration of Epi and T was from 160 to 243 pg/ml and from 46 to 96 pg/ml plasma. For the pregnancy diagnosis in sows blood and faeces were collected of 6 non-pregnant and 30 pregnant animals day 16 to 30 after mating. In faeces the concentration of oestrogens was determined by means of RIA, in blood that of oestrone sulphate and P4 by EIA on micro titre plates. During the whole period of examination the concentration of P4 remained fairly constant. From day 17 to 23 after mating the concentration in non-pregnant was significantly lower than in pregnant sows. In the blood of non-pregnant sows the oestrone sulphate concentration was 1,3±1,2 ng/ml (x-bar ± SD). Day 24 to 30: >x-bar ± 2SD in pregnant animals. Day 25 and 29 of pregnancy the concentration of oestrogens in faeces was: >x-bar ± 2SD = 20,6 ng/g faeces. Pregnancy diagnosis: 21 non-pregnant cows and heifers, 6 bulls and 83 pregnant cows were examined (10th to 35th week of pregnancy). Faeces samples from 21 non-pregnant mares, 6 stallions and 57 pregnant mares (10th to 35th week) and 18 samples from 3 mares at parturition. 18th week of pregnancy the concentration of oestrogens in faeces of cows and mares was: (>x-bar ± 3SD) in non-pregnant animals; (cows: 21,6 ng/g, mares: 14,3 ng/g ) after parturition. 17 refs. (Author)

  10. Immunoassay of sexual steroids for fertility control in cows, sows and mares. Part 2

    International Nuclear Information System (INIS)

    Han Sun Choi

    1987-01-01

    The immunological determination of oestrogens in faeces as a method of pregnancy diagnosis in cows, sows and mares, and the stability of oestrogens in faeces was tested. During 8 days storage at -20 0 to +37 0 C the concentration of oestrogen in faeces was not significantly influenced. During 2 oestrous cycles blood was taken daily of 8 cows and the concentration of progesterone (P4), dehydroepiandrosterone (DHA), androstenedione (AD), epitestosterone (Epi) and testosterone (T) in plasma was determined by radioimmunoassay (RIA). The average concentration of DHA in the blood of cows was 650±71 pg/ml, that of AD 77±8 pg/ml to 122±29 pg/ml (x-bar ± SD). The concentration of Epi and T was from 160 to 243 pg/ml and from 46 to 96 pg/ml plasma. For the pregnancy diagnosis in sows blood and faeces were collected of 6 non-pregnant and 30 pregnant animals day 16 to 30 after mating. In faeces the concentration of oestrogens was determined by means of RIA, in blood that of oestrone sulphate and P4 by EIA on micro titre plates. During the whole period of examination the concentration of P4 remained fairly constant. From day 17 to 23 after mating the concentration in non-pregnant was significantly lower than in pregnant sows. In the blood of non-pregnant sows the oestrone sulphate concentration was 1,3±1,2 ng/ml (x-bar ± SD). Day 24 to 30: >x-bar ± 2SD in pregnant animals. Day 25 and 29 of pregnancy the concentration of oestrogens in faeces was: >x-bar ± 2SD = 20,6 ng/g faeces. Pregnancy diagnosis: 21 non-pregnant cows and heifers, 6 bulls and 83 pregnant cows were examined (10th to 35th week of pregnancy). Faeces samples from 21 non-pregnant mares, 6 stallions and 57 pregnant mares (10th to 35th week) and 18 samples from 3 mares at parturition. 18th week of pregnancy the concentration of oestrogens in faeces of cows and mares was: (>x-bar ± 3SD) in non-pregnant animals; (cows: 21,6 ng/g, mares: 14,3 ng/g ) after parturition. 17 refs. (Author)

  11. The effect of dietary protein on reproduction in the mare. VII. Embryonic development, early embryonic death, foetal losses and their relationship with serum progestagen

    Directory of Open Access Journals (Sweden)

    F.E. Van Niekerk

    1998-07-01

    Full Text Available Sixty-four Thoroughbred and Anglo-Arab mares aged 6-12 years were randomly allocated to 4 dietary groups and fed diets that differed in the total protein content and quality (essential amino-acids. Forty mares were non-lactating and 24 lactating. Eight mares were withdrawn from the investigation owing to injuries or gynaecological pathology. An overall conception rate of 94.6%and a foaling rate of 80%was achieved. Five of 14 (35.7 % mares (Group 1 fed a low-quality protein diet suffered from early embryonic loss before 90 days of pregnancy compared to 3 of 41 (7.3 % mares in the remaining groups that received the higher-quality protein in their diets. Serum progestagen concentrations of mares in Group 1 that suffered foetal loss were indicative of luteal function insufficiency during the 1st 40 days post-ovulation. Non-lactating mares in all 4 groups gained on average approximately 30 kg in mass during the 90 days before the breeding period. Lactating mares in Group 1 (low-quality protein lost on average 25 kg in mass during lactation, with no weight loss observed among the lactating mares in the other 3 groups. No difference in the diameter of the embryonic vesicle was found between dietary groups until Day 35 of pregnancy.

  12. Vascular perfusion of reproductive organs in pony mares and heifers during sedation with detomidine or xylazine.

    Science.gov (United States)

    Araujo, Reno R; Ginther, O J

    2009-01-01

    To assess the vascular effects of detomidine and xylazine in pony mares and heifers, respectively, as determined in a major artery and by extent of vascular perfusion of reproductive organs. 10 pony mares and 10 Holstein heifers. Pony mares were assigned to receive physiologic saline (0.9% NaCl) solution (n = 5) or detomidine (3.0 mg/mare, IV; 5). Heifers were assigned to receive saline solution (5) or xylazine (14 mg/heifer, IM; 5). Color Doppler ultrasonographic examinations were performed immediately before and 10 minutes after administration of saline solution or sedative. In spectral Doppler mode, a spectral graph of blood flow velocities during a cardiac cycle was obtained at the internal iliac artery and at the ovarian pedicle. In color-flow mode, color signals of blood flow in vessels of the corpus luteum and endometrium were assessed. Systemic effects of sedation in the 2 species were evident as a decrease in heart rate; increase in duration of systole, diastole, or both; decrease in volume of blood flow; and decrease in velocity of blood flow within the internal iliac artery. However, an effect of sedatives on local vascular perfusion in the ovaries and endometrium was not detected. Sedation with detomidine in pony mares and xylazine in heifers did not affect vascular perfusion in reproductive organs. These sedatives can be used in experimental and clinical color Doppler evaluations of vascular perfusion of the corpus luteum and endometrium.

  13. Whole-genome sequencing and genetic variant analysis of a Quarter Horse mare.

    KAUST Repository

    Doan, Ryan; Cohen, Noah D; Sawyer, Jason; Ghaffari, Noushin; Johnson, Charlie D; Dindot, Scott V

    2012-01-01

    BACKGROUND: The catalog of genetic variants in the horse genome originates from a few select animals, the majority originating from the Thoroughbred mare used for the equine genome sequencing project. The purpose of this study was to identify genetic variants, including single nucleotide polymorphisms (SNPs), insertion/deletion polymorphisms (INDELs), and copy number variants (CNVs) in the genome of an individual Quarter Horse mare sequenced by next-generation sequencing. RESULTS: Using massively parallel paired-end sequencing, we generated 59.6 Gb of DNA sequence from a Quarter Horse mare resulting in an average of 24.7X sequence coverage. Reads were mapped to approximately 97% of the reference Thoroughbred genome. Unmapped reads were de novo assembled resulting in 19.1 Mb of new genomic sequence in the horse. Using a stringent filtering method, we identified 3.1 million SNPs, 193 thousand INDELs, and 282 CNVs. Genetic variants were annotated to determine their impact on gene structure and function. Additionally, we genotyped this Quarter Horse for mutations of known diseases and for variants associated with particular traits. Functional clustering analysis of genetic variants revealed that most of the genetic variation in the horse's genome was enriched in sensory perception, signal transduction, and immunity and defense pathways. CONCLUSIONS: This is the first sequencing of a horse genome by next-generation sequencing and the first genomic sequence of an individual Quarter Horse mare. We have increased the catalog of genetic variants for use in equine genomics by the addition of novel SNPs, INDELs, and CNVs. The genetic variants described here will be a useful resource for future studies of genetic variation regulating performance traits and diseases in equids.

  14. Whole-genome sequencing and genetic variant analysis of a Quarter Horse mare.

    KAUST Repository

    Doan, Ryan

    2012-02-17

    BACKGROUND: The catalog of genetic variants in the horse genome originates from a few select animals, the majority originating from the Thoroughbred mare used for the equine genome sequencing project. The purpose of this study was to identify genetic variants, including single nucleotide polymorphisms (SNPs), insertion/deletion polymorphisms (INDELs), and copy number variants (CNVs) in the genome of an individual Quarter Horse mare sequenced by next-generation sequencing. RESULTS: Using massively parallel paired-end sequencing, we generated 59.6 Gb of DNA sequence from a Quarter Horse mare resulting in an average of 24.7X sequence coverage. Reads were mapped to approximately 97% of the reference Thoroughbred genome. Unmapped reads were de novo assembled resulting in 19.1 Mb of new genomic sequence in the horse. Using a stringent filtering method, we identified 3.1 million SNPs, 193 thousand INDELs, and 282 CNVs. Genetic variants were annotated to determine their impact on gene structure and function. Additionally, we genotyped this Quarter Horse for mutations of known diseases and for variants associated with particular traits. Functional clustering analysis of genetic variants revealed that most of the genetic variation in the horse\\'s genome was enriched in sensory perception, signal transduction, and immunity and defense pathways. CONCLUSIONS: This is the first sequencing of a horse genome by next-generation sequencing and the first genomic sequence of an individual Quarter Horse mare. We have increased the catalog of genetic variants for use in equine genomics by the addition of novel SNPs, INDELs, and CNVs. The genetic variants described here will be a useful resource for future studies of genetic variation regulating performance traits and diseases in equids.

  15. Parental magmas of Mare Fecunditatis - Evidence from pristine glasses

    International Nuclear Information System (INIS)

    Jin, Y.; Taylor, L.A.

    1990-01-01

    Results are presented on the petrography and electron microprobe analyses of 14 discrete glass beads from the Luna 16 core sample (21036,15) from Mare Fecunditatis regolith, that were previously characterized as representing pristine glasses. Compared to Apollo pristine glasses analyzed by Delano (1986), the Luna 16 pristine glasses have higher CaO and Al2O3 contents but lower MgO and Ni. On the basis of their contents of MgO, FeO, Al2O3, and CaO, these pristine glasses could be divided into two groups, A and B. It is suggested that at least two parental magmas are needed to explain the chemical variations among these glasses. The Group B glasses appear to represent primitive parental magma that evolved by olivine fractionation to the compositions of the Luna 16 aluminous mare basalts, whereas the Group A volcanic glasses may represent an unusual new basalt magma type that contains a high plagioclase component. 14 refs

  16. Hielke Miguel Haak Mares

    Directory of Open Access Journals (Sweden)

    Leonardo Romero

    2013-06-01

    Full Text Available El 25 de junio de 2004 falleció el Dr. Hielke Haak, un destacado colega que fue muy considerado no sólo por su trayectoria académica sino además por su calidad personal. Hielke Miguel Haak Mares nació el 21 de mayo de 1948 y luego de seguir sus estudios en nuestra Alma Mater, en 1974 obtuvo el Grado Acadé- mico de Bachiller en Biología, luego en 1975 obtuvo el Título Profesional de Biólogo y en 1976 el Grado Académico de Magíster en Bioquímica, siendo becario de la Fundación Kellogg. Posteriormente en 1989 se graduó de Doctor en Ciencias Biológicas.

  17. Comparative analysis of some serum proteins and immunoglobulin G concentration in the blood of Yugoslav Trotter mares and newborn foals

    Directory of Open Access Journals (Sweden)

    Lauš S.

    2012-01-01

    Full Text Available The comparison of some serum protein concentrations was performed on 12 Yugoslav Trotter mares and their newborn foals. The mares included in the evaluation were divided into two groups of 6 each. The mares in the first group were vaccinated against equine herpes virus 1 and 4, in the 5th, 7th and 9th month of pregnancy, while mares in the second group were not vaccinated at all. Pregnant mares were clinically observed during the last stage of pregnancy and blood for biochemical evaluations was sampled immediately after foaling. Foals were clinically observed for seven days after birth and blood samples were collected immediately after foaling (before nursing, and 24, 48, 72 and 168 hours after birth. Foals included in the evaluation were divided into two groups according to the group allocation of the respective mares. All mares gave birth to normal foals in expected terms. Biochemical examination revealed slightly lower total gammaglobulin and IgG values in tested mares compared to the values obtained in other horse breeds. The antibody titres against equine herpes virus-1 reached the level that provides sufficient protection in vaccinated mares. Gammaglobulin and traces of IgG were present in the blood serum of foals tested immediately after birth and before nursing. A significant increase of IgG and gammaglobulin concentration was revealed in all foals after the first 24 hours of life. The observed first day increase of concentration was followed by stagnation of gammaglobulin and IgG levels in all foals. Total protein values showed a significant increase 24 hours after the first intake of colostrum in all foals. Immunoglobulin G concentration established by semiquantitative test was considered low positive in 16.67% and in 33.34% of foals from vaccinated and unvaccinated mares, respectively. Turbidimetric analyses of the same samples revealed sufficient Ig transfer, i.e. Ig concentration over 8 g/L. Comparison of the results obtained by the

  18. Breed and species comparison of amino acid transport variation in equine erythrocytes.

    Science.gov (United States)

    Fincham, D A; Young, J D; Mason, D K; Collins, E A; Snow, D H

    1985-05-01

    The amino acid permeability of red blood cells from Equus caballus (thoroughbred, Arab, shire and pony), E przewalskii (Przewalski's horse), E asinus (donkey and mule) and E burchelli (common or plains zebra) was measured. Individual animals exhibited stable but widely differing rates of L-[U-14C]alanine uptake in the range 5 to 1554 mumol (litre cells)-1 h-1 (0.2 mM extracellular L-alanine, 37 degrees C). Of the thoroughbreds tested, 30 per cent had red blood cells which were essentially impermeable to L-alanine (5 to 10 mumol (litre cells)-1 h-1, giving transport rates similar to those found previously in amino acid transport-deficient sheep erythrocytes. In contrast, only 3 per cent of the ponies tested had red blood cells impermeable to L-alanine. No cases of erythrocyte amino acid transport deficiency were found in the other horse breeds and species tested.

  19. Lactate turnover in fast-moving vertebrates: The control of plasma metabolite fluxes

    Energy Technology Data Exchange (ETDEWEB)

    Weber, J.M.

    1987-01-01

    The goals of this thesis were: (1) to investigate the major factors involved in the regulation of plasma metabolite turnover at the whole-organism level-using lactate as a model, and (2) to determine whether endurance-adapted animals can support higher lactate turnover rates than sedentary animals. Lactate turnover was measured by bolus injection of (U{sup {minus}14}C)lacetate in skipjack tuna, Katsuwonus pelamis, and in thoroughbred race horses, Equus caballus. In tuna, turnover rates ranged from 112 to 431 umol min{sup {minus}1} kg{sup {minus}1}, and they were positively correlated with (lactate). These rates were higher than expected for a mammal of equivalent size. Plots of resting lactate and glucose turnover rates vs body mass on a log-log scale were linear for a wide range mammalian body sizes, and they showed the same slope as the classic body mass vs metabolic rate relationship.

  20. A new record of Equus (Mammalia: Equidae from the Late Pleistocene of central-south Chile Un nuevo registro de Equus (Mammalia: Equidae para el Pleistoceno Superior de Osorno, Chile

    Directory of Open Access Journals (Sweden)

    OMAR P RECABARREN

    2011-12-01

    Full Text Available Fourteen dental and bone parts of a horse excavated from the Pilauco paleontological site, Osorno (40°39' S-73°07' W are analysed and interpreted. This site was formed in association with a peat bog located on the banks of the old Damas River and has conserved abundant late Pleistocene mammalian fauna and flora materials. A date of 11457 ± 140 14C yrs B.P. was obtained from a molar and agrees with our stratigraphic age model. We have identified the fossils as pertaining to the species Equus (Amerhippus andium, which confirms its presence in central-south Chile. Furthermore, the recorded geographic location indicate that the metapodial adaptations of the specimens previously described agree with the reconstructed late Pleistocene landscape of Pilauco, dominated by soft volcanic soils and isolated forest patches over large extensions of grasslands.Se analizan e interpretan 14 fósiles correspondientes a dientes y huesos de caballo registrados en el sitio Pilauco, Osorno (40°39' S-73°07' W. El sitio se formó asociado a un pantano en un borde del antiguo río Damas; en él se ha conservado abundante material de mastofauna y flora pleistocénica. Una fecha radiocarbónica de 11457 ± 140 A.P obtenida de un molar, es concordante con el modelo de edad del sitio. La identificación taxonómica permite asociar a los fósiles a la especie Equus (Amerhippus andium, lo que confirma la presencia de la especie en el centro-sur de Chile. Por otra parte, la posición geográfica de los hallazgos y la reconstrucción del paisaje indicarían que se trata de ejemplares cuyas adaptaciones en los metapodios son concordantes para el paisaje pleistocénico de Pilauco dominado por suelos volcánicos blandos, con presencia de bosquetes dispersos en grandes extensiones de praderas de gramíneas.

  1. Perioperative risk factors for mortality and length of hospitalization in mares with dystocia undergoing general anesthesia: A retrospective study

    Science.gov (United States)

    Rioja, Eva; Cernicchiaro, Natalia; Costa, Maria Carolina; Valverde, Alexander

    2012-01-01

    This study investigated associations between perioperative factors and probability of death and length of hospitalization of mares with dystocia that survived following general anesthesia. Demographics and perioperative characteristics from 65 mares were reviewed retrospectively and used in a risk factor analysis. Mortality rate was 21.5% during the first 24 h post-anesthesia. The mean ± standard deviation number of days of hospitalization of surviving mares was 6.3 ± 5.4 d. Several factors were found in the univariable analysis to be significantly associated (P dystocia, intraoperative hypotension, and drugs used during recovery. Type of delivery and day of the week the surgery was performed were significantly associated with length of hospitalization in the multivariable mixed effects model. The study identified some risk factors that may allow clinicians to better estimate the probability of mortality and morbidity in these mares. PMID:23115362

  2. Remote sensing of potential lunar resources. 2: High spatial resolution mapping of spectral reflectance ratios and implications for nearside mare TiO2 content`

    Science.gov (United States)

    Melendrez, David E.; Johnson, Jeffrey R.; Larson, Stephen M.; Singer, Robert B.

    1994-01-01

    High spatial resolution maps illustrating variations in spectral reflectance 400/560 nm ratio values have been generated for the following mare regions: (1) the border between southern Mare Serenitatis and northern Mare Tranquillitatis (including the MS-2 standard area and Apollo 17 landing site), (2) central Mare Tranquillitatis, (3) Oceanus Procellarum near Seleucus, and (4) southern Oceanus Procellarum and Flamsteed. We have also obtained 320-1000 nm reflectance spectra of several sites relative to MS-2 to facilitate scaling of the images and provide additional information on surface composition. Inferred TiO2 abundances for these mare regions have been determined using an empirical calibration which relates the weight percent TiO2 in mature mare regolith to the observed 400/560 nm ratio. Mare areas with high TiO2 abundances are probably rich in ilmenite (FeTiO3) a potential lunar resource. The highest potential TiO2 concentrations we have identified in the nearside maria occur in central Mare Tranquillitatis. Inferred TiO2 contents for these areas are greater than 9 wt% and are spatially consistent with the highest-TiO2 regions mapped previously at lower spatial resolution. We note that the morphology of surface units with high 400/560 nm ratio values increases in complexity at higher spatial resolutions. Comparisons have been made with previously published geologic maps, Lunar Orbiter IV, and ground-based images, and some possible morphologic correlatins have been found between our mapped 400/560 nm ratio values and volcanic landforms such as lava flows, mare domes, and collapse pits.

  3. Positiivsust saab õppida / Mare Pork ; intervjueerinud Signe Rummo ; kommenteerinud Toivo Aavik

    Index Scriptorium Estoniae

    Pork, Mare, 1950-

    2014-01-01

    Intervjuu Tallinna Ülikooli psühholoogiaprofessor Mare Porkiga positiivsest psühholoogiast ja raamatust Boniwell, Ilona. Positiivne psühholoogia : tõhusa toimimise põhitõed. Tallinn : Äripäev, 2014.

  4. Influence of atipamezole on effects of midsacral subarachnoidally administered detomidine in mares.

    Science.gov (United States)

    Skarda, R T; Muir, W W

    1998-04-01

    To examine effects of atipamezole on detomidine midsacral subarachnoidally-induced analgesia, cardiovascular and respiratory activity, head ptosis, and position of pelvic limbs in healthy mares. 10 healthy mares. Using a randomized, blinded, crossover study design, mares received detomidine (0.03 mg/kg of body weight, diluted in 3 ml of CSF) midsacral subarachnoidally, followed by atipamezole (0.1 mg/kg [test]) or sterile saline (0.9% NaCl) solution (control), i.v. 61 minutes later and saline solution (3 ml, midsacral subarachnoidally) on a separate occasion, at least 2 weeks later. Analgesia was determined by lack of sensory perception to electrical stimulation at the perineal dermatome and no response to needle-prick stimulation extending from the coccygeal to T15 dermatomes. Arterial acid-base (pH, standard bicarbonate, and base excess values), gas tensions (PO2, PCO2), PCV, total solids concentration, heart and respiratory rates, rectal temperature, and arterial blood pressure were determined, and mares were observed for sweating and urination. Mean scores of perineal analgesia, head ptosis, position of pelvic limbs, and cardiovascular and respiratory data were compared for the 3-hour test period. Subarachnoidally administered detomidine induced perineal analgesia (mean +/- SD onset, 9.0 +/- 4.6 minutes; duration, 130 +/- 26 minutes), marked head ptosis, moderate changes in pelvic limb position, cardiovascular and respiratory depression, sweating in analgesic zones, and diuresis. Intravenously administered atipamezole significantly reduced mean scores of detomidine-induced perineal analgesia, head ptosis, pelvic limb position, sweating and diuresis; partially antagonized detomidine-induced bradycardia; and did not effect detomidine-induced bradypnea. Most effects of midsacral subarachnoidally administered detomidine, except bradycardia and bradypnea, were reversed by atipamezole (0.1 mg/kg, i.v.), indicating that most of the actions of detomidine were mediated

  5. Revised shallow and deep water-level and storage-volume changes in the Equus Beds Aquifer near Wichita, Kansas, predevelopment to 1993

    Science.gov (United States)

    Hansen, Cristi V.; Lanning-Rush, Jennifer L.; Ziegler, Andrew C.

    2013-01-01

    Beginning in the 1940s, the Wichita well field was developed in the Equus Beds aquifer in southwestern Harvey County and northwestern Sedgwick County to supply water to the city of Wichita. The decline of water levels in the aquifer was noted soon after the development of the Wichita well field began. Development of irrigation wells began in the 1960s. City and agricultural withdrawals led to substantial water-level declines. Water-level declines enhanced movement of brines from past oil and gas activities near Burrton, Kansas and enhanced movement of natural saline water from the Arkansas River into the well field area. Large chloride concentrations may limit use or require the treatment of water from the well field for irrigation or public supply. In 1993, the city of Wichita adopted the Integrated Local Water Supply Program (ILWSP) to ensure an adequate water supply for the city through 2050 and as part of its effort to effectively manage the part of the Equus Beds aquifer it uses. ILWSP uses several strategies to do this including the Equus Beds Aquifer Storage and Recovery (ASR) project. The purpose of the ASR project is to store water in the aquifer for later recovery and to help protect the aquifer from encroachment of a known oilfield brine plume near Burrton and saline water from the Arkansas River. As part of Wichita’s ASR permits, Wichita is prohibited from artificially recharging water into the aquifer in a Basin Storage area (BSA) grid cell if water levels in that cell are above the January 1940 water levels or are less than 10 feet below land surface. The map previously used for this purpose did not provide an accurate representation of the shallow water table. The revised predevelopment water-level altitude map of the shallow part of the aquifer is presented in this report. The city of Wichita’s ASR permits specify that the January 1993 water-level altitudes will be used as a lower baseline for regulating the withdrawal of artificial rechage

  6. Lava flows in mare imbrium: An evaluation of anomalously low earth-based radar reflectivity

    Science.gov (United States)

    Schaber, G.G.; Thompson, T.W.; Zisk, S.H.

    1975-01-01

    The lunar maria reflect two to five times less Earth-based radar power than the highlands, the spectrally blue maria surfaces returning the lowest power levels. This effect of weakening signal return has been attributed to increased signal absorption related to the electrical and magnetic characteristics of the mineral ilmenite (FeTiO3). The surface of Mare Imbrium contains some of the most distinct red-blue colorimetric boundaries and depolarized 70 cm wavelength reflectivity variations on the near side of the Moon. The weakest levels of both 3.8 cm and 70 cm reflectivity within Imbrium are confined to regional mare surfaces of the blue spectral type that can be recognized as stratigraphically unique flow surfaces. Frequency distributions of the 70 cm polarized and depolarized radar return power for five mare surfaces within the basin indicate that signal absorption, and probably the ilmenite content, increases generally from the beginning of the Imbrian Period to the end of the Eratosthenian Period with slight reversal between the end of the Imbrian and beginning of the Eratosthenian. TiO2 calibrated radar reflectivity curves can be utilized for lunar maria geochemical mapping in the same manner as the TiO2 calibrated spectral reflectivity curves of Charette et al. (1974). The long wavelength radar data may be a sensitive indicator of mare chemical variations as it is unaffected by the normal surface rock clutter that includes ray materials from large impact craters. ?? 1975 D. Reidel Publishing Company.

  7. Protocols for collection of streamflow, water-quality, streambed-sediment, periphyton, macroinvertebrate, fish, and habitat data to describe stream quality for the Hydrobiological Monitoring Program, Equus Beds Aquifer Storage and Recovery Program, city of Wichita, Kansas

    Science.gov (United States)

    Stone, Mandy L.; Rasmussen, Teresa J.; Bennett, Trudy J.; Poulton, Barry C.; Ziegler, Andrew C.

    2012-01-01

    The city of Wichita, Kansas uses the Equus Beds aquifer, one of two sources, for municipal water supply. To meet future water needs, plans for artificial recharge of the aquifer have been implemented in several phases. Phase I of the Equus Beds Aquifer Storage and Recovery (ASR) Program began with injection of water from the Little Arkansas River into the aquifer for storage and subsequent recovery in 2006. Construction of a river intake structure and surface-water treatment plant began as implementation of Phase II of the Equus Beds ASR Program in 2010. An important aspect of the ASR Program is the monitoring of water quality and the effects of recharge activities on stream conditions. Physical, chemical, and biological data provide the basis for an integrated assessment of stream quality. This report describes protocols for collecting streamflow, water-quality, streambed-sediment, periphyton, macroinvertebrate, fish, and habitat data as part of the city of Wichita's hydrobiological monitoring program (HBMP). Following consistent and reliable methods for data collection and processing is imperative for the long-term success of the monitoring program.

  8. A COMPARATIVE ANALYSIS OF MANAGERIAL COMPETENCIES BASED ON EVIDENCE FROM SATU MARE COUNTY, ROMANIA

    Directory of Open Access Journals (Sweden)

    Olimpia Neagu

    2014-12-01

    Full Text Available The paper explores the managerial competencies of human resources in the companies from Satu Mare County, by comparing the employers' and employees' views. The comparison is based on data collected and processed within the project HURO/0901/264/2.2.2 implemented in partnership by "Vasile Goldiș" Western University and University of Debrecen and financed by European Union through ERDF under Hungary-Romania 2007-2013 Programme, in 2012, and on data collected and processed in 2013-2014, in a new field research applied to employees from Satu Mare county.

  9. Mare Risk Analysis monitor; Monitor de analisis de riesgos mare

    Energy Technology Data Exchange (ETDEWEB)

    Fuente Prieto, I.; Alonso, P.; Carretero Fernandino, J. A. [Empresarios Agrupados, A. I.E. Madrid (Spain)

    2000-07-01

    The Nuclear Safety Council's requirement that Spanish power plants comply with the requirements of the Maintenance Rule associated with plant risk assessment during power operation, arising from the partial unavailability of systems due to the maintenance activities, has led to need for additional tools to facilitate compliance with said requirements. While the impact on risk produced by individual equipment unavailabilities can easily be evaluated, either qualitatively or quantitatively, the process becomes more complicated when un programmed unavailabilities simultaneously occur in various systems, making it necessary to evaluate their functional impact. It is especially complex in the case of support systems that can affect the functionality of multiple systems. In view of the above, a computer application has been developed that is capable of providing the operator with quick answers based on the specific plant model in order to allow fast risk assessment using the information compiled as part of the Probabilistic Safety Analysis. The paper describes the most important characteristics of this application and the basic design requirements of the MARE Risk Monitor. (Author)

  10. THE IMPORTANCE OF TECHNICAL INFRASTRUCTURE IN TERRITORY. CASE STUDY: DRINKING WATER SUPPLY IN DÂNGĂU MARE, CLUJ COUNTY

    Directory of Open Access Journals (Sweden)

    M. ALEXE

    2011-03-01

    Full Text Available The importance of technical infrastructure in territory. Case study: drinking water supply in Dângău Mare, Cluj County. Water represents an important element in life. Accessibility, water quantity and quality show the standard of living of one community. This article presents a case study, the one of water supply in Dângău Mare from Cluj County. The purpose of this analysis is to reveal the benefits of applying some measures regarding water supply in the rural area, as well as the dysfunction abilities which derive from a bad management (eg. lack of sewage system. Dângău Mare lies near the Gilău Mountains and possesses important and rich resources of surface and underground waters varying under qualitative ratio. The hydrological resources of Dângău Mare are made up of river/rivulet networks (Mireş, Blidaru, Agârbiciu, phreatic waters and natural springs. The identification and delimitation of the Dângău Mare territory represents the first stage of this study, followed by the consultation of bibliographic and cartographic sources, field surveys, to obtain the qualitative and quantitative pieces of information. The second stage consists in the analyzation and classification of information, the integrated study of phenomena and elaboration of cartographic models using GIS. At the end of this study we have made the SWOT analysis to emphasize the characteristics of favourability, the anomalies and the opportunities to improve and develop the territory of Dângău Mare from Cluj County.

  11. Rb-Sr and Sm-Nd chronology and genealogy of mare basalts from the Sea of Tranquility

    Science.gov (United States)

    Papanastassiou, D. A.; Depaolo, D. J.; Wasserburg, G. J.

    1977-01-01

    Rb-Sr and Sm-Nd ages of two Apollo 11 mare basalts, high-K basalt 10072 and low-K basalt 10062, are reported. Rb-Sr, Sm-Nd, and Ar-40-Ar-39 ages are in good agreement and indicate an extensive time interval for filling of the Sea of Tranquility, presumably by thin lava flows, in agreement with similar observations for the Ocean of Storms. Initial Sr and Nd isotopic compositions on Apollo 11 basalts reveal at least two parent sources producing basalts. The Sm-Nd isotopic data demonstrate that low-K and high-Ti basalts from Apollo 11 and 17 derived from distinct reservoirs, while low-Ti Apollo 15 mare basalt sources have Sm/Nd similar to the sources of Apollo 11 basalts. Groupings of mare basalt based on Ti content and on isotopic data do not coincide.

  12. Progesterone levels and days to luteolysis in mares treated with intrauterine fractionated coconut oil.

    Science.gov (United States)

    Diel de Amorim, Mariana; Nielsen, Kayla; Cruz, Raissa Karolliny Salgueiro; Card, Claire

    2016-07-15

    Intrauterine plant oil infusion, including fractionated coconut oil, has been previously found to be a safe, inexpensive, and reversible method of prolonging the luteal phase in mares when administered on Day 10 of the estrous cycle. Our objective was to understand the uteroovarian response to the administration of fractionated coconut oil infusion in the uterus of diestrous mares. We hypothesized that intrauterine coconut oil administration on Day 10 would prolong luteal life span in a dose-dependent fashion and would result in higher serum progesterone levels than untreated mares at the expected time of luteolysis. Light-horse mares (n = 18) were examined using transrectal palpation and ultrasonography to determine if they had a normal interovulatory interval and were then examined daily in estrus until the day of ovulation (Day 0) and then every other day during an estrous cycle. Jugular blood was drawn on Day 11, Day 13, Day 15, and Day 17, centrifuged, and serum stored until assayed for progesterone (P4; Siemens Coat-a-Count Progesterone RIA, Los Angeles, CA, USA). Mares were randomly assigned to treatment and studied over one to two estrous cycles with a rest cycle after each treatment cycle. Groups were: control (n = 5), fractionated coconut oil 1.0 mL (Miglyol 810; Sasol Oil, Witten, Germany) infused in the uterus with an artificial insemination pipette on Day 10 (Group 1; n = 5) and fractionated coconut oil 0.5 mL infused in the uterus with an embryo transfer gun, on Day 10 (Group 2; n = 5). All statistical analyses were performed using analytical software (Stata SE, version 13.1, College Station, TX, USA) at P < 0.05. Data were first evaluated using the Shapiro-Wilk test for normality. Differences between groups in days to luteolysis (DTL) were examined using analysis of variance and Bonferroni, and the effect of day and treatment on P4 levels were examined using the Kruskal-Wallis and Dunn's all pairwise test. There was a significant

  13. A Ground-Based Comparison of the Muscle Atrophy Research and Exercise System (MARES) and a Standard Isokinetic Dynamometer

    Science.gov (United States)

    Hackney, K. J.; English, K. L.; Redd, E.; DeWitt, J. K.; Ploutz-Snyder, R.; Ploutz-Snyder, L. L.

    2010-01-01

    PURPOSE: 1) To compare the test-to-test reliability of Muscle Atrophy Research and Exercise System (MARES) with a standard laboratory isokinetic dynamometer (ISOK DYN) and; 2) to determine if measures of peak torque and total work differ between devices. METHODS: Ten subjects (6M, 4F) completed two trials on both MARES and an ISOK DYN in a counterbalanced order. Peak torque values at 60 deg & 180 deg / s were obtained from five maximal repetitions of knee extension (KE) and knee flexion (KF). Total work at 180 deg / s was determined from the area under the torque vs. displacement curve during twenty maximal repetitions of KE and KF. Reliability of measures within devices was interpreted from the intraclass correlation coefficient (ICC) and compared between devices using the ratio of the within-device standard deviations. Indicators of agreement for the two devices were evaluated from: 1) a calculation of concordance (rho) and; 2) the correlation between the mean of measures versus the delta difference between measures (m u vs delta). RESULTS: For all outcome measures ICCs were high for both the ISOK DYN (0.95-0.99) and MARES (0.90-0.99). However, ratios of the within-device standard deviation were 1.3 to 4.3 times higher on MARES. On average, a wide range (3.3 to 1054 Nm) of differences existed between the values obtained. Only KE peak torque measured at 60 deg & 180 deg / s showed similarities between devices (rho = 0.91 & 0.87; Pearson's r for m u vs delta = -0.22 & -0.37, respectively). CONCLUSION: Although MARES was designed for use in microgravity it was quite reliable during ground-based testing. However, MARES was consistently more variable than an ISOK DYN. Future longitudinal studies evaluating a change in isokinetic peak torque or total work should be limited within one device.

  14. 33 CFR 117.169 - Mare Island Strait and the Napa River.

    Science.gov (United States)

    2010-07-01

    ... Strait and the Napa River. (a) The draw of the Mare Island Drawbridge, mile 2.8, at Vallejo shall open on... may contact the City of Vallejo via the same telephone number to schedule drawspan operation. (b) The...

  15. Electrocardiography of Grevy's zebras (Equus grevyi).

    Science.gov (United States)

    Myers, Debbie A; Citino, Scott; Mitchell, Mark A

    2008-09-01

    Electrocardiograms (ECGs) are a good baseline test for assessing cardiac rhythm. ECGs have not been reported in any zebra species and in very few Perissodactyla species. Standard limb, six-lead ECGs were recorded in 23 anesthetized Grevy's zebras (Equus grevyi). Heart rate, RR interval, P-wave duration, RR maximum/minimum, PR interval, QRS duration, QT interval, ST segment deviation, P-wave amplitude, QRS amplitude, and T-wave amplitude were measured and calculated from lead II ECGs from these Grevy's zebras. Several variables were tested, including gender, age (0-24, 24-48, 48-180, and >180 mo), weight (350 kg), pregnancy status, and anesthetic differences (standard dose or supplemented dose), to see if they affected ECG values in these animals. There were no significant differences in any of the ECG parameters between genders. RR and QT intervals were longer in older zebras; heart rates were faster in younger zebras. The RR and PR intervals, as well as the QRS duration, were greater in heavier zebras; heart rates were faster in lighter zebras. The RR interval was significantly longer in pregnant zebras. There were no significant differences in any of the ECG parameters for zebras anesthetized with a standardized dose of the drug combination etorphine-detomidine-acepromazine compared to those receiving additional supplements of these drugs and/or ketamine. All other parameters were not significantly different among groups, except where noted previously. The results of this research indicate that differences in ECG parameters in zebras may occur between animals of different ages, weights, and pregnancy status and that these factors should be considered when interpreting the respective ECGs of these zebras.

  16. Identification of dipeptidyl peptidase-IV inhibitory peptides from mare whey protein hydrolysates.

    Science.gov (United States)

    Song, J J; Wang, Q; Du, M; Ji, X M; Mao, X Y

    2017-09-01

    Inhibition of dipeptidyl peptidase-IV (DPP-IV) activity is a promising strategy for treatment of type 2 diabetes. In the current study, DPP-IV inhibitory peptides were identified from mare whey protein hydrolysates obtained by papain. The results showed that all the mare whey protein hydrolysates obtained at various hydrolysis durations possessed more potent DPP-IV inhibitory activity compared with intact whey protein. The 4-h hydrolysates showed the greatest DPP-IV inhibitory activity with half-maximal inhibitory concentration of 0.18 mg/mL. The 2 novel peptides from 4-h hydrolysate fractions separated by successive chromatographic steps were characterized by liquid chromatography-electrospray ionization tandem mass spectrometry. The novel peptides Asn-Leu-Glu-Ile-Ile-Leu-Arg and Thr-Gln-Met-Val-Asp-Glu-Glu-Ile-Met-Glu-Lys-Phe-Arg, which corresponded to β-lactoglobulin 1 f(71-77) and β-lactoglobulin 1 f(143-155), demonstrated DPP-IV inhibitory activity with half-maximal inhibitory concentrations of 86.34 and 69.84 μM, respectively. The DPP-IV inhibitory activity of the 2 peptides was retained or even improved after simulated gastrointestinal digestion in vitro. Our findings indicate that mare whey protein-derived peptides may possess potential as functional food ingredients in the management of type 2 diabetes. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  17. Effect of the South African asinine-94 strain of equine arteritis virus (EAV) in pregnant donkey mares and duration of maternal immunity in foals.

    Science.gov (United States)

    Paweska, J T

    1997-06-01

    Clinical, virological and serological responses were investigated in five pregnant donkey mares after experimental exposure to the South African asinine-94 strain of equine arteritis virus (EAV), and the duration of maternal immunity to EAV was studied in their foals. In four intranasally inoculated mares, fever with maximum rectal temperatures of 39.1-40.7 degrees C was recorded 2-11 d after challenge. All the inoculated mares developed mild depression, and a serous ocular and nasal discharge; in three mares mild conjuctivitis was observed. The virus was recovered from the nasopharynx and from buffy-coat samples of all the mares 3-10 d, and 2-18 d post inoculation (p.i.), respectively. Seroconversion to EAV was detected on days 8-10 p.i. Peak serum-virus-neutralizing antibody titres of log10 1.8-2.4, and IgG ELISA OD values of 0.85-2.15 were recorded 2-3 weeks p.i. The in-contact (p.c.) control mare developed fever on days 15-19 post exposure, and showed mild clinical signs of equine viral arteritis similar to those observed in the inoculated mares. Seroconversion to EAV was detected in the p.c. mare on day 20 post exposure, and virus was isolated from nasal swabs and blood samples collected at the time of the febrile response and 1-3 d afterwards. None of the mares aborted. After they had given normal birth 45-128 d p.i. or after p.c. exposure, no virus could be isolated from their placentas. The concentration of EAV-neutralizing antibody in colostrum was two to eight times higher than in serum samples collected at the time of parturition. All the foals born to infected mares were clinically normal at the time of birth and throughout the subsequent 1-2 months of observation. No EAV was recovered from the buffy-coat fraction of blood samples collected at birth nor from those collected on days 1, 2 and 7 after birth. Also, no virus-serum-neutralizing or IgG ELISA antibody to EAV was detected in sera collected immediately after birth before the foals started nursing

  18. Visual attention, an indicator of human-animal relationships? A study of domestic horses (Equus caballus

    Directory of Open Access Journals (Sweden)

    Céline eRochais

    2014-02-01

    Full Text Available As visual attention is an intrinsic part of social relationships, and because relationships are built on a succession of interactions, their establishment involves learning and attention. The emotional, rewarding or punishing, content can modulate selective attention. In horses, the use of positive/negative reinforcement during training determines short and long-term human-horse relationships. In a recent study in horses, where either food or withers’ grooming were used as a reward, it appeared that only the food-rewarded horses learned the task and show better relationship with humans. In the present study, we hypothesized that this differential effect of grooming/food rewards on learning performances could be due to attentional processes. Monitoring, gazes and behaviors directed towards the trainer revealed that the use of a food reward (FR as positive reinforcement increased horses’ selective attention towards their trainer. Conversely, horses trained with grooming reward (GR expressed more inattentive responses and did not show a decrease of agitated behavior. However, individual plotting of attention versus rate of learning performances revealed a complex pattern. Thus, while all FR horses showed a window of attention related to faster learning performances, GR horses’ pattern followed an almost normal curve where the extreme animals (i.e. highest and lowest attention had the slowest learning performances. On the other hand, learning was influenced by attention: at the end of training, the more attentive horses had also better learning performances. This study, based on horses, contributes to the general debates on the place of attentional processes at the interface of emotion and cognition and open new lines of thought about individual sensitivities (only individuals can tell what an appropriate reward is, attentional processes and learning.

  19. Analysis of Horse Myostatin Gene and Identification of Single Nucleotide Polymorphisms in Breeds of Different Morphological Types

    Directory of Open Access Journals (Sweden)

    Stefania Dall'Olio

    2010-01-01

    Full Text Available Myostatin (MSTN is a negative modulator of muscle mass. We characterized the horse (Equus caballus MSTN gene and identified and analysed single nucleotide polymorphisms (SNPs in breeds of different morphological types. Sequencing of coding, untranslated, intronic, and regulatory regions of MSTN gene in 12 horses from 10 breeds revealed seven SNPs: two in the promoter, four in intron 1, and one in intron 2. The SNPs of the promoter (GQ183900:g.26T>C and GQ183900:g.156T>C, the latter located within a conserved TATA-box like motif were screened in 396 horses from 16 breeds. The g.26C and the g.156C alleles presented higher frequency in heavy (brachymorphic type than in light breeds (dolichomorphic type such as Italian Trotter breed. The significant difference of allele frequencies for the SNPs at the promoter and analysis of molecular variance (AMOVA on haplotypes indicates that these polymorphisms could be associated with variability of morphology traits in horse breeds.

  20. Species identification in meat products: A new screening method based on high resolution melting analysis of cyt b gene.

    Science.gov (United States)

    Lopez-Oceja, A; Nuñez, C; Baeta, M; Gamarra, D; de Pancorbo, M M

    2017-12-15

    Meat adulteration by substitution with lower value products and/or mislabeling involves economic, health, quality and socio-religious issues. Therefore, identification and traceability of meat species has become an important subject to detect possible fraudulent practices. In the present study the development of a high resolution melt (HRM) screening method for the identification of eight common meat species is reported. Samples from Bos taurus, Ovis aries, Sus scrofa domestica, Equus caballus, Oryctolagus cuniculus, Gallus gallus domesticus, Meleagris gallopavo and Coturnix coturnix were analyzed through the amplification of a 148 bp fragment from the cyt b gene with a universal primer pair in HRM analyses. Melting profiles from each species, as well as from several DNA mixtures of these species and blind samples, allowed a successful species differentiation. The results demonstrated that the HRM method here proposed is a fast, reliable, and low-cost screening technique. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Analysis of Horse Myostatin Gene and Identification of Single Nucleotide Polymorphisms in Breeds of Different Morphological Types

    Science.gov (United States)

    Dall'Olio, Stefania; Fontanesi, Luca; Nanni Costa, Leonardo; Tassinari, Marco; Minieri, Laura; Falaschini, Adalberto

    2010-01-01

    Myostatin (MSTN) is a negative modulator of muscle mass. We characterized the horse (Equus caballus) MSTN gene and identified and analysed single nucleotide polymorphisms (SNPs) in breeds of different morphological types. Sequencing of coding, untranslated, intronic, and regulatory regions of MSTN gene in 12 horses from 10 breeds revealed seven SNPs: two in the promoter, four in intron 1, and one in intron 2. The SNPs of the promoter (GQ183900:g.26T>C and GQ183900:g.156T>C, the latter located within a conserved TATA-box like motif) were screened in 396 horses from 16 breeds. The g.26C and the g.156C alleles presented higher frequency in heavy (brachymorphic type) than in light breeds (dolichomorphic type such as Italian Trotter breed). The significant difference of allele frequencies for the SNPs at the promoter and analysis of molecular variance (AMOVA) on haplotypes indicates that these polymorphisms could be associated with variability of morphology traits in horse breeds. PMID:20706663

  2. PREGNANCY LOSS IN MARES

    Directory of Open Access Journals (Sweden)

    Tibary A

    2015-12-01

    Full Text Available Pregnancy loss is an important aspect of equine practice due to the economic and emotional loss that it engenders. Pregnancy loss is often divided in two categories: early pregnancy loss (EPL or embryonic death (ED (first 42 days and fetal losses (after 42 days. Diagnosis of the causes of pregnancy loss is often very challenging. Many of the causes of EPL remain poorly documented but studies on embryo development and embryo-uterine interaction have been able to shed some light on predisposing factors. Fetal losses or abortions are dominated by infectious causes and particularly bacterial placentitis. Detailed reviews of pregnancy loss were recently published by the authors (Tibary et al., 2012; Tibary and Pearson, 2012; Tibary et al., 2014. The objective of this paper is to provide an overview of the epidemiology, etiology, diagnosis and prevention of pregnancy loss in the mare.

  3. Relationship between colour flow Doppler sonographic assessment of corpus luteum activity and progesterone concentrations in mares after embryo transfer.

    Science.gov (United States)

    Brogan, P T; Henning, H; Stout, T A E; de Ruijter-Villani, M

    2016-03-01

    Colour-flow Doppler sonography has been described as a means of assessing corpus luteum (CL) function rapidly, because area of luteal blood vessels correlates well with circulating progesterone (P4) concentrations [P4] in oestrous cycling mares. The aim of this study was to assess the relationships between CL size and vascularity, and circulating [P4] during early pregnancy in mares, and to determine whether luteal blood flow was a useful aid for selecting an embryo transfer recipient. Equine embryos (n=48) were recovered 8 days after ovulation and were transferred to available recipient mares as part of a commercial program with the degree of synchrony in timing of recipient ovulation ranging from 1 day before to 4 days after the donor. Immediately prior to embryo transfer (ET), maximum CL cross-section and blood vessel areas were assessed sonographically, and jugular blood was collected to measure plasma [P4]. Sonographic measurements and jugular blood collection were repeated at day 4 after ET for all mares, and again at days 11, 18 and 25 after ET in mares that were pregnant. The number of grey-scale and colour pixels within the CL was subsequently quantified using ImageJ software. The CL blood flow correlated significantly but weakly with plasma [P4] on the day of transfer and on day 4 after ET in all mares, and on days 11 and 25 after ET in pregnant mares (r=0.30-0.36). The CL area and plasma [P4] were also correlated on each day until day 11 after ET (r=0.49-0.60). The CL colour pixel area decreased significantly after day 18, whereas CL area was already decreasing by day 4 after ET. The CL area, area of blood flow, or [P4] was predictive of pregnancy. Findings in the present study suggest that both CL area and blood flow are correlated with circulating [P4] at the time of transfer and in early pregnancy. Evaluation of the CL using B-mode or CF sonography, although practical, provides no improvement in the selection of recipients or prediction of pregnancy

  4. Detection of Equid herpesvirus type 2 and 5 DNA in uterine flushings of mares with reproductive disorders.

    Science.gov (United States)

    Marenzoni, Maria Luisa; Sforna, Monica; Stefanetti, Valentina; Casagrande Proietti, Patrizia; Brignone, Luca; Del Sero, Andrea; Falcioni, Fabio; Orvieto, Simona; Tamantini, Cristina; Tiburzi, Alessandra; Valentini, Silvia; Coletti, Mauro; Timoney, Peter J; Passamonti, Fabrizio

    2014-12-05

    In recent years, there has been increasing evidence of the potential pathogenic significance of equine gammaherpesviruses in the horse. In humans, cattle and mice, gammaherpesviruses have already been associated with uterine infection. The aim of the present study was to investigate the presence of gammaherpesviruses in uterine flushings of mares with reproductive problems and to evaluate if there was a possible statistical association with clinical and laboratory findings in these cases. A total of 80 uterine flushings were collected from 61 mares with different reproductive problems and these were tested for equine herpesviruses (EHV) 1-5 by PCR. In the case of each mare in the study, the age, history of infertility, presence of anatomical defects in the reproductive tract, presence of systemic or local disease at time of sampling, phase in the oestrous cycle, post-partum interval, nature of uterine lavage performed (low versus large volume lavage), cytological and bacteriological examination results from the uterine flushing, and PCR herpesvirus results were recorded. Univariate analysis and multivariable logistic regression models were used to identify possible statistical associations and risk factors. Nine out of 61 mares (14.7%) had EHV-5 DNA in their uterine flushings. Co-infections with EHV-1 and EHV-2 were present in two cases. Of all the variables analyzed, only the cytological examination findings were associated with EHV-5 PCR positive results, both on univariate and multivariable analysis, especially in cases with an inflammation score of 3. It is postulated that presence of EHV-5 infection in the non-pregnant uterus may have a role to play in reproductive dysfunction and have a negative consequence on the pregnant uterus. Additional studies involving both healthy mares and mares with reproductive problems need to be performed, however, to elucidate whatever role equine gammaherpesviruses may play in the reproductive tract. This would be very

  5. Changes of biochemical environment and body weight in healthy periparturient Lipizzan mares

    Directory of Open Access Journals (Sweden)

    Vladimír Hura

    2017-01-01

    Full Text Available The aims of this study were to determine the concentrations of calcium, magnesium, phosphorus, chlorine, potassium, sodium, urea, total cholesterol, triacylglycerols, non-esterified fatty acids, total protein, creatinine, total bilirubin, aspartate aminotransferase, insulin, insulin growth factor 1, and glucose in the blood serum and to monitor the body weight changes in nine clinically healthy Lipizzan mares at weekly intervals within 2 weeks before and 2 weeks after the parturition. A significant body weight loss (P < 0.01 was found in the mares after the foaling. The peak of insulin growth factor 1 concentration in serum was reached at the day of parturition and similar patterns were revealed for the concentrations of insulin and glucose. After parturition, all these indices were significantly decreased. The concentrations of phosphorus and triacylglycerols were decreased, while the concentrations of potassium and sodium were increased at the day of parturition. Moreover, the concentration of non-esterified fatty acids was increased at the day of parturition (P < 0.05 with a tendency to higher values even on the 7th day postpartum. Other studied indexes remained relatively stable throughout the transition period. We can conclude that periparturient mares face some degree of negative energy balance with concomitant significant homeostatic and homeorhetic changes. For this reason, our results can be used as a basis for reference values and a diagnostic tool to examine the health status in horses during the transition period.

  6. A study on plasma estradiol and progesterone profile at days 11, 12 and 13 post ovulation undergone embryo transfer at day 7-post ovulation in local Egyptian mares

    Directory of Open Access Journals (Sweden)

    Khalid Mohammed Karam

    2017-07-01

    Full Text Available This study was conducted on 28 recipient local mares after synchronizing and recovery of embryos of Arabian mares (donor mares and transferring them to recipients on day 7 post ovulation, all mares were raised in the studs of police academy –Cairo Egypt under same circumstances in the breeding season from February till may of 2013. Seventeen recipient mares were pregnant and 9 mares were non pregnant when ultrasound pregnancy check was done on day 21 post ovulation, blood samples were taken on days 11,12 and 13 to detect the steroidal hormonal profile (estrogen and progesterone via Elisa technique of the recipient mares plasma steroid level and its role in early pregnancy and maternal recognition. The results were significantly higher (P≤0.05 between pregnant (n=17 and non-pregnant (n=9 recipient mares in the plasma progesterone concentrations which were 10.99±0.16 vs 9.59±0.11, 12.69±0.16 vs 11.79±0.22 and 14.4±0.15 vs 13.78±0.23 ng/ml on days 11,12 and 13 post ovulation respectively, significant difference(P≤0.05 was observed when comparison between pregnant mare’s plasma progesterone concentrations on days 11,12 and 13 post ovulation. Plasma estrogen concentration were significantly higher (P≤0.05 in non-pregnant and pregnant mares which were15.17±0.18 vs 14.84±0.14, 14.74±0.27 vs13.94±0.12 and 14.14±0.3 vs13.12±0.16 pg/ ml on days 11,12 and respectively, on the other hand when comparison between days11,12 and 13 plasma estrogen levels were significantly different (P≤0.05 in pregnant mares while no significant difference was found in the same days between non pregnant mares, thus might be the main reason for early embryonic death when detected in early pregnancy check via ultrasonography in 21 days post ovulation.

  7. Comparison of a single dose of moxidectin and a five-day course of fenbendazole to reduce and suppress cyathostomin fecal egg counts in a herd of embryo transfer-recipient mares.

    Science.gov (United States)

    Mason, Maren E; Voris, Nathan D; Ortis, Hunter A; Geeding, Amy A; Kaplan, Ray M

    2014-10-15

    To compare larvicidal regimens of fenbendazole and moxidectin for reduction and suppression of cyathostomin fecal egg counts (FEC) in a transient herd of embryo transfer-recipient mares. Randomized, complete block, clinical trial. 120 mares from 21 states, residing on 1 farm. An initial fecal sample was collected from each mare; mares with an FEC ≥ 200 eggs/g were assigned to treatment groups. Eighty-two horses received fenbendazole (10.0 mg/kg [4.5 mg/lb], PO, q 24 h for 5 days) or moxidectin (0.4 mg/kg [0.18 mg/lb], PO, once); FEC data were analyzed 14, 45, and 90 days after treatment. Mean FEC reduction was 99.9% for moxidectin-treated mares and 41.9% for fenbendazole-treated mares 14 days after treatment. By 45 days, mean FEC of fenbendazole-treated mares exceeded pretreatment counts; however, FECs of moxidectin-treated mares remained suppressed below pretreatment values for the duration of the 90-day study. Fecal egg counts were significantly different between groups at 14, 45, and 90 days after treatment. Failure of the 5-day regimen of fenbendazole to adequately reduce or suppress FEC suggested inadequate adulticidal and larvicidal effects. In contrast, a single dose of moxidectin effectively reduced and suppressed FEC for an extended period. Given the diverse geographic origins of study mares, these results are likely representative of cyathostomin-infected mares in much of the United States, confirming previous findings indicating that fenbendazole resistance in cyathostomins is widespread and that moxidectin remains an effective treatment for control of these important parasites.

  8. Endoscopic monitoring the estrous phase of Arabian mares with assaying its biopsy

    Directory of Open Access Journals (Sweden)

    Mohamed Fathi

    2017-01-01

    Full Text Available Objective: To evaluate the changes occur in the vagina, cervix and endometrium during the pre- ovulatory period in Arabian mares by using endoscope as a diagnostic tool as well as the availability of taking an endoscopic biopsy during this stage.Methods: Ten cyclic and healthy arabian mares were subjected to ultrasound scanning of their ovaries to estimate the diameter of the preovulatory follicles, collection of blood samples for estimating the hormonal levels (Estradiol-17 β and progestrone for confirming the estrous phase, endoscopic monitoring their vagina, cervix and endometrium, the availability of taking biopsical samples and histological examination of the obtained samples.Results: The obtained data revealed that, the mean diameter of the preovulatory follicles was (3.95±0.34 cm, the plasma estradiol and progestrone levels were (85.98±5.26 pg/mL and (0.73±0.23 ng/mL, respectively, endoscopic monitoring the vagina, cervix and endometrium revealed hyperemic vaginal mucous membrane, soft and opened cervical ostium with abundant estrous mucous and folding, hyperemic and edematous appearance of the endometrium, respectively and the histological features of the biopsical endometrial samples revealed that, The lamina propria-sub mucosa was packed with simple or branched tubular glands lined with simple columnar epithelium showing oval or rounded dark nuclei with different degrees of secretory activities of the glands.Conclusions: The endoscope proved to be a reliable tool for confirming the estrous phase in mares and monitoring the gross features of the vagina, the cervix and the endometrium, in addition to the availability of taking biopsical smears.

  9. Cheek tooth morphology and ancient mitochondrial DNA of late Pleistocene horses from the western interior of North America: Implications for the taxonomy of North American Late Pleistocene Equus.

    Directory of Open Access Journals (Sweden)

    Christina I Barrón-Ortiz

    Full Text Available Horses were a dominant component of North American Pleistocene land mammal communities and their remains are well represented in the fossil record. Despite the abundant material available for study, there is still considerable disagreement over the number of species of Equus that inhabited the different regions of the continent and on their taxonomic nomenclature. In this study, we investigated cheek tooth morphology and ancient mtDNA of late Pleistocene Equus specimens from the Western Interior of North America, with the objective of clarifying the species that lived in this region prior to the end-Pleistocene extinction. Based on the morphological and molecular data analyzed, a caballine (Equus ferus and a non-caballine (E. conversidens species were identified from different localities across most of the Western Interior. A second non-caballine species (E. cedralensis was recognized from southern localities based exclusively on the morphological analyses of the cheek teeth. Notably the separation into caballine and non-caballine species was observed in the Bayesian phylogenetic analysis of ancient mtDNA as well as in the geometric morphometric analyses of the upper and lower premolars. Teeth morphologically identified as E. conversidens that yielded ancient mtDNA fall within the New World stilt-legged clade recognized in previous studies and this is the name we apply to this group. Geographic variation in morphology in the caballine species is indicated by statistically different occlusal enamel patterns in the specimens from Bluefish Caves, Yukon Territory, relative to the specimens from the other geographic regions. Whether this represents ecomorphological variation and/or a certain degree of geographic and genetic isolation of these Arctic populations requires further study.

  10. Comparison of pH and refractometry index with calcium concentrations in preparturient mammary gland secretions of mares.

    Science.gov (United States)

    Korosue, Kenji; Murase, Harutaka; Sato, Fumio; Ishimaru, Mutsuki; Kotoyori, Yasumitsu; Tsujimura, Koji; Nambo, Yasuo

    2013-01-15

    To test the usefulness of measuring pH and refractometry index, compared with measuring calcium carbonate concentration, of preparturient mammary gland secretions for predicting parturition in mares. Evaluation study. 27 pregnant Thoroughbred mares. Preparturient mammary gland secretion samples were obtained once or twice daily 10 days prior to foaling until parturition. The samples were analyzed for calcium carbonate concentration with a water hardness kit (151 samples), pH with pH test paper (222 samples), and refractometry index with a Brix refractometer (214 samples). The sensitivity, specificity, and positive and negative predictive values for each test were calculated for evaluation of predicting parturition. The PPV within 72 hours and the NPV within 24 hours for calcium carbonate concentration determination (standard value set to 400 μg/g) were 93.8% and 98.3%, respectively. The PPV within 72 hours and the NPV within 24 hours for the pH test (standard value set at 6.4) were 97.9% and 99.4%, respectively. The PPV within 72 hours and the NPV within 24 hours for the Brix test (standard value set to 20%) were 73.2% and 96.5%, respectively. Results suggested that the pH test with the standard value set at a pH of 6.4 would be useful in the management of preparturient mares by predicting when mares are not ready to foal. This was accomplished with equal effectiveness of measuring calcium carbonate concentration with a water hardness kit.

  11. Consortium study of lunar meteorites Yamato-793169 and Asuka-881757: Geochemical evidence of mutual similarity, and dissimilarity versus other mare basalts

    Science.gov (United States)

    Warren, Paul H.; Lindstrom, Marilyn M.

    1993-01-01

    Compositions of bulk powders and separated minerals from two meteorites derived from the mare lava plains of the Earth's Moon, Yamato-793169 and Asuka-881757, indicate a remarkable degree of similarity to one another, and clearly favor lunar origin. However, these meteorites are unlike any previously studied lunar rock. In both cases, the bulk-rock TiO2 content is slightly greater than the level separating VLT from low-Ti mare basalt, yet the Sc content is much higher than previously observed except among high-Ti mare basalts. Conceivably, the Sc enrichment in A881757 reflects origin of this rock as a cumulate from a mare magma of 'normal' Sc content, but this seems unlikely. Mineral-separate data suggest that most of the Sc is in pyroxene, and a variety of evidence weighs against the cumulus hypothesis as a major cause for the high Sc. The remarkable similarity between Y793169 and A881757 suggests the possibility that they were derived from a single source crater on the Moon.

  12. The effect of consignment to broodmare sales on physiological stress measured by faecal glucocorticoid metabolites in pregnant Thoroughbred mares.

    Science.gov (United States)

    Schulman, Martin; Becker, Annet; Ganswindt, Stefanie; Guthrie, Alan; Stout, Tom; Ganswindt, Andre

    2014-01-17

    Validation of a method for the minimally-invasive measurement of physiological stress will help understanding of risk factors that may contribute to stress-associated events including recrudescence of Equid herpesvirus (EHV), which is anecdotally associated with sales consignment of pregnant Thoroughbred mares. In this study we compared two similar groups of late-gestation Thoroughbred broodmares on the same farm: a consigned Sales group (N = 8) and a non-consigned Control group (N = 6). The Sales mares were separated from their paddock companions and grouped prior to their preparation for, transport to, and return from the sales venue. Both groups were monitored by sampling at regular intervals from 5 days prior to until 14 days after the sales date (D0) to measure physiological stress in terms of changes in faecal glucocorticoid metabolite (FGM) concentrations, and for event-related viral recrudescence via daily body temperature measurements and periodic nasal swabs for PCR analysis for EHV-1 and -4 DNA. In both groups, FGM levels increased post-sales before returning to pre-sales levels. Specifically, FGM concentrations in the Sales mares were significantly higher on D + 3 and D + 10 than on D-4 and D-3 (F = 12.03, P Sales) mare showed PCR evidence of EHV-1 shedding. Using FGM to measure physiological stress was supported by the increases observed in all mares after Sales consignment, including those not consigned to the sale. Monitoring FGM levels therefore represents an appropriate, minimally-invasive method for future studies to assess the contribution of physiological stress to EHV recrudescence in horses transported to sales or equestrian events.

  13. Comparison of intraoperative behavioral and hormonal responses to noxious stimuli between mares sedated with caudal epidural detomidine hydrochloride or a continuous intravenous infusion of detomidine hydrochloride for standing laparoscopic ovariectomy.

    Science.gov (United States)

    Virgin, Joanna; Hendrickson, Dean; Wallis, Ty; Rao, Sangeeta

    2010-08-01

    To compare the presence or absence of pain, pain-related behavioral responses, and hormonal responses to noxious stimuli during standing laparoscopic ovariectomy in mares sedated with continuous intravenous (IV) detomidine infusion and caudal epidural detomidine. A double blind prospective study. Mares (n=12) Mares were divided into 2 treatment groups; 6 were sedated using continuous IV detomidine infusion and 6 were sedated with caudal epidural detomidine. All mares received IV xylazine (0.33 mg/kg) and butorphanol tartrate (5 mg) premedication before detomidine administration. Venous blood samples were taken to assess serum cortisol levels in each mare at 4 time points: a baseline cortisol measurement after the mares' arrival to the clinic, 10 minutes before surgery, at the removal of the 2nd ovary, and 10 minutes postsurgery. Two surgeons performed bilateral ovariectomy and at 8 time points involving surgical manipulations, noted the presence or absence of pain (yes/no) and scored the patient's response on a 10 cm visual analogue scale (VAS) for pain assessment with 0 indicating no pain responses and 10 cm indicating pain so severe that the mare required additional sedation or analgesia to complete the procedure. Each mare was also assigned a VAS score by each surgeon for the overall satisfaction of analgesia during the entire procedure. Serum cortisol levels between the 2 detomidine administration groups differed significantly at the baseline (precortisol) measurement but not at the 3 remaining time points. Seven of the procedures within the surgeries did not differ significantly in VAS scores between the 2 groups. The initial grasp of the left ovary (the 1st ovary) in the continuous infusion group had a significantly higher (P=.05) median VAS score compared with the caudal epidural group. Mares sedated with a continuous IV infusion of detomidine have similar hormonal and behavioral responses to painful stimuli during standing laparoscopic ovariectomy as mares

  14. Lunar mare deposits associated with the Orientale impact basin: New insights into mineralogy, history, mode of emplacement, and relation to Orientale Basin evolution from Moon Mineralogy Mapper (M3) data from Chandrayaan-1

    Science.gov (United States)

    Whitten, J.; Head, J.W.; Staid, M.; Pieters, C.M.; Mustard, J.; Clark, R.; Nettles, J.; Klima, R.L.; Taylor, L.

    2011-01-01

    Moon Mineralogy Mapper (M3) image and spectral reflectance data are combined to analyze mare basalt units in and adjacent to the Orientale multiring impact basin. Models are assessed for the relationships between basin formation and mare basalt emplacement. Mare basalt emplacement on the western nearside limb began prior to the Orientale event as evidenced by the presence of cryptomaria. The earliest post-Orientale-event mare basalt emplacement occurred in the center of the basin (Mare Orientale) and postdated the formation of the Orientale Basin by about 60-100 Ma. Over the next several hundred million years, basalt patches were emplaced first along the base of the Outer Rook ring (Lacus Veris) and then along the base of the Cordillera ring (Lacus Autumni), with some overlap in ages. The latest basalt patches are as young as some of the youngest basalt deposits on the lunar nearside. M3 data show several previously undetected mare patches on the southwestern margins of the basin interior. Regardless, the previously documented increase in mare abundance from the southwest toward the northeast is still prominent. We attribute this to crustal and lithospheric trends moving from the farside to the nearside, with correspondingly shallower density and thermal barriers to basaltic magma ascent and eruption toward the nearside. The wide range of model ages for Orientale mare deposits (3.70-1.66 Ga) mirrors the range of nearside mare ages, indicating that the small amount of mare fill in Orientale is not due to early cessation of mare emplacement but rather to limited volumes of extrusion for each phase during the entire period of nearside mare basalt volcanism. This suggests that nearside and farside source regions may be similar but that other factors, such as thermal and crustal thickness barriers to magma ascent and eruption, may be determining the abundance of surface deposits on the limbs and farside. The sequence, timing, and elevation of mare basalt deposits

  15. Mare Risk Analysis monitor

    International Nuclear Information System (INIS)

    Fuente Prieto, I.; Alonso, P.; Carretero Fernandino, J. A.

    2000-01-01

    The Nuclear Safety Council's requirement that Spanish power plants comply with the requirements of the Maintenance Rule associated with plant risk assessment during power operation, arising from the partial unavailability of systems due to the maintenance activities, has led to need for additional tools to facilitate compliance with said requirements. While the impact on risk produced by individual equipment unavailabilities can easily be evaluated, either qualitatively or quantitatively, the process becomes more complicated when un programmed unavailabilities simultaneously occur in various systems, making it necessary to evaluate their functional impact. It is especially complex in the case of support systems that can affect the functionality of multiple systems. In view of the above, a computer application has been developed that is capable of providing the operator with quick answers based on the specific plant model in order to allow fast risk assessment using the information compiled as part of the Probabilistic Safety Analysis. The paper describes the most important characteristics of this application and the basic design requirements of the MARE Risk Monitor. (Author)

  16. Ei sinistele esmaspäevadele!!! / Piret Jamnes, Marju Unt, Mare Teichmann, Eva Palu

    Index Scriptorium Estoniae

    2010-01-01

    Personaliotsingufirma Fontes partner ja konsultant Piret Jamnes, Estonian Euromanagement Institute'i direktor Marju Unt, kommunikatsioonibüroo JLS PR-konsultant Eva Palu ja TTÜ psühholoogiaprofessor Mare Teichmann ideedest, mis aitavad tööst rohkem rõõmu tunda

  17. Identificación de Especímenes de Equus grevyi en el Parque Zoológico Nacional de Cuba

    OpenAIRE

    Irina Fermin-Morales; Alberto Martín-Mora

    2014-01-01

    La cebra de Grevy (Equus grevyi) se ha manejado a través de extracciones y reintroducciones de individuos desde su inclusión en la colección de animales del Parque Zoológico Nacional de Cuba. Para mejorar el manejo de esta especie es necesaria la identificación individual a través de caracteres morfológicos, por esto los que los investigadores se propusieron demostrar las diferencias en el patrón de rayado facial existente entre los individuos y entre ambos lados de un mismo individuo. El mét...

  18. THE QUANTITATIVE COMPONENT’S DIAGNOSIS OF THE ATMOSPHERIC PRECIPITATION CONDITION IN BAIA MARE URBAN AREA

    Directory of Open Access Journals (Sweden)

    S. ZAHARIA

    2012-12-01

    Full Text Available The atmospheric precipitation, an essential meteorological element for defining the climatic potential of a region, presents through its general and local particularities a defining influence for the evolution of the other climatic parameters, conditioning the structure of the overall geographic landscape. Their quantitative parameters sets up the regional natural setting and differentiation of water resources, soil, vegetation and fauna, in the same time influencing the majority of human activities’ aspects, through the generated impact over the agriculture, transportation, construction, for tourism etc. Especially, through the evolution of the related climatic parameters (production type, quantity, duration, frequency, intensity and their spatial and temporal fluctuations, the pluviometric extremes set out the maxim manifestation of the energy gap of the hydroclimatic hazards/risks which induce unfavourable or even damaging conditions for the human activities’ progress. Hence, the production of atmospheric precipitation surpluses conditions the triggering, or reactivation of some intense erosion processes, landslides, and last but not least, floods. Just as dangerous are the adverse amounts of precipitation or their absence on longer periods, determining the appearance of droughts, aridity phenomena, which if associated with the sharp anthropic pressure over the environment, favours the expansion of desertification, with the whole process of the arising negative effects. In this context, this paper aims to perform the diagnosis of atmospheric precipitation condition in Baia Mare urban area, through its quantitative component, in multiannual condition (1971-2007, underlining through the results of the analyzed climatic data and their interpretation, the main characteristics that define it. The data bank from Baia Mare station from the National Meteorological Administration network, representative for the chosen study area, was used. Baia

  19. The cosmopolitan maternal heritage of the Thoroughbred racehorse breed shows a significant contribution from British and Irish native mares

    OpenAIRE

    Bower, M. A.; Campana, M. G.; Whitten, M.; Edwards, C. J.; Jones, H.; Barrett, E.; Cassidy, R.; Nisbet, R. E. R.; Hill, E. W.; Howe, C. J.; Binns, M.

    2010-01-01

    The paternal origins of Thoroughbred racehorses trace back to a handful of Middle Eastern stallions, imported to the British Isles during the seventeenth century. Yet, few details of the foundation mares were recorded, in many cases not even their names (several different maternal lineages trace back to ‘A Royal Mare’). This has fuelled intense speculation over their origins. We examined mitochondrial DNA from 1929 horses to determine the origin of Thoroughbred foundation mares. There is no e...

  20. Uneven distribution of enamel in the tooth crown of a Plains Zebra (Equus quagga

    Directory of Open Access Journals (Sweden)

    Daniela E. Winkler

    2015-06-01

    Full Text Available Unworn teeth of herbivorous mammals are not immediately functional. They have to be partially worn to expose enamel ridges which can then act as shear-cutting blades to break the food down. We use the Plains Zebra (Equus quagga as a hypsodont, herbivorous model organism to investigate how initial wear of the tooth crown is controlled by underlying structures. We find that the enamel proportion is smaller at the apical half of the tooth crown in all upper tooth positions and suggest that lower enamel content here could promote early wear. Besides this uneven enamel distribution, we note that the third molar has a higher overall enamel content than any other tooth position. The M3 is thus likely to have a slightly different functional trait in mastication, resisting highest bite forces along the tooth row and maintaining functionality when anterior teeth are already worn down.

  1. Uneven distribution of enamel in the tooth crown of a Plains Zebra (Equus quagga).

    Science.gov (United States)

    Winkler, Daniela E; Kaiser, Thomas M

    2015-01-01

    Unworn teeth of herbivorous mammals are not immediately functional. They have to be partially worn to expose enamel ridges which can then act as shear-cutting blades to break the food down. We use the Plains Zebra (Equus quagga) as a hypsodont, herbivorous model organism to investigate how initial wear of the tooth crown is controlled by underlying structures. We find that the enamel proportion is smaller at the apical half of the tooth crown in all upper tooth positions and suggest that lower enamel content here could promote early wear. Besides this uneven enamel distribution, we note that the third molar has a higher overall enamel content than any other tooth position. The M3 is thus likely to have a slightly different functional trait in mastication, resisting highest bite forces along the tooth row and maintaining functionality when anterior teeth are already worn down.

  2. Reproductive phenology of Creole horses in Ecuador in the absence of photoperiod variation: The effects of forage availability and flooding affecting body condition of mares.

    Science.gov (United States)

    Carranza, Juan; Yoong, Washington A; Mateos, Concha; Caño Vergara, Belén; Gómez, Chian L; Macías, Verónica

    2017-12-01

    Horse reproduction tends to be seasonal. The main adjusting factor in their original temperate ranges is photoperiod variation, although it is absent in equatorial areas where horses were introduced by European colonizers. Hence, dates of reproduction in these areas may be influenced by factors affecting mares' conditions and the success of foaling. Here we study reproductive timing in Creole horses in Ecuador reared in an extensive production system. We found that foaling peaked in August. Mares' conditions showed one peak in June-July, before the start of the breeding season, and another in December, and it was highly variable along the year. Mares' conditions increased after a period of vegetation growth and thus appeared negatively associated with the increment of grass greenness (normalized difference vegetation index data). Seasonal flooding of some pasturelands during March and April appeared to seriously impair mares' conditions and probably influenced the timing of foaling toward the dry season. Our results evidenced that horse breeding in these equatorial areas tended to be seasonal and point to some key factors that influence phenology by affecting body condition of mares, which may have implications for horse biology and management. © 2017 Japanese Society of Animal Science.

  3. The mare as a model for luteinized unruptured follicle syndrome : intrafollicular endocrine milieu

    NARCIS (Netherlands)

    Bashir, S T; Gastal, M O; Tazawa, S P; Tarso, S G S; Hales, D B; Cuervo-Arango, J; Baerwald, A R; Gastal, E L

    2016-01-01

    Luteinized unruptured follicle (LUF) syndrome is a recurrent anovulatory dysfunction that affects up to 23% of women with normal menstrual cycles and up to 73% with endometriosis. Mechanisms underlying the development of LUF syndrome in mares were studied to provide a potential model for human

  4. Inter-birth interval in zebras is longer following the birth of male foals than after female foals

    Science.gov (United States)

    Barnier, Florian; Grange, Sophie; Ganswindt, Andre; Ncube, Hlengisizwe; Duncan, Patrick

    2012-07-01

    Mammalian reproductive rates vary among individuals for physiological and environmental reasons. This study aims to determine reproductive rates from an individually monitored population of wild Plains zebras Equus quagga, and to assess the sources of variability in inter-birth intervals. The animals were monitored, where possible, every six months from 2004 to 2011. Thirty nine intervals corresponding to 65 births in 26 mares were identified, using direct observations and faecal steroid monitoring. Mean foaling rate of the population is 0.74 foal/year, and comparable with the literature. There was no significant effect of mother's age, nor of the season of previous birth on the length of inter-birth intervals. Inter-birth interval was significantly longer when the first foal was a male. This finding indicates that additional costs of having a son may delay future reproduction and thus reduce the total number of offspring a mare can have during her lifetime. Individually-based data provide critical information on the determinants of reproductive rates, and are therefore a key to understanding the causes of variations in life-history traits.

  5. Verdes Mares: The Ideology of the Siren

    Directory of Open Access Journals (Sweden)

    Bruno Marinoni Marinoni

    2009-02-01

    Full Text Available The television channel number 10 of Fortaleza (current TV Verdes Mares, during the 1960 decade, passed through the ideological filter of the Military Dictatorship, when the channel was taken from its owner and given to the businessman Edson Queiroz. The filter had consequences in the next decade with the channel affiliation to the biggest network broadcasting of the country, the Rede Globo, which was also protected by the Military Regime. Based on those two facts, it is intended to discuss some aspects of the exploration models of communication that occurs in the country since the specified period, emphasizing the ideology transmitted by the TV channel which has the biggest audience ratings in Ceará.

  6. Testing freshwater Lago Mare dispersal theory on the phylogeny relationships of iberian cyprinid genera Chondrostoma and Squalius (Cypriniformes, Cyprinidae

    Directory of Open Access Journals (Sweden)

    Carmona, José Ambrosio

    2003-12-01

    Full Text Available A phylogeny of the species in the genera Chondrostoma and Squalius was constructed based on the complete mitochondrial cytochrome b gene (1140pb. The molecular phylogeny was used to test the effect of the Mediterranean Lago Mare dispersal theory on the processes of divergence and speciation of European freshwater fishes. Phylogenetic relationships among Squalius samples and the molecular clock revealed that the ancestor of the current Iberian Squalius species inhabited a wide geographic area in the central and southwestern part of the former Iberian Peninsula during the Miocene before the Lago Mare phase. Similarly, the four main Iberian lineages of the genus Chondrostoma originated in the Middle-Upper Miocene. Hence, the Lago Mare phase of the Mediterranean Sea seems to have been a too recent paleogeographic event to have had any major impact on the dispersion of Squalius and Chondrostoma species. However, the reduction of the water-bodies during the Tortonian and Messinian may have intensified the isolation of populations. The Operational Biogeographic Units recovered from the Squalius and Chondrostoma phylogenies also reject the Lago Mare dispersal theory and support the idea that the differentiation processes were due to both the formation of the current hydrographical basin during the Plio-Pleistocene as well as to an earlier endorrheism event that occurred prior to hydrographical configuration.Realizamos una filogenia de los géneros Chondrostoma y Squalius mediante el estudio de la secuencia completa del gen mitocondrial citocromo b (1140pb. La filogenia molecular fue usada para comprobar el efecto que la teoría de dispersión del Mediterráneo Lago Mare ha tenido sobre los procesos de divergencia y especiación en los peces de agua dulce europeos. Las relaciones filogenéticas entre las muestras de Squalius y la aplicación del reloj molecular pusieron de manifiesto que el ancestro de las actuales especies ibéricas de Squalius habitaba

  7. dataMares - An online platform for the fast, effective dissemination of science

    Science.gov (United States)

    Johnson, A. F.; Aburto-Oropeza, O.; Moreno-Báez, M.; Giron-Nava, A.; Lopez-Sagástegui, R.; Lopez-Sagástegui, C.

    2016-02-01

    One of the current challenges in public policy development, especially related to natural resource management and conservation, is that there are very few tools that help easily identify and incorporate relevant scientific findings and data into public policy. This can also lead to a repetition of research efforts and the collect of information that in some cases might already exist. The key to addressing this challenge is to develop collaborative research tools, which can be used by different sectors of society including key stakeholder groups, managers, policy makers and the public. Here we present an "open science" platform capable of handling large data and disseminating results to a wide audience quickly. dataMares uses business intelligence software to allow the dynamic presentation of data quickly to a range of users online. dataMares provides Robust and up-to-date scientific information for decision-makers, resource managers, conservation practitioners, fishers, community members, and regional and national level decision-makers in a nutshell. It can also be used in the training of young scientists and allows quick and open connections with the journalism industry.

  8. Lunar mare volcanism - Stratigraphy, eruption conditions, and the evolution of secondary crusts

    Science.gov (United States)

    Head, James W., III; Wilson, Lionel

    1992-01-01

    Recent developments in the geological analysis of lunar mare volcanism are reviewed. Analysis of returned samples and photogeological and remote sensing studies shows that mare volcanism began prior to the end of heavy bombardment (the period of cryptomare formation), in pre-Nectarian times, and continued until the Copernical Period, the total duration approaching 3.5-4 Ga. Stratigraphic analysis shows that the flux was not constant, but peaked in early lunar history, during the Imbrian Period. Average volcanic output rate during this period was about 0.01 cu cm/a. Volcanic landforms indicate that many eruptions were of high volume and long duration. Some eruptions associated with sinuous rills may have lasted a year and emplaced 1000 cu km of lava, representing the equivalent in one year of about 70,000 yr at the average flux. The occurrence of farside maria within craters whose diameter is generally near to or less than the thickness of the crust may be accounted for by the difference between local and regional compensation.

  9. [Development and application of real-time PCR for identification and detection of horse meat in animal-origin products].

    Science.gov (United States)

    Li, Nan; Wang, Jiahui; Shen, Qing; Han, Chunhui; Zhang, Jing; Li, Fengqin; Xu, Jin; Jiang, Tao

    2013-11-01

    To develop a real-time PCR method for identification and detection of domestic horse meat (Equus caballus) in animal-origin products. The primer and TaqMan-probe was designed and synthesized according to the EU reference laboratory and 87 bp fragments was amplified for horse ingredients. The specificity and sensitivity was tested by artificially spiked horse meat into other domestic meat, such as cattle, sheep, pork, chicken, duck and rabbit. 122 samples of cattle and sheep products were random collected in Beijing market and the detection of horse meat was carried out. The real-time PCR in this study has high specificity and sensitivity for horse meat. No cross-reaction was observed between the horse and sheep, pork, chicken, duck and rabbit meat. There was little cross reaction between horse and cattle when the CT value reach 33. 81. The method can detect 0.1% of horse meat mixed with other domestic animal-origin products. No horse meat ingredients were detected in 122 samples in this survey. There was no horse meat mixed into cattle and sheep products in Beijing marked.

  10. Infezioni gastroenteriche e fonti di rischio da balneazione nel mare Adriatico

    Directory of Open Access Journals (Sweden)

    N. Schinaia

    2003-05-01

    Full Text Available

    Obiettivi: gli obiettivi generali della ricerca sono stati: stimare un eccesso di rischio di insorgenza di gastroenterite a seguito di attività di balneazione o consumo di prodotti ittici nel mare Adriatico; misurare nuovi parametri microbiologici di inquinamento marino.

    Metodi: sono stati condotti i seguenti studi: 1 caso controllo; 2 uno studio di prevalenza (beach survey per descrivere la frequenza di alcune patologie (dell’orecchio, delle vie aeree superiori, della cute rispetto alla balneazione o meno; 3 identificazione di nuovi patogeni nelle acque di balneazione (quali virus o Cryptosporidium parvum.

    Risultati: l’analisi dei fattori di rischio nello studio caso controllo non ha evidenziato un aumento di gastroenterite associata a balneazione. Gli episodi gastroenterici osservati nei casi erano prevalentemente sostenuti da Salmonella sp. e la modalità di infezione era legata ad alcuni alimenti quali la maionese. Il risultato principale dello studio di beach survey è stato che la balneazione nel mare Adriatico non è associata ad un aumento significativo di patologie serie, quali gastroenterite acuta.

    Tuttavia, è stato possibile evidenziare un aumento di rischio statisticamente significativo per forme morbose lievi, quali congiuntivite e dermatite aspecifica, fra chi ha fatto il bagno in mare e chi no. Tale aumentato rischio è stato soprattutto osservato nei bambini e ragazzi al di sotto di 15 anni. I risultati di microbiologia sperimentale dimostrano il ruolo svolto dalle acque marine quale pabulum idoneo alla sopravvivenza delle oocisti di C. parvum. Sono stati validati protocolli di diagnostica molecolare per l’identificazione di enterovirus, rotavirus e reovirus nelle acque di balneazione.

    Conclusioni: l’epidemiologia può contribuire a studiare i rapporti fra balneazione e salute all’interno di una visione generale di salute

  11. Effects of intravenously administered yohimbine on antinociceptive, cardiorespiratory, and postural changes induced by epidural administration of detomidine hydrochloride solution to healthy mares.

    Science.gov (United States)

    Skarda, R T; Muir, W W

    1999-10-01

    To determine effects of i.v. administered yohimbine on perineal analgesia, cardiovascular and respiratory activity, and head and pelvic limb position in healthy mares following epidural administration of detomidine hydrochloride solution. 8 healthy mares. Each mare received detomidine hydrochloride (0.06 mg/kg of body weight), administered in the caudal epidural space, followed 61 minutes later by yohimbine (0.05 mg/kg; test) or sterile saline (0.9% NaCl) solution (control), administered i.v., in a randomized, crossover study design with > or = 2 weeks between treatments. Analgesia was determined by lack of sensory perception to electrical stimulation of perineal dermatomes and needle-prick stimulation of coccygeal to 15th thoracic dermatomes. Arterial pH, PaCO2, PaO2, heart and respiratory rates, rectal temperature, arterial blood pressure, and cardiac output were determined, and mares were observed for sweating and urination. Mean scores obtained for test and control groups were compared. Intravenously administered yohimbine significantly reduced mean scores of detomidine-induced perineal analgesia, head ptosis, changes in pelvic limb position, and sweating and diuresis; antagonized detomidine-induced decreases in heart rate and cardiac output; but did not affect detomidine-induced decrease in respiratory rate. Most effects of epidurally administered detomidine, except bradypnea, were antagonized by yohimbine, suggesting that detomidine may influence respiratory rate by mechanisms other than stimulation of alpha2-adrenoceptors, or that yohimbine induces respiratory depressant effects. Yohimbine may be an effective alpha2-adrenoceptor antagonist for all but respiratory depression following epidural administration of detomidine to mares.

  12. Serological diagnosis of Besnoitia bennetti infection in donkeys (Equus asinus).

    Science.gov (United States)

    Ness, SallyAnne L; Schares, Gereon; Peters-Kennedy, Jeanine; Mittel, Linda D; Dubey, Jitender P; Bowman, Dwight D; Mohammed, Hussni O; Divers, Thomas J

    2014-11-01

    Besnoitiosis is an emerging infectious disease of donkeys (Equus asinus) in the United States for which there are currently no serologic methods of diagnosis. A study was performed to evaluate physical examination findings and 3 serologic assays for the detection of Besnoitia bennetti infection in donkeys. A prospective study of 416 donkeys from 6 privately owned herds across 5 U.S. states (New York, Pennsylvania, Vermont, Oregon, and Washington) was performed. Donkeys were examined for clinical lesions suggestive of besnoitiosis and evaluated for antibodies against B. bennetti using a fluorescent antibody test (FAT) and 2 immunoblot assays specific for bradyzoite and tachyzoite antigens, respectively. Donkeys were confirmed to be infected with B. bennetti by histology (cases; n = 32) and were compared to those with no clinical signs of besnoitiosis (controls; n = 384). Identifying clinical lesions in 2 or more locations correctly identified infected donkeys 83% of the time. Donkeys with besnoitiosis had significantly higher FAT titers (P donkeys. The sensitivity and specificity of the serologic assays for detecting besnoitiosis was 88% and 96% for FAT, 81% and 91% for bradyzoite immunoblot, and 91% and 92% for tachyzoite immunoblot, respectively. Fluorescent antibody and immunoblot assays are effective at identifying donkeys with besnoitiosis and provide a more efficient and less invasive diagnostic alternative to histology. © 2014 The Author(s).

  13. SEASONAL DISCHARGE REGIME OF THE RIVERS IN THE TRANSYLVANIAN SUBCARPATHIANS AND THE ADJACENT MOUNTAINOUS SPACE BETWEEN TÂRNAVA MARE AND NIRAJ

    OpenAIRE

    VICTOR SOROCOVSCHI; DANIEL RADULY; CSABA HORVATH

    2015-01-01

    Seasonal discharge regime of the rivers in the Transylvanian Subcarpathians and the adjacent mountainous space between Târnava Mare and Niraj. The studied region is situated in the North-East of the Transylvanian Depression and includes two distinct units: the Transylvanian Subcarpathians and the Moldavo-Transylvanian Carpathians, comprised between the valleys of Târnava Mare and Niraj. The study is based upon the processing and interpretation of data coming from 13 hydrometric stations. In o...

  14. Economic benefit of fertility control in wild horse populations

    Science.gov (United States)

    Bartholow, J.

    2007-01-01

    I projected costs for several contraceptive treatments that could be used by the Bureau of Land Management (BLM) to manage 4 wild horse (Equus caballus) populations. Potential management alternatives included existing roundup and selective removal methods combined with contraceptives of different duration and effectiveness. I projected costs for a 20-year economic life using the WinEquus?? wild horse population model and state-by-state cost estimates reflecting BLM's operational expenses. Findings revealed that 1) currently available 2-year contraceptives in most situations are capable of reducing variable operating costs by 15%, 2) experimental 3-year contraceptives may be capable of reducing costs by 18%, and 3) combining contraceptives with modest changes to herd sex ratio (e.g., 55-60% M) could trim costs by 30%. Predicted savings can increase when contraception is applied in conjunction with a removal policy that targets horses aged 0-4 years instead of 0-5 years. However, reductions in herd size result in greater variation in annual operating expenses. Because the horse program's variable operating costs make up about half of the total program costs (which include other fixed costs), contraceptive application and management can only reduce total costs by 14%, saving about $6.1 million per year. None of the contraceptive options I examined eliminated the need for long-term holding facilities over the 20-year period simulated, but the number of horses held may be reduced by about 17% with contraceptive treatment. Cost estimates were most sensitive to the oldest age adoptable and per-day holding costs. The BLM will experience significant cost savings as carefully designed contraceptive programs become widespread in the wild horse herds it manages.

  15. A retrospective study of artificial insemination of 251 mares using chilled and fixed time frozen-thawed semen.

    Science.gov (United States)

    Crowe, C A M; Ravenhill, P J; Hepburn, R J; Shepherd, C H

    2008-09-01

    Historically, artificial insemination (AI) using frozen semen has been perceived to have poorer success rates and be more labour intensive than using chilled semen. A retrospective study was therefore conducted to compare the conception rate achieved by AI between chilled and frozen semen, using fixed time insemination protocols over 2 breeding seasons. Artificial insemination using chilled semen produces a higher conception rate than that achieved with frozen semen. Mares (n = 251) were inseminated with either chilled (n = 112) or frozen (n = 139) semen in the 2006 and 2007 northern hemisphere breeding season. Per rectum ultrasonography of the mare's reproductive tract determined the timing of insemination, and deslorelin acetate was used to induce ovulation. Chilled semen insemination was performed using a single preovulatory dose delivered into the uterine body. Frozen semen was administered as 2 doses (pre- and post ovulation) using a deep uterine insemination technique. Pregnancy was detected ultrasonographically at 15 days post insemination. Conception rates were compared using a Chi-squared test. Insemination with frozen semen produced a significantly (P = 0.022) higher seasonal conception rate (82.0%) than that achieved with chilled semen (69.6%). Insemination with frozen semen can achieve conception rates equal to those with chilled semen, enabling the mare owner a greater selection of stallions.

  16. Cartografía del desencanto en la novela Los mares del Sur

    Directory of Open Access Journals (Sweden)

    Héctor Reyes

    2012-01-01

    Full Text Available RESUMEN: En este trabajo pretendemos aproximarnos a la obra de Montalbán, en específico a la novela Los mares de Sur, desde la literatura del viaje. Para esto trazamos el recorrido real e imaginario de Carlos Stuart Pedrell y Pepe Carvalho dentro de un marco espacial determinado por el propio escritor, es decir Barcelona, y durante un periodo específico, la transición democrática,todo ello encaminado a mostrar lo que para un gran número de críticos literarios simboliza la narrativa de Manuel Vázquez Montalbán: “la crónica del desencanto”. ABSTRACT: In this study we attempt to approach Montalban’s oeuvre, specifically the novel Los mares de Sur, from the perspective of travel literature. For this purpose we trace the real and imaginary itinerary of Carlos Stuart Pedrell and Pepe Carvalho within a spatial framework provided by the writer himself, that is Barcelona, and during a specific period, the democratic transition, all aimed at revealing what for a large number of literary critics symbolizes Manuel Vázquez Montalbán’s narrative: “the chronicle of disenchantment”.

  17. The effect of dietary protein on reproduction in the mare. V. Endocrine changes and conception during the early post partum period

    Directory of Open Access Journals (Sweden)

    F.E. Van Niekerk

    1998-07-01

    Full Text Available Pregnant Anglo-Arab and Thoroughbred mares (n = 24 were divided randomly according to age and breed into 4 groups of 6 mares each from approximately 6 weeks before their expected foaling date. Diets received by the 4 groups varied in essential amino-acid and total protein contents. Serum progestagen, FSH and LH concentrations were determined from the day of parturition until foal heat and during the 1st oestrous cycle following foal heat. Serum progestagen, FSH and LH concentrations did not differ between the treatment groups. Progestagen concentrations were high (c = 7.0: 5.2-16.4 ng/mℓ at parturition but decreased rapidly within 48 h. As progestagen concentrations decreased LH concentrations increased from Days 3-6 post partum to reach maximum values at, or the day after ovulation. FSH concentrations declined 3-4 d after parturition and increased 2-3 d before ovulation at foal heat. The duration of elevated progestagen concentrations during the luteal phase of the subsequent oestrous cycle affected the interovulatory period. A 12-14 d FSH cyclical releasing pattern occurred. Season/photoperiod affected the resumption of normal oestrous cyclicity during the post partum period. The duration of the 1st oestrous cycle after foal heat in mares fed a low-quality protein diet showed a greater range (13-30 d compared to mares fed a high-quality protein diet (18-26 d.

  18. Ways of Optimising Regional Planning: Settlement Typology. Case Study: Baia Mare Depression

    OpenAIRE

    ADRIAN GAVRA; SORIN FILIP

    2006-01-01

    In a relatively uniform natural environment, the settlements in the Baia Mare Depression have very diverse forms. According to an oriented complex typology, we have identified the features and the problems characteristic of these settlements, according to the following criteria: the infrastructure already, demographic features, education, health, and tourism. By synthesising these criteria, we identified the following settlement types: polarising urban centres, under-pressure urban settlement...

  19. RECURRENT, IDIOPATHIC URTICARIA IN A TONGA PONY MARE

    Directory of Open Access Journals (Sweden)

    T. Ahmad, G. Muhammad and M. H. Hussain

    2003-01-01

    Full Text Available A 15-Yearold tonga (a light wheeled horse cart pony mare was presented for the treatment of a condition characterized by generalized urticarial wheals, anemic mucous membranes, concentrated urine, inappetance and unilateral chemosis. Haematological alterations included a marked leucocytosis (WBC = 14x103/ul with monocytosis (2.5x109/L and moderate anemia (RBC count = 4.lx1012/L; PCV = 18; hemoglobin = 8.2 gm/dl. There was no history of exposure to agents known tQtrigger urticaria. Parental administration of a corticosteroid preparation (prednisolone plus dexamethasone and antihistamine (pheniramine maleate in 4 rounds of treatment over a 16 days period was associated with rebounding of signs of urticaria after cessation of each round oftherapyo

  20. Cultura Política e Polos Regionais: comparando Campos dos Goytacazes (RJ com Maringá ampliada (PR

    Directory of Open Access Journals (Sweden)

    Sergio de Azevedo

    2015-01-01

    Full Text Available The article analyzes in comparative perspective the similarities and differences between the political culture of the population resident in Campos dos Goytacazes (RJ and Maringá, Paysandú and Sarandi, set of municipalities that we call Maringá magnified. On the comparative analysis between the Regional Poles two major theoretical questions that unify the proposal of this work are prioritized. The first corresponds to the classical concerns relating to the operation of democracy and citizens’ participation in the public life. The second refers to the impacts that the processes of change, differentiation and trajectory of life impacted in different groups, personal values that present, in different ways, an arc that goes from traditional conservatism to the legitimization of new habits and posture.

  1. The Effectiveness of Anti-R. equi Hyperimmune Plasma against R. equi Challenge in Thoroughbred Arabian Foals of Mares Vaccinated with R. equi Vaccine

    Directory of Open Access Journals (Sweden)

    Osman Erganis

    2014-01-01

    Full Text Available This study aimed to determine the effectiveness of a pregnant mare immunization of a Rhodococcus equi (R. equi vaccine candidate containing a water-based nanoparticle mineral oil adjuvanted (Montanide IMS 3012 inactive bacterin and virulence-associated protein A (VapA, as well as the administration of anti-R. equi hyperimmune (HI plasma against R. equi challenge in the mares’ foals. The efficacy of passive immunizations (colostral passive immunity by mare vaccination and artificial passive immunity by HI plasma administration was evaluated based on clinical signs, complete blood count, blood gas analysis, serological response (ELISA, interleukin-4 (IL-4 and interferon gamma (IFN-γ, total cell count of the bronchoalveolar lavage fluids (BALF samples, reisolation rate of R. equi from BALF samples (CFU/mL, lung samples (CFU/gr, and lesion scores of the organs and tissue according to pathological findings after necropsy in the foals. The vaccination of pregnant mares and HI plasma administration in the foals reduced the severity of R. equi pneumonia and lesion scores of the organs and tissue by 3.54-fold compared to the control foals. This study thus indicates that immunization of pregnant mares with R. equi vaccine candidate and administration of HI plasma in mares’ foals effectively protect foals against R. equi challenge.

  2. Characterization of a novel variant of amino acid transport system asc in erythrocytes from Przewalski's horse (Equus przewalskii).

    Science.gov (United States)

    Fincham, D A; Ellory, J C; Young, J D

    1992-08-01

    In thoroughbred horses, red blood cell amino acid transport activity is Na(+)-independent and controlled by three codominant genetic alleles (h, l, s), coding for high-affinity system asc1 (L-alanine apparent Km for influx at 37 degrees C congruent to 0.35 mM), low-affinity system asc2 (L-alanine Km congruent to 14 mM), and transport deficiency, respectively. The present study investigated amino acid transport mechanisms in red cells from four wild species: Przewalski's horse (Equus przewalskii), Hartmann's zebra (Zebra hartmannae), Grevy's zebra (Zebra grevyi), and onager (Equus hemonius). Red blood cell samples from different Przewalski's horses exhibited uniformly high rates of L-alanine uptake, mediated by a high-affinity asc1-type transport system. Mean apparent Km and Vmax values (+/- SE) for L-alanine influx at 37 degrees C in red cells from 10 individual animals were 0.373 +/- 0.068 mM and 2.27 +/- 0.11 mmol (L cells.h), respectively. As in thoroughbreds, the Przewalski's horse transporter interacted with dibasic as well as neutral amino acids. However, the Przewalski asc1 isoform transported L-lysine with a substantially (6.4-fold) higher apparent affinity than its thoroughbred counterpart (Km for influx 1.4 mM at 37 degrees C) and was also less prone to trans-stimulation effects. The novel high apparent affinity of the Przewalski's horse transporter for L-lysine provides additional key evidence of functional and possible structural similarities between asc and the classical Na(+)-dependent system ASC and between these systems and the Na(+)-independent dibasic amino acid transport system y+. Unlike Przewalski's horse, zebra red cells were polymorphic with respect to L-alanine transport activity, showing high-affinity or low-affinity saturable mechanisms of L-alanine uptake. Onager red cells transported this amino acid with intermediate affinity (apparent Km for influx 3.0 mM at 37 degrees C). Radiation inactivation analysis was used to estimate the target

  3. The presence of Giardia intestinalis in donkeys, Equus asinus, in China.

    Science.gov (United States)

    Zhang, Xiao-Xuan; Zhang, Fu-Kai; Li, Fa-Cai; Hou, Jun-Ling; Zheng, Wen-Bin; Du, Shuai-Zhi; Zhao, Quan; Zhu, Xing-Quan

    2017-01-03

    Giardia intestinalis is one of the most important zoonotic enteric parasites. As no information regarding prevalence and genotype of G. intestinalis in donkeys (Equus asinus) in China is available, 181 faecal samples from 48 donkeys from Jilin Province, from 104 from Shandong Province and from 29 from Liaoning Province were examined between May and December 2015. Twenty-eight (15.47%) out of 181 donkey samples were tested G. intestinalis-positive by nested amplification of the triosephosphate isomerase (tpi) gene. The prevalence in different regional groups varied from 10.42 to 18.27%. The prevalence in adult and young donkeys was 14.29 and 22.92%, respectively. Otherwise, the prevalence was 11.69% in summer and 18.27% in winter. However, no statistically significant differences were found in relation to region or age group. Sequence analysis of the tpi, glutamate dehydrogenase (gdh) and beta giardin (bg) loci identified 4, 1 and 3 subtypes of assemblage B, respectively. Moreover, four novel multilocus genotypes (MLGs novel-1 to novel-4) were identified in assemblage B. This first report of G. intestinalis in donkeys in China indicates that further studies of nation-wide molecular epidemiology and geographical distribution of Giardia in donkeys are warranted. Effective strategies should be implemented to control G. intestinalis infection in donkeys, other animals and humans.

  4. GN and C Subsystem Concept for Safe Precision Landing of the Proposed Lunar MARE Robotic Science Mission

    Science.gov (United States)

    Carson, John M., III; Johnson, Andrew E.; Anderson, F. Scott; Condon, Gerald L.; Nguyen, Louis H.; Olansen, Jon B.; Devolites, Jennifer L.; Harris, William J.; Hines, Glenn D.; Lee, David E.; hide

    2016-01-01

    The Lunar MARE (Moon Age and Regolith Explorer) Discovery Mission concept targets delivery of a science payload to the lunar surface for sample collection and dating. The mission science is within a 100-meter radius region of smooth lunar maria terrain near Aristarchus crater. The location has several small, sharp craters and rocks that present landing hazards to the spacecraft. For successful delivery of the science payload to the surface, the vehicle Guidance, Navigation and Control (GN&C) subsystem requires safe and precise landing capability, so design infuses the NASA Autonomous precision Landing and Hazard Avoidance Technology (ALHAT) and a gimbaled, throttleable LOX/LCH4 main engine. The ALHAT system implemented for Lunar MARE is a specialization of prototype technologies in work within NASA for the past two decades, including a passive optical Terrain Relative Navigation (TRN) sensor, a Navigation Doppler Lidar (NDL) velocity and range sensor, and a Lidar-based Hazard Detection (HD) sensor. The landing descent profile is from a retrograde orbit over lighted terrain with landing near lunar dawn. The GN&C subsystem with ALHAT capabilities will deliver the science payload to the lunar surface within a 20-meter landing ellipse of the target location and at a site having greater than 99% safety probability, which minimizes risk to safe landing and delivery of the MARE science payload to the intended terrain region.

  5. Baltimaade klaasikunstil on arenguruumi, vajaka jääb võimalustest / Mare Saare

    Index Scriptorium Estoniae

    Saare, Mare, 1955-

    2008-01-01

    Rahvusvaheline klaasinäitus "Vitrum Balticum IV" ("Balti klaas IV") Kaunases kuni 7. XII. Esindatud on Eesti (Kai Kiudsoo-Värv, Eeva Käsper, Ivo Lill, Kairi Orgusaar, Mare Saare, Maret Sarapu, Tiina Sarapu), Läti, Leedu ja Soome klaasikunstnikud. 14. XI rahvusvaheline seminar Läänemeremaade klaasikunsti arengukäigust 21. sajandil kunstiakadeemias. Näituse ja seminari kuraator kunstiteadlane Raimonda Kogelyte-Simanatiene

  6. Da questa parte del mare. Gianmaria Testa ed Erri De Luca nel secolo delle migrazioni

    Directory of Open Access Journals (Sweden)

    Isabella Maria Zoppi

    2009-11-01

    Full Text Available Gianmaria Testa's album Da questa parte del mare (2006 expresses a fifteen-year-long meditation about the theme of the great migrations which have marked the Twentieth Century. That same theme is considered by Erri De Luca as the only possible, epic narration of the contemporary world. On the one hand, Testa's project finds its starting point from the song-writer's capacity of observing and interpreting common stories as well as from his considerations about the changing of History; on the other hand, it takes origin from the reading of Erri De Luca's novels and lyrics, especially those of Solo andata. Righe che vanno troppo spesso a capo (2005. Within Testa's Da questa parte del mare, their lyrical voices and artistic and human perspectives seem somehow to cross and melt. Through his songs, Testa tells in an original way the new human geography traced by the migrant phenomenon across the Mediterranean and Europe.

  7. Administration of RRR-α-tocopherol to pregnant mares stimulates maternal IgG and IgM production in colostrum and enhances vitamin E and IgM status in foals

    DEFF Research Database (Denmark)

    Bondo, Tine; Jensen, Søren Krogh

    2011-01-01

    This study assessed the effect of a vitamin E supplement given to pregnant mares on immunoglobulins (Ig) levels in foals. In addition, the fatty acid (FA) content and composition of the mares’ milk was assessed. Milk α-tocopherol concentrations were compared between pregnant Danish Warmblood mare...

  8. Uterine culture in mares.

    Science.gov (United States)

    Brook, D

    1984-05-01

    A guarded, sterile swab is used to obtain samples for uterine culture. With the mare in stocks, the tail bandage and the perineum washed, the culture rod is introduced into the vagina with a gloved hand. After the rod is guided through the cervix, the guard cap is dislodged and the swab is rubbed along the endometrium, after which the rod is extracted. Samples for uterine culture should only be obtained during full estrus. Swabs should be directly plated onto agar within 2 hours of collection. Blood agar is appropriate for initial screening, but use of specialized types of agar expedites identification of microbes. Plates are incubated at 37 C and inspected for growth every 12 hours. The type and number of bacterial colonies should be coupled with the history and clinical signs in deciding on the necessity and type of treatment. Pure, heavy bacterial growth is usually accompanied by clinical signs of infection. Interpretation of the significance of moderate bacterial growth may be aided by cytologic examination of endometrial smears, made by rolling the swab onto a glass slide and staining with Diff - Quik . Large numbers of neutrophils indicate the need for antibiotic therapy. Mixed bacterial growth and variable numbers of neutrophils usually indicate faulty sampling technic. Microaerophilic or anaerobic cultures may aid diagnosis in cases of equivocal aerobic culture results.

  9. Effects of body condition and leptin on the reproductive performance of Lusitano mares on extensive systems.

    Science.gov (United States)

    Fradinho, M J; Correia, M J; Grácio, V; Bliebernicht, M; Farrim, A; Mateus, L; Martin-Rosset, W; Bessa, R J B; Caldeira, R M; Ferreira-Dias, G

    2014-06-01

    The aim of this study was to investigate the effects of body condition (BC), BC changes, and plasma leptin concentrations on the reproductive performance of Lusitano broodmares on extensive systems. Data from 119 mares (ranging from 4 to 22 years of age) were collected over a period of four consecutive breeding seasons. Each case was considered as one foaled mare bred in 1 year. Body condition changes at conception (ΔBCScon) showed a strong effect on fertility at the first two postpartum estrous cycles and a significant interaction with body condition score at conception (BCScon) was observed (P rate for the 4-year period was 74.5%. Mean foaling interval and gestation length were, respectively, 368.0 ± 2.8 and 340.3 ± 1.0 days. Gestation length was influenced by the month of foaling (P conditions. Copyright © 2014 Elsevier Inc. All rights reserved.

  10. Compositional studies of Mare Moscoviense: New perspectives from Chandrayaan-1 VIS-NIR data

    Science.gov (United States)

    Bhatt, Megha; Wöhler, Christian; Dhingra, Deepak; Thangjam, Guneshwar; Rommel, Daniela; Mall, Urs; Bhardwaj, Anil; Grumpe, Arne

    2018-03-01

    Moscoviense is one of the prominent mare-filled basin on the lunar far side holding key insights about volcanic activity on the far side. Here, we present spectral and elemental maps of mare Moscoviense, using the Moon Mineralogy Mapper (M3) and Infrared Spectrometer-2 (SIR-2) data-sets. The different mare units are mapped based on their spectral properties analyzing both quantitatively (band center, band depth) and qualitatively (Integrated Band Depth composite images), and also using their elemental compositions. We find a total of five distinct spectral units from the basin floor based on the spectral properties. Our analysis suggests that the northern part which was mapped as Iltm unit (Imbrian low Ti, low Fe) by earlier researchers is actually a distinct unit, which is different in composition and age, named as Ivltm unit (Imbrian very low Ti and very low Fe). We obtain the absolute model age of 3.2 Ga with uncertainties of +0.2/ -0.5 Ga for the unit Ivltm. The newly identified basalt unit Ivltm is compositionally intermediate to the units Im and Iltm in FeO and TiO2 abundances. We find a total of five distinct spectral units from the basin floor based on the spectral properties. The units Im (Imbrian very low Ti) from southern and northern regions of the basin floor are spectrally distinct in terms of band center position and corresponding band depths but considered a single unit based on the elemental abundance analysis. The units Ivltm and Im are consistent with a high-Al basalt composition. Our detailed analysis of the entire Moscoviense basin indicates that the concentrations of orthopyroxene, olivine, and Mg-rich spinel, named as OOS rock family are widespread and dominant at the western and southern side of the middle ring of the basin with one isolated area found on the northern side of the peak ring.

  11. Seroepidemiology of Sarcocystis neurona and Neospora hughesi infections in domestic donkeys (Equus asinus in Durango, Mexico

    Directory of Open Access Journals (Sweden)

    Alvarado-Esquivel Cosme

    2017-01-01

    Full Text Available There is currently no information regarding Sarcocystis neurona and Neospora hughesi infections in donkeys in Mexico. Here, we determined the presence of antibodies against S. neurona and N. hughesi in donkeys in the northern Mexican state of Durango. Serum samples of 239 domestic donkeys (Equus asinus were assayed for S. neurona and N. hughesi antibodies using home-made enzyme-linked immunoassays; six (2.5% of the 239 donkeys tested seropositive for S. neurona. The seroprevalence of S. neurona infection was comparable among donkeys regardless of their origin, health status, or sex. Multivariate analysis showed that seropositivity to S. neurona was associated with increased age (OR = 2.95; 95% CI: 1.11–7.82; p = 0.02. Antibodies to N. hughesi were found in two (0.8% of the 239 donkeys. Both exposed donkeys were healthy, 3- and 6-year-old females. This is the first evidence of S. neurona and N. hughesi infections in donkeys in Mexico.

  12. THE VULNERABILITY OF THE BAIA MARE URBAN SYSTEM (ROMANIA TO EXTREME CLIMATE PHENOMENA DURING THE WARM SEMESTER OF THE YEAR

    Directory of Open Access Journals (Sweden)

    DRAGOTĂ CARMEN

    2013-03-01

    Full Text Available The geographical position of the Baia Mare Urban System (intra-hilly depression favours the occurrence of a wide range of extreme climate phenomena which, coupled with the industrial profile of the city (non-ferrous mining and metallurgical industry triggering typical emissions (CO2, SOX, particulate matters and Pb, might pose a significant threat to human health. The article is aiming to assess the occurrence, frequency and amplitude of these extreme climate phenomena based on monthly and daily extreme climatic values from Baia Mare weather station in order to identify the areas more exposed. A GIS-based qualitative-heuristic method was used, each extreme climatic hazard being evaluated on a 1 to 3 scale according to its significance/impact in the study area and assigned with a weight (w and a rank (r, resulting the climate hazard map for the warm semester of the year. The authors further relate the areas exposed to the selected extreme climatic events to socio-economic aspects: demographic and economic in order to delineate the spatial distribution of the environmental vulnerability in the Baia Mare Urban System.

  13. Clinical Trials during Late Pregnancy in Mares: Prevention of Abortion

    Directory of Open Access Journals (Sweden)

    Kirill PLEMYASHOV

    2015-07-01

    Full Text Available The paper observed the influence of the integrated treatment of abortion in mares with the supplement Haemobalans® to replace high-turnover vitamins, amino acids and minerals; and probiotics BF-15® which contains Bifidobacterium bifidum. The aims of this study were to prove the application of Haemobalans and BF-15 as adaptogens during late gestation. We examined 60 healthy adult Thoroughbred mares that were divided into four equal groups (n=15 on the 270 - 300th days of gestation. Test animals received the following treatment: 1 intramuscular injection of Haemobalans in 3 days, in a dose of 1 ml per 45 kg of body weight. BF-15 was also given for 10 days: 20 ml of the oral solution with oats two times per day. Reflex-1 group was treated with the same dose of Haemobalans. Reflex-2 group was treated with the same dose of BF-15. Control animals were also examined. Blood samples were taken before the treatment and two weeks after it. First examination showed the basic level of investigated sources, the last one showed the result of the treatment. The difference between the data (which were obtained before and after treatment was compared in each group. In case of significant differences between the data of the test group relative to the other three groups, we talked about the reliability of the outcomes. Tissue of placentae were taken after delivery, fixed with neutral formalin and stained with hematoxylin and eosin. Zones of pathological changes were identified. Database of categorical data was created in placental study. Number of cases for markers of placental insufficiency (PI was determined. In the personal database of one animal the presence of a pathological case was marked (1 and the absence was marked (0. The objective excess of (1 was regarded as PI. The concentrations of glucose, total protein, creatinine, hemoglobin, vitamin B12, ESR, count of lymphocyte and MCHC in the test group were significantly higher: 16.4%; 10.78%; 17.87%; 11

  14. Evaluation of intranasal oxygen supplementation in mules anesthetized with the combination of ketamine, butorphanol, and guaifenesin

    Directory of Open Access Journals (Sweden)

    T.J.C. Módolo

    Full Text Available ABSTRACT Hypoxemia is a major complication of field anesthesia and no studies regarding this occurrence in mules has been done. Thus, the aim of this study was to evaluate intranasal oxygen supplementation (IOS in mules (Equus caballus x Equus asinus anesthetized with ketamine/butorphanol/guaifenesin combination. For this, we used six male, adult mules (322±29kg which underwent premedication (MPA with 0.2mg/kg of midazolam intramuscularly after 15 minutes, 0.02mg/kg detomidine IV 5 minutes after, induction IV with combination of ketamine (2mg/mL, butorphanol (22.5mg/mL, and guaifenesin (50mg/mL (K/B/G until lateral decumbency. Maintenance was done with the same anesthetic combination. The animals were submitted twice to the protocol described above, 20 days apart, forming two groups. CG: MPA, induction (0.92±0.24mL/kg (mean±SD, and maintenance (2.2±0.2mL/kg/h without SIO; TG: MPA, induction (0.98±0.17mL/kg, and maintenance (2.3±0.4mL/kg/h with IOS flow 40mL/kg/h. During anesthesia arterial blood was collected every 20 minutes (T0, T20, T40, and T60 for blood gas analysis. Data analyzed by ANOVA followed by the Bonferroni test. P<0.05 was considered significant. Hypoxemia of the animals in the CG in periods (59±5; 55±5; 53±7; 49±8 with lower averages than the TG (160±4, 115±34, 92±25, 81±19 was observed, demonstrating that IOS increases PaO2 avoiding the occurrence of hypoxemia.

  15. Horse domestication and conservation genetics of Przewalski's horse inferred from sex chromosomal and autosomal sequences.

    Science.gov (United States)

    Lau, Allison N; Peng, Lei; Goto, Hiroki; Chemnick, Leona; Ryder, Oliver A; Makova, Kateryna D

    2009-01-01

    Despite their ability to interbreed and produce fertile offspring, there is continued disagreement about the genetic relationship of the domestic horse (Equus caballus) to its endangered wild relative, Przewalski's horse (Equus przewalskii). Analyses have differed as to whether or not Przewalski's horse is placed phylogenetically as a separate sister group to domestic horses. Because Przewalski's horse and domestic horse are so closely related, genetic data can also be used to infer domestication-specific differences between the two. To investigate the genetic relationship of Przewalski's horse to the domestic horse and to address whether evolution of the domestic horse is driven by males or females, five homologous introns (a total of approximately 3 kb) were sequenced on the X and Y chromosomes in two Przewalski's horses and three breeds of domestic horses: Arabian horse, Mongolian domestic horse, and Dartmoor pony. Five autosomal introns (a total of approximately 6 kb) were sequenced for these horses as well. The sequences of sex chromosomal and autosomal introns were used to determine nucleotide diversity and the forces driving evolution in these species. As a result, X chromosomal and autosomal data do not place Przewalski's horses in a separate clade within phylogenetic trees for horses, suggesting a close relationship between domestic and Przewalski's horses. It was also found that there was a lack of nucleotide diversity on the Y chromosome and higher nucleotide diversity than expected on the X chromosome in domestic horses as compared with the Y chromosome and autosomes. This supports the hypothesis that very few male horses along with numerous female horses founded the various domestic horse breeds. Patterns of nucleotide diversity among different types of chromosomes were distinct for Przewalski's in contrast to domestic horses, supporting unique evolutionary histories of the two species.

  16. Evidence for anthropophily in five species of phlebotomine sand flies (Diptera: Psychodidae) from northern Colombia, revealed by molecular identification of bloodmeals.

    Science.gov (United States)

    Paternina, Luís E; Verbel-Vergara, Daniel; Romero-Ricardo, Luís; Pérez-Doria, Alveiro; Paternina-Gómez, Margaret; Martínez, Lily; Bejarano, Eduar E

    2016-01-01

    Identification of the bloodmeal sources of phlebotomine sand flies is fundamental to determining which species are anthropophilic and understanding the transmission of Leishmania parasites in natural epidemiological settings. The objective of this study was to identify sand fly bloodmeals in the mixed leishmaniasis focus of the department of Sucre, northern Colombia. In all 141 engorged female sand flies were analyzed, after being captured in intradomiciliary, peridomiciliary and extradomiciliary habitats with Shannon and CDC traps and by active searching in diurnal resting sites. Bloodmeals were identified by sequencing and analysis of a 358bp fragment of the mitochondrial gene Cytochrome b (CYB) and a 330bp fragment of the nuclear gene prepronociceptin (PNOC). Using both genes 105 vertebrate bloodmeals were identified, with an efficiency of 72% for CYB but only 7% for PNOC. Ten species of vertebrates were identified as providing bloodmeal sources for 8 sand fly species: Homo sapiens (Lutzomyia evansi, Lutzomyia panamensis, Lutzomyia micropyga, Lutzomyia shannoni and Lutzomyia atroclavata), Equus caballus (L. evansi, L. panamensis and Lutzomyia cayennensis cayennensis), Equus asinus (L. evansi and L. panamensis), Bos taurus (L. evansi, L. panamensis and L. c. cayennensis), Tamandua mexicana (L. shannoni and Lutzomyia trinidadensis), Proechimys guyanensis (L. evansi, L. panamensis and L. c. cayennensis), Mabuya sp. (Lutzomyia micropyga), Anolissp. (L. micropyga), Sus scrofa (L. evansi and Lutzomyia gomezi) and Gallus gallus (L. evansi). Cattle, donkeys, humans and pigs were significantly more important than other animals (P=0.0001) as hosts of L. evansi, this being the most abundant sand fly species. The five Lutzomyia species in which blood samples of human origin were detected included L. micropyga and L. atroclavata, constituting the first evidence of anthropophily in both species. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. ANATOMIA ÓSSEA E MUSCULAR DO CÍNGULO ESCAPULAR E BRAÇO DE Tapirus terrestris (PERISSODACTYLA: TAPIRIDAE

    Directory of Open Access Journals (Sweden)

    Saulo Gonçalves Pereira

    2015-04-01

    Full Text Available Tapirus terrestris (Linneaus, 1758 is a mammal found in South America and in almost all Brazilian biomes. The aim of this study was to describe the anatomy of bone and muscle of the scapular cingulum and arm of Tapirus terrestris and compare it with other species of mammals, especially equines. We used four animals donated to the Laboratory of Education and Research of Wild Animals of the Federal University of Uberlândia, after their death with no trauma. The bones were carefully analyzed, described and the muscles were dissected, analyzed and described in accordance with the usual techniques of gross anatomy. The skeleton of the scapular cingulum and arm of Tapirus terrestris is formed by scapula and humerus bones, the lateral muscles of the scapula are subclavian m., deltoid m. supraspinatus m. and infraspinatus, teres minor m., subscapularis m., teres major m., coracobrachialis m., shoulder joint m., biceps brachii m., brachial m. triceps, forearm tensor fasciae m., anconeus m. The muscular and bone standard found is similar to the horse (Equus caballus T. terrestris has bone and muscle characteristics of a suitable animal to displacement and eventual swimming with obvious bone accidents and developed muscles .

  18. Evaluating the impact of domestication and captivity on the horse gut microbiome.

    Science.gov (United States)

    Metcalf, Jessica L; Song, Se Jin; Morton, James T; Weiss, Sophie; Seguin-Orlando, Andaine; Joly, Frédéric; Feh, Claudia; Taberlet, Pierre; Coissac, Eric; Amir, Amnon; Willerslev, Eske; Knight, Rob; McKenzie, Valerie; Orlando, Ludovic

    2017-11-14

    The mammal gut microbiome, which includes host microbes and their respective genes, is now recognized as an essential second genome that provides critical functions to the host. In humans, studies have revealed that lifestyle strongly influences the composition and diversity of the gastrointestinal microbiome. We hypothesized that these trends in humans may be paralleled in mammals subjected to anthropogenic forces such as domestication and captivity, in which diets and natural life histories are often greatly modified. We investigated fecal microbiomes of Przewalski's horse (PH; Equus ferus przewalskii), the only horses alive today not successfully domesticated by humans, and herded, domestic horse (E. f. caballus) living in adjacent natural grasslands. We discovered PH fecal microbiomes hosted a distinct and more diverse community of bacteria compared to domestic horses, which is likely partly explained by different plant diets as revealed by trnL maker data. Within the PH population, four individuals were born in captivity in European zoos and hosted a strikingly low diversity of fecal microbiota compared to individuals born in natural reserves in France and Mongolia. These results suggest that anthropogenic forces can dramatically reshape equid gastrointestinal microbiomes, which has broader implications for the conservation management of endangered mammals.

  19. THE NITROGEN REGIME OF THE SASAR RIVER, IN BAIA MARE SECTION, THE PERIOD 2000-2010

    Directory of Open Access Journals (Sweden)

    ADRIANA MUNTEAN

    2011-03-01

    Full Text Available The Baia Mare city - the residence of Maramures county, is known as one of the most polluted cities from Romania, following a long history of mining activities and ores processing. The improper treatment of wastewater from flotation and treatment with cyanide ores and their discharge into the river Sasar led, slowly, but surely destroying the ecosystem. In addition to mining activities have contributed of course, and the metallurgical activities in the area. One of constant pollutions is and disposal of sewage waste water (treated poorly or not at all in the mass water of the Sasar river. The nitrogen regime may provide clues as to the possibility of developing various forms of life, being an indicator of the nutrient regime of aquatic life. This study aims at assessing the quality of the nitrogen regime of Sasar river, in the section upstream and downstream of Baia Mare, in the period 2000-2010, with reference to the Order 161/2006 - regarding the classification of surface water quality to determine the ecological status of water bodies .

  20. MOTIVATIONAL PRACTICES USED BY EMPLOYERS FROM THE COUNTIES OF SATU MARE AND BIHOR

    Directory of Open Access Journals (Sweden)

    Olimpia Neagu

    2013-09-01

    Full Text Available The paper explores the motivation of human resources in the companies from counties of Satu Mare and Bihor. Data were collected by applying a questionnaire to 114 companies located in the counties of Satu Mare and Bihor, within the project HURO/0901/264/2.2.2 implemented in partnership by "Vasile Goldis" Western University and University of Debrecen and financed by European Union through ERDF under Hungary-Romania 2007- 2013 Programme. Data were processed and analyzed by using the SPSS soft. We found that employers perceived as most efficient the following motivation instruments: a good communication between employees, basic wage, partial delegation of managerial tasks and optimal working conditions. The efficiency of the motivation instruments in the view of employers differs significantly across activity sectors. Thus, using the ANOVA test, we found that the variation of variables related to basic wage, performance rewarding, bonuses, partial delegation of managerial tasks, work competencies, fear of job loss, need for affiliation to a workgroup, the prestige outside the organisation, working a good reputation organisation, social benefits, home distance can be explained in a proportion ranged from 23,5% to 42,9% by the variation of variable associated to the activity sector.

  1. GIS UTILITY FOR HYDROLOGICAL IMPACT EVALUATION CAUSED BY DAMAGES OF WATER SUPPLY NETWORK IN RURAL AREAS. APPLICATIONS IN BAIA MARE DEPRESSION

    Directory of Open Access Journals (Sweden)

    RADU ALEXANDRU MARIAN

    2012-11-01

    Full Text Available GIS utility for hydrological impact evaluation caused by damages of water supply network in rural areas. Applications in Baia Mare Depression. Occurrence of a failure within the water supply network is an element of risk with important hydrological implications. Although at first glance you might think that a pipe diameter of only 20 cm can generate large effects, however, in case of significant damage or even burst pipe, a good part of high water flow in the pipe (approx. 25 m3/h on average in the Baia Mare associated with a long duration of failure (several hours may be in the drain area, impact on the local community. Regarding rural settlements, surface drainage allow a quantity of water retention tank underground infiltration but in many cases lack of a sewage system effectively contribute to increased negative consequences related to such damage (flooding farms, roads, crops compromise of flooding or drought in the event of damage to the hot water supply pipe and so on. This paper focuses on the role of Geographic Information Systems (GIS to assess the impact of runoff induced by damages in rural areas. The study therefore spatial aspect, through GIS, on the one hand runoff along the flow path with the start point of the network fault location and view previous hydrological conditions of the terrain, and on the other hand the impact of runoff the rural community. Study area Dumbrăviţa settlement located in Baia Mare Depression. This village is part of water supply system to the south and southeast of Baia Mare.

  2. Dimensions of temperament modulate cue-controlled behavior: a study on Pavlovian to instrumental transfer in horses (Equus caballus.

    Directory of Open Access Journals (Sweden)

    Léa Lansade

    Full Text Available Pavlovian to instrumental transfer (PIT is a central factor in how cues influence animal behavior. PIT refers to the capacity of a Pavlovian cue that predicts a reward to elicit or increase a response intended to obtain the same reward. In the present study, using an equine model, we assessed whether PIT occurs in hoofed domestic animals and whether its efficacy can be modulated by temperamental dimensions. To study PIT, horses were submitted to Pavlovian conditioning whereby an auditory-visual stimulus was repeatedly followed by food delivery. Then, horses were submitted to instrumental conditioning during which they learned to touch with their noses an object signaled by the experimenter in order to obtain the same reward. During the PIT test, the Pavlovian conditioned stimulus was presented to the animal in the absence of reward. At the end of the experiment, a battery of behavioral tests was performed on all animals to assess five temperamental dimensions and investigate their relationships with instrumental performance. The results indicate that PIT can be observed in horses and that its efficacy is greatly modulated by individual temperament. Indeed, individuals with a specific pattern of temperamental dimensions (i.e., higher levels of gregariousness, fearfulness, and sensory sensitivity exhibited the strongest PIT. The demonstration of the existence of PIT in domesticated animals (i.e., horses is important for the optimization of its use by humans and the improvement of training methods. Moreover, because PIT may be implicated in psychological phenomena, including addictive behaviors, the observation of relationships between specific temperamental dimensions and PIT efficacy may aid in identifying predisposing temperamental attributes.

  3. Catastrophic complication following injection and extracorporeal shock wave therapy of a medial femoral condyle subchondral cystic lesion in a 14 year old Arabian mare

    Directory of Open Access Journals (Sweden)

    Darla K. Moser

    2017-05-01

    Full Text Available This report describes fibrous cyst lining injection and extracorporeal shock wave therapy (ESWT of a medial femoral condyle (MFC subchondral cystic lesion (SCL resulting in catastrophic MFC fracture in an Arabian mare. The mare was presented for evaluation of a severe hind limb lameness of approximately 4 months duration. On presentation, a non-weight bearing lameness of the left hind limb with severe effusion and soft tissue swelling of the stifle region was noted. Radiographic evaluation of the stifle revealed a large SCL of the MFC with associated osteoarthritis. Arthroscopic guided intra-lesional injection of the SCL with corticosteroids and autologous bone marrow concentrate was performed followed by ESWT of the MFC. The mare was discharged walking comfortably 48-hours post-operatively. An acute increase in lameness was noted 14 days post-operatively. Imaging revealed catastrophic fracture of the left MFC. Possible mechanisms leading to failure of the MFC secondary to the described treatment are discussed.

  4. Draft Genome Sequence of Leuconostoc mesenteroides 406 Isolated from the Traditional Fermented Mare Milk Airag in Tuv Aimag, Mongolia

    OpenAIRE

    Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Nguyen, Tien Thi Thuy; Wulijideligen,; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku

    2016-01-01

    Leuconostoc mesenteroides 406 was isolated from the traditional fermented mare milk airag in Tuv Aimag, Mongolia. This strain produces an antilisterial bacteriocin. Here, we report the draft genome sequence of this organism.

  5. Horse species symposium: a novel approach to monitoring pathogen progression during uterine and placental infection in the mare using bioluminescence imaging technology and lux-modified bacteria.

    Science.gov (United States)

    Ryan, P L; Christiansen, D L; Hopper, R M; Walters, F K; Moulton, K; Curbelo, J; Greene, J M; Willard, S T

    2011-05-01

    Uterine and placental infections are the leading cause of abortion, stillbirth, and preterm delivery in the mare. Whereas uterine and placental infections in women have been studied extensively, a comprehensive examination of the pathogenic processes leading to this unsatisfactory pregnancy outcome in the mare has yet to be completed. Most information in the literature relating to late-term pregnancy loss in mares is based on retrospective studies of clinical cases submitted for necropsy. Here we report the development and application of a novel approach, whereby transgenically modified bacteria transformed with lux genes of Xenorhabdus luminescens or Photorhabdus luminescens origin and biophotonic imaging are utilized to better understand pathogen-induced preterm birth in late-term pregnant mares. This technology uses highly sensitive bioluminescence imaging camera systems to localize and monitor pathogen progression during tissue invasion by measuring the bioluminescent signatures emitted by the lux-modified pathogens. This method has an important advantage in that it allows for the potential tracking of pathogens in vivo in real time and over time, which was hitherto impossible. Although the application of this technology in domestic animals is in its infancy, investigators were successful in identifying the fetal lungs, sinuses, nares, urinary, and gastrointestinal systems as primary tissues for pathogen invasion after experimental infection of pregnant mares with lux-modified Escherichia coli. It is important that pathogens were not detected in other vital organs, such as the liver, brain, and cardiac system. Such precision in localizing sites of pathogen invasion provides potential application for this novel approach in the development of more targeted therapeutic interventions for pathogen-related diseases in the equine and other domestic species.

  6. Antibody response in vaccinated pregnant mares to recent G3BP[12] and G14P[12] equine rotaviruses

    Directory of Open Access Journals (Sweden)

    Nemoto Manabu

    2012-11-01

    Full Text Available Abstract Background Both the G3P[12] and the G14P[12] type of equine group A rotavirus (RVA have recently become predominant in many countries, including Japan. G3 types are classified further into G3A and G3B. The G3A viruses have been circulating in Europe, Australia, and Argentina, and the G3B viruses have been circulating in Japan. However, only an inactivated vaccine containing a single G3BP[12] strain is commercially available in Japan. To assess the efficacy of the current vaccine against recently circulating equine RVA strains, we examined antibody responses in pregnant mares to recent G3BP[12] and G14P[12] strains by virus neutralization test. Findings After vaccination in five pregnant mares, the geometric mean serum titers of virus-neutralizing antibody to recent G3BP[12] strains increased 5.3- to 7.0-fold and were similar to that against homologous vaccine strain. Moreover, antibody titers to recent G14P[12] strains were also increased 3.0- to 3.5-fold. Conclusions These results suggest that inoculation of mares with the current vaccine should provide foals with virus-neutralizing antibodies against not only the G3BP[12] but also the G14P[12] RVA strain via the colostrum.

  7. Programas de Contra Turno Social para crianças e adolescentes na cidade de Maringá/PR: características e funções (Supplementary Activities Outside class time for children and adolescents in Maringá city - Paraná state: features and functions

    Directory of Open Access Journals (Sweden)

    Paula Marçal Natali

    2008-01-01

    Full Text Available Resumo: Este artigo tem o objetivo de apresentar as características e funções dos programas de contra turno social os quais atendem crianças e adolescentes em situação de risco, na cidade de Maringá-PR, que foram implantados no início dos anos 90. Este estudo faz parte de uma pesquisa de mestrado que analisa os Programas de Contra Turno Social na cidade de Maringá-PR, mais especificamente no que se refere à questão do papel do lúdico inserido no currículo destes programas de contra turno social. Esta forma de atendimento foi legitimada pelo Estatuto da Criança e do Adolescente no que diz respeito às políticas de atendimento em regime de apoio sócio-educativo em meio aberto. Nesta pesquisa qualitativa, no primeiro momento apresentaremos um breve panorama das políticas de atendimento à criança e ao adolescente no Brasil, partindo da promulgação do Código de Menores de 1927 e chegando ao Estatuto da Criança e do Adolescente de 1990. Em um segundo momento, relataremos as representações dos órgãos governamentais e da sociedade civil sobre como os programas sociais de contra turno vem sendo realizados na cidade de Maringá através de entrevistas com funcionárias da Secretaria de Assistência Social e Cidadania do município e membros do Conselho Municipal da Criança e do Adolescente. Entendemos que as representações sobre o contra turno social na cidade de Maringá são carregadas de elementos técnicos e burocráticos e muito incipientes em relação aos fundamentos pedagógicos e filosóficos deste atendimento que são elementos primordiais para a efetivação dos direitos à criança e ao adolescente em situação de risco fundamentada na concepção do Estatuto da Criança e do Adolescente de sujeito de direito que busque a participação popular e que tenha um projeto emancipatório.Abstract: This paper aims to present the features and functions of the programmes of supplementary activities offered outside of

  8. Os sistemas atmosféricos e a variação do tempo em Maringá, Estado do Paraná, Brasil = Atmosphere systems and weather variations in Maringá, Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Leonor Marcon da Silveira

    2006-01-01

    Full Text Available O município de Maringá, atravessado pelas coordenadas de 23º27´S e51º57´W, situa-se no Norte do Estado do Paraná - Brasil. Verifica-se aí acentuada variação do tempo atmosférico, decorrente da alternância de sistemas atmosféricos tropicais e extratropicais. O presente estudo teve por objetivo investigar as variações diárias doselementos climáticos à superfície em Maringá e suas relações com os sistemas atmosféricos geradores dos diferentes tipos de tempo que atuaram durante o outono e o inverno de 1996. Objetivou também averiguar as relações entre a atuação da Frente Polar Atlântica (FPA e a pluviosidade local. Elegeu-se o ano de 1996 por apresentar neutralidade em relação aos fenômenos El Niño e La Niña. Esse estudo apoiou-se na concepção dinâmica de clima e na metodologia da análise rítmica. Constatou-se que, durante o período em estudo, todas aschuvas decorreram, direta ou indiretamente, da Frente Polar Atlântica (FPA. Constatou-se também que a pluviosidade esteve mais relacionada com a duração dos sistemas frontais do que com o número de passagens desses sistemas pela região. As temperaturas muito baixas decorreram principalmente das incursões de sistemas polares interiorizados e geralmente ocorreram quando as frentes não promoveram chuva.The municipality of Maringá, 23°27' S and 51°57' W, lies in the north State of Paraná, southern Brazil. Pronounced atmosphere variations are due to alternations in tropical and extra-tropical atmosphere systems. Daily variations of surface climate factors in Maringá and their relationships with atmospheric systems which cause different types of weather during autumn and winter of 1996 have been investigated. The relationship between the activities of the Atlantic Polar Front (APF and local rainfall has also been analyzed. The year 1996 has been chosen because of the absence of the El Niño and LaNiña phenomena. The analysis was based on the dynamic

  9. Soil water balance simulated by CROPGRO-Drybean model for edaphoclimatic conditions in Maringá Balanço da água no solo simulado pelo modelo CROPGRO-Drybean para as condições edafoclimáticas de Maringá

    Directory of Open Access Journals (Sweden)

    Rivanildo Dallacort

    2010-04-01

    Full Text Available The performance of the CROPGRO-Drybeans model for the prediction of soil water balance, as well as growth components and bean crop yield, was assessed using data from two field experiments conducted at the State University of Maringá Irrigation Technical Center, Paraná - Brazil, (latitude 23º27'S, longitude 51º57' and altitude 542 m, during the 2005 and 2006 growing season. The model simulations correlated well with measured soil moisture (r > 0.7 for both experiments. However, there were high discrepancies between measured and simulated soil moisture values on the days after rainfall. In addition, it was found that the model exaggerates the effect of water stress during the flowering phase, which leds to underprediction (19 and 29% of crop yield.O desempenho do modelo CROPGRO-Drybeans para predição do balanço de água no solo, componentes de crescimento e produtividade, foram avaliados por meio de dados de dois experimentos de campo conduzidos no Centro Técnico de Irrigação da Universidade Estadual de Maringá, localizado em Maringá, PR (latitude 23º 25' S, longitude de 51º 57' O, altitude de 542 m, nos os anos agrícolas de 2005 e 2006. Concluiu-se que o modelo simulou estresse hídrico maior que o real na fase de florescimento, subestimando o rendimento em 19 e 29%. Os valores de umidade do solo medidos no campo e simulados pelo CROPGRO, foram bem correlacionados (r > 0,7, porém houve discrepância acentuada nos valores medidos e simulados no dia posterior à ocorrência da precipitação.

  10. Management of Stakeholders in Urban Regeneration Projects. Case Study: Baia-Mare, Transylvania

    Directory of Open Access Journals (Sweden)

    Corina M. Rădulescu

    2016-03-01

    Full Text Available The process of regeneration of abandoned areas or deteriorated structures in the cities of Romania has become a strategy of urban-integrated development. Conversions and/or regeneration of facilities in the form of assets, with different destinations, are part of the new trend of urban regeneration and a strategy used to attract investment capital. The disappearance of mining industry sites in Maramures County, Romania, has allowed the expansion and planning of new spaces for public use and/or semipublic, and most cities have opened new development perspectives. The study is based on empirical research conducted on the brownfields of Baia-Mare City. This research investigates how stakeholders of an urban regeneration project can be more actively involved in the decision-making processes with regard to the strategic elements of the renewal project of Cuprom, as a former mining industry area. This research contributes to the development of the investigation of new types of knowledge of stakeholder analysis and improves the available practices for stakeholder salience. Social networks created and consolidated by stakeholders of an urban regeneration project are the object of analysis, evaluation, and monitoring of the equilibrium between project management and grant of resources and capital. This paper studies the salience of stakeholders of the SEPA-CUPROM project from Baia-Mare using the social networking approach. Visualization by graphical methods of social networking analysis is a useful instrument in the decision-making process of brownfield projects as part of sustainable strategies in Romania.

  11. Seroepidemiology of Sarcocystis neurona and Neospora hughesi infections in domestic donkeys (Equus asinus) in Durango, Mexico.

    Science.gov (United States)

    Alvarado-Esquivel, Cosme; Howe, Daniel K; Yeargan, Michelle R; Alvarado-Esquivel, Domingo; Alfredo Zamarripa-Barboza, José; Dubey, Jitender P

    2017-01-01

    There is currently no information regarding Sarcocystis neurona and Neospora hughesi infections in donkeys in Mexico. Here, we determined the presence of antibodies against S. neurona and N. hughesi in donkeys in the northern Mexican state of Durango. Serum samples of 239 domestic donkeys (Equus asinus) were assayed for S. neurona and N. hughesi antibodies using home-made enzyme-linked immunoassays; six (2.5%) of the 239 donkeys tested seropositive for S. neurona. The seroprevalence of S. neurona infection was comparable among donkeys regardless of their origin, health status, or sex. Multivariate analysis showed that seropositivity to S. neurona was associated with increased age (OR = 2.95; 95% CI: 1.11-7.82; p = 0.02). Antibodies to N. hughesi were found in two (0.8%) of the 239 donkeys. Both exposed donkeys were healthy, 3- and 6-year-old females. This is the first evidence of S. neurona and N. hughesi infections in donkeys in Mexico. © C. Alvarado-Esquivel et al., published by EDP Sciences, 2017.

  12. Pre-mare cratering and early solar system history

    International Nuclear Information System (INIS)

    Wetherill, G.W.

    1974-01-01

    An evaluation of the application of the high extra-lunar flux in pre-mare times to more general problems of early solar system history is attempted by combining the results of dynamic studies with lunar chronological data. Dynamical studies permit separate evaluation of the possible sources for both the normal flux during the first 600 m.y. years of lunar history as well as the peak which apparently occurred 4.0 b.y. ago. Dynamical studies have been carried out in order to determine the extent to which a heliocentric flux could be confined to the Moon (and Earth). A Monte Carlo method has been used to calculate the relative impact rates of planet-crossing bodies with the moon and the terrestrial planets. It is concluded that the time-variation of the flux on these planets is closely related to that on the moon

  13. The method of preparation and use of vasectomized stallions to regulate the sexual function in mares during hippodrome testing

    Directory of Open Access Journals (Sweden)

    Nursulu Julanova

    2016-01-01

    Full Text Available The objective of this study was to develop a method of preparation and use of vasectomized stallions, and to test them as a factor preventing genital functional disorders in mares during training and hippodrome testing. Thoroughbred mares of English, Arabic and Akhal-Teke breeds owned by horse ranches of the Republic of Kazakhstan were used in the research. Vasectomy techniques were mastered on a slaughtering material, and then field tested on stallions. A series of experiments were set for comparative evaluation of various methods of preparation and use of a vasectomized stallion, resulting in a technique based on removing the front section of sperm ducts in the ventro-caudal portion of the scrotum. The developed method is convenient, safe, and easy to perform in field conditions. The surgery is not time consuming, and there are no postoperative complications. We found a positive effect of the vasectomized stallion on the course of the mares’ oestrous cycles, on their performance during hippodrome testing, and their reproductive function. The method reduced the standing heat period, and the mares quickly recovered their performance. Thus, it decreased the time of the mares’ elimination from the training schedule and had a positive effect on the performance during hippodrome testing. The use of a vasectomized stallion during training significantly predetermined the course of the mares’ reproductive cycle after completion of the hippodrome testing. The results of this study are relevant to the practical needs of sport horse breeding.

  14. Draft Genome Sequence of Leuconostoc mesenteroides 406 Isolated from the Traditional Fermented Mare Milk Airag in Tuv Aimag, Mongolia.

    Science.gov (United States)

    Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Nguyen, Tien Thi Thuy; Wulijideligen; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku

    2016-03-24

    Leuconostoc mesenteroides406 was isolated from the traditional fermented mare milk airag in Tuv Aimag, Mongolia. This strain produces an antilisterial bacteriocin. Here, we report the draft genome sequence of this organism. Copyright © 2016 Morita et al.

  15. Endoscopic diagnosis and management of an unusual nasal foreign body in a mare

    Directory of Open Access Journals (Sweden)

    Turke M. Shawaf

    2017-06-01

    Full Text Available Occurrence of intra-nasal foreign bodies is uncommon in horses. This report describes -for the first time- a case of a 4-year-old Arabian-cross mare with unilateral mucopurulent nasal discharge, epistaxis and exercise intolerance due to intra-nasal foreign body. Clinical signs, radiography and endoscopic examination confirmed the presence of a tooth fragment (foreign body embedded in the ventral valve of the left nasal cavity. The foreign body was successfully removed using alligator forceps under endoscopic guidance.

  16. Host social rank and parasites: plains zebra (Equus quagga) and intestinal helminths in Uganda.

    Science.gov (United States)

    Fugazzola, M C; Stancampiano, L

    2012-08-13

    The main aim of this study was to evaluate the relationship between the social hierarchy of plain zebra, Equus quagga, and the level of parasitism. For the study 141 fecal samples from the same number of animals were collected within the two major populations of E. quagga of Uganda (Lake Mburo Conservation Area and Kidepo Valley National Park). Quantitative (eggs per gram of feces) and qualitative parasite assessment were performed with standard methods. The relationship between parasite burden and individual host features was analyzed using Generalized Linear Models. Strongyles, cestodes, Strongyloides sp. and oxiurids where present in the examined samples. Social rank and age class significantly affect all parasites' abundance with dominant individuals being less parasitized than subordinate individuals, regardless of the parasite groups excluding oxiurids. Sex could not been shown to be related with any of the found parasites. Age was positively related with strongyles and oxiurids abundance and negatively related with cestodes and Strongyloides sp. The main result of the present study was the evidence that social status influences parasite level with dominant zebras shedding less parasite eggs than subordinate ones. Social rank appears, therefore, as an important factor giving rise to parasite aggregation in plain zebras. Copyright © 2012 Elsevier B.V. All rights reserved.

  17. Frequency of Gastric Pathologies in Donkeys (Equus africanus asinus in Córdoba, Colombia

    Directory of Open Access Journals (Sweden)

    José Alberto Cardona Álvarez

    2015-12-01

    Full Text Available This study aimed to determine the frequency of gastric pathologies in donkeys (Equus africanus asinus in the department of Córdoba, Colombia. Stomachs of 137 donkeys (73 intact males, 16 castrated males, and 48 females, aged between 1 to 25 years, were examined, characterized and photographed post mortem. Data on sex, age and pathology were reported on the respective forms and then digitized. Of the total population (137 donkeys, stomach ulcers and associated gastritis were found in 100% of the samples, antral edema in 56.9%, parasites (Trichostrongylus axei in 10.2%, and impaction in 5.8%. Furthermore, Hemomelasma gastric was found in one stomach (0.7%. As a conclusion, 100% of the evaluated animals presented at least some kind of gastric pathology. Acute gastritis was the most frequent type (71.5%, followed in a smaller proportion by chronic gastritis (28.4%. The study showed a significant statistical dependence between age and the degree of injury to the glandular mucosa (p < 0.05. Thus, it evidenced a high incidence of gastric pathologies in donkeys in different livestock holdings in Córdoba, among which squamous ulcers are the most frequent ones, followed by acute gastritis and antral edema. For this reason, it is necessary to do more research and to raise awareness about the treatment of these pathologies in these animals.

  18. In vivo effect of interleukin-1beta and interleukin-1RA on oocyte cytoplasmic maturation, ovulation, and early embryonic development in the mare

    Directory of Open Access Journals (Sweden)

    Gérard Nadine

    2005-06-01

    Full Text Available Abstract A growing body of evidence suggests that the interleukin-1 system is involved in periovulatory events. Previous work from our lab demonstrated that in the mare, interleukin-1beta (IL-1beta increases the ovulatory rate of metaphase II oocytes. The present study was conducted to analyze in vivo the effect of IL-1 on oocyte cytoplasmic maturation, ovulation and pregnancy rate. In the present work, IL-1beta (experiment 1, n = 13; experiment 2, n = 25 and interleukin-1RA (IL-1RA; experiment 1, n = 25 were injected intrafollicularly by using the transvaginal ultrasound-guided injection method. Injections were performed on cyclic mares when the diameter of the growing dominant follicle reached 30–34 mm. In experiment 1, mares were inseminated the day of the treatment and all the other day until ovulation. The time of ovulation was determined and a pregnancy diagnosis was performed 14 days after ovulation of the injected follicle. In experiment 2, the cumulus-oocyte complex from each injected follicle was collected by transvaginal ultrasound-guided aspiration 38 h after the intrafollicular injection. Oocyte nuclear stage and oocyte cytoplasmic maturation were assessed by analyzing chromatin configuration, cortical granules migration and mitochondria distribution under a confocal microscope. The results from experiment 1 confirm that an intrafollicular injection of 1 microgram IL-1beta induces ovulation in the mare whereas IL-1RA has no effect at the dose used in the present study. Furthemore, we demonstrated, that in our experimental conditions, IL-1beta and IL-1RA induced a decrease in embryo development. Experiment 2 leads us to observe that IL-1beta is unable to induce cortical granules migration and remodelling of mitochondria, that commonly occurs during oocyte maturation, whereas it acts on nuclear maturation. This result may explain the decrease in embryo development we observed after IL-1beta intrafollicular injection. In conclusion

  19. Morphological and physiological features of the species Asimina triloba (L. dunal, introduced as an ornamental plant in Baia Mare (Maramureş county, Romania

    Directory of Open Access Journals (Sweden)

    Beatrice SZILAGYI

    2011-11-01

    Full Text Available Tree species Asimina triloba (L. Dunal, is native to North America. In the area of origin is cultivated, both as food species because the edible fruit, and as ornamental species. Ornamental value derives both from decorative flowers, that open in early spring, and because habitus species. The species is demanding from slightly acidic soils (pH 5.5 to 7.0 and well drained. Seedlings are susceptible to heatstroke and need areas of the sun, but since the second year, vegetate well in bright light conditions [27]. Optimum climate is temperate to subtropical one. The species exhibits unique quality traits for a temperate fruit that are similar to other fruit in the Annonaceae family, including cherimoya (Annona cherimola Mill., sugar apple or sweetsop, (A. squamosa L., soursop (A. muricata L., custard apple (A. reticulata L., and atemoya (A. squamosa X A. cherimola, all of which are tropical [2].This study follows the behavior of the species, in particular conditions of the Baia Mare and its surroundings. In this area a fewindividuals were introduced, in order to diversigy the range of species of ornamental plants. In Baia Mare, topoclimate is specifically depression, sheltered by mountains, more atenuated as temperature and winds, than in surrounding areas. As a result ofclimatic conditions, chestnut Castanea sativa, grows in good conditions in Baia Mare. Instead, the area is heavily polluted,especially at ground level. Pollution by heavy metals is a historical being generated by the mining industry.The introduction and use of a new plant species into a new area involves: 1. easy to obtain seed; 2.- maintaining the crown shape habitus and and leaf shape and size, respectively; 3 – determination of optimal physiological parameters. Therefore have been performed, the following experimental determinations: 1. - germination of seed obtained in the particular conditions of the Baia Mare; 2. - some morphomtric characteristics of leaves, in the juveniles

  20. Draft Genome Sequence of Leuconostoc mesenteroides 213M0, Isolated from Traditional Fermented Mare Milk Airag in Bulgan Aimag, Mongolia

    OpenAIRE

    Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Bolormaa, Tsognemekh; Burenjargal, Sedkhuu; Nguyen, Co Thi Kim; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku

    2016-01-01

    Leuconostoc mesenteroides 213M0 was isolated from traditional fermented mare milk airag in Bulgan Aimag, Mongolia. This strain produces a listericidal bacteriocin-like inhibitory substance. Here, we report the draft genome sequence of this organism.

  1. Regional stratigraphy and geologic history of Mare Crisium

    Science.gov (United States)

    Head, J. W., III; Adams, J. B.; Mccord, T. B.; Pieters, C.; Zisk, S.

    1978-01-01

    Remote sensing and Luna 24 sample data are used to develop a summary of the regional stratigraphy and geologic history of Mare Crisium. Laboratory spectra of Luna 24 samples, telescopic reflectance spectra in the 0.3 to 1.1 micron range and orbital X-ray data have identified three major basalt groups in the region. Group I soil is derived from iron- and magnesium-rich titaniferous basalts and was apparently emplaced over the majority of the basin, however is presently exposed as a shelf in the southwest part. Group II soils, derived from very low titanium ferrobasalts, were emplaced in two stages subsequent to Group I emplacement and now appear as part of the outer shelf and topographic annulus. Subsidence of the basin interior preceded and continued after the emplacement of the third basalt group, a soil derived from a low titanium ferrobasalt. The Luna 24 site is found to be within a patch of Group II material.

  2. Subsurface structures in the northern Mare Imbrium measured by Chang'E-3 and SELENE

    Science.gov (United States)

    Kumamoto, A.; Ishiyama, K.; Feng, J.

    2016-12-01

    Subsurface structures in the northern Mare Imbrium measured by Chang'E-3 and SELENE have been compared. In Chang'E-3 mission, subsurface radar sounding at (19.51W, 44.12N) was performed by Lunar Penetrating Radar (LPR) onboard the Yutu rover. The LPR was pulse radar operated at two frequencies: 60 MHz and 500 MHz. During its operation period from December 2013 to January 2014, the LPR observed subsurface echoes along the rover's track with total distance of 114 m. From the observation in 60 MHz, the subsurface echoes from buried regolith layers at depths of 35, 50, 140, 240, and 360 m were reported (Xiao et al., 2015). In SELENE mission, global subsurface radar sounding of the moon was performed by Lunar Radar Sounder (LRS) onboard the SELENE (Kaguya) spacecraft from the polar orbit with an altitude of 100 km. The LRS was chirp radar operated in a frequency range from 4-6 MHz. So the range resolution of LRS was 75 m in vacuum. During operation period from December 2007 to September 2008, subsurface echoes from all areas of the Moon was observed with a lateral resolution of 76 m. From the global observation, the subsurface echoes from the buried regolith layers in the neraside maria including Mare Imbrium at depths of several hundred meters were reported (Ono et al., 2009).In the present study, we focus on SELENE/LRS data obtained at (19.50W, 44.12N) which is the nearest to the Chang'E-3 landing site. While clear and large-scale subsurface reflectors, as found in Ono et al. (2009), are not found in it, we can identify some echo components from the depths of 140 ( 2000 ns), 240 ( 4000 ns), and 360 m ( 6000 ns). Further analyses utilizing high-resolution data from Chang'E-3/LPR and large-scale data from SELENE/LRS, we will be able to determine the thickness and large-scale structures of the buried regolith layers found by the both radars, and discuss their formation processes in volcanic history of Mare Imbrium.

  3. Sulfate influx on band 3 protein of equine erythrocyte membrane (Equus caballus) using different experimental temperatures and buffer solutions.

    Science.gov (United States)

    Casella, S; Piccione, D; Ielati, S; Bocchino, E G; Piccione, G

    2013-06-01

    The aim of this study was to assess the anion transport in equine erythrocytes through the measurement of the sulfate uptake operating from band 3 using different experimental temperatures and buffer solutions. Blood samples of six clinically healthy horses were collected via jugular vein puncture, and an emochrome-citometric examination was performed. The blood was divided into four aliquots and by centrifugation and aspiration the plasma and buffy coat were carefully discarded. The red blood cells were washed with an isosmotic medium and centrifuged. The obtained cell suspensions were incubated with two different experimental buffer solutions (buffer A: 115 mM Na2SO4, 10 mM NaCl, 20 mM ethylenediaminetetraacetic acid, 30 mM glucose; and buffer B: 115 mM Na2SO4, 10 mM NaCl, 20 mM ethylenediaminetetraacetic acid, 30 mM MgCl2) in a water bath for 1 h at 25 °C and 37 °C. Normal erythrocytes, suspended at 3% hematocrit, were used to measure the SO4= influx by absorption spectrophotometry at 425 nm wavelength. Unpaired Student's t-test showed a statistically significant decrease (P buffer solutions. Comparing the buffer A with buffer B unpaired Student's t-test showed statistically lower values (P < 0.0001) for A solution versus B solution both at 25 °C and at 37 °C. The greater inhibition of SO4 (=) influx measured in equine erythrocytes indicates the increased formation of the sulfydryl bonds in band 3 and the modulation of the sulfydryl groups, culminating in the conformational changes in band 3. Copyright © 2012 John Wiley & Sons, Ltd.

  4. Evaluation of circulating miRNAs during late pregnancy in the mare.

    Directory of Open Access Journals (Sweden)

    Shavahn C Loux

    Full Text Available MicroRNAs (miRNAs are small, non-coding RNAs which are produced throughout the body. Individual tissues tend to have a specific expression profile and excrete many of these miRNAs into circulation. These circulating miRNAs may be diagnostically valuable biomarkers for assessing the presence of disease while minimizing invasive testing. In women, numerous circulating miRNAs have been identified which change significantly during pregnancy-related complications (e.g. chorioamnionitis, eclampsia, recurrent pregnancy loss; however, no prior work has been done in this area in the horse. To identify pregnancy-specific miRNAs, we collected serial whole blood samples in pregnant mares at 8, 9, 10 m of gestation and post-partum, as well as from non-pregnant (diestrous mares. In total, we evaluated a panel of 178 miRNAs using qPCR, eventually identifying five miRNAs of interest. One miRNA (miR-374b was differentially regulated through late gestation and four miRNAs (miR-454, miR-133b, miR-486-5p and miR-204b were differentially regulated between the pregnant and non-pregnant samples. We were able to identify putative targets for the differentially regulated miRNAs using two separate target prediction programs, miRDB and Ingenuity Pathway Analysis. The targets for the miRNAs differentially regulated during pregnancy were predicted to be involved in signaling pathways such as the STAT3 pathway and PI3/AKT signaling pathway, as well as more endocrine-based pathways, including the GnRH, prolactin and insulin signaling pathways. In summary, this study provides novel information about the changes occurring in circulating miRNAs during normal pregnancy, as well as attempting to predict the biological effects induced by these miRNAs.

  5. Parasite-mediated selection drives an immunogenetic tradeoff in plains zebra (Equus quagga)

    Science.gov (United States)

    Kamath, Pauline L.; Turner, Wendy C.; Küsters, Martina; Getz, Wayne M.

    2014-01-01

    Pathogen evasion of the host immune system is a key force driving extreme polymorphism in genes of the major histocompatibility complex (MHC). Although this gene family is well characterized in structure and function, there is still much debate surrounding the mechanisms by which MHC diversity is selectively maintained. Many studies have investigated relationships between MHC variation and specific pathogens, and have found mixed support for and against the hypotheses of heterozygote advantage, frequency-dependent or fluctuating selection. Few, however, have focused on the selective effects of multiple parasite types on host immunogenetic patterns. Here, we examined relationships between variation in the equine MHC gene, ELA-DRA, and both gastrointestinal (GI) and ectoparasitism in plains zebras (Equus quagga). Specific alleles present at opposing population frequencies had antagonistic effects, with rare alleles associated with increased GI parasitism and common alleles with increased tick burdens. These results support a frequency-dependent mechanism, but are also consistent with fluctuating selection. Maladaptive GI parasite ‘susceptibility alleles’ were reduced in frequency, suggesting that these parasites may play a greater selective role at this locus. Heterozygote advantage, in terms of allele mutational divergence, also predicted decreased GI parasite burden in genotypes with a common allele. We conclude that an immunogenetic trade-off affects resistance/susceptibility to parasites in this system. Because GI and ectoparasites do not directly interact within hosts, our results uniquely show that antagonistic parasite interactions can be indirectly modulated through the host immune system. This study highlights the importance of investigating the role of multiple parasites in shaping patterns of host immunogenetic variation.

  6. Genetic diversity of the Ethiopian Grevy's zebra (Equus grevyi) populations that includes a unique population of the Alledeghi Plain.

    Science.gov (United States)

    Kebede, Fanuel; Rosenbom, Sonia; Khalatbari, Leili; Moehlman, Patricia D; Beja-Pereira, Albano; Bekele, Afework

    2016-01-01

    The endangered Grevy's Zebra (Equus grevyi) is confined to the Horn of Africa, specifically Ethiopia and Kenya. It is threatened by habitat loss and fragmentation due to human encroachment of historic range. Knowledge of population genetics is essential for the development of appropriate conservation actions and management. The focus of this study was to assess the heterogeneity and genetic distinctiveness of the two Grevy's zebra populations in Ethiopia. Non-invasive fecal samples (N = 120) were collected during 2009-2010 from Grevy's zebra populations in the Alledeghi Wildlife Reserve and the Sarite area, Ethiopia. Analyses of a 329 bp of the mtDNA control region of 47 sequences, revealed the existence of two unreported haplotypes in the northern population of Alledeghi, that were not shared with the southern population of Sarite. The Sarite population is contiguous with the Grevy's zebra population in Kenya. The nucleotide diversity levels found in both the populations are extremely low.

  7. High variation and very low differentiation in wide ranging plains zebra (Equus quagga): insights from mtDNA and microsatellites.

    Science.gov (United States)

    Lorenzen, Eline D; Arctander, Peter; Siegismund, Hans R

    2008-06-01

    Patterns of genetic differentiation in the plains zebra (Equus quagga) were analysed using mitochondrial DNA control region variation and seven microsatellites. The six morphologically defined subspecies of plains zebra lacked the population genetic structure indicative of distinct evolutionary units. Both marker sets showed high levels of genetic variation and very low levels of differentiation. There was no geographical structuring of mitochondrial DNA haplotypes in the phylogenetic tree, and the plains zebra showed the lowest overall differentiation recorded in any African ungulate studied so far. Arid-adapted African ungulates have shown significant regional genetic structuring in support of the Pleistocene refuge theory. This was not the case in the zebra, and the data are discussed in relation to the impact of Pleistocene climate change on a nonbovid member of the savannah ungulate community. The only other species showing a similar absence of genetic structuring is the African buffalo (Syncerus caffer), but this taxon lacks the high levels of morphological variation present in the plains zebra.

  8. Relationship between colour flow Doppler sonographic assessment of corpus luteum activity and progesterone concentrations in mares after embryo transfer

    NARCIS (Netherlands)

    Brogan, P. T.; Henning, H.; Stout, T. A E; de Ruijter-Villani, M.

    2016-01-01

    Colour-flow Doppler sonography has been described as a means of assessing corpus luteum (CL) function rapidly, because area of luteal blood vessels correlates well with circulating progesterone (P4) concentrations [P4] in oestrous cycling mares. The aim of this study was to assess the relationships

  9. Prof.Ing. Vladimír Mareček, DrSc. se potká se pětašedesátkou

    Czech Academy of Sciences Publication Activity Database

    Samec, Zdeněk; Štulík, K.

    2009-01-01

    Roč. 103, č. 10 (2009), s. 867-867 ISSN 0009-2770 Institutional research plan: CEZ:AV0Z40400503 Keywords : Prof. Mareček * electrochemistry Subject RIV: CG - Electrochemistry Impact factor: 0.717, year: 2009

  10. STUDY OF MINERALOGY OF MARE HUMORUM, MOON UTILIZING HySI and M3 DATA FROM CHANDRAYAAN-I MISSION Dr. Mamta Chauhan and Mayank BishwariDept. of Geology, School of Earth Sciences, Banasthali Vidyapith, Rajasthan, INDIA geologymamta@gmail.com

    Science.gov (United States)

    Chauhan, M.

    2017-12-01

    Mare Humorum, centered at 24°S and 39°W is a mare basin of Nectarian age present at the southwestern end of Oceanus Procellarum towards the nearside of the Moon. It displays several rings, in varying states of exposure and preservation. The area is entirely flooded by mare material that constitutes its major recognizable event. In the present study, investigation of mineralogy of the basaltic flows of Mare Humorum basin have been undertaken to understand its compositional character, especially the pyroxene variability. Primarily, high-resolution data of Hyperspectral Imager (HySI) (Spatial resolution, 80m/pixel) from Chandrayaan-I mission of Indian Space Research Organization (I.S.R.O) have been used. Besides, Moon Mineralogy Mapper M3 data (140 m/pixel) from the same mission, with its full coverage of the area have been used as base of whole study. The spectral properties of pyroxenes have utilized for characterization of mare lithology and to demarcate the various spectral units based on pyroxene-variability. The compositional analysis results, thus obtained, are studied and discussed for understanding the basaltic evolution of the Humorum basin.

  11. Cryptic etiopathological conditions of equine nervous system with special emphasis on viral diseases

    Directory of Open Access Journals (Sweden)

    Rakesh Kumar

    2017-12-01

    Full Text Available The importance of horse (Equus caballus to equine practitioners and researchers cannot be ignored. An unevenly distributed population of equids harbors numerous diseases, which can affect horses of any age and breed. Among these, the affections of nervous system are potent reason for death and euthanasia in equids. Many episodes associated with the emergence of equine encephalitic conditions have also pose a threat to human population as well, which signifies their pathogenic zoonotic potential. Intensification of most of the arboviruses is associated with sophisticated interaction between vectors and hosts, which supports their transmission. The alphaviruses, bunyaviruses, and flaviviruses are the major implicated groups of viruses involved with equines/humans epizootic/epidemic. In recent years, many outbreaks of deadly zoonotic diseases such as Nipah virus, Hendra virus, and Japanese encephalitis in many parts of the globe addresses their alarming significance. The equine encephalitic viruses differ in their global distribution, transmission and main vector species involved, as discussed in this article. The current review summarizes the status, pathogenesis, pathology, and impact of equine neuro-invasive conditions of viral origin. A greater understanding of these aspects might be able to provide development of advances in neuro-protective strategies in equine population.

  12. The effects of age, rank and neophobia on social learning in horses.

    Science.gov (United States)

    Krueger, Konstanze; Farmer, Kate; Heinze, Jürgen

    2014-05-01

    Social learning is said to meet the demands of complex environments in which individuals compete over resources and cooperate to share resources. Horses (Equus caballus) were thought to lack social learning skills because they feed on homogenously distributed resources with few reasons for conflict. However, the horse's social environment is complex, which raises the possibility that its capacity for social transfer of feeding behaviour has been underestimated. We conducted a social learning experiment using 30 socially kept horses of different ages. Five horses, one from each group, were chosen as demonstrators, and the remaining 25 horses were designated observers. Observers from each group were allowed to watch their group demonstrator opening a feeding apparatus. We found that young, low-ranking and more exploratory horses learned by observing older members of their own group, and the older the horse, the more slowly it appeared to learn. Social learning may be an adaptive specialisation to the social environment. Older animals may avoid the potential costs of acquiring complex and potentially disadvantageous feeding behaviours from younger group members. We argue that horses show social learning in the context of their social ecology and that research procedures must take such contexts into account. Misconceptions about the horse's sociality may have hampered earlier studies.

  13. The brain of the horse: weight and cephalization quotients.

    Science.gov (United States)

    Cozzi, Bruno; Povinelli, Michele; Ballarin, Cristina; Granato, Alberto

    2014-01-01

    The horse is a common domestic animal whose anatomy has been studied since the XVI century. However, a modern neuroanatomy of this species does not exist and most of the data utilized in textbooks and reviews derive from single specimens or relatively old literature. Here, we report information on the brain of Equus caballus obtained by sampling 131 horses, including brain weight (as a whole and subdivided into its constituents), encephalization quotient (EQ), and cerebellar quotient (CQ), and comparisons with what is known about other relevant species. The mean weight of the fresh brains in our experimental series was 598.63 g (SEM ± 7.65), with a mean body weight of 514.12 kg (SEM ± 15.42). The EQ was 0.78 and the CQ was 0.841. The data we obtained indicate that the horse possesses a large, convoluted brain, with a weight similar to that of other hoofed species of like mass. However, the shape of the brain, the noteworthy folding of the neocortex, and the peculiar longitudinal distribution of the gyri suggest an evolutionary specificity at least partially separate from that of the Cetartiodactyla (even-toed mammals and cetaceans) with whom Perissodactyla (odd-toed mammals) are often grouped.

  14. Analysis of the 227 bp short interspersed nuclear element (SINE insertion of the promoter of the myostatin (MSTN gene in different horse breeds

    Directory of Open Access Journals (Sweden)

    Stefania Dall'Olio

    2014-09-01

    Full Text Available The myostatin (MSTN gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic. The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81 and in the Thoroughbred (0.51, whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

  15. Analysis of the 227 bp short interspersed nuclear element (SINE) insertion of the promoter of the myostatin (MSTN) gene in different horse breeds.

    Science.gov (United States)

    Dall'Olio, Stefania; Scotti, Emilio; Fontanesi, Luca; Tassinari, Marco

    2014-01-01

    The myostatin (MSTN) gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus) MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE) insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs) generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot) and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81) and in the Thoroughbred (0.51), whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

  16. Peeling back the evolutionary layers of molecular mechanisms responsive to exercise-stress in the skeletal muscle of the racing horse.

    Science.gov (United States)

    Kim, Hyeongmin; Lee, Taeheon; Park, Woncheoul; Lee, Jin Woo; Kim, Jaemin; Lee, Bo-Young; Ahn, Hyeonju; Moon, Sunjin; Cho, Seoae; Do, Kyoung-Tag; Kim, Heui-Soo; Lee, Hak-Kyo; Lee, Chang-Kyu; Kong, Hong-Sik; Yang, Young-Mok; Park, Jongsun; Kim, Hak-Min; Kim, Byung Chul; Hwang, Seungwoo; Bhak, Jong; Burt, Dave; Park, Kyoung-Do; Cho, Byung-Wook; Kim, Heebal

    2013-06-01

    The modern horse (Equus caballus) is the product of over 50 million yrs of evolution. The athletic abilities of the horse have been enhanced during the past 6000 yrs under domestication. Therefore, the horse serves as a valuable model to understand the physiology and molecular mechanisms of adaptive responses to exercise. The structure and function of skeletal muscle show remarkable plasticity to the physical and metabolic challenges following exercise. Here, we reveal an evolutionary layer of responsiveness to exercise-stress in the skeletal muscle of the racing horse. We analysed differentially expressed genes and their co-expression networks in a large-scale RNA-sequence dataset comparing expression before and after exercise. By estimating genome-wide dN/dS ratios using six mammalian genomes, and FST and iHS using re-sequencing data derived from 20 horses, we were able to peel back the evolutionary layers of adaptations to exercise-stress in the horse. We found that the oldest and thickest layer (dN/dS) consists of system-wide tissue and organ adaptations. We further find that, during the period of horse domestication, the older layer (FST) is mainly responsible for adaptations to inflammation and energy metabolism, and the most recent layer (iHS) for neurological system process, cell adhesion, and proteolysis.

  17. Draft Genome Sequence of Leuconostoc mesenteroides 213M0, Isolated from Traditional Fermented Mare Milk Airag in Bulgan Aimag, Mongolia.

    Science.gov (United States)

    Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Bolormaa, Tsognemekh; Burenjargal, Sedkhuu; Nguyen, Co Thi Kim; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku

    2016-03-31

    Leuconostoc mesenteroides213M0 was isolated from traditional fermented mare milk airag in Bulgan Aimag, Mongolia. This strain produces a listericidal bacteriocin-like inhibitory substance. Here, we report the draft genome sequence of this organism. Copyright © 2016 Morita et al.

  18. MARE2DEM: a 2-D inversion code for controlled-source electromagnetic and magnetotelluric data

    Science.gov (United States)

    Key, Kerry

    2016-10-01

    This work presents MARE2DEM, a freely available code for 2-D anisotropic inversion of magnetotelluric (MT) data and frequency-domain controlled-source electromagnetic (CSEM) data from onshore and offshore surveys. MARE2DEM parametrizes the inverse model using a grid of arbitrarily shaped polygons, where unstructured triangular or quadrilateral grids are typically used due to their ease of construction. Unstructured grids provide significantly more geometric flexibility and parameter efficiency than the structured rectangular grids commonly used by most other inversion codes. Transmitter and receiver components located on topographic slopes can be tilted parallel to the boundary so that the simulated electromagnetic fields accurately reproduce the real survey geometry. The forward solution is implemented with a goal-oriented adaptive finite-element method that automatically generates and refines unstructured triangular element grids that conform to the inversion parameter grid, ensuring accurate responses as the model conductivity changes. This dual-grid approach is significantly more efficient than the conventional use of a single grid for both the forward and inverse meshes since the more detailed finite-element meshes required for accurate responses do not increase the memory requirements of the inverse problem. Forward solutions are computed in parallel with a highly efficient scaling by partitioning the data into smaller independent modeling tasks consisting of subsets of the input frequencies, transmitters and receivers. Non-linear inversion is carried out with a new Occam inversion approach that requires fewer forward calls. Dense matrix operations are optimized for memory and parallel scalability using the ScaLAPACK parallel library. Free parameters can be bounded using a new non-linear transformation that leaves the transformed parameters nearly the same as the original parameters within the bounds, thereby reducing non-linear smoothing effects. Data

  19. Alpha-fetoprotein is present in the fetal fluids and is increased in plasma of mares with experimentally induced ascending placentitis.

    Science.gov (United States)

    Canisso, Igor F; Ball, Barry A; Scoggin, Kirsten E; Squires, Edward L; Williams, Neil M; Troedsson, Mats H

    2015-03-01

    The objectives of this study were to: (i) determine alpha-fetoprotein (AFP) concentrations in fetal fluids (FF), and (ii) compare plasma concentrations of AFP in mares with placentitis (n=17) and gestationally age-matched control mares (n=17). Fetal fluid sampling (FFS, n=7/group) was performed at 0, 5 and 12 days post inoculation (DPI) or until abortion. Plasma was harvested daily for 12 days or until abortion. Placentitis was induced via intracervical inoculation of Streptococcus equi ssp. zooepidemicus. Proteins present in the FF were resolved by 1D-SDS-PAGE, and immunoblotting was used to detect the presence of AFP in fetal fluids. Concentrations of AFP in FF and plasma were determined with a chemiluminescence immunoassay. Mixed models for DPI, and for days from abortion (DFA) were used to analyze plasma concentrations of AFP. A protein band ∼68kDa consistent with the AFP size was present in all samples of fetal fluids examined. Immunoblotting for AFP revealed a single protein band (∼68kDa) in all samples. Concentrations of AFP in FF appeared higher than those in maternal plasma. There were effects of time (DPI p<0.0001; DFA p=0.0002) and time-by-group interactions (DPI*Group p<0.06; Group*DFA p<0.001). This study confirmed that AFP is present in the FF of mares during the third trimester of pregnancy. Experimentally induced placentitis was associated with an elevation in maternal plasma concentrations of AFP. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Fotografia religiosa: a leitura de imagens na história da Diocese de Maringá

    OpenAIRE

    Selson Garutti

    2011-01-01

    This study comprises reading photos specifically referring to the episcopate in religious photos of Dom Jaime Luiz Coelho, 1st Bishop of the Diocese of Maringá, in Paraná State, the Catholic bishops¿ period which lasted for 40 years, from 1957 to 1997. Based on acquits consists of multiple images, analyzed four categories of photographs: ecclesiastical architecture, episcopate, activities and ecclesiastical body. Noting the discourse about the Church, the social context and their relations re...

  1. Morphometric analysis of the neuronal numbers and densities of the inferior olivary complex in the donkey (Equus asinus).

    Science.gov (United States)

    Alkafafy, Mohamed; Rashed, Reda; Attia, Hossam

    2011-07-01

    The morphometric interrelations between the compartments of the inferior olivary complex (IOC) in the donkey (Equus asinus) were ascertained by examining serial sections throughout the entire length of the IOC for both sides. Nissl-stained celloidin sections of four brainstems of donkeys were used. The IOC consisted of three major nuclei and four small cell groups. The total neuronal count in both sides of the IOC was 202,040±8480 cells. The medial accessory olivary nucleus (MAO) had the largest relative area (46%) and the highest number of neurons (90,800±7600). The dorsal accessory olivary nucleus (DAO) had the second largest relative area (33%), while the principal olivary nucleus (PO) had the lowest relative area (21%). However, the total neuron count in the PO was larger (60,840±1840) than DAO (50,360±4040). The average neuronal density was 2700±400 cells/mm(3). The numerical values of the current study of the IOC in the donkey were similar to those of other mammals. Copyright © 2010 Elsevier GmbH. All rights reserved.

  2. Monitoring of toxic chemical in the basin of Maringá stream=Monitoramento de compostos químicos tóxicos na bacia do ribeirão Maringá

    Directory of Open Access Journals (Sweden)

    Célia Regina Granhen Tavares

    2012-07-01

    Full Text Available This study aimed to track the spatial and temporal variations of toxic chemical compounds, such as the metals Al, Cd, Pb, Cu, Cr, Mn, Zn and the pesticide glyphosate, in Maringá stream and in a stretch of Pirapó river. The results pointed out that, in the case of metals, one of the possible sources of these elements is associated to agricultural activities. For glyphosate, were not found concentrations above those established by the Brazilian Water Quality Legislation (CONAMA 357/2005. Concerning this, we emphasized that the impact caused by the agrochemical on water quality should be evaluated considering the adverse effects to the environment caused by its degradation, that produces recalcitrant and surfactant compounds that may be even more toxic for humans and aquatic environment. Esse estudo teve por objetivo monitorar a variação espaço-temporal de compostos químicos tóxicos, como os metais Al, Cd, Pb, Cu, Cr, Mn, Zn e o defensivo agrícola glifosato, nas águas do ribeirão Maringá e de um trecho do rio Pirapó. Os resultados obtidos mostraram que no caso dos metais uma das possíveis fontes destes elementos na bacia está vinculada às atividades agrícolas. Para o defensivo glifosato, neste trabalho não foram encontradas concentrações acima do permitido pela legislação (CONAMA 357/2005. Sobre esse aspecto, ressalta-se que o impacto dos produtos agrícolas sobre a qualidade da água deve ser avaliado do ponto de vista dos efeitos adversos ao ambiente causados por sua degradação, gerando, por sua vez, compostos recalcitrantes e surfactantes e que podem ser muito mais tóxicos à vida aquática e ao homem.

  3. A gênese da escassez de chuva em Maringá, Estado do Paraná, Brasil, durante os meses de maio de 2003 e maio de 2005 = The genesis of scanty rainfall in Maringá, Paraná State, Brazil, during the months of May 2003 and May 2005

    Directory of Open Access Journals (Sweden)

    Leonor Marcon da Silveira

    2010-01-01

    Full Text Available O presente estudo teve por objetivo identificar os sistemas atmosféricos geradores da escassez de chuvas durante os meses de maio de 2003 e maio de 2005, em Maringá, Estado do Paraná, Brasil. Para atingir os objetivos propostos, utilizaram-se dados meteorológicos de superfície referentes às variações diárias dos elementos climáticos, com os quais se elaborou uma tabela para cada um dos meses em estudo, eleitos como amostragem de meses de maio secos. Para identificar os sistemas atmosféricos promotores dos diferentes tipos de tempo, tais tabelas foram analisadas concomitantemente à análise de cartas sinóticas meteorológicas de superfície, também diárias, e de imagens de satélite. Constatou-se que a escassez de chuva em Maringá durante os períodos estudados decorreu da atuação de anticiclones frios, que penetraram na retaguarda dos sistemas frontais, e da atuação do Sistema Tropical Atlântico sobre o continente, o qual geralmente bloqueava as frentes frias próximo à latitude de 30°S, de modo que estas se deslocavam para o Atlântico antes de alcançarem a área em estudo. The atmospheric systems accountable for scanty rainfall during May 2003 and May 2005 in Maringá, Paraná State, Brazil, are identified. Surface meteorological data on daily variables of climatic elements have been employed for the creation of a table for each month under analysis. They were chosen as dry May samplings. Tables were analyzed concomitantly with an investigation on daily surface meteorological synoptic charts and on satellite photos, so that the atmosphericsystems causing different types of climate might be identified. Results show that scanty rainfall in Maringá during the periods under analysis was caused by cold anti-cyclone activities which followed after frontal systems and by the activities of Atlantic TropicalSystem on the South American subcontinent. The latter normally blocks out cold fronts near latitude 30°S which, in turn

  4. MARE-WINT. New Materials and Reliability in Offshore Wind Turbine Technology

    DEFF Research Database (Denmark)

    This book provides a holistic, interdisciplinary overview of offshore wind energy, and is a must-read for advanced researchers. Topics, from the design and analysis of future turbines, to the decommissioning of wind farms, are covered. The scope of the work ranges from analytical, numerical...... and experimental advancements in structural and fluid mechanics, to novel developments in risk, safety & reliability engineering for offshore wind. The core objective of the current work is to make offshore wind energy more competitive, by improving the reliability, and operations and maintenance (O&M) strategies...... of wind turbines. The research was carried out under the auspices of the EU-funded project, MARE-WINT. The work seeks to bridge the gap between research and a rapidly-evolving industry....

  5. Prevalence of mycoplasmas in the semen and vaginal swabs of Danish stallions and mares

    DEFF Research Database (Denmark)

    Baczynska, Agata; Fedder, J.; Schougaard, H.

    2006-01-01

    may occur. Mycoplasmas have been implicated in genital disorders and infertility of many species including humans and horses. However, their role as commensals or pathogens of the genital tract of horses is still not determined. Bacteriological examinations made on the fossa glandis, urethra, penis...... and semen of stallions, showed the presence of different Mycoplasma species. Therefore our study aimed to find the prevalence of Mycoplasma species and a possible association with fertility problems in Danish riding horses. Eighty semen samples from stallions and 19 vaginal swab samples from mares were...

  6. Prevalence of mycoplasmas in the semen and vaginal swabs of Danish stallions and mares

    DEFF Research Database (Denmark)

    Baczynska, Agata; Fedder, J; Schougaard, H

    2007-01-01

    may occur. Mycoplasmas have been implicated in genital disorders and infertility of many species including humans and horses. However, their role as commensals or pathogens of the genital tract of horses is still not determined. Bacteriological examinations made on the fossa glandis, urethra, penis...... and semen of stallions, showed the presence of different Mycoplasma species. Therefore our study aimed to find the prevalence of Mycoplasma species and a possible association with fertility problems in Danish riding horses. Eighty semen samples from stallions and 19 vaginal swab samples from mares were...

  7. Human Activity Dampens the Benefits of Group Size on Vigilance in Khulan (Equus hemionus in Western China.

    Directory of Open Access Journals (Sweden)

    Mu-Yang Wang

    Full Text Available Animals receive anti-predator benefits from social behavior. As part of a group, individuals spend less time being vigilant, and vigilance decreases with increasing group size. This phenomenon, called "the many-eyes effect", together with the "encounter dilution effect", is considered among the most important factors determining individual vigilance behavior. However, in addition to group size, other social and environmental factors also influence the degree of vigilance, including disturbance from human activities. In our study, we examined vigilance behavior of Khulans (Equus hemionus in the Xinjiang Province in western China to test whether and how human disturbance and group size affect vigilance. According to our results, Khulan showed a negative correlation between group size and the percentage time spent vigilant, although this negative correlation depended on the groups' disturbance level. Khulan in the more disturbed area had a dampened benefit from increases in group size, compared to those in the undisturbed core areas. Provision of continuous areas of high-quality habitat for Khulans will allow them to form larger undisturbed aggregations and to gain foraging benefits through reduced individual vigilance, as well as anti-predator benefits through increased probability of predator detection.

  8. Human Activity Dampens the Benefits of Group Size on Vigilance in Khulan (Equus hemionus) in Western China.

    Science.gov (United States)

    Wang, Mu-Yang; Ruckstuhl, Kathreen E; Xu, Wen-Xuan; Blank, David; Yang, Wei-Kang

    2016-01-01

    Animals receive anti-predator benefits from social behavior. As part of a group, individuals spend less time being vigilant, and vigilance decreases with increasing group size. This phenomenon, called "the many-eyes effect", together with the "encounter dilution effect", is considered among the most important factors determining individual vigilance behavior. However, in addition to group size, other social and environmental factors also influence the degree of vigilance, including disturbance from human activities. In our study, we examined vigilance behavior of Khulans (Equus hemionus) in the Xinjiang Province in western China to test whether and how human disturbance and group size affect vigilance. According to our results, Khulan showed a negative correlation between group size and the percentage time spent vigilant, although this negative correlation depended on the groups' disturbance level. Khulan in the more disturbed area had a dampened benefit from increases in group size, compared to those in the undisturbed core areas. Provision of continuous areas of high-quality habitat for Khulans will allow them to form larger undisturbed aggregations and to gain foraging benefits through reduced individual vigilance, as well as anti-predator benefits through increased probability of predator detection.

  9. Corpo, festa e ludicidade: a cultura maringaense retratada em telas Body, party and ludic way: the Maringá culture reported in paintings

    Directory of Open Access Journals (Sweden)

    Fabiane Castilho Teixeira

    2011-09-01

    Full Text Available O texto analisa como corpo, festa e ludicidade aparecem na pintura em telas da artista plástica Lilia Lobo e como sua arte traduz a memória cultural da cidade de Maringá-PR. Com base no método iconológico, o intuito do estudo é apresentar obras que retratam a cultura nesta cidade, notadamente, aquelas que tematizam as festas. Os dados atentam para a materialização imagética da cultura maringaense, ressaltada em detalhes que expressam um corpo lúdico num campo festivo singular. As investigações apontam para a necessidade de contribuir para a difusão/valorização de artistas que se tornam esquecidos e que produzem importante documento iconográfico da cultura da cidade.The text analyses how body, party and ludic way appear in the oil painting of the artist Lilia Lobo and how her art translate the Maringá city, Paraná state, cultural memory. Using the iconological method, the purpose of this study is to present a work that reports the culture in this city, mainly the ones that have parties as subject. The data focus the imagnetic materialization of the Maringá culture, remarked in details that express a ludic body in a singular party field. The investigations point to the need to contribute with a diffusion/valorization of artists that become forgotten and that produce important iconographical documents of the city culture.

  10. A brief and critical review on hydrofluorosis in diverse species of domestic animals in India.

    Science.gov (United States)

    Choubisa, Shanti Lal

    2018-02-01

    India is one of the fluoride-endemic countries where the maximum numbers of ground or drinking water sources are naturally fluoridated. In India, a total of 23, out of 36 states and union territories have drinking water contaminated with fluoride in varying concentration. In the present scenario, especially in rural India, besides the surface waters (perennial ponds, dams, rivers, etc.), bore wells and hand pumps are the principal drinking water sources for domestic animals such as cattle (Bos taurus), water buffaloes (Bubalus bubalis), sheep (Ovis aries), goats (Capra hircus), horses (Equus caballus), donkeys (Equus asinus) and dromedary camels (Camelus dromedarius). Out of 23 states, 17 states, namely Andhra Pradesh, Assam, Bihar, Chhattisgarh, Gujarat, Haryana, Jharkhand, Karnataka, Kerala, Madhya Pradesh, Maharashtra, Odisha (Orissa), Punjab, Rajasthan, Telangana, Uttar Pradesh and West Bengal, have fluoride beyond the maximum permissible limit of 1.0 or 1.5 ppm in drinking water. This situation is a great concern for the animal health because fluoride is a slow toxicant and causes chronic diverse serious health hazards or toxic effects. Despite the fact that domestic animals are the basic income sources in rural areas and possess a significant contributory role not only in the agriculture sector but also in the strengthening of economy as well as in sustainable development of the country, research work on chronic fluoride intoxication (hydrofluorosis) due to drinking of fluoridated water in domestic animals rearing in various fluoride-endemic states is not enough as compared to work done in humans. However, some interesting and excellent research works conducted on different aspects of hydrofluorosis in domesticated animals rearing in different states are briefly and critically reviewed in the present communication. Author believes that this review paper not only will be more useful for researchers to do some more advance research work on fluoride

  11. Twenty years of immunocontraceptive research: lessons learned.

    Science.gov (United States)

    Miller, Lowell A; Fagerstone, Kathleen A; Eckery, Douglas C

    2013-12-01

    The National Wildlife Research Center (NWRC) began immunocontraception vaccine research by testing porcine zona pellucida (PZP) on white-tailed deer (Odocoileus virginianus). Early PZP research demonstrated that PZP induced infertility; however, increased length of the rut was observed in PZP-treated deer. An alternative vaccine using a keyhole limpet hemocyanin-gonadotropin-releasing hormone (KLH-GnRH) conjugate formulated with modified Freund's adjuvant was developed at NWRC. Suppression of GnRH has reduced reproduction in both sexes but is most effective in females. This vaccine was effective in preventing contraception in female deer for several years after a prime and boost. Due to adverse side effects of Freund's adjuvant, NWRC developed a new adjuvant called AdjuVac, a mineral oil/surfactant adjuvant with the addition of Mycobacterium avium as an immunostimulant. The price of KLH prompted a search for a more economical hemocyanin carrier protein for the GnRH peptide. Blue protein, derived from the mollusk Concholepas concholepas, proved to be a successful option. Formulation improvements resulted in a vaccine that can be effective as a single injection for multiple years, now called GonaCon. GonaCon is registered with the Environmental Protection Agency (EPA) for use in white-tailed deer in urban/suburban areas and for wild horses (Equus caballus) and burros (Equus asinus). Future GonaCon applications may include reducing reproduction to manage populations of other wildlife species, such as prairie dogs (Cynomys ludovicianus) in urban areas and suppressing reproduction to reduce the spread of venereal diseases such as brucellosis. Research is being conducted to develop a GnRH vaccine used in combination with the rabies vaccine to control population growth in free-roaming dogs, with the secondary effect of managing the spread of rabies. The EPA would regulate all these uses. Research is also ongoing on a GnRH vaccine to delay the onset of adrenocortical

  12. Whole mitochondrial genome sequencing of domestic horses reveals incorporation of extensive wild horse diversity during domestication

    Directory of Open Access Journals (Sweden)

    Lippold Sebastian

    2011-11-01

    Full Text Available Abstract Background DNA target enrichment by micro-array capture combined with high throughput sequencing technologies provides the possibility to obtain large amounts of sequence data (e.g. whole mitochondrial DNA genomes from multiple individuals at relatively low costs. Previously, whole mitochondrial genome data for domestic horses (Equus caballus were limited to only a few specimens and only short parts of the mtDNA genome (especially the hypervariable region were investigated for larger sample sets. Results In this study we investigated whole mitochondrial genomes of 59 domestic horses from 44 breeds and a single Przewalski horse (Equus przewalski using a recently described multiplex micro-array capture approach. We found 473 variable positions within the domestic horses, 292 of which are parsimony-informative, providing a well resolved phylogenetic tree. Our divergence time estimate suggests that the mitochondrial genomes of modern horse breeds shared a common ancestor around 93,000 years ago and no later than 38,000 years ago. A Bayesian skyline plot (BSP reveals a significant population expansion beginning 6,000-8,000 years ago with an ongoing exponential growth until the present, similar to other domestic animal species. Our data further suggest that a large sample of wild horse diversity was incorporated into the domestic population; specifically, at least 46 of the mtDNA lineages observed in domestic horses (73% already existed before the beginning of domestication about 5,000 years ago. Conclusions Our study provides a window into the maternal origins of extant domestic horses and confirms that modern domestic breeds present a wide sample of the mtDNA diversity found in ancestral, now extinct, wild horse populations. The data obtained allow us to detect a population expansion event coinciding with the beginning of domestication and to estimate both the minimum number of female horses incorporated into the domestic gene pool and the

  13. THE PRESSURE OF ANTHROPIC ACTIVITIES ON NATURAL CAPITAL OF SATU MARE COUNTY

    Directory of Open Access Journals (Sweden)

    VIOLETA BRAN

    2017-12-01

    Full Text Available The relationship between man and the natural environment, that provides the most valuable resources for existence, has transformed over time into an artificial and destructive manifestation. The encrease of the standard of living of society has been achieved through the drastic reduction of natural resources and the demage of the environment, endangering the welfare of future generations. Activities such as discharges of waste in the rivers, inappropriate use of land, uncontrolled deforestation, fragmentation of habitats due to infrastructure development pose the greatest risks to natural capital. This article aims to analyze by statistical methods, on the basis of the documents studied, the negative effects of anthropogenic activities on the natural capital of Satu Mare County.

  14. Parasite-mediated selection drives an immunogenetic trade-off in plains zebras (Equus quagga).

    Science.gov (United States)

    Kamath, Pauline L; Turner, Wendy C; Küsters, Martina; Getz, Wayne M

    2014-05-22

    Pathogen evasion of the host immune system is a key force driving extreme polymorphism in genes of the major histocompatibility complex (MHC). Although this gene family is well characterized in structure and function, there is still much debate surrounding the mechanisms by which MHC diversity is selectively maintained. Many studies have investigated relationships between MHC variation and specific pathogens, and have found mixed support for and against the hypotheses of heterozygote advantage, frequency-dependent or fluctuating selection. Few, however, have focused on the selective effects of multiple parasite types on host immunogenetic patterns. Here, we examined relationships between variation in the equine MHC gene, ELA-DRA, and both gastrointestinal (GI) and ectoparasitism in plains zebras (Equus quagga). Specific alleles present at opposing population frequencies had antagonistic effects, with rare alleles associated with increased GI parasitism and common alleles with increased tick burdens. These results support a frequency-dependent mechanism, but are also consistent with fluctuating selection. Maladaptive GI parasite 'susceptibility alleles' were reduced in frequency, suggesting that these parasites may play a greater selective role at this locus. Heterozygote advantage, in terms of allele mutational divergence, also predicted decreased GI parasite burden in genotypes with a common allele. We conclude that an immunogenetic trade-off affects resistance/susceptibility to parasites in this system. Because GI and ectoparasites do not directly interact within hosts, our results uniquely show that antagonistic parasite interactions can be indirectly modulated through the host immune system. This study highlights the importance of investigating the role of multiple parasites in shaping patterns of host immunogenetic variation.

  15. Social Class and Group Size as Predictors of Behavior in Male Equus kiang

    Directory of Open Access Journals (Sweden)

    Prameek M. Kannan

    2017-11-01

    Full Text Available Ethograms provide a systematic approach to identify and quantify the repertoire of behaviors of an organism. This information may assist animal welfare in zoos, increase awareness of conservation needs, and help curb high-risk behaviors during human-wildlife conflict. Our primary objective was to utilize an equid ethogram to produce activity budgets for Equus kiang males, a social ungulate that is among the least-studied mammals worldwide, and unknown to the ethological literature. We recently reported the existence of three social classes of this species; Territorial males, Bachelor males and ‘Transient’ males. Therefore, our secondary objective was to compare activity budgets in each of these three groups. We found that kiang spent >70% of their time performing six behaviors: vigilance (34%, locomotion (24.2%, resting (14.2%, mixed foraging (12.5%, browsing (5.1%, and antagonism (1.1%. Over 2% of the total behavioral investment was spent on olfactory investigations (genital sniffing, sniffing proximity and flehmen. Eleven of the eighteen behaviors differed by class. Habitat selection differed strongly by each group, with Territorial males favoring mesic sites with greater vegetation abundance. Vigilance also differed according to habitat selection, but not group size. Animals in the xeric, least vegetation-rich area were far less vigilant than animals at more attractive sites. We found that the full repertoire of behaviors, and relative investments in each, differ according to social class. These findings are a reminder that researchers should make every effort to disambiguate social class among ungulates– and other taxa where behaviors are class-dependent.

  16. Isolated limb perfusion electrochemotherapy for the treatment of an advanced squamous cell carcinoma of the hoof in a mare

    Directory of Open Access Journals (Sweden)

    Enrico Pierluigi Spugnini

    2017-06-01

    Full Text Available A twenty-year-old female saddle horse was referred for evaluation of a seven month, non-healing erosive lesion of the right hind hoof with proliferation and bleeding of the underlying soft tissues. This lesion had been twice surgically treated as a canker but rapidly recurred. Histological examination of the second excision revealed a well-differentiated squamous cell carcinoma. At presentation, the horse was mildly depressed, lame and partially non-weight-bearing on the right hind leg, which exhibited a 10 x 10 cm erosive and proliferative lesion remodeling the hoof. After completing staging procedures, the lesion was approached with surgery and intraoperative electrochemotherapy (ECT administration of bleomycin in isolated limb perfusion. A second session of surgery and ECT was performed one month later, followed by three additional monthly sessions of ECT. During periodic recheck, the mare showed continuous improvement. One year after presentation, the mare was in complete remission and her gait markedly improved. ECT was well-tolerated and resulted in improved local control of a tumor in a challenging anatomical district.

  17. The period of the follicular phase during which the uterus of mares shows estrus-like echotexture influences the subsequent pregnancy rate

    NARCIS (Netherlands)

    Mateu-Sánchez, S; Newcombe, J R; Garcés-Narro, C; Cuervo-Arango, J

    2016-01-01

    The interval from both spontaneous and prostaglandin (PGF)-induced luteolysis to ovulation is greatly variable in mares. Several reports have shown a positive association between the length of the interval from PGF treatment to ovulation (ITO) and the subsequent pregnancy rate (PR). However, it is

  18. Proximate and fatty acid composition of zebra (Equus quagga burchellii) muscle and subcutaneous fat.

    Science.gov (United States)

    Hoffman, Louwrens C; Geldenhuys, Greta; Cawthorn, Donna-Mareè

    2016-08-01

    The meat from African game species is healthy, naturally produced and increasingly popular with consumers. Among these species, zebra (Equus quagga burchellii) are growing in number in South Africa, with the meat from surplus animals holding potential to contribute to food security and economic stability. Despite being consumed locally and globally, little information exists on the composition of zebra meat. This study aimed to determine the proximate composition of zebra meat as well as the fatty acid composition of the intramuscular (IMF) and subcutaneous (SCF) fat. Zebra longissimus lumborum muscle was shown to have a high mean protein content (22.29 g per 100 g) and low mean fat content (1.47 g per 100 g). High proportions of polyunsaturated fatty acids (PUFAs) were found in the IMF (41.15%) and SCF (37.71%), mainly comprising α-linolenic (C18:3n-3) and linoleic (C18:2n-6) acids. Furthermore, the IMF and SCF had favourable PUFA/saturated fatty acid ratios (>0.4) and omega-6/omega-3 ratios (<4), indicating that both components are healthy lipid food sources. This study has shed new light on the nutritional value of zebra meat, which will not only be important for food product labelling, nutritional education and incorporation into food composition databases, but will also be indispensable for marketing and export purposes. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  19. Modeling and Observing the Role of Wind-Waves in Lake-Climate Interactions on Titan using the T104 Flyby of Kraken Mare

    Science.gov (United States)

    Hayes, A. G., Jr.; Lorenz, R. D.; Zebker, H. A.; Donelan, M. A.; Karatekin, O.; Mastrogiuseppe, M., Sr.; Le Gall, A. A.; Hofgartner, J. D.; Encrenaz, P.; Poggiali, V.

    2014-12-01

    Oceanography is no longer just an Earth Science. Standing bodies of liquid that interact with both atmospheric and surface reservoirs are known to exist on Titan, and are thought to have existed on early Mars. The exchange of heat, moisture, and momentum between lakes/seas and the atmosphere are of fundamental importance to the hydrologic systems of all three bodies. The generation and propagation of wind-waves, and their consequent shoreline erosion, are key factors in air-sea-surface exchange. Titan, in particular, offers a laboratory in which to understand these processes at a more fundamental level. Much of the parameterization for wave models on Earth are empirical, despite laboratory studies that have demonstrated wave growth depends on both gravity and fluid properties. Titan's exotic environment ensures that even rudimentary measurements of wave generation will provide valuable data to anchor physical models. Furthermore, in the presence of wind waves, Cassini can be used as an anemometer to measure wind speeds over hydrocarbon liquids. Herein, we will report on the results of the Aug 21st altimetry observation over Titan's largest sea, Kraken Mare, and interpret them in the context of wave activity and composition (from passive radiometry). On Earth, it is rare to observe a body of water whose surface is not disturbed by some form of wave activity. On Titan, Cassini observations through the end of its Equinox Mission in Dec 2010 showed no indication of waves. These observations are intriguing given the predominance of aeolian features at equatorial latitudes and have been attributed to the light winds predicted during the Titan winter. More recently, however, the previous series of upper limits and non-detections are giving way to indications that the expected freshening of winds in northern summer may be causing sporadic ruffling of the sea surfaces. Specifically, apparent sunglints offset from the geometric specular point has been observed by VIMS in

  20. Equus: a construção do personagem Alan Strang na tradução cinematográfica.

    Directory of Open Access Journals (Sweden)

    Lucyana do Amaral Brilhante

    2005-01-01

    Full Text Available Peter Shaffer is a British playwright of the second half of the twentieth century. One of his major works is the play Equus, that tells the story of a young man, Alan Strang, who is in psychiatric treatment. The film director Sidney Lumet, with the script of Shaffer, translated the play to the screen. Based on the concept of intersemiotic translation of Jackobson (1995, it may be said that a film adaptation is, in fact, an intersemiotic translation, which in turn is a kind of audiovisual translation. It is then natural that, in the translation of a play to the screen, the original changes because the translations become different texts, normally unattached to the original work. This work’s objective is to analyze the differences between the play and the film. This paper aims at looking at differences between the screenplay and the film, paying special attention to those that affect the character Alan Strang. So, the corpus of the research consists of the film and the play by Schaffer. The analysis of the character was based on translation and literary theories. Keywords: Audiovisual translation, intersemiotic translation, literature and cinema.

  1. Mass dependent fractionation of stable chromium isotopes in mare basalts: Implications for the formation and the differentiation of the Moon

    Science.gov (United States)

    Bonnand, Pierre; Parkinson, Ian J.; Anand, Mahesh

    2016-02-01

    We present the first stable chromium isotopic data from mare basalts in order to investigate the similarity between the Moon and the Earth's mantle. A double spike technique coupled with MC-ICP-MS measurements was used to analyse 19 mare basalts, comprising high-Ti, low-Ti and KREEP-rich varieties. Chromium isotope ratios (δ53Cr) for mare basalts are positively correlated with indices of magmatic differentiation such as Mg# and Cr concentration which suggests that Cr isotopes were fractionated during magmatic differentiation. Modelling of the results provides evidence that spinel and pyroxene are the main phases controlling the Cr isotopic composition during fractional crystallisation. The most evolved samples have the lightest isotopic compositions, complemented by cumulates that are isotopically heavy. Two hypotheses are proposed to explain this fractionation: (i) equilibrium fractionation where heavy isotopes are preferentially incorporated into the spinel lattice and (ii) a difference in isotopic composition between Cr2+ and Cr3+ in the melt. However, both processes require magmatic temperatures below 1200 °C for appreciable Cr3+ to be present at the low oxygen fugacities found in the Moon (IW -1 to -2 log units). There is no isotopic difference between the most primitive high-Ti, low-Ti and KREEP basalts, which suggest that the sources of these basalts were homogeneous in terms of stable Cr isotopes. The least differentiated sample in our sample set is the low-Ti basalt 12016, characterised by a Cr isotopic composition of -0.222 ± 0.025‰, which is within error of the current BSE value (-0.124 ± 0.101‰). The similarity between the mantles of the Moon and Earth is consistent with a terrestrial origin for a major fraction of the lunar Cr. This similarity also suggests that Cr isotopes were not fractionated by core formation on the Moon.

  2. Effects of aquifer storage and recovery activities on water quality in the Little Arkansas River and Equus Beds Aquifer, south-central Kansas, 2011–14

    Science.gov (United States)

    Stone, Mandy L.; Garrett, Jessica D.; Poulton, Barry C.; Ziegler, Andrew C.

    2016-07-18

    The Equus Beds aquifer in south-central Kansas is aprimary water source for the city of Wichita. The Equus Beds aquifer storage and recovery (ASR) project was developed to help the city of Wichita meet increasing current (2016) and future water demands. The Equus Beds ASR project pumps water out of the Little Arkansas River during above-base flow conditions, treats it using drinking-water quality standards as a guideline, and recharges it into the Equus Beds aquifer for later use. Phase II of the Equus Beds ASR project currently (2016) includes a river intake facility and a surface-water treatment facility with a 30 million gallon per day capacity. Water diverted from the Little Arkansas River is delivered to an adjacent presedimentation basin for solids removal. Subsequently, waste from the surface-water treatment facility and the presedimentation basin is returned to the Little Arkansas River through a residuals return line. The U.S. Geological Survey, in cooperation with the city of Wichita, developed and implemented a hydrobiological monitoring program as part of the ASR project to characterize and quantify the effects of aquifer storage and recovery activities on the Little Arkansas River and Equus Beds aquifer water quality.Data were collected from 2 surface-water sites (one upstream and one downstream from the residuals return line), 1 residuals return line site, and 2 groundwater well sites (each having a shallow and deep part): the Little Arkansas River upstream from the ASR facility near Sedgwick, Kansas (upstream surface-water site 375350097262800), about 0.03 mile (mi) upstream from the residuals return line site; the Little Arkansas River near Sedgwick, Kans. (downstream surface-water site 07144100), about 1.68 mi downstream from the residuals return line site; discharge from the Little Arkansas River ASR facility near Sedgwick, Kansas (residuals return line site 375348097262800); 25S 01 W 07BCCC01 SMW–S11 near CW36 (MW–7 shallow groundwater well

  3. Flebotomíneos coletados em matas remanescentes e abrigos de animais silvestres de zoológico no perímetro urbano de Maringá, sul do Brasil. Estudo preliminar Phlebotomines collected in remaining florests and wild animal shelters in zoological garden in the urban area of Maringá, Paraná State, shoutern Brazil. Preliminary study

    Directory of Open Access Journals (Sweden)

    Ueslei Teodoro

    1998-12-01

    Full Text Available Um caso de leishmaniose tegumentar com provável infecção em uma das áreas de matas remanescentes no perímetro urbano de Maringá, Paraná, Brasil, o desconhecimento da fauna e do comportamento de flebotomíneos nestas matas despertaram o interesse desta investigação. Os flebotomíneos foram coletados com armadilhas de Falcão instaladas em matas remanescentes do Parque do Ingá, Bosque Dois e Horto Florestal, de junho a setembro de 1995, no período noturno. Nestas áreas coletaram-se 3.532 flebotomíneos, prevalecendo Lutzomyia (Nyssomyia whitmani (Antunes & Coutinho, 1939 com 3.395 (96,1% exemplares. No Parque do Ingá, onde as coletas também foram feitas em abrigos de animais silvestres, mantidos em zoológico, foram coletados 2.907 flebotomíneos, dos quais 1.723 nestes abrigos. Os resultados mostram melhor adaptação de Lutzomyia whitmani nas matas remanescentes no perímetro urbano de Maringá e sua freqüência nos abrigos dos animais silvestres mantidos em cativeiro.The present study was undertaken after the detection of one case of cutaneous leishmaniasis with presumed infection in one of the three remaining wooded areas in the urban area of the city of Maringá, Southern Brazil; also in view of the lack of knowledge about sand flies and their behavior. From June to September, 1995, sand flies were caught with Falcão traps during the night in the remaining wooded areas (Parque do Ingá, Bosque Dois and Horto Florestal. A total of 2,907 sand flies were caugth in Parque do Ingá; 1,723 of them were aught in forest traps and 1,184 in wild animal shelter traps at the zoo. The results show that Lutzomyia whitmani is better adapted to the three areas under study and that it frequently occurs in wild animal shelters within the urban perimeter of Maringá.

  4. Gordura corporal e eficiência reprodutiva em éguas doadoras de embrião Mangalarga Marchador Body fat and reproductive efficiency of Mangalarga Marchador embryo donor mares

    Directory of Open Access Journals (Sweden)

    Paula Gomes Rodrigues

    2011-10-01

    Full Text Available Foi comparado o julgamento do escore de condição corporal (ECC com a espessura de gordura subcutânea (EGS e sua relação com a eficiência reprodutiva de éguas Mangalarga Marchador doadoras de embrião. O experimento foi conduzido com 56 éguas doadoras entre os meses de agosto/08 e abril/09. O ECC foi maior em éguas mais velhas e aumentou com os dias de permanência no experimento. Houve correlação positiva entre peso e tempo de experimento. O peso não foi associado à idade, porém aumentou ao longo do experimento. A EGS na região da cauda e entre a 12ª e 13ª costelas aumentou com a idade e diminuiu com os dias de permanência no experimento. Houve correlação positiva entre EGS e ECC para a cauda e costela. O diâmetro do folículo dominante aumentou ao longo do ciclo estral, e foi menor em éguas com ECC abaixo de 6,5. O diâmetro folicular não foi influenciado pela idade. O diâmetro médio do folículo ovulatório foi 38,43 ± 3,09 mm. A recuperação embrionária não foi afetada pela idade ou ECC, mas foi menor (41% eméguas que ovularam folículos menores que 40 mm quando comparados às que ovularam folículos maiores que 40 mm (59%. A idade da doadora não foi associada à taxa de gestação dos embriões nas receptoras. A gordura corporal afetou a eficiência reprodutiva das éguas, além disso, a ultrassonografia parece ser essencial para a avaliação precisa e correta do escore de condição corporal.Body condition scoring (BCS was compared to an ultrasound subcutaneous fat thickness (SFT determination in relation to the reproductive efficiency of Mangalarga Marchador embryo donor mares. Fifty six barren mares were studied throughout the 2008/2009 breeding season (August through April and the experiment was designed in a completely randomized scheme. BCS was higher in older mares and increased with time in the experiment, and there was a positive interaction between weight and time. Weight was not associated with age

  5. Stress Response of Veterinary Students to Gynaecological Examination of Horse Mares - Effects of Simulator-Based and Animal-Based Training.

    Science.gov (United States)

    Nagel, C; Ille, N; Erber, R; Aurich, C; Aurich, J

    2015-10-01

    Invasive procedures in animals are challenging for veterinary students who may perceive a gynaecological examination of mares as stressful. Simulator-based training may reduce stress. In this study, students received equine gynaecology training 4 times either on horses (group H; n = 14) or a teaching simulator (group SIM; n = 13). One day and 14 days thereafter, their diagnostic skills were tested on horses (skills tests 1 and 2). During the skills tests, the students' stress response was analysed by heart rate, heart rate variability (HRV) parameters SDRR (standard deviation of beat-to-beat [RR] interval) and RMSSD (root-mean-square of successive RR differences), and salivary cortisol. In addition, students answered a questionnaire on their perceived stress. Sympathetic activation with increased heart rate (p stress response. Subjective stress perception of students was higher in skills test 1 vs 2 (p stressed than SIM students (p stress parameters. In conclusion, gynaecological examination of mares evoked a moderate stress response in veterinary students, which was more evident after simulator-based than animal-based training. © 2015 Blackwell Verlag GmbH.

  6. Effect of immunomodulatory therapy on the endometrial inflammatory response to induced infectious endometritis in susceptible mares

    DEFF Research Database (Denmark)

    Christoffersen, Mette; Woodward, Elizabeth; Bojesen, Anders Miki

    2012-01-01

    endometritis based on their endometrial histopathology and ability to clear an induced uterine inflammation. To investigate the effect of immunomodulatory therapy, the mares were inoculated with 10(5) colony forming units (CFU) Escherichia coli in three consecutive estrus cycles in a modified cross-over study...... inoculation. Endometrial biopsies were recovered 3, 24 and 72 h post inoculation. Relative gene-expression analyses were performed by quantitative reverse transcriptase PCR (qRT-PCR). Endometrial gene expression of inflammatory cytokines was modulated by administration of GC. Expression of proinflammatory...

  7. Pre-foaling period in Trotter mares – 2: variations of protein fractions in pre-colostrum secretion

    Directory of Open Access Journals (Sweden)

    A. Falaschini

    2010-01-01

    Full Text Available Mare has a diffuse epitheliochorial placenta that does not allow the transplacental passage of maternal antibodies to the foetus. As a consequence, newly-born foals are immunologically dependent on the absorption of colostral maternal immunoglobulins (Ig. Therefore, the newborn foal should immediately suckle an adequate quantity of colostrum to reach an haematological IgG concentration of 400 mg/dl which prevent the occurrence of Failure of Passive Transfer (FPT, disease which can be fatal to the foal (Jeffcott, 1972; Curadi and Orlandi, 1998.

  8. Przewalski’ s Horse ( Equus ferus przewalskii Re-intr oduction in the Great Gobi B Strictly Protected Area: from Species to Ecosystem Conservation

    Directory of Open Access Journals (Sweden)

    P. Kaczensky

    2007-05-01

    Full Text Available The Przewalski’s horse ( Equus ferus przewalskii Po ljakov , 1881, or “T akhi” in Mongolian, became extinct in the wild by the mid 1960’ s. The last recorded sightings of Przewalski’s horses occurred in the Dzungarian Gobi desert in SW Mo ngolia, today’s Great Gobi B Strictly Protected Area (SP A. A re - introduction program was initiated in 1992 and the fi rs t group of captive-born Przewalski’s horses was airlifted to the SPA. Given the logistical challenges associated with such a venture, the initial project focus has been on transport logistics and the well-being of the re-introduced horses. Tod ay, conservation efforts are spread over the entire protected area. Present day ef forts include other mammals, vegetation and the local people. Due to its important symbolic value in Mongolian culture, the Przewalski’ s horse became an important fl agship species for the protected area’s conservation and management.

  9. A influência das condições termo-pluviométricas nos indicadores do comércio de Maringá, Estado do Paraná: um ensaio metodológico na perspectiva da valoração ambiental = The influence of thermopluviometric conditions in the commerce indicators of Maringá city, state of Paraná: a methodological essay in the environmental valoration perspective

    Directory of Open Access Journals (Sweden)

    Lays Regina Andriucci

    2007-07-01

    Full Text Available Este artigo analisa o grau da influência termo-pluviométrica em algunsindicadores do comércio de Maringá, Estado do Paraná. Para isso foram estudados os elementos climáticos, temperatura e precipitação, bem como os indicadores econômicos: ICMS, SCPC, Vídeo-Cheque, Consumo e Consumidores de Energia Elétrica. Realizaramse análises gráficas, e aplicações estatísticas de correlação e regressão, bem como, o exame de um estudo de caso. Considera-se que os grupos investigados apresentaram variações nas formas de correlações. Os resultados apresentados neste trabalho possuem o caráter de testes preliminares por ser uma primeira tentativa de aproximação real entre as variáveis do clima (temperatura e precipitação com alguns indicadores do comportamento do comércio da cidade de Maringá.This article analyzes the degree of thermopluviometric influence on certain indicators in the commerce of Maringá, state of Paraná. To that end, climate elements, such as the temperature and precipitation as well as certain economic indicators, namely: ICMS (taxes, SCPC, Video-Check, Consumption and Consumers of Electric Energy were studied. Graphical analyses along with statistical applications of correlation and regression were performed, as well as the examination of a case study. It is believed that the groups investigated showed variations in the forms of correlation. The results herein presented are in the manner of a preliminary trial, representing a first attempt at measuring the actual relationship between the climaticvariables (temperature and precipitation with certain behavioral indicators of commerce in the city of Maringá.

  10. Diagnostic value of computed tomography, radiography and ultrasonography in metacarpophalangeal joint disorders in horses

    Directory of Open Access Journals (Sweden)

    V.M.V. Machado

    2016-02-01

    Full Text Available In modern society the work and athletic performance of horses has led to a very important animal production sector in which Brazil possesses the third largest horse stock. Among all equine lesions described, metacarpophalangeal (fetlock joint lesions are considered one of the main causes of lameness. Consequently, there is a need to improve the understanding and diagnosis of these injuries. The most efficient imaging diagnostic methods for the fetlock region are computed tomography, radiography and ultrasound. Imaging studies of the anatomical structures involving this joint are extremely important to obtain a more precise diagnose. The present study was performed in order to evaluate the capacity of different imaging diagnostic modalities to detect a variety of lesions in different fetlock structures. Twenty horses (Equus caballus used for horsemanship activities were referred to the Department of Animal Reproduction and Veterinary Radiology of São Paulo State University, Botucatu campus, with clinical signs of metacarpophalangeal joint injuries. Horses were submitted to radiographic and ultrasonographic exam and computed tomography scan. Image analysis revealed a significant capacity of these methods to characterize lesions in this region. However, computed tomography provided broader and better evaluation of lesions in bones and adjacent structures, because it allows the analysis to be performed on three-dimensional projections, with attenuation coefficients (window selections and tissue density measurement through Hounsfield Units (HU.

  11. Quantifying Equid Behavior - A Research Ethogram for Free-Roaming Feral Horses

    Science.gov (United States)

    Ransom, Jason I.; Cade, Brian S.

    2009-01-01

    Feral horses (Equus caballus) are globally distributed in free-roaming populations on all continents except Antarctica and occupy a wide range of habitats including forest, grassland, desert, and montane environments. The largest populations occur in Australia and North America and have been the subject of scientific study for decades, yet guidelines and ethograms for feral horse behavioral research are largely absent in the scientific literature. The U.S. Geological Survey (USGS) Fort Collins Science Center conducted research on the influences of the immunocontraceptive porcine zona pellucida (PZP) on feral horse behavior from 2003-2006 in three discrete populations in the American west. These populations were the Little Book Cliffs Wild Horse Range in Colorado, McCullough Peaks Herd Management Area in Wyoming, and Pryor Mountain Wild Horse Range in Montana; the research effort included over 1,800 hours of behavioral observations of 317 adult free-roaming feral horses. An ethogram was developed during the course of this study to facilitate accurate scientific data collection on feral horse behavior, which is often challenging to quantify. By developing this set of discrete behavioral definitions and a set of strict research protocols, scientists were better able to address both applied questions, such as behavioral changes related to fertility control, and theoretical questions, such as understanding networks and dominance hierarchies within social groups of equids.

  12. De Novo Assembly of the Donkey White Blood Cell Transcriptome and a Comparative Analysis of Phenotype-Associated Genes between Donkeys and Horses.

    Science.gov (United States)

    Xie, Feng-Yun; Feng, Yu-Long; Wang, Hong-Hui; Ma, Yun-Feng; Yang, Yang; Wang, Yin-Chao; Shen, Wei; Pan, Qing-Jie; Yin, Shen; Sun, Yu-Jiang; Ma, Jun-Yu

    2015-01-01

    Prior to the mechanization of agriculture and labor-intensive tasks, humans used donkeys (Equus africanus asinus) for farm work and packing. However, as mechanization increased, donkeys have been increasingly raised for meat, milk, and fur in China. To maintain the development of the donkey industry, breeding programs should focus on traits related to these new uses. Compared to conventional marker-assisted breeding plans, genome- and transcriptome-based selection methods are more efficient and effective. To analyze the coding genes of the donkey genome, we assembled the transcriptome of donkey white blood cells de novo. Using transcriptomic deep-sequencing data, we identified 264,714 distinct donkey unigenes and predicted 38,949 protein fragments. We annotated the donkey unigenes by BLAST searches against the non-redundant (NR) protein database. We also compared the donkey protein sequences with those of the horse (E. caballus) and wild horse (E. przewalskii), and linked the donkey protein fragments with mammalian phenotypes. As the outer ear size of donkeys and horses are obviously different, we compared the outer ear size-associated proteins in donkeys and horses. We identified three ear size-associated proteins, HIC1, PRKRA, and KMT2A, with sequence differences among the donkey, horse, and wild horse loci. Since the donkey genome sequence has not been released, the de novo assembled donkey transcriptome is helpful for preliminary investigations of donkey cultivars and for genetic improvement.

  13. Are California Sea Lions (Zalophus californianus Sensitive to the Attentional State of their Caretakers?

    Directory of Open Access Journals (Sweden)

    Marie Penel

    2014-11-01

    Full Text Available Human-animal relations appear in various contexts (homes, farms, zoos, aquatic parks, etc. possibly favoring the emergence of the ability to understand heterospecific communication signals in several species. Studies show that dogs (Canis familiaris have developed the ability to attribute attention to humans, reading their body, head and gaze cues. Horses (Equus caballus and other species including African gray parrots (Psittacus erithacus show this ability too. Here, we asked if California sea lions (Zalophus californianus can discriminate the attentional state of their caretakers. Four sea lions were tested in three increasingly complex experiments requiring them to make a choice between an attentive versus an inattentive caretaker. The first test asked whether sea lions could attribute attention to a human facing them versus facing away. In the second test, the caretaker’s head orientation towards the sea lion served as the attentional cue. In the final test, the inattentive caretaker wore dark sunglasses. The results were heterogeneous and showed a higher rate of success than failure in the test 1, but the opposite in test 2. The results in the test 3 were not significant. Furthermore, the latency measures suggested that the subjects did not understand the tasks. It therefore appears that in the situation used here sea lions mainly focused their attention on the experimenter’s body orientation; the head did not seem to be a pertinent cue.

  14. Bilateral Dorsal Subluxation of the Proximal Interphalangeal Joint of the Hind Limb in a Mare: Case Report

    OpenAIRE

    Pizzigatti, Dietrich; Hussni, Carlos Alberto; Rodrigues, Celso Antonio; Watanabe, Marcos Jun; Moura Alonso, Juliana de; Vulcano, Luiz Carlos; Cisneros Álvarez, Luis Emiliano

    2013-01-01

    Subluxation of the proximal interphalangeal joint is a rare and little studied condition in horses. We describe the case of a 12-year-old mare with bilateral dorsal subluxation of the proximal interphalangeal joint of the hind feet. Tenectomy of the medial digital flexor was performed in both limbs, and the patient showed signs of recovery within 14 days. Goniometry of the proximal interphalangeal joints 10 months after surgery showed diminution of 5° for the proximal interphalangeal axis of ...

  15. Aquatic macrophytes from Danube Delta lagoons Musura Bay and Zatonul Mare

    Directory of Open Access Journals (Sweden)

    Sava D.,

    2016-05-01

    Full Text Available The Romanian Danube Delta, a unique, young and continuing to grow region situated in the eastern part of Europe, is the largest continuous marshland and the second largest delta on the continent, and also a favorable place for developing a unique flora and fauna in Europe, with many rare and protected species. The predominance of the aquatic environment, led to the existence of a particular macrophytic flora. In this context, the purpose of this paper is to contribute to the study of aquatic macrophytes. The present study took place over two years, between 2013-2014, and in each year a number of expeditions were made in the two lagoons (Musura Bay and Zătonul Mare in different seasons, in order to observe the diverse flora, because, due to seasonal variation in water quality, there might be a significantly seasonality of the vegetation also.

  16. Predicting survival function and identifying associated factors in patients with renal insufficiency in the metropolitan area of Maringá, Paraná State, Brazil.

    Science.gov (United States)

    Ramires, Thiago G; Nakamura, Luiz R; Righetto, Ana J; Ortega, Edwin M M; Cordeiro, Gauss M

    2018-02-05

    Renal insufficiency is a serious medical and public health problem worldwide. Recently, although many surveys have been developed to identify factors related to the lifetime of patients with renal insufficiency, controversial results from several studies suggest that researches should be conducted by region. Thus, in this study we aim to predict and identify factors associated with the lifetime of patients with chronic renal failure (CRF) in the metropolitan area of Maringá, Paraná State, Brazil, based on the generalized additive models for location, scale and shape (GAMLSS) framework. Data used in this study were collected from the Maringá Kidney Institute and comprehends 177 patients (classified with CRF and mostly being treated under the Brazilian Unified National Health System) enrolled in a hemodialysis program from 1978 up to 2010. By using this approach, we concluded that in other regions, gender, kidney transplant indicator, antibodies to hepatitis B and antibodies to hepatitis C are significant factors that affect the expected lifetime.

  17. Predicting survival function and identifying associated factors in patients with renal insufficiency in the metropolitan area of Maringá, Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Thiago G. Ramires

    2018-02-01

    Full Text Available Renal insufficiency is a serious medical and public health problem worldwide. Recently, although many surveys have been developed to identify factors related to the lifetime of patients with renal insufficiency, controversial results from several studies suggest that researches should be conducted by region. Thus, in this study we aim to predict and identify factors associated with the lifetime of patients with chronic renal failure (CRF in the metropolitan area of Maringá, Paraná State, Brazil, based on the generalized additive models for location, scale and shape (GAMLSS framework. Data used in this study were collected from the Maringá Kidney Institute and comprehends 177 patients (classified with CRF and mostly being treated under the Brazilian Unified National Health System enrolled in a hemodialysis program from 1978 up to 2010. By using this approach, we concluded that in other regions, gender, kidney transplant indicator, antibodies to hepatitis B and antibodies to hepatitis C are significant factors that affect the expected lifetime.

  18. AN ATTEMPT TO DETERMINE THE RELATION BETWEEN HUCUL HORSES CONFORMATION ASSESSMENT, MOVEMENT AND COURAGE TEST RESULTS PART II. MARE FAMILIES

    Directory of Open Access Journals (Sweden)

    Jadwiga TOPCZEWSKA

    2012-01-01

    Full Text Available The objective of the research was to determine the relationship between evaluation of conformation and motion indicators and results of the Huculs’ path and also to ascertain the courage (basic and elimination of Hucul horses with their classification into mare families being taken account of. The scores of 116 horses presented for the evaluation of their exterior (championship breeding were analyzed. The assessment covered the type, body conformation, movement in walk and trot as well as overall impression and preparedness for the exhibition. Measurements of length of steps, frequency and rate of the walk and trot were performed during the tests for courage. The estimated correlation coefficients exhibited the existence of some interesting trends i.e., there was positive correlation between values for type, body conformation, movement in walk and trot and the length of steps in walk and trot in individuals representing most of mare families. The reverse was the case with horses from the Sroczka and Wyderka families. Amongst the Wrona, however, negative correlations between the grade for walk and frequency of steps in walk was observed while that of between the result of path and utility tests was positive.

  19. Prevalence of Toxoplasma gondii antibodies in domestic donkeys (Equus asinus) in Durango, Mexico slaughtered for human consumption.

    Science.gov (United States)

    Alvarado-Esquivel, Cosme; Alvarado-Esquivel, Domingo; Dubey, Jitender P

    2015-01-17

    Nothing is known about Toxoplasma gondii prevalence in donkeys in Mexico. Meat from donkey is consumed by humans in Mexico and also exported to other countries. We sought to determine the presence of antibodies against T. gondii in 239 domestic donkeys (Equus asinus) for slaughter in Durango, Mexico using the modified agglutination test (MAT). Donkeys were sampled in four premises (trade centers) where donkeys were gather for shipment to abattoirs in other Mexican states. Antibodies to T. gondii were found in 26 (10.9%) of 239 donkeys, with MAT titers of 1:25 in 7, 1:50 in 11, 1:100 in 6, and 1:200 in 2. Seropositive donkeys were found in three (75%) of the four gathering premises studied. Seroprevalence in donkeys varied from 0% to 23.1% among gathering premises. The seroprevalence of T. gondii infection was comparable among donkeys regardless their age, sex or health status. Seropositivity to T. gondii was found in donkeys between 1 to 12 years old. Multivariate analysis showed that seropositivity to T. gondii was associated with the gathering premises (OR = 1.58; 95% CI: 1.11-2.24; P = 0.009). This is the first report of T. gondii infection in donkeys in Mexico. Results indicate that consumption of undercooked or raw meat from T. gondii-infected donkeys is potentially a source of T. gondii infection for humans.

  20. Risk Factors Associated with the Occurrence of Gastrointestinal Helminths among Indigenous Donkeys (Equus asinus in Northeastern Nigeria

    Directory of Open Access Journals (Sweden)

    Saleh Mohammed Jajere

    2016-01-01

    Full Text Available Aim. This survey study was conducted from April 2014 through March 2015 in Bauchi, Yobe, and Gombe states, northeastern Nigeria, to explore the risk factors associated with the occurrence of gastrointestinal helminthosis among indigenous donkeys (Equus asinus. Materials and Methods. A total of six hundred fresh faecal samples were randomly collected from indigenous donkeys of varying age, sex, and settlements. Simple flotation and sedimentation techniques were used for the detection of helminths eggs. Results. Three gastrointestinal nematode parasites were encountered including Strongyle, Parascaris equorum, and Oxyuris equi. An overall prevalence of 98.3% was obtained, of which 78.3%, 40.3%, and 17.5% were, respectively, from Strongyle, Parascaris equorum, and Oxyuris equi. Age, sex, and season were not statistically associated with the risk of helminth infection as were the different study areas (p>0.05. However, body condition score, settlement, anthelminthic medication history, and management practices were significantly associated with the risk of gastrointestinal helminthosis. Statistically high prevalence of helminthic infections was observed in donkeys, with poor (thin body condition, from rural settlements, that were not dewormed and raised under poor management systems (p<0.001. Conclusion. It is concluded from the study that gastrointestinal helminths particularly Strongyle were endemic among the indigenous donkeys in northeastern Nigeria. Further control and preventive measures were discussed.

  1. Determination of the prevalence of subclinical endometritis and evaluation of molecular characterization of Escherichia coli (E-coli separated of them in mares repeat breeder in Yazd province

    Directory of Open Access Journals (Sweden)

    Taktaz Hafshejani Taghi

    2016-11-01

    Full Text Available Escherichia coli are known as the most common cause of reproductive tract infection in mare. Due to the progressive process of antibiotics use and increasing prevalence of antibiotic resistance, the aim of this study is evaluate the prevalence of subclinical endometritis and antibiotic resistance genes in Escherichia coli isolated. In this study, 60 mares were used with infertility background. Diagnosis of endometritis was performed using history and ultrasonography. Cytology, culture, Antibiogram were done of samples and PCR test was used to examine the gene virulence and antibiotic resistance. E-coli bacteria was isolated 48/33 % from sample culture. In PCR test 66/21 % of bacteria had virulence gene. It was determined, the lowest resistance to chloramphenicol about 38/15% and greatest resistance into ampicillin, tetracycline and streptomycin with 23/69 percent, respectively. 93% samples cytology had neutrophil more than two and the agent of 50% showed E. coli. The cause of half of subclinical endometritis in infertile maresis E-coli bacteriaEscherichia coli are known as the most common cause of reproductive tract infection in mare. Due to the progressive process of antibiotics use and increasing prevalence of antibiotic resistance, the aim of this study is evaluate the prevalence of subclinical endometritis and antibiotic resistance genes in Escherichia coli isolated. In this study, 60 mares were used with infertility background. Diagnosis of endometritis was performed using history and ultrasonography. Cytology, culture, Antibiogram were done of samples and PCR test was used to examine the gene virulence and antibiotic resistance. E-coli bacteria was isolated 48/33 % from sample culture. In PCR test 66/21 % of bacteria had virulence gene. It was determined, the lowest resistance to chloramphenicol about 38/15% and greatest resistance into ampicillin, tetracycline and streptomycin with 23/69 percent, respectively. 93% samples cytology had

  2. SEDIMENTS POLLUTION WITH HEAVY METALS. CASE STUDY: BAIA MARE MINING AREA.

    Directory of Open Access Journals (Sweden)

    PIŞTEA IOANA

    2015-03-01

    Full Text Available The purpose of this research was to assess the degree of sediments contamination with heavy metals. In December 2013, 8 sediments samples were collected from several areas from Baia Mare. Each of the collected sediment samples was analyzed for pH, redox potential (ORP, electrical conductivity (EC, total dissolved solids (TDS and salinity with a portable multiparameter (WTW 3210i. In laboratory, using an ICP-OES, all the sediment samples were analyzed for iron (Fe, nickel (Ni, chromium (Cr, cobalt (Co, copper (Cu, zinc (Zn, cadmium (Cd, lead (Pb, and manganese (Mn.According to Romanian legislation the level of Cd, Cu, Pb and Zn exceeded the maximum permissible limit (0.8 mg/kg, 40 mg/kg, 85 mg/kg and 150 mg/kg.Heavy metals are not removed from aquatic ecosystem by self purification and they can accumulate in suspanded particulates and sediments, as a consequence they are a real threath for the human health and ecosystem via food chain accumulation.

  3. Mitochondrial DNA analyses revealed low genetic diversity in the endangered Indian wild ass Equus hemionus khur.

    Science.gov (United States)

    Khaire, Devendra; Atkulwar, Ashwin; Farah, Sameera; Baig, Mumtaz

    2017-09-01

    The Indian wild ass Equus hemionus khur, belonging to ass-like equid branch, inhabits the dry and arid desert of the Little Rann of Kutch, Gujarat. The E. h. khur is the sole survivor of Asiatic wild ass species/subspecies in South Asia. To provide first ever insights into the genetic diversity, phylogeny, and demography of the endangered Indian wild ass, we sampled 52 free-ranging individuals from the Little Rann of Kutch by using a non-invasive methodology. The sequencing of 230 bp in cytochrome b (Cyt b) and displacement loop (D-loop) region revealed that current ∼4000 extant population of Indian wild ass harbours low genetic diversity. Phylogenetic analyses confirmed that E. h. khur, E. h. onager, and E. h. kulan belong to a single strict monophyletic clade. Therefore, we suggest the delimitation of the five E. hemionus subspecies in vogue to a single species E. hemionus. The application of molecular clock confirmed that the Asiatic wild ass had undergone diversification 0.65 Million years ago. Demographic measurements assessed using a Bayesian skyline plot demonstrated decline in the maternal effective population size of the Indian wild ass during different periods; these periods coincided with the origin and rise of the Indus civilization in the northwest of the Indian subcontinent during the Neolithic. In conclusion, maintaining high genetic diversity in the existing isolated population of 4000 Indian wild asses inhabiting the wild ass sanctuary is important compared with subspecies preservation alone.

  4. Prevalence of risk factors for breast neoplasm in the city of Maringá, Paraná state, Brazil Prevalencia de factores de riesgo para el cáncer de mama en el municipio de Maringá, en el estado de Paraná, Brasil Prevalência de fatores de risco para o câncer de mama no município de Maringá, Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Jéssica Carvalho de Matos

    2010-06-01

    Full Text Available The aim of this study was to identify the prevalence of the risk factors for breast cancer among women between 40 and 69 years old in the city of Maringá, Paraná State, Brazil. An analytical, exploratory and cross-sectional study was carried out through a population research at homes in Maringá. The sample was composed of 439 women between 40 and 69 years old. The data were collected by home interviews, stored using the Statistical Package for the Social Sciences (SPSS software and presented in tables as absolute and relative frequency. The predominant ethnical group was Caucasian with an average age of 52 years. Among risk factors identified in the present study, an expressive number of overweight women were found. It is important and necessary to put in practice actions that identify the modifiable risk factors for the development of breast tumors in order to reduce morbidity and mortality levels due to this pathology.Ese estudio pretendió identificar la prevalencia de los factores de riesgo para el cáncer de mama en mujeres de 40 la 69 años, en el municipio de Maringá. Fue realizado un estudio analítico, exploratorio, de corte transversal, tipo encuesta poblacional domiciliar. El estudio fue realizado con 439 mujeres entre 40 y 69 años. Los datos fueron recolectados durante entrevistas domiciliares, almacenados en el programa Statisitical Package for the Social Sciences (SPSS y presentados en forma de frecuencia absoluta y relativa. La mayor parte de las mujeres estudiadas pertenecía a la raza blanca, con promedio de edad de 52 años. Entre los factores de riesgo identificados se destaca el gran número de mujeres con sobrepeso. Se resalta la importancia de la implementación de acciones que tengan por objetivo identificar los factores de riesgo modificables para el desarrollo del cáncer de mama para, con eso, disminuir el número de nuevos casos y de muerte por esa patología.Esse estudo pretendeu identificar a prevalência dos

  5. Injuries and their probable causes in undergraduates of the Physical Education course at the State University of Maringá

    Directory of Open Access Journals (Sweden)

    Alberto Saturno Madureira

    2008-06-01

    Full Text Available The aim of this study to analyse the occurrence of injuries in undergraduates of the Physical Education Course at the State University of Maringá. Types of injuries were diagnosed, the opinion of students and professors with regard to their probable causes was taken and the factors that could render injuries less damaging were identified. Research was carried out in the second semester of 1991 when 231 students were regularly enlisted. Data were collected by means of questionnaires for professors and for students. Forty injury cases were verified, 13 with males and 27 with females. The most common type of injury was bruises (55% followed by strain (18%. The inferior members were the most affected region. Judo was the subject in which the greatest number of injuries occurred. Students stated that salient probable causes were: agressivity of colleages in practical exercises (33% and defective sports facilities (25%. In the professors opinion, however, the two chief causes were: students’ distraction (20% and physical inability (20%. The establishment of an Internal Commission for the Prevention of Accidents has been suggested made up of professors, under graduate students and personnel of the Physical Education Department at the State University of Maringá. Its aims are to carry out a following up of this situation, to promote the prevention of injuries and to suggest possible improvements in the premises.

  6. Fotografia religiosa: a leitura de imagens na história da Diocese de Maringá

    Directory of Open Access Journals (Sweden)

    Selson Garutti

    2011-01-01

    Full Text Available This study comprises reading photos specifically referring to the episcopate in religious photos of Dom Jaime Luiz Coelho, 1st Bishop of the Diocese of Maringá, in Paraná State, the Catholic bishops¿ period which lasted for 40 years, from 1957 to 1997. Based on acquits consists of multiple images, analyzed four categories of photographs: ecclesiastical architecture, episcopate, activities and ecclesiastical body. Noting the discourse about the Church, the social context and their relations revealed by captured images. The text also highlights the relevance of the iconographic documentation for the study of ecclesiastical history, in particular, the study of ecclesiastical institution established in the city of Maringa.

  7. ONLINE RESOURCES

    Indian Academy of Sciences (India)

    Navya

    Low genetic diversity of the endangered Indian wild ass Equus hemionus khur, as revealed by microsatellite ... species of the Asiatic wild asses, Equus hemionus and Equus kiang, have been .... 5'-TCA CCC ACT AAA TCT CAA ATC C-3'.

  8. PROBIOTIC POTENCY OF LACTOBACILLUS SPP. ISOLATED FROM SUMBAWA MARE MILK

    Directory of Open Access Journals (Sweden)

    I Nengah Sujaya

    2008-03-01

    Full Text Available This research was deigned to elucidate the potency of Lactobacillus spp. isolated from sumbawa mare milk to be developed as a probiotic. Sixteen lacobacilli were screened based on their resitancy to a model of gastric juice at pH 2, 3, and 4, then followed by their resistncy to small intestional fluid model containing deoxycholic. Three lactobacilli i.e. Lactobacillus sp. SKA13, Lactobacillus rhamnosus SKG34 and Lactobacillus rhamnosus SKG49 were found to be resistentent to gastric juice at pH 3 and 4. However, there were no lactobacilli resisted to pH 2. Lactobacillus rhamnosus SKG34 and Lactobacillus rhamnosus SKG49 were able to reach the colon even after being expossed to a model of intestinal fluid containing 0,4 mM deoxycholate and pancreatine. Therefore, these isolates have a potency to be developed as probiotic lactobacilli. Nevertherless, these lactobcailli could probably transform cholic acid into secondary bile acids, which were not expected to be found in the probiotic, and this capability is not appropriate for probiotic. This character is worthly to be studied since it has never been reported in lactobacilli.

  9. Plains zebra (Equus quagga) adrenocortical activity increases during times of large aggregations in the Serengeti ecosystem.

    Science.gov (United States)

    Seeber, P A; Franz, M; Dehnhard, M; Ganswindt, A; Greenwood, A D; East, M L

    2018-04-20

    Adverse environmental stimuli (stressors) activate the hypothalamic-pituitary-adrenal axis and contribute to allostatic load. This study investigates the contribution of environmental stressors and life history stage to allostatic load in a migratory population of plains zebras (Equus quagga) in the Serengeti ecosystem, in Tanzania, which experiences large local variations in aggregation. We expected higher fGCM response to the environmental stressors of feeding competition, predation pressure and unpredictable social relationships in larger than in smaller aggregations, and in animals at energetically costly life history stages. As the study was conducted during the 2016 El Niño, we did not expect food quality of forage or a lack of water to strongly affect fGCM responses in the dry season. We measured fecal glucocorticoid metabolite (fGCM) concentrations using an enzyme immunoassay (EIA) targeting 11β-hydroxyetiocholanolone and validated its reliability in captive plains zebras. Our results revealed significantly higher fGCM concentrations 1) in large aggregations than in smaller groupings, and 2) in band stallions than in bachelor males. Concentrations of fGCM were not significantly higher in females at the energetically costly life stage of late pregnancy/lactation. The higher allostatic load of stallions associated with females, than bachelor males is likely caused by social stressors. In conclusion, migratory zebras have elevated allostatic loads in large aggregations that probably result from their combined responses to increased feeding competition, predation pressure and various social stressors. Further research is required to disentangle the contribution of these stressors to allostatic load in migratory populations. Copyright © 2018 Elsevier Inc. All rights reserved.

  10. Rock spatial densities on the rims of the Tycho secondary craters in Mare Nectaris

    Science.gov (United States)

    Basilevsky, A. T.; Michael, G. G.; Kozlova, N. A.

    2018-04-01

    The aim of this work is to check whether the technique of estimation of age of small lunar craters based on spatial density of rock boulders on their rims described in Basilevsky et al. (2013, 2015b) and Li et al. (2017) for the craters rock counts on the rims of four craters having diameters 1000, 1100, 1240 and 1400 m located in Mare Nectaris. These craters are secondaries of the primary crater Tycho, whose age was found to be 109 ± 4 Ma (Stoffler and Ryder, 2001) so this may be taken as the age of the four craters, too. Using the dependence of the rock spatial densities at the crater rims on the crater age for the case of mare craters (Li et al., 2017) our measured rock densities correspond to ages from ∼100 to 130 Ma. These estimates are reasonably close to the given age of the primary crater Tycho. This, in turn, suggests that this technique of crater age estimation is applicable to craters up to ∼1.5 km in diameter. For the four considered craters we also measured their depth/diameter ratios and the maximum angles of the crater inner slopes. For the considered craters it was found that with increasing crater diameter, the depth/diameter ratios and maximum angles of internal slopes increase, but the values of these parameters for specific craters may deviate significantly from the general trends. The deviations probably result from some dissimilarities in the primary crater geometries, that may be due to crater to crater differences in characteristics of impactors (e.g., in their bulk densities) and/or differences in the mechanical properties of the target. It may be possible to find secondaries of crater Tycho in the South pole area and, if so, they may be studied to check the specifics and rates of the rock boulder degradation in the lunar polar environment.

  11. Manual semen collection from a Grevy's zebra stallion (Equus grevyi), onset of sperm production, semen characteristics, and cryopreservation of semen, with a comparison to the sperm production from a Grant's Zebra stallion (Equus burchelli boehmi).

    Science.gov (United States)

    Crump, J P; Crump, J W

    1994-01-01

    A manual technique was used to collect representative ejaculates from an unrestrained Grevy's zebra stallion beginning at 13 mo of age to determine the onset of sperm production, to calculate the number of spermatozoa produced per ejaculate, and to determine any seasonality associated with sperm production. Spermatozoa first appeared in the ejaculate at 31 mo of age. By 48 mo of age the zebra was producing up to 40 billion spermatozoa per ejaculate. Progressive sperm motility ranged from 75 to 95%. Gel-free semen volume averaged 75 to 120 ml/ejaculate. Gel volume ranged from 0 to 1100 ml/ejaculate. Semen was frozen in 2 different extenders in 0.5-ml PVC straws. The post-thaw motility of cryopreserved spermatozoa ranged from 30 to 70%. A domestic horse mare became pregnant on the first cycle after insemination with frozen-thawed spermatozoa from this zebra. Sperm production data obtained from semen collections made on a Grant's Zebra stallion from 3 to 8 yr of age is presented for comparison of the 2 species.

  12. Winds and tides of Ligeia Mare, with application to the drift of the proposed time TiME (Titan Mare Explorer) capsule

    Science.gov (United States)

    Lorenz, Ralph D.; Tokano, Tetsuya; Newman, Claire E.

    2012-01-01

    We use two independent General Circulation Models (GCMs) to estimate surface winds at Titan’s Ligeia Mare (78° N, 250° W), motivated by a proposed mission to land a floating capsule in this ∼500 km hydrocarbon sea. The models agree on the overall magnitude (∼0.5-1 m/s) and seasonal variation (strongest in summer) of windspeeds, but details of seasonal and diurnal variation of windspeed and direction differ somewhat, with the role of surface exchanges being more significant than that of gravitational tides in the atmosphere. We also investigate the tidal dynamics in the sea using a numerical ocean dynamics model: assuming a rigid lithosphere, the tidal amplitude is up to ∼0.8 m. Tidal currents are overall proportional to the reciprocal of depth-with an assumed central depth of 300 m, the characteristic tidal currents are ∼1 cm/s, with notable motions being a slosh between Ligeia’s eastern and western lobes, and a clockwise flow pattern. We find that a capsule will drift at approximately one tenth of the windspeed, unless measures are adopted to augment the drag areas above or below the waterline. Thus motion of a floating capsule is dominated by the wind, and is likely to be several km per Earth day, a rate that will be readily measured from Earth by radio navigation methods. In some instances, the wind vector rotates diurnally such that the drift trajectory is epicyclic.

  13. Climate services for an urban area (Baia Mare City, Romania) with a focus on climate extremes

    Science.gov (United States)

    Sima, Mihaela; Micu, Dana; Dragota, Carmen-Sofia; Mihalache, Sorin

    2013-04-01

    The Baia Mare Urban System is located in the north-western part of Romania, with around 200,000 inhabitants and represents one of the most important former mining areas in the country, whose socioeconomic profile and environmental conditions have greatly changed over the last 20 years during the transition and post-transition period. Currently the mining is closed in the area, but the historical legacy of this activity has implications in terms of economic growth, social and cultural developments and environmental quality. Baia Mare city lies in an extended depression, particularly sheltered by the mountain and hilly regions located in the north and respectively, in the south-south-eastern part of it, which explains the high frequency of calm conditions and low airstream channeling occurrences. This urban system has a typically moderate temperate-continental climate, subject to frequent westerly airflows (moist), which moderate the thermal regime (without depicting severe extremes, both positive and negative) and enhance the precipitation one (entailing a greater frequency of wet extremes). During the reference period (1971-2000), the climate change signal in the area is rather weak and not statistically significant. However, since the mid 1980s, the warming signal became more evident from the observational data (Baia Mare station), showing a higher frequency of dry spells and positive extremes. The modelling experiments covering the 2021-2050 time horizon using regional (RM5.1/HadRM3Q0/RCA3) and global (ARPEGE/HadCM3Q0/BCM/ECHAM5) circulation models carried out within the ECLISE FP7 project suggest an ongoing temperature rise, associated to an intensification of temperature and precipitation extremes. In this context, the aim of this study was to evaluate how the local authorities consider and include climate change in their activity, as well as in the development plans (e.g. territorial, economic and social development plans). Individual interviews have been

  14. Mare Tralla : Stories of a "disgusting girl" : küberfeministlik ja trans/natsionaalne tehno-naer = Stories of a "disgusting girl" : cyberfeminist and trans/national techno-laughter / Katrin Kivimaa

    Index Scriptorium Estoniae

    Kivimaa, Katrin, 1969-

    2007-01-01

    Mare Tralla kunstnikuteest 1990-ndatel performance'i- ja videokunstniku, feministi ning kuraatorina. Tema kunsti iseloomustab ühiskonnakriitika ja eneseirooniline nostalgia ning "väike feministllik revolutsioon ühiskonna harmoonilisema ja õiglasema arengu tarvis". Alates 1996. aastast elab ja tegutseb peamiselt Londonis

  15. De Novo Assembly of the Donkey White Blood Cell Transcriptome and a Comparative Analysis of Phenotype-Associated Genes between Donkeys and Horses.

    Directory of Open Access Journals (Sweden)

    Feng-Yun Xie

    Full Text Available Prior to the mechanization of agriculture and labor-intensive tasks, humans used donkeys (Equus africanus asinus for farm work and packing. However, as mechanization increased, donkeys have been increasingly raised for meat, milk, and fur in China. To maintain the development of the donkey industry, breeding programs should focus on traits related to these new uses. Compared to conventional marker-assisted breeding plans, genome- and transcriptome-based selection methods are more efficient and effective. To analyze the coding genes of the donkey genome, we assembled the transcriptome of donkey white blood cells de novo. Using transcriptomic deep-sequencing data, we identified 264,714 distinct donkey unigenes and predicted 38,949 protein fragments. We annotated the donkey unigenes by BLAST searches against the non-redundant (NR protein database. We also compared the donkey protein sequences with those of the horse (E. caballus and wild horse (E. przewalskii, and linked the donkey protein fragments with mammalian phenotypes. As the outer ear size of donkeys and horses are obviously different, we compared the outer ear size-associated proteins in donkeys and horses. We identified three ear size-associated proteins, HIC1, PRKRA, and KMT2A, with sequence differences among the donkey, horse, and wild horse loci. Since the donkey genome sequence has not been released, the de novo assembled donkey transcriptome is helpful for preliminary investigations of donkey cultivars and for genetic improvement.

  16. Geography and Timing of Cases of Eastern Equine Encephalitis in New York State from 1992 to 2012.

    Science.gov (United States)

    Oliver, JoAnne; Lukacik, Gary; Kramer, Laura D; Backenson, P Bryon; Sherwood, James A; Howard, John J

    2016-04-01

    In New York State (NYS), Eastern equine encephalitis (EEE) was first reported in a human in 1971, in horses in 1970, and in pheasants in 1952. Following work for the interval from 1970 to 1991, we identified cases in vertebrates from 1992 to 2012, through a passive surveillance system involving veterinarians in clinical practice, county health departments, and the Departments of Agriculture and Markets, Environmental Conservation, and Health, of the State of New York. During an 11-year hiatus, from 1992 to 2002, no case in any vertebrate was observed. In a re-emergence, from 2003 to 2012, disease occurred in 12 counties, including 7 counties where disease had never been documented. Vertebrate cases included 4 cases in humans and 77 nonhuman occurrences; in 58 horses, Equus ferus caballus L.; 2 deer, Odocoileus virginianus Zimmermann; 6 dogs, Canis familiaris; 10 birds; and 1 flock of pheasants, Phasianus colchicus L. These were the first reported cases in NYS in white-tailed deer, the domestic dog, and in five species of birds: American crow, Corvus brachyrhynchos Brehm; American goldfinch, Carduelis tristis L.; bald eagle, Haliaeetus leucocephalus L.; blue jay, Cyanocitta cristata (L.); and red-tailed hawk, Buteo jamaicensis Gmelin. One crow was dually infected with EEE virus and West Nile virus. The northern, southern, and southeastern borders of the state were newly affected. The geographic area, time periods, and vertebrate species with risk of EEE disease expanded from 1992 to 2012.

  17. Characterization and Distribution of Lunar Mare Basalt Types Using Remote Sensing Techniques. Ph.D. Thesis

    Science.gov (United States)

    Pieters, C.

    1977-01-01

    The types of basal to be found on the moon were identified using reflectance spectra from a variety of lunar mare surfaces and craters as well as geochemical interpretations of laboratory measurements of reflectance from lunar, terrestrial, and meteoritic samples. Findings indicate that major basaltic units are not represented in lunar sample collections. The existence of late stage high titanium basalts is confirmed. All maria contain lateral variations of compositionally heterogenous basalts; some are vertically inhomogenous with distinctly different subsurface composition. Some basalt types are spectrally gradational, suggesting minor variations in composition. Mineral components of unsampled units can be defined if spectra are obtained with sufficient spectral coverage (.3 to 2.5 micron m) and spatial resolution (approximating .5 km).

  18. Seasonal and pulsatile dynamics of thyrotropin and leptin in mares maintained under a constant energy balance.

    Science.gov (United States)

    Buff, P R; Messer, N T; Cogswell, A M; Johnson, P J; Keisler, D H; Ganjam, V K

    2007-11-01

    The objective of this study was to determine if seasonal and/or pulsatile variations occur in plasma concentrations of thyrotropin (TSH) and leptin in mares while maintaining a constant energy balance. Blood samples were collected every 20 min during a 24h period in winter and again in summer from six Quarter Horse type mares. Plasma concentrations of TSH, leptin, and T(4) were determined by radioimmunoassay. No differences were observed in body weight between winter (388.1+/-12.5 kg) and summer (406.2+/-12.5 kg; P=0.11). Plasma concentrations of TSH were greater in the summer (2.80+/-0.07 ng/ml) when compared to winter (0.97+/-0.07 ng/ml; P<0.001). Pulse frequency of TSH was not different between winter (6.17+/-0.78 pulses/24h) and summer (5.33+/-0.78 pulses/24h; P=0.49). Mean TSH pulse amplitude, pulse area, and area under the curve were all greater in summer compared to winter (3.11+/-0.10 ng/ml versus 1.20+/-0.10 ng/ml, 24.86+/-0.10 ng/ml min versus 13.46+/-1.90 ng/ml min, 3936+/-72.93 ng/ml versus 1284+/-72.93 ng/ml, respectively; P<0.01). Mean concentrations of leptin were greater in summer (2.48+/-0.17 ng/ml) compared to winter (0.65+/-0.17 ng/ml; P<0.001). Pulsatile secretion patterns of leptin were not observed in any horses during experimentation. Mean concentrations of T(4) were greater in winter (20.3+/-0.4 ng/ml) compared to summer (18.2+/-0.4 ng/ml; P<0.001). These seasonal differences between winter and summer provide evidence of possible seasonal regulation of TSH and leptin.

  19. Field immobilization of feral 'Judas' donkeys (Equus asinus) by remote injection of medetomidine and ketamine and antagonism with atipamezole.

    Science.gov (United States)

    Woolnough, Andrew P; Hampton, Jordan O; Campbell, Susan; Lethbridge, Mark R; Boardman, Wayne S J; Sharp, Trudy; Rose, Ken

    2012-04-01

    The Judas technique is a method used for landscape control of feral donkeys (Equus asinus) in northern Australia. Central to the success of any Judas program is the safe, efficient, and humane attachment of the telemetry device. For feral donkeys, this involves the use of field immobilization. We examine the replacement of the current chemical capture agent, succinylcholine, with contemporary immobilization agents to achieve positive animal welfare outcomes. A combination of medetomidine and ketamine delivered by remote injection from a helicopter was used to capture 14 free-ranging feral donkeys for the fitting of telemetry collars in Western Australia in November 2010. Dose rates of 0.14 mg/kg medetomidine and 4.1 mg/kg ketamine were appropriate to immobilize animals in 9 min (± SD = 3). Mean recovery time (total time in recumbency) was 21 min (± 14). All animals recovered uneventfully after being administered atipamezole, a specific antagonist of medetomidine, intramuscularly at 0.35 mg/kg. Physiologic parameters were recorded during recumbency, with environment-related hyperthermia being the only abnormality recognized. No significant complications were encountered, and this drug combination represents an efficient approach to capturing wild donkeys. This new method allows a rapid, safe, cost-effective approach to the immobilization of feral donkeys for use as Judas animals. This drug combination will replace the relatively inhumane succinylcholine for the field immobilization of feral donkeys.

  20. Značkování u koňovitých (Equidae)

    OpenAIRE

    TUČKOVÁ, Vladimíra

    2012-01-01

    This master thesis examined the scent marking behaviour by urine and faeces in four equid species, African wild ass (Equus africanus), Grevy?s zebra (Equus grevyi), Plain zebra (Equus quagga) and Mountain zebra (Equus zebra), in captivity. Data about scent marking were collected during two five-month seasons of behavioural observation of 15 equid herds in 5 Czech Zoos, Zoo Dvůr Králové, Zoo Liberec, Zoo Brno, Zoo Ostrava and Zoo Ústí nad Labem. The study focused mainly on testing several hypo...

  1. Depressive symptoms in seniors’ population in Maringá, PR Prevalência da sintomatologia depressiva em idosos em uma área de saúde da família no município de Maringá, Estado do Paraná

    Directory of Open Access Journals (Sweden)

    Mauro Porcu

    2002-04-01

    Full Text Available This paper aims to verify the prevalence of depressive symptoms in the seniors’ population, over 60 years, in a PSF restricted area, district of Maringá - PR. An oblique study was accomplished using Beck’s Inventory for Depression. From a population of 451 individuals, a sample of 123 people were analyzed (27,3% of the total. Results were the following: 1 average age ≅ 69 ± 8 years; 2 dysphoria: 15.1% for men and 17.2% for women (p=0,7590; depression: 34% for men and 37.7% for women (p=0,6942; 3 the depression prevalence was 4.8 times higher than the Brazilian population and 2.1 times of the American seniors. It was concluded that the depressive symptoms were very high in the seniors’ sample studies of a PSF areaVerificar a prevalência da sintomatologia depressiva na população de idosos com idade superior a 60 anos, numa área adstrita do PSF, no município de Maringá, Estado do Paraná. Foi realizado um estudo transversal, utilizando o Inventário para Depressão de Beck. A população estudada foi de 451 indivíduos, da qual foi utilizada uma amostra de 123 pessoas correspondendo a 27,3% do total. Obtiveram-se os seguintes resultados: 1 idade média ≅ 69 ± 8 anos; 2 disforia: 15,1% dos homens e 17,2% das mulheres (p = 0,7590; depressão: 34% dos homens e 37,7% das mulheres (p = 0,6942; 3 a prevalência de “depressão” foi 4,8 vezes maior que a população brasileira e 2,1 vezes a dos idosos americanos. Assim, a sintomatologia depressiva foi altamente prevalente na amostra de idosos estudada, de uma área de PSF

  2. Plants and pollinating bees in Maringá, State of Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Toledo Vagner de Alencar Arnaut de

    2003-01-01

    Full Text Available The present study was carried out to survey the bees as visitors to melliferous flora in the region of Maringá, state of Paraná, Brazil. A total of 331 insects were captured, and the fauna comprised 39.88% Trigona spinipes, 38.37% Apis mellifera, 8.16% Tetragonisca angustula, 3.93% Halictidae, 1.21% Megachilidae, 2.42% Anthophoridae, and 3.32% other Hymenoptera. Eleven plant species from nine families were observed. The four families most frequently visited by A. mellifera were Pontederiaceae (93.53%, Sterculiaceae and Polygoniaceae (47.22%, Apocynaceae and Apiaceae (42.86%. The families most visited by T. spinipes were Lamiaceae (64.70%, Apocynaceae (57.14%, Sterculiaceae (51.85% and Anacardiaceae (48.39%, and the families most visited by T. angustula were (28.57%, Asteraceae (22.22% and Labiatae (16.47%. Three species predominated in number of bee visits Dombeya wallichii (32.63%, Ocimum americanum (15.5% and Antigonon leptopus (15.2%. T. angustula was the most frequent visitor of O. gratissimum flowers (60.87%.

  3. 2011 ESTCP Live Site Demonstrations, Vallejo CA, ESTCP MR-1165, Demonstration Data Report, Former Mare Island Naval Shipyard, MTADS Discrimination Array, (TEMTADS) Survey

    Science.gov (United States)

    2012-04-05

    Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6110--12-9397 2011 ESTCP Live Site Demonstrations Vallejo , CA ESTCP MR-1165 Demonstration...b. ABSTRACT c. THIS PAGE 18. NUMBER OF PAGES 17. LIMITATION OF ABSTRACT 2011 ESTCP Live Site Demonstrations Vallejo , CA ESTCP MR-1165 Demonstration...Hertz IVS Instrument Verification Strip (f)MINSY (former) Mare Island Naval Shipyard, located in Vallejo , CA MR Munitions Response MTADS Multi-sensor

  4. Photoadvisory: the photography in the press advisory body in the Maringá City Hall Administration Fotoassessorismo: a imagem fotográfica na assessoria de imprensa da Prefeitura Municipal de Maringá

    Directory of Open Access Journals (Sweden)

    Cibele Abdo Rodella

    2011-08-01

    Full Text Available Guided by the methodological perspective of analytical deconstruction, this work analyses photographic images from Maringa´s Prefecture press advisory. It seeks to answer to the following question: What strategies of senses do the photographic images build in the press advisement? In this attempt, it aims to: 1 To conceptualize the aspect of communicational intentionality; 2 To infer about its use on press advisory services; 3 To analyze if formats and genres of photographic image in journalism remain in the press advisory body. As a discourse, the photographic image in the press advisory body aims to build positive senses for the advised. In this case, with technical and photographic language domain, photojournalists intent to build elements, objects and characters to build up concepts, values and positive representation of the advised. For analysis of the photojournalists’ intentionality, they were used photographs taken from the site of the press advisory body of Maringá (PR Prefecture, referring to several articles.

  5. Vegetal test-system investigation on cytotoxicity of water from urban streams located in the northeastern region of Maringá, Paraná State, Brazil - doi: 10.4025/actascibiolsci.v33i1.4924 Vegetal test-system investigation on cytotoxicity of water from urban streams located in the northeastern region of Maringá, Paraná State, Brazil - doi: 10.4025/actascibiolsci.v33i1.4924

    Directory of Open Access Journals (Sweden)

    Marcus Eduardo Kamide Gonçalves

    2011-02-01

    Full Text Available The increase in consumption of water, the destruction of riparian forests and the pollution caused by humans, have severely degraded several water resources. Numerous stream crisscross the city of Maringá, Paraná state, Brazil and most of their sources are scattered through the urban region. Current analysis assesses the cytotoxic potential of water from the Corregozinho, Isalto, Morangueira and Ozório streams, located within the high-populated northeastern region of Maringá, inside the urban perimeter. Root meristematic cells of Allium cepa were used as test-system. The roots of onion were prepared by Feulgen’s reaction and stained with Schiff's reagent. Results showed that there were no statistically significant changes evaluated by the chi-square test on the rates of cell division in cells of Allium cepa roots treated with the water of the streams when compared to data from controls. However, further analyses should be undertaken at different times for a periodic assessment of conditions in the streams, coupled with an awareness of the population on the environment.The increase in consumption of water, the destruction of riparian forests and the pollution caused by humans, have severely degraded several water resources. Numerous stream crisscross the city of Maringá, Paraná state, Brazil and most of their sources are scattered through the urban region. Current analysis assesses the cytotoxic potential of water from the Corregozinho, Isalto, Morangueira and Ozório streams, located within the high-populated northeastern region of Maringá, inside the urban perimeter. Root meristematic cells of Allium cepa were used as test-system. The roots of onion were prepared by Feulgen’s reaction and stained with Schiff's reagent. Results showed that there were no statistically significant changes evaluated by the chi-square test on the rates of cell division in cells of Allium cepa roots treated with the water of the streams when compared to

  6. Fermentation characteristics and angiotensin I-converting enzyme-inhibitory activity of Lactobacillus helveticus isolate H9 in cow milk, soy milk, and mare milk.

    Science.gov (United States)

    Wang, Jicheng; Li, Changkun; Xue, Jiangang; Yang, Jie; Zhang, Qing; Zhang, Heping; Chen, Yongfu

    2015-06-01

    Lactobacillus helveticus isolate H9 demonstrated high angiotensin I-converting enzyme (ACE)-inhibitory activity in previous research. Here, we evaluated the fermentation characteristics (pH, titratable acidity, free amino nitrogen, and viable bacterial counts), ACE-inhibitory activity, and contents of Val-Pro-Pro (VPP) and Ile-Pro-Pro (IPP) peptides of stored yogurt (4°C for 28 d) fermented by L. helveticus isolate H9 (initially inoculated at 4 concentrations), from cow, mare, and soy milks. During storage, the pH and titratable acidity remained stable in yogurts produced from all milk types and all inoculation concentrations. The viable bacterial counts in all stored yogurts ranged between 10(6.72) and 10(8.59) cfu/g. The highest ACE-inhibitory activity (70.9-74.5%) was achieved at inoculation concentrations of 5×10(6) cfu/mL. The ACE-inhibitory tripeptides VPP and IPP as determined by ultra-performance liquid chromatography-tandem mass spectrometry were not produced in yogurt made from soy milk or mare milk. These evaluations indicate that L. helveticus H9 has good probiotic properties and would be a promising candidate for production of fermented food with probiotic properties. Copyright © 2015 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  7. Combining histology, stable isotope analysis and ZooMS collagen fingerprinting to investigate the taphonomic history and dietary behaviour of extinct giant tortoises from the Mare aux Songes deposit on Mauritius

    NARCIS (Netherlands)

    van der Sluis, L.G.; Hollund, H.I.; Buckley, M.; de Louw, P.G.B.; Rijsdijk, K.F.; Kars, H.

    2014-01-01

    Taphonomic research of bones can provide additional insight into a site's formation and development, the burial environment and ongoing post-mortem processes. A total of 30 tortoise (Cylindraspis) femur bone samples from the Mare aux Songes site (Mauritius) were studied histologically, assessing

  8. Ocorrência de onicomicose em Maringá, Estado do Paraná, Brasil - DOI: 10.4025/actascihealthsci.v27i2.1425 Occurrence of the onychomycosis in Maringá, Paraná State, Brazil - DOI: 10.4025/actascihealthsci.v27i2.1425

    Directory of Open Access Journals (Sweden)

    Terezinha Inez Estivalet Svidzinski

    2005-03-01

    Full Text Available Onicomicoses são infecções fúngicas que atingem as unhas e acometem cerca de 30% da população. Recentemente tem sido relatado aumento dessas infecções e também alterações em sua etiologia. O objetivo deste estudo foi avaliar a freqüência das onicomicoses e perfil dos pacientes acometidos em Maringá, Estado do Paraná, Brasil. Entre janeiro de 1999 a junho de 2003 foram analisadas, no Laboratório de Micologia do Lepac (Laboratório de Ensino e Pesquisa em Análises Clínicas da Universidade Estadual de Maringá, um total de 435 amostras de pacientes com suspeita clínica de onicomicose. Destas amostras 74,25% (N = 323 foram positivas, sendo 15,48% confirmadas por exame direto (N=50, 20,43% exclusivamente por cultura (N=66 e 64,09% por exame direto e cultura (N=207. As mulheres foram mais afetadas que os homens (72,67% e 27,33%, respectivamente, e a maior prevalência foi em indivíduos com mais de 40 anos. As unhas dos pés foram mais acometidas que as unhas das mãos (65,90% e 34,10%, respectivamente. Os agentes etiológicos mais freqüentes foram as leveduras (52,17% isoladas especialmente das unhas das mãos. Os fungos filamentosos foram prevalentes nas unhas dos pés, destacando-se os dermatófitos responsáveis por 33,85% das onicomicoses e os não dermatófitos (FFND por 13,97%Onychomycosis are fungal infections that reach the nails and affect about 30% of the population. Recently has been observed increase of these infections and also alterations in its etiology. The objective of this study was to evaluate the frequency of these mycosis and profile of the patients attacked in Maringá, Paraná State, Brazil. Between January 1999 to June 2003 were analyzed at the Mycological Laboratory from the Teaching and Research Laboratory in Clinical Analyses (Lepac a total of 435 samples of patients with clinical symptoms of onychomycoses. Of those samples 74,25% (N=323, were positive, being 15,48% confirmed by direct examination (N=50

  9. THE MORPHOLOGY OF TÂRNAVA MARE CORRIDOR AND IT’S CONDITIONING ON THE SETTLEMENTS AND THOROUGHFARES PLANNING (COPŞA MICĂ – BLAJ SECTOR

    Directory of Open Access Journals (Sweden)

    Gheorghe ROŞIAN

    2011-04-01

    Full Text Available Settlements and thoroughfares positioning in hilly terrains, fragmented by valleys, as in the Târnava Mare Corridor case, is influenced by the value of morphological parameters. The variety of the relief, as extension and altitude, determines a specific distribution of the resources offered by the other geographic components. This directs to the anthropic component adaptation to local conditions, action expressed by capitalizing the favorable areas and avoiding the restrictive ones.

  10. Unraveling the effects of selection and demography on immune gene variation in free-ranging plains zebra (Equus quagga) populations.

    Science.gov (United States)

    Kamath, Pauline L; Getz, Wayne M

    2012-01-01

    Demography, migration and natural selection are predominant processes affecting the distribution of genetic variation among natural populations. Many studies use neutral genetic markers to make inferences about population history. However, the investigation of functional coding loci, which directly reflect fitness, is critical to our understanding of species' ecology and evolution. Immune genes, such as those of the Major Histocompatibility Complex (MHC), play an important role in pathogen recognition and provide a potent model system for studying selection. We contrasted diversity patterns of neutral data with MHC loci, ELA-DRA and -DQA, in two southern African plains zebra (Equus quagga) populations: Etosha National Park, Namibia, and Kruger National Park, South Africa. Results from neutrality tests, along with observations of elevated diversity and low differentiation across populations, supported previous genus-level evidence for balancing selection at these loci. Despite being low, MHC divergence across populations was significant and may be attributed to drift effects typical of geographically separated populations experiencing little to no gene flow, or alternatively to shifting allele frequency distributions driven by spatially variable and fluctuating pathogen communities. At the DRA, zebra exhibited geographic differentiation concordant with microsatellites and reduced levels of diversity in Etosha due to highly skewed allele frequencies that could not be explained by demography, suggestive of spatially heterogeneous selection and local adaptation. This study highlights the complexity in which selection affects immune gene diversity and warrants the need for further research on the ecological mechanisms shaping patterns of adaptive variation among natural populations.

  11. Seropositivity of Toxoplasma gondii in domestic donkeys (Equus asinus) and isolation of T. gondii from farm cats.

    Science.gov (United States)

    Dubey, J P; Ness, S L; Kwok, O C H; Choudhary, S; Mittel, L D; Divers, T J

    2014-01-17

    Donkeys (Equus asinus) are used as both companion and working animals throughout the world and in some countries, their meat and milk are used for human consumption. Here we report the first serological survey of Toxoplasma gondii in donkeys in the United States. Serum samples from 373 donkeys from eight farms in five states were tested for T. gondii antibodies by the modified agglutination test (MAT). Twenty-four of 373 (6.4%) of donkeys were seropositive, with MAT titers ranging from 25 to ≥ 200. All seropositive donkeys were Miniature breed. Seropositivity prevalence was 7.0% in female donkeys (20/282) and 4.1% in male donkeys (4/91). No donkeys less than 24 months of age (129) were seropositive, suggesting postnatal transmission of infection. Domestic cats were present on six of the eight farms. Three cats from one farm had MAT titers of 200. Viable T. gondii was isolated from the hearts of two cats, but not from brain tissues. Genotyping of isolate DNA extracted from culture-derived tachyzoites using 10 PCR-restriction fragment length polymorphism (RFLP) markers (SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, PK1, L358 and Apico loci) revealed that both isolates were clonal Type II (ToxoDB PCR-RFLP genotype #1). This is the first serological survey for T. gondii in donkeys in the United States, and suggests that donkey milk and meat should be considered as a potential source for human infection. The role of barn cats in the transmission of T. gondii to donkeys on farms warrents further investigation. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Black rhinoceros (Diceros bicornis) and domestic horse (Equus caballus) hindgut microflora demonstrate similar fermentation responses to grape seed extract supplementation in vitro.

    Science.gov (United States)

    Huntley, N F; Naumann, H D; Kenny, A L; Kerley, M S

    2017-10-01

    The domestic horse is used as a nutritional model for rhinoceros maintained under human care. The validity of this model for browsing rhinoceros has been questioned due to high prevalence of iron overload disorder (IOD) in captive black rhinoceros (Diceros bicornis), which is associated with high morbidity and mortality. Iron chelators, such as tannins, are under investigation as dietary supplements to ameliorate or prevent IOD in prone species. Polyphenolic compounds variably affect microbial fermentation, so the first objective of this experiment was to evaluate the effects of grape seed extract (GSE; a concentrated source of condensed tannins; CT) on black rhinoceros hindgut fermentation. Equine nutrition knowledge is used to assess supplements for rhinoceros; therefore, the second objective was to evaluate the domestic horse model for black rhinoceros fermentation and compare fermentation responses to GSE using a continuous single-flow in vitro culture system. Two replicated continuous culture experiments were conducted using horse and black rhinoceros faeces as inoculum sources comparing four diets with increasing GSE inclusion (0.0%, 1.3%, 2.7% and 4.0% of diet dry matter). Diet and GSE polyphenolic compositions were determined, and sodium sulphite effect on neutral detergent fibre extraction of CT-containing forages was tested. Increasing GSE inclusion stimulated microbial growth and fermentation, and proportionally increased diet CT concentration and iron-binding capacity. Horse and black rhinoceros hindgut microflora nutrient digestibility and fermentation responses to GSE did not differ, and results supported equine fermentation as an adequate model for microbial fermentation in the black rhinoceros. Interpretation of these results is limited to hindgut fermentation and further research is needed to compare foregut digestibility and nutrient absorption between these two species. Supplementation of GSE in black rhinoceros diets up to 4% is unlikely to adversely affect hindgut nutrient digestibility or microbial viability and fermentation. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.

  13. SEASONAL DISCHARGE REGIME OF THE RIVERS IN THE TRANSYLVANIAN SUBCARPATHIANS AND THE ADJACENT MOUNTAINOUS SPACE BETWEEN TÂRNAVA MARE AND NIRAJ

    Directory of Open Access Journals (Sweden)

    VICTOR SOROCOVSCHI

    2015-05-01

    Full Text Available Seasonal discharge regime of the rivers in the Transylvanian Subcarpathians and the adjacent mountainous space between Târnava Mare and Niraj. The studied region is situated in the North-East of the Transylvanian Depression and includes two distinct units: the Transylvanian Subcarpathians and the Moldavo-Transylvanian Carpathians, comprised between the valleys of Târnava Mare and Niraj. The study is based upon the processing and interpretation of data coming from 13 hydrometric stations. In order to emphasize the particuliarities of the seasonal discharge regime, we took into account three periods (1950-1967, 1950-2009 and 1970-2009. The characteristics of the geographic coating from the studied area, especially the climatic and geomorphic ones, are clearly reflected in the discharge regime of river waters. Thus, on all rivers, spring discharge is predominant, and winter and autumn are the seasons with the lowest weight of the multiannual average volume. We have underlined the particuliarities of the three subtypes of seasonal regime and we have defined the limits of the corresponding display areas. The variation of the seasonal discharge on a multiannual level was outlined with the help of variation coefficients. Likewise, we also determined the discharge tendencies for the three studied intervals. The analysis carried out has revealed the fact that the rhythmic structure of the hydric system reflects the local characteristics of the supplying sources, of geological, as well as morphological and morphometrical conditions of the relief.

  14. O uso de praguicidas por trabalhadores do setor agrícola atendidos ambulatorialmente em Maringá no período de 2002 a 2003 - DOI: 10.4025/actascihealthsci.v26i2.1583 Pesticide use by agricultural workers in outpatients attendance in Maringá in the periods of 2002 and 2003 - DOI: 10.4025/actascihealthsci.v26i2.1583

    Directory of Open Access Journals (Sweden)

    Miguel Machinski Junior

    2004-04-01

    Full Text Available Os impactos de origem ambiental e ocupacional, relacionados ao uso de praguicidas, têm como alvo imediato a saúde coletiva, pois os resíduos liberados do ambiente ou remanescentes nas culturas estão sendo progressivamente transferidos para a água, para os alimentos e para o homem. Este trabalho teve como objetivo caracterizar a utilização de praguicidas por trabalhadores do setor agrícola, atendidos no Ambulatório de Toxicologia e Saúde do Trabalhador do Centro de Controle de Intoxicações de Maringá (CCI-Maringá, a fim de avaliar os impactos sobre o ambiente e a saúde dessa população. Durante o período de 2002 a 2003, foi realizado um estudo descritivo retrospectivo em vinte e cinco pacientes atendidos devido à intoxicação por praguicidas. Os resultados demonstraram que os praguicidas representam um importante risco à saúde da população estudada e ao meio ambiente.The environmental and occupational origin impacts concerning the use of pesticides have the public health as immediate target. The environment residues or remainders in the crops are being gradually transferred to water, food and human being. The purpose of this paper was to characterize the use of pesticides by agricultural workers in the outpatient’s attendance of the Toxicology and Worker Health Clinic of the Poisoning Control Center of Maringá (Brazil, in order to evaluate their impacts on the environment and on the population’s health. During the period 2002-2003, a retrospective descriptive study was carried out in twenty-five patients attended for pesticide poisoning. The results showed that the pesticides represent an important risk to the health of the studied population as well as to the environment.

  15. SENSIBILITY OF MICROCULTIVATION ASSAY DERMATOBAC® FOR FUNGAL ENDOMETRITIS DIAGNOSIS IN MARES

    Directory of Open Access Journals (Sweden)

    Eriky Akio de Oliveira Tongu

    2015-10-01

    Full Text Available Among different etiologic factors, fungal endometritis is a common cause of decreased mare’s fertility. Two experiments were conducted to evaluate the sensitivity of Dermatobac®, a microculture system originallydevelopedfortheisolationoffungithatconcerns Human Medicine. In Experiment 1, standard (ATCC strains of Candida (n=4 and Aspergyllus (n=1 were grown and visually analyzed daily for 7 days. For Experiment 2, 34 mares were selected and subjected to material harvesting for completion of uterine cytology as well as seeding with Dermatobac®. After 24h of cultivation, the macroscopic observation of all Candida and Aspergyllus strains (Experiment 1 was possible. In Experiment 2, five animals showed presence of yeast on cytologic slides (14.71%, results also confirmed sowing in Dermatobac® system (100% sensitivity. Five false positive cases were observed, characterized by microbiological growth in Dermatobac® but not confirmed by endometrial cytology, determining specificity of 85%. However, the results did not compromise the efficiency of Dermatobac® system given all contaminants presented differentiated morphology and higher growing time (P<0.05 when compared to the major etiological agents of equine fungal endometritis. The Dermatobac® system proved to be efficient for the macroscopic diagnosis of fungal endometritis in horses, showing conclusive information only after 24 hours of culture.

  16. Bifidobacterium mongoliense sp. nov., from airag, a traditional fermented mare's milk product from Mongolia.

    Science.gov (United States)

    Watanabe, Koichi; Makino, Hiroshi; Sasamoto, Masae; Kudo, Yuko; Fujimoto, Junji; Demberel, Shirchin

    2009-06-01

    Two novel micro-organisms, designated strains YIT 10443(T) and YIT 10738, were isolated from airag, a traditional fermented mare's milk from Mongolia. The two strains were Gram-positive-staining, non-motile, asporogenous, catalase-negative, facultatively anaerobic rods of various shapes. Comparative analyses of 16S rRNA and ClpC ATPase (clpC) gene sequences and the presence of fructose-6-phosphate phosphoketolase (F6PPK) demonstrated that the novel strains were members of the genus Bifidobacterium. On the basis of 16S rRNA gene sequence similarity, the type strains of Bifidobacterium minimum (96.6 %) and Bifidobacterium psychraerophilum (95.7 %) were the closest neighbours of the novel strains, and DNA-DNA reassociation values with these strains were found to be lower than 15 %. The phenotypic and genotypic features demonstrated that the two strains represent a single, novel Bifidobacterium species, for which the name Bifidobacterium mongoliense sp. nov. is proposed. The type strain is YIT 10443(T) (=JCM 15461(T) =DSM 21395(T)).

  17. Perfil do consumo de leite e produtos derivados na cidade de Maringá, Estado do Paraná = Profile of milk and its products consumption in Maringá, Paraná State

    Directory of Open Access Journals (Sweden)

    Gustavo Molina

    2010-07-01

    Full Text Available Os dados coletados na cidade de Maringá, Estado do Paraná, referentes ao consumo e à aceitação do leite e seus derivados foram utilizados para se traçar o perfil do consumo desses produtos, gerando subsídios para entendimento mais amplo sobre o mercado consumidor de leite. Trezentos indivíduos responderam à pesquisa que avaliou o grau de aceitação e frequência de consumo do leite e produtos derivados. Observou-se que o mais importante para o consumidor, no momento da compra, encontra-se na relação entre preço e qualidade do produto, e aproximadamente metade dos entrevistados (48,17% tem preferência pelo leite integral, seguido pelo desnatado com 26,20%. Entretanto,constatou-se que 8,73% dos entrevistados declararam não consumir leite, e a maior parte dos casos justifica-se por possuírem algum nível de intolerância à lactose. Enquanto isso, o iogurte e os queijos foram apontados como os derivados com maior percentual defrequência de consumo e aceitação. De forma geral, os dados coletados permitem concluir que o leite e seus derivados são produtos consumidos com regularidade e seus derivados foram apontados com alto percentual de frequência de consumo e aceitação.Data collected in Maringá, Paraná State, on the acceptance and consumption of milk and its products were used to delineate the profile of consumption of these products, generating benefits for a better understanding of the consumer market for milk. A total of 300 people answered the survey that assessed the degree of acceptance and frequency of consumption of milk and its products. It was observed that the most important to the consumer at the time of purchase, is the relationship between price and quality of product, and approximately half of respondents (48.17% prefer whole milk, followed by skimmed milk with 26.20%. However, it was found that 8.73% of respondents reported that do not consume milk, with the majority of cases justified by some level of

  18. Caracterização dos traumas abdominais em pacientes atendidos no Hospital Universitário Regional de Maringá, 2006 = Abdominal trauma at the University Hospital of Maringá, 2006

    Directory of Open Access Journals (Sweden)

    Orlando Ribeiro Prado Filho

    2008-07-01

    Full Text Available De todas as mortes por causas externas por trauma, metade poderia ser evitada, e um terço delas é dito potencialmente evitável. Objetiva-se determinar as características comuns referentes ao paciente com traumatismo abdominal. Realizou-se um estudo de 57 casos de pacientes com traumatismo abdominal atendidos no Hospital UniversitárioRegional de Maringá, no período de janeiro a dezembro de 2006. Constatou-se que a maioria das vítimas é do sexo masculino; a faixa etária mais acometida é a terceira década de vida; o trauma abdominal aberto mostrou-se discretamente mais frequente, sendo o ferimento por arma branca mais comum; a maioria das contusões abdominais se deveu aacidentes de trânsito; a realização de intervenção cirúrgica supera o tratamento conservador nos traumas abdominais abertos; nos traumas contusos, o baço e os rins foram os órgãos mais acometidos, enquanto nos ferimentos abertos a víscera mais acometida foi o intestinodelgado; a evolução para óbito predominou nos traumas abdominais abertos. Em virtude da prevalência, gravidade e importância do tema, sugere-se que mais estudos sejam realizados para que, assim, seja possível estabelecer condutas cada vez mais apropriadas à realidade doSistema Único de Saúde.Of all the deaths due to external cause trauma, half could be avoided, and a third are potentially preventable. The objective of this study was to determine the common characteristics related to patients with abdominal trauma. A study was conducted of 57 cases of abdominal trauma at the University Hospital of Maringá, during the period from January to December 2006. The majority of victims are male; the most affected age group is in its third decade oflife; open abdominal trauma proved to be slightly more prevalent, and wounds from cold steel weapons were the most common; most abdominal injuries were due to traffic accidents; the conduct of surgical intervention overcomes conservative treatment in

  19. Towards a typology of the mares sandstone of Mallorca Concept, characterization and stratigraphy; Hacia una tipología de la piedra de marés de Mallorca. Concepto, caracterización y estratigrafía

    Energy Technology Data Exchange (ETDEWEB)

    Mas Gornals, C.

    2017-09-01

    The mares sandstone has traditionally been the most representative and characteristic building stone on the island of Mallorca, used practically exclusively as construction material for centuries, since the abandonment of stone-and-mortar walls, until its progressive disuse with the appearance of the re-enforced concrete, which finally eclipsed its use. Such emblematic buildings for the island, as Bellver Castle, the Cathedral, La Lonja or the old city walls of Palma, bear witness to this. In Mallorca, the mares sandstone is quarried in the open air or in subterranean galleries. Vernacular architecture has always used the most accessible appropriate materials, and in the case of the mares sandstone, its abundance, sufficient softness, which facilitates its extraction, Together with sufficient hardness to confer solidity and durability in constructions, converge. The lack of specific scientific and geological data published about the different types of mares in Mallorca, added to the recent resurgence of technical, applied and landscape interest in this stone, have made a revision of its definition, characterization and classification necessary. [Spanish] Se definen el concepto y naturaleza de la piedra calcarenita denominada marés de la isla de Mallorca, a partir d sus características intrínsecas y de uso. Se realiza una clasificación y caracterización tipológica a partir de la cronoestratigrafía y contexto geológico de esta piedra utilizada como material de construcción. Se proporcionan datos históricos y etnológicos sobre su producción y aplicaciones. El marés de Mallorca, junto con las canteras donde se extrae, además de constituir un valioso patrimonio histórico-etnológico-cultural, constituyen también un importante patrimonio geológico-natural que registra y nos permite seguir la evolución y la historia geológica de la isla de Mallorca a través de los últimos 15 millones de años, desde el Mioceno medio (Langhiense-Serravalliense) hasta

  20. A young multilayered terrane of the northern Mare Imbrium revealed by Chang’E-3 mission

    Science.gov (United States)

    Xiao, Long; Zhu, Peimin; Fang, Guangyou; Xiao, Zhiyong; Zou, Yongliao; Zhao, Jiannan; Zhao, Na; Yuan, Yuefeng; Qiao, Le; Zhang, Xiaoping; Zhang, Hao; Wang, Jiang; Huang, Jun; Huang, Qian; He, Qi; Zhou, Bin; Ji, Yicai; Zhang, Qunying; Shen, Shaoxiang; Li, Yuxi; Gao, Yunze

    2015-03-01

    China’s Chang’E-3 (CE-3) spacecraft touched down on the northern Mare Imbrium of the lunar nearside (340.49°E, 44.12°N), a region not directly sampled before. We report preliminary results with data from the CE-3 lander descent camera and from the Yutu rover’s camera and penetrating radar. After the landing at a young 450-meter crater rim, the Yutu rover drove 114 meters on the ejecta blanket and photographed the rough surface and the excavated boulders. The boulder contains a substantial amount of crystals, which are most likely plagioclase and/or other mafic silicate mineral aggregates similar to terrestrial dolerite. The Lunar Penetrating Radar detection and integrated geological interpretation have identified more than nine subsurface layers, suggesting that this region has experienced complex geological processes since the Imbrian and is compositionally distinct from the Apollo and Luna landing sites.

  1. Riqueza, composição e distribuição espacial da comunidade de aves em um fragmento florestal urbano em Maringá, Norte do Estado do Paraná, Brasil = Richness, composition and spatial distribution of bird community on an urban forest fragment at Maringá, Northern Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    André Beal Galina

    2006-10-01

    Full Text Available Foi analisada a riqueza, composição e distribuição espacial de aves em um fragmento florestal urbano de 47,3 ha em Maringá, Sul do Brasil (23°25’S e 51°25W. Quatro hábitats foram categorizados neste fragmento: interior de floresta, borda de floresta, áreas abertas e lago. A borda e interior de floresta foram divididos em três estratos: inferior (abaixo de 3 m, médio (3-6 m e superior (acima de 6 m. Uma transecção abrangendo todos os hábitats foi percorrida quatro vezes por mês de janeiro a dezembro de 2003, totalizando 48 dias de amostragens. Foram registradas 86 espécies de aves no fragmento florestal, sendo os insetívoros e onívoros, respectivamente, as guildas com maior número de espécies. A maioriadas espécies foi registrada no máximo em 25% das amostragens. O interior da floresta foi o hábitat que teve a maior riqueza de espécies e a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. O estrato médio apresentou a maior riqueza e o superior a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. Ressalta-se a importância de se manter os vários fragmentos florestais urbanos e a cobertura arbórea nacidade de Maringá, a fim de se minimizar os efeitos do isolamento e tentar suprir as necessidades de uma parte da comunidade de aves que possivelmente não se manteria caso não houvesse outras áreas florestais próximas ao local estudado.Richness, composition and spatial distribution of birds were analyzed on an urban forest fragment of 47.3 ha at Maringá, Southern Brazil (23°25'S and 51°25W. Four habitats were categorized on this fragment: forest, forest edge, open areas and lagoon. The forest and forest edge were divided into three levels: understory (bellow 3 m, mid-levels (3-6 m and canopy (above 6 m. A standard transect was ran throughout all pre-established habitats four times each month of January to December 2003, totaling 48 sampling days. A total of 86

  2. Space-Use Patterns of the Asiatic Wild Ass (Equus hemionus): Complementary Insights from Displacement, Recursion Movement and Habitat Selection Analyses.

    Science.gov (United States)

    Giotto, Nina; Gerard, Jean-François; Ziv, Alon; Bouskila, Amos; Bar-David, Shirli

    2015-01-01

    The way in which animals move and use the landscape is influenced by the spatial distribution of resources, and is of importance when considering species conservation. We aimed at exploring how landscape-related factors affect a large herbivore's space-use patterns by using a combined approach, integrating movement (displacement and recursions) and habitat selection analyses. We studied the endangered Asiatic wild ass (Equus hemionus) in the Negev Desert, Israel, using GPS monitoring and direct observation. We found that the main landscape-related factors affecting the species' space-use patterns, on a daily and seasonal basis, were vegetation cover, water sources and topography. Two main habitat types were selected: high-elevation sites during the day (specific microclimate: windy on warm summer days) and streambed surroundings during the night (coupled with high vegetation when the animals were active in summer). Distribution of recursion times (duration between visits) revealed a 24-hour periodicity, a pattern that could be widespread among large herbivores. Characterizing frequently revisited sites suggested that recursion movements were mainly driven by a few landscape features (water sources, vegetation patches, high-elevation points), but also by social factors, such as territoriality, which should be further explored. This study provided complementary insights into the space-use patterns of E. hemionus. Understanding of the species' space-use patterns, at both large and fine spatial scale, is required for developing appropriate conservation protocols. Our approach could be further applied for studying the space-use patterns of other species in heterogeneous landscapes.

  3. The Responses of Young Domestic Horses to Human-Given Cues

    Science.gov (United States)

    Proops, Leanne; Rayner, Jenny; Taylor, Anna M.; McComb, Karen

    2013-01-01

    It has been suggested that the process of domestication, at least in some species, has led to an innate predisposition to be skilled at reading human communicative and attentional cues. Adult domestic horses (Equus caballus) are highly sensitive to subtle bodily cues when determining if a person is attending to them but they are less adept at using human communicative cues in object choice tasks. Here we provide the first study into the ontogeny of such skills in order to gain insights into the mechanisms underlying these abilities. Compared with adult horses, youngsters under the age of three could use body orientation but not more subtle cues such as head movement and open/closed eyes to correctly choose an attentive person to approach for food. Across two object choice experiments, the performance of young horses was comparable to that of adult horses – subjects were able to correctly choose a rewarded bucket using marker placement, pointing and touching cues but could not use body orientation, gaze, elbow pointing or tapping cues. Taken together these results do not support the theory that horses possess an innate predisposition to be particularly skilled at using human cues. Horses' ability to determine whether humans are attending to them using subtle body cues appears to require significant experience to fully develop and their perhaps less remarkable use of limited cues in object choice tasks, although present at a much earlier age, is likely to reflect a more general learning ability related to stimulus enhancement rather than a specific ‘human-reading’ skill. PMID:23840572

  4. OAS1 polymorphisms are associated with susceptibility to West Nile encephalitis in horses.

    Directory of Open Access Journals (Sweden)

    Jonathan J Rios

    Full Text Available West Nile virus, first identified within the United States in 1999, has since spread across the continental states and infected birds, humans and domestic animals, resulting in numerous deaths. Previous studies in mice identified the Oas1b gene, a member of the OAS/RNASEL innate immune system, as a determining factor for resistance to West Nile virus (WNV infection. A recent case-control association study described mutations of human OAS1 associated with clinical susceptibility to WNV infection. Similar studies in horses, a particularly susceptible species, have been lacking, in part, because of the difficulty in collecting populations sufficiently homogenous in their infection and disease states. The equine OAS gene cluster most closely resembles the human cluster, with single copies of OAS1, OAS3 and OAS2 in the same orientation. With naturally occurring susceptible and resistant sub-populations to lethal West Nile encephalitis, we undertook a case-control association study to investigate whether, similar to humans (OAS1 and mice (Oas1b, equine OAS1 plays a role in resistance to severe WNV infection. We identified naturally occurring single nucleotide mutations in equine (Equus caballus OAS1 and RNASEL genes and, using Fisher's Exact test, we provide evidence that mutations in equine OAS1 contribute to host susceptibility. Virtually all of the associated OAS1 polymorphisms were located within the interferon-inducible promoter, suggesting that differences in OAS1 gene expression may determine the host's ability to resist clinical manifestations associated with WNV infection.

  5. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

  6. Geographic variability of Escherichia coli ribotypes from animals in Idaho and Georgia.

    Science.gov (United States)

    Hartel, Peter G; Summer, Jacob D; Hill, Jennifer L; Collins, J Victoria; Entry, James A; Segars, William I

    2002-01-01

    Several genotypic methods have been developed for determining the host origin of fecal bacteria in contaminated waters. Some of these methods rely on a host origin database to identify environmental isolates. It is not well understood to what degree these host origin isolates are geographically variable (i.e., cosmopolitan or endemic). This is important because a geographically limited host origin database may or may not be universally applicable. The objective of our study was to use one genotypic method, ribotyping, to determine the geographic variability of the fecal bacterium, Escherichia coli, from one location in Idaho and three locations in Georgia for cattle (Bos taurus), horse (Equus caballus), swine (Sus scrofa), and chicken (Gallus gallus domesticus). A total of 568 fecal E. coli isolates from Kimberly, ID (125 isolates), Athens, GA (210 isolates), Brunswick, GA (102 isolates), and Tifton, GA (131 isolates), yielded 213 ribotypes. The percentage of ribotype sharing within an animal species increased with decreased distance between geographic locations for cattle and horses, but not for swine and chicken. When the E. coli ribotypes among the four host species were compared at one location, the percent of unshared ribotypes was 86, 89, 81, and 79% for Kimberly, Athens, Brunswick, and Tifton, respectively. These data suggest that there is good ribotype separation among host animal species at each location. The ability to match environmental isolates to a host origin database may depend on a large number of environmental and host origin isolates that ideally are not geographically separated.

  7. Ghosts of yellowstone: multi-decadal histories of wildlife populations captured by bones on a modern landscape.

    Directory of Open Access Journals (Sweden)

    Joshua H Miller

    Full Text Available Natural accumulations of skeletal material (death assemblages have the potential to provide historical data on species diversity and population structure for regions lacking decades of wildlife monitoring, thereby contributing valuable baseline data for conservation and management strategies. Previous studies of the ecological and temporal resolutions of death assemblages from terrestrial large-mammal communities, however, have largely focused on broad patterns of community composition in tropical settings. Here, I expand the environmental sampling of large-mammal death assemblages into a temperate biome and explore more demanding assessments of ecological fidelity by testing their capacity to record past population fluctuations of individual species in the well-studied ungulate community of Yellowstone National Park (Yellowstone. Despite dramatic ecological changes following the 1988 wildfires and 1995 wolf re-introduction, the Yellowstone death assemblage is highly faithful to the living community in species richness and community structure. These results agree with studies of tropical death assemblages and establish the broad capability of vertebrate remains to provide high-quality ecological data from disparate ecosystems and biomes. Importantly, the Yellowstone death assemblage also correctly identifies species that changed significantly in abundance over the last 20 to ∼80 years and the directions of those shifts (including local invasions and extinctions. The relative frequency of fresh versus weathered bones for individual species is also consistent with documented trends in living population sizes. Radiocarbon dating verifies the historical source of bones from Equus caballus (horse: a functionally extinct species. Bone surveys are a broadly valuable tool for obtaining population trends and baseline shifts over decadal-to-centennial timescales.

  8. How grazing affects soil quality of soils formed in the glaciated northeastern United States.

    Science.gov (United States)

    Cox, Alissa H; Amador, José A

    2018-02-21

    Historically, much of the New England landscape was converted to pasture for grazing animals and harvesting hay. Both consumer demand for local sustainably produced food, and the number of small farms is increasing in RI, highlighting the importance of characterizing the effects livestock have on the quality of pasture soils. To assess how livestock affect pasture on Charlton and Canton soils series in RI, we examined soil quality in farms raising beef cattle (Bos taurus), sheep (Ovis aries), and horses (Equus ferus caballus), using hayed pastures as a control. We sampled three pastures per livestock type and three control hayed pastures in May, August, and October 2012. Hay fields and pastures grazed by sheep had statistically significant (P soil quality than pastures grazed by beef cattle or horses. This was driven by parameters including penetration resistance, bulk density, aggregate stability, and infiltration rate. Hayfields also showed higher soil quality measures than grazed pastures for organic matter content and active C. In addition, significant differences in nitrate and phosphate concentrations were observed among livestock types. Respiration and infiltration rates, pH, and ammonium concentrations, on the other hand, did not differ significantly among pasture types. When all soil quality indicators in this study were weighed equally, soil quality scores followed the order: hay > sheep > beef cattle > horses. The results of our study provide baseline data on the effect different types of livestock have on pasture soil quality in RI, which may be useful in making sound land use and agricultural management decisions.

  9. Unraveling the effects of selection and demography on immune gene variation in free-ranging plains zebra (Equus quagga populations.

    Directory of Open Access Journals (Sweden)

    Pauline L Kamath

    Full Text Available Demography, migration and natural selection are predominant processes affecting the distribution of genetic variation among natural populations. Many studies use neutral genetic markers to make inferences about population history. However, the investigation of functional coding loci, which directly reflect fitness, is critical to our understanding of species' ecology and evolution. Immune genes, such as those of the Major Histocompatibility Complex (MHC, play an important role in pathogen recognition and provide a potent model system for studying selection. We contrasted diversity patterns of neutral data with MHC loci, ELA-DRA and -DQA, in two southern African plains zebra (Equus quagga populations: Etosha National Park, Namibia, and Kruger National Park, South Africa. Results from neutrality tests, along with observations of elevated diversity and low differentiation across populations, supported previous genus-level evidence for balancing selection at these loci. Despite being low, MHC divergence across populations was significant and may be attributed to drift effects typical of geographically separated populations experiencing little to no gene flow, or alternatively to shifting allele frequency distributions driven by spatially variable and fluctuating pathogen communities. At the DRA, zebra exhibited geographic differentiation concordant with microsatellites and reduced levels of diversity in Etosha due to highly skewed allele frequencies that could not be explained by demography, suggestive of spatially heterogeneous selection and local adaptation. This study highlights the complexity in which selection affects immune gene diversity and warrants the need for further research on the ecological mechanisms shaping patterns of adaptive variation among natural populations.

  10. Utilização de métodos contraceptivos entre as usuárias da rede pública de saúde do município de Maringá-PR Contraceptive methods in the public health service ("Sistema Único de Saúde" in Maringá-PR

    Directory of Open Access Journals (Sweden)

    Jovita Maria Matarezi de Souza

    2006-05-01

    Full Text Available OBJETIVO: avaliar os métodos contraceptivos adotados e o perfil das usuárias da rede pública de saúde do município de Maringá-PR, em relação às orientações para o seu uso, indicações, contra-indicações e razões para interrupção dos métodos. MÉTODOS: estudo transversal, descritivo, obtido por 284 entrevistas domiciliares de mulheres selecionadas das 62 equipes do Programa de Saúde da Família, mediante consentimento livre e esclarecido. O questionário foi aprovado pelo Comitê de Ética em Pesquisa envolvendo seres humanos da Universidade Estadual de Maringá. Os questionários utilizados foram pré-testados e então aplicados, interessando para este estudo as seguintes seções: caracterização da entrevistada; indicadores socioeconômicos; métodos contraceptivos. Análise estatística das distribuições de freqüências, pelo Statistical Package for the Social Sciences, versão 12.0. RESULTADOS: a maioria das mulheres eram de etnia branca, casadas, tinham idade entre 35 e 49 anos, escolaridade em nível médio, exerciam trabalho não remunerado e foram classificadas na classe econômica D e E. Quanto aos hábitos, 22,5% eram fumantes e 4,9% usuárias de bebida alcoólica. A pílula foi adotada em 50,3%, preservativo em 28,1% e laqueadura em 32%. A orientação quanto ao uso de métodos anticoncepcionais geralmente foi dos profissionais da área de saúde. Os motivos de interrupção dos métodos foram: desejo de engravidar, preferência por método definitivo e efeitos colaterais da pílula. O fator de risco mais prevalente para uso de pílula foi o tabagismo. Apenas 35,9% das entrevistadas iniciaram o uso da pílula após consulta prévia e quase a mesma proporção, 33,6%, não a fizeram antes do início de seu uso. CONCLUSÕES: observou-se que as indicações do uso do método contraceptivo e as orientações realizadas por profissionais da área de saúde foram satisfatórias, apesar das elevadas taxas de laqueadura

  11. Solar Ion Processing of Major Element Surface Compositions of Mature Mare Soils: Insights from Combined XPS and Analytical TEM Observations

    Science.gov (United States)

    Christoffersen, R.; Dukes, C.; Keller, L. P.; Baragiola, R.

    2012-01-01

    Solar wind ions are capable of altering the sur-face chemistry of the lunar regolith by a number of mechanisms including preferential sputtering, radiation-enhanced diffusion and sputter erosion of space weathered surfaces containing pre-existing compositional profiles. We have previously reported in-situ ion irradiation experiments supported by X-ray photoelectron spectroscopy (XPS) and analytical TEM that show how solar ions potentially drive Fe and Ti reduction at the monolayer scale as well as the 10-100 nm depth scale in lunar soils [1]. Here we report experimental data on the effect of ion irradiation on the major element surface composition in a mature mare soil.

  12. Modulation of leptin, insulin, and growth hormone in obese pony mares under chronic nutritional restriction and supplementation with ractopamine hydrochloride.

    Science.gov (United States)

    Buff, Preston R; Johnson, Philip J; Wiedmeyer, Charles E; Ganjam, Venkataseshu K; Messer Iv, Nat T; Keisler, Duane H

    2006-01-01

    Horses fed beyond their nutritional requirement and that are physically inactive will develop obesity, which is often accompanied by insulin resistance and heightened risk of laminitis. The use of pharmacologic agents in combination with nutritional restriction may promote weight loss in obese horses unable to exercise because of laminitic pain. This study shows that reducing feed intake of brome grass hay to 75% of ad libitum intake in obese pony mares reduces body weight without induced exercise. Additional supplementation of ractopamine hydrochloride for 6 weeks resulted in a tendency for increased weight loss. Subsequent modulation of obesity-associated hormones, leptin and insulin, as a result of caloric restriction was observed.

  13. A young multilayered terrane of the northern Mare Imbrium revealed by Chang'E-3 mission.

    Science.gov (United States)

    Xiao, Long; Zhu, Peimin; Fang, Guangyou; Xiao, Zhiyong; Zou, Yongliao; Zhao, Jiannan; Zhao, Na; Yuan, Yuefeng; Qiao, Le; Zhang, Xiaoping; Zhang, Hao; Wang, Jiang; Huang, Jun; Huang, Qian; He, Qi; Zhou, Bin; Ji, Yicai; Zhang, Qunying; Shen, Shaoxiang; Li, Yuxi; Gao, Yunze

    2015-03-13

    China's Chang'E-3 (CE-3) spacecraft touched down on the northern Mare Imbrium of the lunar nearside (340.49°E, 44.12°N), a region not directly sampled before. We report preliminary results with data from the CE-3 lander descent camera and from the Yutu rover's camera and penetrating radar. After the landing at a young 450-meter crater rim, the Yutu rover drove 114 meters on the ejecta blanket and photographed the rough surface and the excavated boulders. The boulder contains a substantial amount of crystals, which are most likely plagioclase and/or other mafic silicate mineral aggregates similar to terrestrial dolerite. The Lunar Penetrating Radar detection and integrated geological interpretation have identified more than nine subsurface layers, suggesting that this region has experienced complex geological processes since the Imbrian and is compositionally distinct from the Apollo and Luna landing sites. Copyright © 2015, American Association for the Advancement of Science.

  14. USING THE FOURNIER INDEXES IN ESTIMATING RAINFALL EROSIVITY. CASE STUDY - THE SECAŞUL MARE BASIN

    Directory of Open Access Journals (Sweden)

    M. COSTEA

    2012-03-01

    Full Text Available Using the Fournier Index in Estimating Rainfall Erosivity. Case Study - The Secaşul Mare Basin. Climatic aggressiveness is one of the most important factors in relief dynamic. Of all climatic parameters, rainfall is directly involved in versant dynamic, in the loss of soil quality and through pluvial denudation and the processes associated with it, through the erosivity of torrential rain. We analyzed rainfall aggressiveness based on monthly and annual average values through the Fournier's index (1970 and Fournier's index modified by Arnoldus (1980. They have the advantage that they can be used not only for evaluating the land susceptibility to erosion and the calculation of erodibility of land and soil losses, but also in assessing land susceptibility to sliding (Aghiruş, 2010. The literature illustrates the successful use of this index which provides a summary assessment of the probability of rainfall with significant erosive effects. The results obtained allow observation of differences in space and time of the distribution of this index.

  15. Evaluation in Physical Education: an analysis in state and municipal schools in Maringá-PR

    Directory of Open Access Journals (Sweden)

    Saray Giovana dos Santos

    2008-06-01

    Full Text Available Problems related to evaluation deal with many issues that Physical Education, as a pedagogical subject, has been facing. In order to investigate these aspects, this study has as its aim to analyse how and with purpose, the professionals from the area of Physical Education are evaluating studentes from the 5th to the 8th forms in state and municipal schools in Maringá. A questionnaire was used. The sample was formed by 30 teachers from 12 schools: 15 teachers from state schools and 15 from municipal schools. Descriptive statistics at simple frequency level and non-parametric test (χ2 were used. Results show that evaluation in the subject Physical Education is performed only to follow the norms, without planning and consequently without pre-defined educational objectives showing, thus, the contradictions and confusions inherent to evaluation modalities by the professionals of this area. These professionals demonstrated the precaroiusness of the understanding of evaluation role in teaching-learning process.

  16. Preliminary Regional Analysis of the Kaguya Lunar Radar Sounder (LRS) Data through Eastern Mare Imbrium

    Science.gov (United States)

    Cooper, B.L.; Antonenko, I.; Yamaguchi, Y.; Osinski, G.; Ono, T.; Ku-mamoto, A.

    2009-01-01

    The Lunar Radar Sounder (LRS) experiment on board the Kaguya spacecraft is observing the subsurface structure of the Moon, using ground-penetrating radar operating in the frequency range of 5 MHz [1]. Because LRS data provides in-formation about lunar features below the surface, it allows us to improve our understanding of the processes that formed the Moon, and the post-formation changes that have occurred (such as basin formation and volcanism). We look at a swath of preliminary LRS data, that spans from 7 to 72 N, and from 2 to 10 W, passing through the eastern portion of Mare Imbrium (Figure 1). Using software, designed for the mineral exploration industry, we produce a preliminary, coarse 3D model, showing the regional structure beneath the study area. Future research will involve smaller subsets of the data in regions of interest, where finer structures, such as those identified in [2], can be studied.

  17. Apollo 15 yellow-brown volcanic glass: Chemistry and petrogenetic relations to green volcanic glass and olivine-normative mare basalts

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, S.S.; Schmitt, R.A.; (Oregon State Univ., Corvallis (USA)); Delano, J.W. (State Univ. of New York, Albany (USA))

    1988-10-01

    Apollo 15 yellow-brown glass is one of twenty-five, high Mg, primary magmas emplaced on the lunar surface in pyroclastic eruptions. Forty spherules of this glass were individually analyzed by electron microprobe and INAA for major- and trace-elements. The abundances demonstrate that this primary magma was produced by partial melting of differentiated cumulates in the lunar mantle. Models are developed to explain the possible source-regions of several Apollo 15 and Apollo 12 low-Ti mare magmas as being products of hybridization involving three ancient differentiated components of a primordial lunar magma ocean: (a) early olivine {plus minus} orthopyroxene cumulates; (b) late-stage clinopyroxene + pigeonite + ilmenite + plagioclase cumulates; and (c) late-stage inter-cumulus liquid.

  18. Análise dos óbitos evitáveis de menores de cinco anos no município de Maringá-PR Análisis de los óbitos evitables en menores de cinco años en Maringá-PR Analysis of preventable deaths in children under five years in Maringá-PR

    Directory of Open Access Journals (Sweden)

    Denise Albieri Jodas

    2013-06-01

    Full Text Available O objetivo deste estudo foi analisar os óbitos de menores de cinco anos por doenças evitáveis ocorridos em 2008 no município de Maringá, PR. Estudo quantitativo, descritivo, com 41 óbitos. Como instrumento norteador de coleta de dados, utilizou-se o formulário de investigação do Comitê de Prevenção do Óbito Infantil e Fetal. Dos 41 casos encontrados, 65,9% representaram óbitos neonatais, 24,4% pós-neonatais e 9,7%, de criança com mais de um ano; destes, 90,2% óbitos foram considerados evitáveis, sendo 64,9% neonatais, 27,0% pós-neonatais e 8,1% na idade acima de um ano. Quanto às medidas de evitabilidade, percebeu-se que as atividades de prevenção foram as mais encontradas entre as possibilidades de redução do óbito, com 59,5%, seguidas de ações de diagnóstico e tratamento precisos, com 35,1%. Conclui-se que a maioria dos óbitos evitáveis tem relação direta com a assistência à gestante no pré-natal e no parto, demonstrando a necessidade de instituir uma prática efetiva e de qualidade.Analizar las muertes de niños menores de cinco años por enfermedades evitables ocurridas en 2008 en Maringá, PR. Investigación cuantitativa, descriptiva, con 41 óbitos. Como instrumento de orientación para la recolección de datos, se utilizó el formulario de investigación de la Comisión de la Prevención de la Mortalidad Infantil y Fetal. De los 41 casos encontrados, un 65,9% representaron óbitos neonatales, 24,4% post-neonatales y 9,7% por encima de un año; de estos 90,2% de las muertes fueron consideradas evitables, siendo un 64,9% neonatales, 27,0% post-neonatales y 8,1% en la edad por encima de un año. Cuanto a las medidas de prevención, se observó que las actividades de prevención se han encontrado con mayor frecuencia entre las posibilidades de reducción de la muerte, dejando a un 59,5%, seguido por las acciones de diagnóstico y tratamiento, con un 35,1%. Conclusión: la mayoría de las muertes evitables

  19. Trabalhar com famílias no Programa de Saúde da Família: a prática do enfermeiro em Maringá-Paraná Trabajar con familias en el Programa de Salud de la Familia: la práctica del enfermero en Maringá-Paraná Working with families within the Family Health Program: nurse's practice in Maringá-Paraná

    Directory of Open Access Journals (Sweden)

    Raquel Gusmão Oliveira

    2007-03-01

    Full Text Available O Programa de Saúde da Família (PSF propõe-se a atender a família integralmente em seu espaço social o que requer uma nova postura profissional. Este estudo tem como objetivo conhecer a prática do trabalho realizado com famílias pelos enfermeiros que atuam no PSF em Maringá, Paraná. Foi realizado um estudo descritivo exploratório com abordagem qualitativa, utilizando, para a coleta de dados, entrevistas, observação e análise documental. Os dados foram analisados, segundo o referencial teórico de Bardin. Os resultados revelaram três categorias: atividades com indivíduos, atividades na comunidade e atividades no domicílio. Concluiu-se que, apesar de os enfermeiros considerarem a família em seu espaço domiciliar, por meio de visitas domiciliares, de coleta de dados e da educação em saúde, ainda centralizam a doença e o indivíduo, e a sua postura não tem estimulado a participação e a autonomia das famílias no que se refere à assistência e ao serviço.El Programa de Salud de la Familia (PSF se propone atender a la familia integralmente en su espacio social lo que requiere de una nueva postura profesional. En este trabajo se tuvo como objetivo conocer la práctica del trabajo realizado con familias por los enfermeros que actúan en el PSF en Maringá, Paraná. Se realizó un estudio descriptivo exploratorio con abordaje cualitativo, utilizando para la recolección de datos, entrevistas, observación y análisis documental. Los datos fueron analizados según el referencial teórico de Bardin. Los resultados revelaron tres categorías: actividades con individuos, actividades en la comunidad y actividades en el domicilio. Se concluye que a pesar de que los enfermeros consideran a la familia en su espacio domiciliario, por medio de visitas domiciliarias, de recolección de datos y de la educación en salud, aun centralizan la enfermedad y al individuo, y su postura no ha estimulado la participación y la autonomía de las

  20. Non-invasive Pregnancy Diagnosis from Urine by the Cuboni Reaction and the Barium Chloride Test in Donkeys (Equus asinus) and Alpacas (Vicugna pacos).

    Science.gov (United States)

    Kubátová, A; Fedorova, T; Skálová, I; Hyniová, L

    2016-09-01

    The aim of the research was to evaluate two chemical tests for non-invasive pregnancy diagnosis from urine, the Cuboni reaction and the barium chloride test, in donkeys (Equus asinus) and alpacas (Vicugna pacos). The research was carried out from April 2013 to September 2014. Urine samples were collected on five private Czech farms from 18 jennies and 12 alpaca females. Urine was collected non-invasively into plastic cups fastened on a telescopic rod, at 6-9 week intervals. In total, 60 and 54 urine samples from alpacas and jennies, respectively, were collected. The Cuboni reaction was performed by the State Veterinary Institute Prague. The barium chloride test was done with 5 ml of urine mixed together with 5 ml of 1% barium chloride solution. Results of the Cuboni reaction were strongly influenced by the reproductive status of jennies; the test was 100% successful throughout the second half of pregnancy. However, no relationship was found between the real reproductive status of alpaca females and results of the Cuboni reaction. It was concluded that the barium chloride test is not suitable for pregnancy diagnosis either in donkeys, due to significant influence of season on the results, or in alpacas, because no relationship between results of the test and the reproductive status of alpaca females was found. In conclusion, the Cuboni reaction has potential to become a standard pregnancy diagnostic method in donkeys.

  1. The Evaluation of Small Intestinal Volvulus Caused by PathogenicMicroorganisms in a Thoroughbred Mare

    Directory of Open Access Journals (Sweden)

    Javad Javanbakht

    2013-11-01

    Full Text Available Background: Small intestinal (SI volvulus is defined as a rotation of greater than 180 degrees about its mesentery of a segment of jejunum or ileum. Horses of all ages have been affected. There is typically an acute onset of signs of mild to severe pain. Objectives: The objective of this study was to evaluate the microbial pathogens of the duodenum, ileum, cecum, colon and rectum (feces in associated with volvulus horse, and to determine whether rectal (fecal samples are representative of proximal segments of the gastrointestinal tract. Materials and Methods: A brown 26 years old mare, BCS (body condition score 4 was found dead in stall in the morning. It was moved to a suitable area to conduct a post-mortem exam. The mare was examined in hanging position and then left lateral-recumbent. Advanced abdominal tympany was present. Clinical signs, laboratory data, surgical or necropsy findings, clinic-histopathological findings and outcome for horse with SI volvulus was obtained from medical records, and identified by manual review. Horsefeces and colon were collected in autopsy. Fecal material was scooped from the center of a freshly defecated bolus into sterile sample cups, which were placed into plastic anaerobe jars with PackAnaero sachets (Mitsubishi Gas Co. via Remel, Lenexa, KS and transported to the laboratory. Alternatively, colon contents were collected from horse at the autopsy by direct incision into the colon immediately after the horse was autopsied. The samples were transported anaerobically to the laboratory. Results: On opening the abdominal cavity; a large quantity of sanguineous, foul-smelling fluid with pus exited the perforated bowel wall (hemoperitoneum. Additionally, signs of an acute diffuse peritonitis were visible. The blood vessels of the stomach and intestines were distended. Small intestinal volvulus was observed in several segments (360 degree rotation involving the mesentery. This information may aid diagnosis and

  2. [Prevalence of diseases diagnosed by the Program of Neonatal Screening in Maringá, Paraná, Brazil: 2001-2006].

    Science.gov (United States)

    Luz, Geisa dos Santos; Carvalho, Maria Dalva de Barros; Pelloso, Sandra Marisa; Higarashi, Ieda Harumi

    2008-09-01

    Irreversible sequels of some genetic diseases can be prevented by neonatal screening. The aim of this paper was to verify the prevalence of diseases diagnosed by the National Program of Neonatal Screening (PNTN) in Maringá, Paraná, Brazil, between 2001 and 2006. This cross-sectional descriptive study included 20,529 newborn infants screened by that program. Out of those, 859 were re-examined, and 21 had the disease confirmed. Considering all screened newborn infants and the number of diagnostics per disease, the following disease prevalence was determine: phenylketonuria--1:20,529; congenital hypothyrodism--1:2,281; hemoglobinopahies--1:3,421; cystic fibrosis--1:10,264; and biotinidase deficiency--1:6,843. Understanding disease status and prevalence of newborns in a population allows the establishment and the improvement of public policies aimed at the children.

  3. Intravenous anaesthesia using detomidine, ketamine and guaiphenesin for laparotomy in pregnant pony mares.

    Science.gov (United States)

    Taylor, Polly M; Luna, Stelio Pl; White, Kate L; Bloomfield, Malcolm; Fowden, Abigail L

    2001-07-01

    Objective To characterize intravenous anaesthesia with detomidine, ketamine and guaiphenesin in pregnant ponies. Animals Twelve pony mares, at 260-320 days gestation undergoing abdominal surgery to implant fetal and maternal vascular catheters. Materials and methods Pre-anaesthetic medication with intravenous (IV) acepromazine (30 µg kg -1 ), butorphanol (20 µg kg -1 ) and detomidine (10 µg kg -1 ) preceded induction of anaesthesia with detomidine (10 µg kg -1 ) and ketamine (2 mg kg -1 ) IV Maternal arterial blood pressure was measured directly throughout anaesthesia and arterial blood samples were taken at 20-minute intervals for measurement of blood gases and plasma concentrations of cortisol, glucose and lactate. Anaesthesia was maintained with an IV infusion of detomidine (0.04 mg mL -1 ), ketamine (4 mg mL -1 ) and guaiphenesin (100 mg mL -1 ) (DKG) for 140 minutes. Oxygen was supplied by intermittent positive pressure ventilation (IPPV) adjusted to maintain PaCO 2 between 5.0 and 6.0 kPa (38 and 45 mm Hg), while PaO 2 was kept close to 20.0 kPa (150 mm Hg) by adding nitrous oxide. Simultaneous fetal and maternal blood samples were withdrawn at 90 minutes. Recovery quality was assessed. Results DKG was infused at 0.67 ± 0.17 mL kg -1 hour -1 for 1 hour then reduced, reaching 0.28 ± 0.14 mL kg -1 hour -1 at 140 minutes. Arterial blood gas values and pH remained within intended limits. During anaesthesia there was no change in heart rate, but arterial blood pressure decreased by 10%. Plasma glucose and lactate increased (10-fold and 2-fold, respectively) and cortisol decreased by 50% during anaesthesia. Fetal umbilical venous pH, PO 2 and PCO 2 were 7.34 ± 0.06, 5.8 ± 0.9 kPa (44 ± 7 mm Hg) and 6.7 ± 0.8 kPa (50 ± 6 mm Hg); and fetal arterial pH, PO 2 and PCO 2 were 7.29 ± 0.06, 4.0 ± 0.7 kPa (30 ± 5 mm Hg) and 7.8 ± 1.7 kPa (59 ± 13 mm Hg), respectively. Surgical conditions were good but four ponies required a single additional dose of ketamine

  4. 50 CFR 17.11 - Endangered and threatened wildlife.

    Science.gov (United States)

    2010-10-01

    ... Argentina Entire E 15 NA NA Armadillo, pink fairy Chlamyphorus truncatus Argentina ......do E 3 NA NA Ass, African wild Equus asinus Somalia, Sudan, Ethiopia ......do E 3, 22 NA NA Ass, Asian wild Equus hemionus...

  5. Empreendedorismo Digital. Estudo do Projeto Negócios Digitais Realizado pelo Sebrae-PR em Maringá

    Directory of Open Access Journals (Sweden)

    Jaiane Aparecida Pereira

    2016-01-01

    Full Text Available Doing business in digital form has become popular across the telecommunications infrastructurecheapening and this competitiveness environment becomes increasingly difficult. In order to supportthe micro and small entrepreneurs in the process, Sebrae Paraná conceived the Digital Business Project, which was operated later by municipal units, as Sebrae Maringá. Thus, the aim of thisstudy is to understand how the Digital Business Project developed by Sebrae Maringa support inthe development of digital entrepreneurship in micro and small enterprises. For this, we made aqualitative research through semi-structured interviews with project managers and monitoring ofthree companies that participated. We also made a quantitative descriptive research to characterizethe participating profile. Therefore, the results show that the participant’s motivations was related toseeking knowledge about tools and strategies used in the digital environment, but lack of time andfinancial resources hinder this process. In addition, we indicate the importance of initiatives such asProject and suggestions for improve it.

  6. Lar Betânia: O atendimento à infância abandonada em Maringá – PR

    Directory of Open Access Journals (Sweden)

    Ângela Mara de Barros Lara

    2012-08-01

    Full Text Available O presente artigo discute as políticas públicas de atendimento à criança e ao adolescenteem situação social de risco, na cidade de Maringá-PR, por meio da história do Lar Betânia,um abrigo fundado em 1965, no sistema casa-lar. A instituição que, em muitos períodos desua história chegou a atender, simultaneamente, 100 crianças vive hoje, a possibilidade desucumbir diante da atual filosofia do Estado de priorizar a permanência do menor junto àfamília biológica e, na impossibilidade dessa convivência, encaminhá-lo para acolhimento,junto às famílias cadastradas e preparadas para atuarem como famílias temporárias. Estadiscussão só foi possível a partir do estudo dos pressupostos que evidenciam o papel doEstado e dos direitos sociais na sociedade em que vivemos.

  7. Evolução da mortalidade materna na 15a regional de saúde de Maringá, Estado do Paraná, entre 1989 e 2000 Maternal mortality evolution at the XV Maringá Health Center, state of Paraná, from 1989 to 2000

    Directory of Open Access Journals (Sweden)

    Sandra Marisa Pelloso

    2002-04-01

    Full Text Available Este estudo teve como objetivo descrever e analisar as causas e as taxas dos óbitos ocorridos entre as mulheres em idade fértil. Os dados foram colhidos através das declarações de óbito e das fichas de investigação do Comitê Regional de Mortalidade Materna de Maringá, Estado do Paraná, no período de 1989 a 2000. Os resultados mostram que o coeficiente de mortalidade materna é alto na região. Outro dado importante é a questão do sub registro dos óbitos. Em relação às causas de óbito materno, verificou-se que as obstétricas diretas, ou seja, as causas previníveis são as de maior incidência. Os números são absolutamente necessários para se ter uma visão do quadro epidemiológico e uma base sólida para ações. Eles permitem identificar os problemas e as falhas e possibilitam a formulação de propostas intervencionistas no sentido de diminuir os coeficientes de mortalidade maternaThis paper had the aim to describe and analyze the causes and death rates of females in fertile time. Data were collected from death certificates and investigation records of the Regional Committee of Mothers’ Death Rate in Maringá, state of Paraná, between 1980 and 2000. Results show that coefficient of mothers’ death rate is still high in the region under analysis. Other important data refer to details in these certificates. With regard to death causes, it has been verified that direct obstetric causes, that is, causes that could have been easily avoided were highest. Data are absolutely necessary so that one may have a precise idea of the epidemic picture and a solid base for triggering proceedings. In fact, if data identify problems and deficiencies, they also help in interventionist suggestions to decrease the coefficients of mothers’ death rate

  8. O perfil dos adolescentes que cumprem medida socioeducativa de prestação de serviços à comunidade em Maringá - PR

    Directory of Open Access Journals (Sweden)

    José Lopes Silva

    2011-07-01

    Full Text Available Este artigo resulta da pesquisa sobre adolescentes em conflito com a lei e o cumprimento da medida sócio educativa de Prestação de Serviços a Comunidade no município de Maringá – PR. Trata-se de uma pesquisa documental qualitativa, cujo objetivo foi o de construir uma breve reflexão sobre a a infância e juventude para compreensão do envolvimento do adolescente em atos infracionais. A pesquisa foi realizada no Centro de Referência Sócio Educativo - CRSE, órgão executor das medidas sócio educativas de Prestação de Serviços a Comunidade e Liberdade Assistida, no município de Maringá- PR. A pesquisa ocorreu em duas etapas: a revisão de literatura sobre os temas criança e adolescente e adolescente em conflito com a lei. A segunda ocorreu por meio da consulta ao banco de dados do CRSE; do registro dos prontuários dos adolescentes que cumprem a referida medida, bem como os instrumentos utilizados pelos profissionais do CRSE nos atendimentos realizados. A pesquisa foi desenvolvida no período de julho a novembro de 2010. Foi possível identificar o perfil do adolescente em cumprimento de medida sócio educativa de PSC no CRSE. Esta identificação nos deu a dimensão da situação econômica e social do adolescente e família atendidos pela equipe do programa.

  9. Milk of Italian Saddle and Haflinger nursing mares: physico – chemical characteristics, nitrogen composition and mineral elements at the end of lactation

    Directory of Open Access Journals (Sweden)

    Francesca Martuzzi

    2010-01-01

    Full Text Available Aim of this work was to investigate nursing mares milk characteristics at the end of lactation (D and to make a comparisonwith milk taken during early lactation (3 to 30 d post partum (E. The survey was carried out on 17 Italian Saddlemares (IS (193 days in milk; 147 pregnancy days and on 12 Haflinger mares (H (174 days in milk; 146 pregnancydays. N fractions were determined by means of Kjeldahl; fat and lactose by means of mid infrared lectures; mineral elementswere determined by Atomic Absorption Spectrophotometry; P by colorimetry. Data referring to 58 individual milksamples were analyzed by ANCOVA. Significant variations, similar in both breeds, were observed (E vs D for density at15°C (1.036 vs 1.034, pH (6.94 vs 7.24, titratable acidity (3.56 vs 1.70 °SH, fat (1.17 vs 0.76% g/100g of milk,crude protein (2.31 vs 1.68% g/100g, casein number (52.37 vs 46.59 and ash (0.50 vs 0.30% g/100g; similarly(mg/100g for non casein N (172.31 vs 142.05, non protein N (34.43 vs 29.09, P (61.30 vs 32.48, Ca (112.88 vs54.42, Mg (8.40 vs 4.38 and K (60.77 vs 41.31. Freezing point, lactose and Na showed no significant variations. Atthe end of lactation, milk resulted poorer in all main organic components, except lactose, and in all mineral components,except Na. Only freezing point and phosphorus variations differed in IS from H. Breed significantly affected fat, casein Nand ash mean contents.

  10. Freqüência de onicomicoses por leveduras em Maringá, Paraná, Brasil Frequency of onychomycoses caused by yeasts in Maringa, Parana, Brazil

    Directory of Open Access Journals (Sweden)

    Eliane Alves de Freitas Souza

    2007-04-01

    Full Text Available FUNDAMENTOS: Onicomicoses são afecções ungueais de origem infecciosa causadas por fungos e estão entre as principais onicopatias em todo o mundo. OBJETIVOS: Determinar a freqüência de leveduras como agentes etiológicos de onicomicoses na cidade de Maringá, PR, Brasil. MATERIAL E MÉTODOS: Realizou-se um estudo retrospectivo do período entre janeiro de 1997 e dezembro de 2004, em que foram avaliados os resultados de 1.295 pacientes com suspeita de onicomicose, recebidos no Laboratório de Ensino e Pesquisa em Análises Clínicas da Universidade Estadual de Maringá, Paraná, Brasil. RESULTADOS: A confirmação micológica de onicomicose ocorreu em 761 (58,76% desses pacientes. As mulheres foram responsáveis por 71% das onicomicoses, e os homens, por 29%. A prevalência nas unhas das mãos foi de 28,67% e nas unhas dos pés, 71,33%. Em relação aos agentes, as leveduras foram mais freqüentemente isoladas (46,39%, seguidas pelos dermatófitos (40,60% e pelos fungos filamentosos não dermatófitos (13,01%. CONCLUSÃO: A alta freqüência de fungos leveduriformes em onicomicoses indica aprimoramento nas técnicas diagnósticas de confirmação laboratorial de fungos oportunistas. Esses resultados, associados à abordagem clínica do paciente, possibilitam maior segurança no diagnóstico e tratamento.INTRODUCTION: Onychomycoses are infectious ungueal diseases caused by fungi and represent the major onychopathies all over the world. OBJECTIVES: To determine the frequency of yeasts as etiological agents of onychomycoses in the city of Maringa, Parana, Brazil. METHODS: A retrospective study from January 1997 to December 2004. Results of 1295 patients with suspected onychomycosis were evaluated; tests were performed at the Teaching and Research Pathology Laboratory at the Universidade Estadual de Maringá, Parana, Brazil. RESULTS: Onychomycosis was confirmed by mycological exam in 761 (58.76% patients; 71% females and 29.00% males. The

  11. Fractal analysis of the dark matter and gas distributions in the Mare-Nostrum universe

    International Nuclear Information System (INIS)

    Gaite, José

    2010-01-01

    We develop a method of multifractal analysis of N-body cosmological simulations that improves on the customary counts-in-cells method by taking special care of the effects of discreteness and large scale homogeneity. The analysis of the Mare-Nostrum simulation with our method provides strong evidence of self-similar multifractal distributions of dark matter and gas, with a halo mass function that is of Press-Schechter type but has a power-law exponent -2, as corresponds to a multifractal. Furthermore, our analysis shows that the dark matter and gas distributions are indistinguishable as multifractals. To determine if there is any gas biasing, we calculate the cross-correlation coefficient, with negative but inconclusive results. Hence, we develop an effective Bayesian analysis connected with information theory, which clearly demonstrates that the gas is biased in a long range of scales, up to the scale of homogeneity. However, entropic measures related to the Bayesian analysis show that this gas bias is small (in a precise sense) and is such that the fractal singularities of both distributions coincide and are identical. We conclude that this common multifractal cosmic web structure is determined by the dynamics and is independent of the initial conditions

  12. Diversidade de fungos micorrízicos arbusculares em remanescente florestal impactado (Parque Cinqüentenário - Maringá, Paraná, Brasil Diversity of arbuscular mycorrizal fungi in an impacted forest remnant - Parque Cinquentenário, Maringá, Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Fábio Eduardo Ferreira dos Santos

    2011-06-01

    Full Text Available As micorrizas são consideradas importante componente na recuperação e restabelecimento da vegetação em áreas frágeis ou degradadas, bem como na manutenção da biodiversidade de plantas e das funções dos ecossistemas. O conhecimento da diversidade e dinâmica dos fungos micorrízicos arbusculares (FMA em áreas impactadas pela ação humana é importante para seu manejo e como indicador de sua qualidade. O Parque Cinqüentenário, localizado no município de Maringá, PR, pertence à formação original do conjunto Mata Atlântica, do domínio da floresta Estacional semi-decidual, é um dos poucos remanescentes florestais existentes na cidade de Maringá, PR, e encontra-se em estádio acelerado de degradação. O objetivo deste trabalho foi avaliar a diversidade de FMA nativos no solo e o grau de micorrização das plantas neste ecossistema. Amostras de solo e raízes foram coletadas em 65 pontos diferentes, na profundidade de 0-20 cm. A determinação da porcentagem de colonização micorrízica arbuscular foi feita sob microscópio estereoscópico, pelo método da interseção de quadrantes. A identificação das espécies de FMA foi realizada de acordo com a análise morfológica dos esporos. Foram estimados índices de diversidade, calculados com base no número de esporos em cada amostra. Foi verificada a ocorrência de 50 espécies de FMA, distribuídas em cinco gêneros: Glomus (31 espécies, Acaulospora (10 espécies, Scutellospora (6 espécies, Gigaspora (duas espécies e Paraglomus (uma espécie. Glomus foi o gênero mais abundante, com várias espécies esporocárpicas.Mycorrhizae are important components of any recuperation and recovery plan for threatened and endangered vegetation in degraded areas, as well as for the maintenance of plant diversity and ecosystem functions. Knowledge of diversity and dynamics of arbuscular mycorrhizal fungi (AMF in areas impacted by anthropic activities is important for managing these areas

  13. Comparative Mineralogy, Microstructure and Compositional Trends in the Sub-Micron Size Fractions of Mare and Highland Lunar Soils

    Science.gov (United States)

    Thompson, M. S.; Christoffersen, R.; Noble, S. K.; Keller, L. P.

    2012-01-01

    The morphology, mineralogy, chemical composition and optical properties of lunar soils show distinct correlations as a function of grain size and origin [1,2,3]. In the fraction, there is an increased correlation between lunar surface properties observed through remote sensing techniques and those attributed to space weathering phenomenae [1,2]. Despite the establishment of recognizable trends in lunar grains fraction fraction for both highland and mare derived soils. The properties of these materials provide the focus for many aspects of lunar research including the nature of space weathering on surface properties, electrostatic grain transport [4,5] and dusty plasmas [5]. In this study, we have used analytical transmission and scanning transmission electron microscopy (S/TEM) to characterize the mineralogy type, microstructure and major element compositions of grains in this important size range in lunar soils.

  14. Resposta cutânea a alérgenos ambientais em indivíduos atendidos em serviço de pneumologia, Maringá, Estado do Paraná, Brasil - doi: 10.4025/actascihealthsci.v34i1.7920 Cutaneous response to environmental allergens in patients attended in pulmonology service of Maringá, Paraná State, Brazil - doi: 10.4025/actascihealthsci.v34i1.7920

    Directory of Open Access Journals (Sweden)

    Valentim Constante Sella

    2011-12-01

    Full Text Available As alergias respiratórias, comumente as rinites e a asma, vêm se tornando cada vez mais frequentes. Considerando que no Noroeste do Paraná há poucos dados referentes ao assunto, propusemos a verificar os agentes causadores de alergias respiratórias e suas intercorrências em indivíduos atendidos em serviço privado de pneumologia do município de Maringá, Paraná. Estudo tipo observacional transversal, retrospectivo, realizado de janeiro/2004 a dezembro/2005. Os participantes foram avaliados clinicamente e realizado o teste de hipersensibilidade imediata, Punctura – Prick TestR. De cada indivíduo foram anotados os seguintes dados: idade, positividade ao teste, principais alérgenos reagentes, presença ou ausência de atopia, rinite ou asma. De 396 indivíduos, 236 (59,3% apresentaram positividade para um ou mais alérgenos, sendo que 80 (20,2% reagiram a três antígenos, 85 (21,5% a quatro ou mais. A reatividade dos indivíduos foi mais frequente à poeira doméstica (207, Dermatophagoides pteronyssimus (184, Dermatophagoides farinae (158 e Blomia tropicalis (95. Inclusive, poeira domiciliar, D. pteronyssimus e D. farinae ocorreram principalmente em indivíduos com moderada a severa atopia. Aproximadamente 70% dos indivíduos com idade entre seis a 20 anos apresentaram atopia. Considerando o elevado nível de atopia nos pacientes atendidos pelo serviço de pneumologia em Maringá, é imprescindível realizar programas de controle no meio ambiente, juntamente com o acompanhamento e o tratamento médico dos indivíduos atópicos.Respiratory allergies, especially rhinitis and asthma, are becoming increasingly common. Given that in northwestern Paraná there is little data on the subject, our objective was to verify the causative agents of respiratory allergies and their complications in patients treated at a private pulmonology service in the municipality of Maringá, Paraná. The study was observational, retrospective, lasting from

  15. Water-gas dynamics and coastal land subsidence over Chioggia Mare field, northern Adriatic Sea

    Science.gov (United States)

    Teatini, Pietro; Baú, Domenico; Gambolati, Giuseppe

    2000-09-01

    A major development programme comprising 15 gas fields of the northern Adriatic Sea has recently been submitted to the Ministry of the Environment, VIA Committee for the assessment of the environmental impact, by ENI-Agip, the Italian national oil company. One of the largest reservoirs is Chioggia Mare, located about 10 km offshore of the Venetian littoral, with a burial depth of 1000-1400 m. The planned gas production from this field is expected to impact the shoreline stability with a potential threat to the city of Venice, 25 km northwest of the center of Chioggia Mare. To evaluate the risk of anthropogenic land subsidence due to gas withdrawal, a numerical model was developed that predicts the compaction of both the gas-bearing formations and the lateral/bottom aquifer (water drive) during a 13-year producing and a 12-year post-production period, and the transference of the deep compaction to the ground surface. To address the uncertainty of a few important hydromechanical parameters, several scenarios are simulated and the most pessimistic predictions obtained. The modeling results show that at most 1 cm of land subsidence over 25 years may be expected at the city of Chioggia, whereas Venice is not subject to settlement. If aquifer drawdown is mediated by water injection, land subsidence is arrested 5 km offshore, with the Chioggia littoral zone experiencing a rebound of 0.6-0.7 cm. Résumé. Un important programme de développement portant sur 15 gisements de gaz du nord de l'Adriatique a été récemment soumis au Comité VIA pour l'évaluation de l'impact sur l'environnement du Ministère de l'Environnement, par la société ENI-Agip, la compagnie nationale pétrolière italienne. L'un des plus importants réservoirs est celui de Chioggia Mare, situé à environ 10 km au large du littoral vénitien, à une profondeur de 1000 à 1400 m. La production de gaz prévue pour ce gisement laisse envisager un impact sur la stabilité du trait de côte, avec une

  16. EquiFACS: The Equine Facial Action Coding System.

    Directory of Open Access Journals (Sweden)

    Jen Wathan

    Full Text Available Although previous studies of horses have investigated their facial expressions in specific contexts, e.g. pain, until now there has been no methodology available that documents all the possible facial movements of the horse and provides a way to record all potential facial configurations. This is essential for an objective description of horse facial expressions across a range of contexts that reflect different emotional states. Facial Action Coding Systems (FACS provide a systematic methodology of identifying and coding facial expressions on the basis of underlying facial musculature and muscle movement. FACS are anatomically based and document all possible facial movements rather than a configuration of movements associated with a particular situation. Consequently, FACS can be applied as a tool for a wide range of research questions. We developed FACS for the domestic horse (Equus caballus through anatomical investigation of the underlying musculature and subsequent analysis of naturally occurring behaviour captured on high quality video. Discrete facial movements were identified and described in terms of the underlying muscle contractions, in correspondence with previous FACS systems. The reliability of others to be able to learn this system (EquiFACS and consistently code behavioural sequences was high--and this included people with no previous experience of horses. A wide range of facial movements were identified, including many that are also seen in primates and other domestic animals (dogs and cats. EquiFACS provides a method that can now be used to document the facial movements associated with different social contexts and thus to address questions relevant to understanding social cognition and comparative psychology, as well as informing current veterinary and animal welfare practices.

  17. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Directory of Open Access Journals (Sweden)

    Cristina Ballarin

    Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

  18. Phylogenetic relationships among Perissodactyla: secretoglobin 1A1 gene duplication and triplication in the Equidae family.

    Science.gov (United States)

    Côté, Olivier; Viel, Laurent; Bienzle, Dorothee

    2013-12-01

    Secretoglobin family 1A member 1 (SCGB 1A1) is a small anti-inflammatory and immunomodulatory protein that is abundantly secreted in airway surface fluids. We recently reported the existence of three distinct SCGB1A1 genes in the domestic horse genome as opposed to the single gene copy consensus present in other mammals. The origin of SCGB1A1 gene triplication and the evolutionary relationship of the three genes amongst Equidae family members are unknown. For this study, SCGB1A1 genomic data were collected from various Equus individuals including E. caballus, E. przewalskii, E. asinus, E. grevyi, and E. quagga. Three SCGB1A1 genes in E. przewalskii, two SCGB1A1 genes in E. asinus, and a single SCGB1A1 gene in E. grevyi and E. quagga were identified. Sequence analysis revealed that the non-synonymous nucleotide substitutions between the different equid genes coded for 17 amino acid changes. Most of these changes localized to the SCGB 1A1 central cavity that binds hydrophobic ligands, suggesting that this area of SCGB 1A1 evolved to accommodate diverse molecular interactions. Three-dimensional modeling of the proteins revealed that the size of the SCGB 1A1 central cavity is larger than that of SCGB 1A1A. Altogether, these findings suggest that evolution of the SCGB1A1 gene may parallel the separation of caballine and non-caballine species amongst Equidae, and may indicate an expansion of function for SCGB1A1 gene products. Copyright © 2013 Elsevier Inc. All rights reserved.

  19. MATER - Pianeta Terra-Mare: an interactive and multidisciplinary approach to Geosphere sciences

    Science.gov (United States)

    Piangiamore, Giovanna Lucia; Fanelli, Emanuela; Furia, Stefania; Garau, Daniela; Merlino, Silvia; Musacchio, Gemma; Carla Centineo, Maria

    2016-04-01

    Recent studies demonstrate that Earth and Marine Sciences are not properly treated in scholastic programs and in textbooks are included in a superficial way. These topics are interdisciplinary and experimental (biology, ecology, oceanography and geology) and the recent advance in these fields is strictly linked to technologic improvement. School cannot keep up with the huge advances of knowledge experimented in the last 20 years, also for the lack of didactic laboratories sufficiently updated to support experimental activities. In this context, in 2014-15 three Italian Research Institutes (INGV, ISMAR-CNR and ENEA-CRAM) have decided to support the Unified School District "ISA 10"of Lerici (Liguria, Italy) - comprehensive of kindergartner, primary and middle schools - to develop the project MATER - Pianeta Terra-Mare (Planet Earth and Sea). The acronym MATER (MARe and TERra) has also a gender value, as people involved in the projects were women, mostly researchers and teachers, which have worked side by side with other women belonging to environmental and cultural associations of the territory. This heterogeneous group has a common objective: to promote the diffusion of a scientific culture and to sensitize students from 3 to 14 years towards problems occurring in marine and terrestrial environments, fostering the settlement of a sustainable attitude to the exploitation of natural resources and consciousness to natural hazards, such as earthquakes and floods, quite common in the Ligurian region. MATER has been considered as one of the best projects funded by MIUR (Italian Ministry of Education, University and Research) inside the Dissemination of Scientific and Technological Culture call for the year 2014. Natural hazards (Planet Earth) and the chemical-physical aspects and resources of the marine environment (Planet Sea) were the two modules of the project. Planet Earth developed through Piovono Idee! (Cloudy with a chance of Ideas!), an interactive exhibition on

  20. Comparison between two ovulation-inducing drugs in mares

    Directory of Open Access Journals (Sweden)

    Paula Cardoso de Almeida Silva

    2016-11-01

    Full Text Available ABSTRACT. Silva P.C.A., Oliveira J.P., Sá M.A.F., Paiva S.O., Caram D.F., Junqueira R.G.C. & Jacob J.C.F. [Comparison between two ovulation-inducing drugs in mares.] Comparação entre dois agentes indutores da ovulação em éguas. Revista Brasileira de Medicina Veterinária, 38(Supl.2:45-48, 2016. Departamento de Reprodução e Avaliação Animal, Instituto de Zootecnia, Universidade Federal Rural do Rio de Janeiro, BR-465, Km 7, Seropédica, RJ 23890-000, Brasil. E-mail: paulinha_calmeida@hotmail.com Hormonal control of the ovulation is an effective tool to improve reproductive performance and reduce costs in equine breeding programs. The aim of this study was to compare the efficiency of lower doses of hCG and Deslorelina than doses traditionally used, evaluating the follicular parameters and time between induction and ovulation. Induction of ovulation was performed according to the groups, 1000 IU of hCG (G1, 0.75mg of Deslorelin (G2, and 1.0ml of saline solution (G3. Twenty-four hours after administration, ovaries were evaluated by ultrasound every six hours until detection of ovulation.  The percentage of ovulation within 36 hours was 34.4%, 13.3% and 8.7%, and up to 42 hours was 96.9%, 70% and 17.4% for G1, G2 and G3, respectively, showing a significant increase (p ˂ 0.0001 in G1 compared to other groups. In G2 there was a significant increase (p ˂ 0.0001 of ovulation after 42 hours from the induction, and G3 after 48 hours. Until 48 hours the percentage of induction of ovulation was 96.8% (31/32 90% (27/30 and 30.4% (7/23, respectively, for G1, G2 and G3. Thus, the lower doses of ovulation-inducing drugs were effective in inducing ovulation within 48 hours, however hCG was faster than deslorelin, which might reduce costs and help the reproduction management.

  1. Contribuição ao estudo do funículo espermático em eqüinos sem raça definida (Equus caballus, L.

    Directory of Open Access Journals (Sweden)

    André Luiz Quagliatto Santos

    1992-06-01

    Full Text Available Utilizando 35 pares de funículos esperméticos de eqüinos sem raça definida, estudaram-se os aspectos histológicos dos envoltórios funiculares, dos vasos arteriais e venosos e dos tecidos intervasculares, assim como o seu arranjo vascular e o comprimento do segmento da artéria testicular nele contido.

  2. Adaptação do modelo de emissão modal CMEM para a frota da cidade de Maringá, Estado do Paraná, Brasil = Adaptation of CMEM modal emission model to the fleet of the city of Maringá, Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Ed Pinheiro Lima

    2011-01-01

    Full Text Available Este artigo descreve a adaptação do modelo de emissão modal CMEM à frota da cidade de Maringá, Estado do Paraná, Brasil. Foram adotados como parâmetros de referência os fatores médios ponderados de emissão e de consumo determinados para a cidade. Esses fatores ponderados foram obtidos para cada fase do Proconve por meio dos fatores médios de emissão, corrigidos pelos fatores de deterioração do AP-42 da EPA e de consumo. Para cada fase do Proconve, foi associado um veículo representativo. Para cada veículo representativo, os parâmetros do modelo CMEM foram ajustados para aproximar-se aos fatores de emissão e consumo de referência. Observou-se que os fatores do AP42 tendem a representar melhor a deterioração da frota, principalmente para veículos mais antigos. A comparação com resultados do ciclo FTP, desagregados por fase, demonstrou variações percentuais mais significativas do que no valor total do ciclo. This paper describes the CMEM modal emission model adaptation to the fleet of the city of Maringá, Parana state, Brazil. Weighted averagefactors of determined emission and consumption for the city were adopted as reference parameters. These weighed factors were obtained for each PROCONVE phase through consumption and emission average factors, the latter corrected by AP-42 deterioration factors. For each Proconve phase a composite vehicle was associated. For each composite vehicle, the CMEM model parameters were adjusted to approach emission and consumption reference factors. It was observed AP42 deterioration factors tend to better represent the deterioration of the fleet, especially old vehicles. The comparison with FTP cycleresults, disaggregated by phase, demonstrated more significant percentile variations than the total value of the cycle.

  3. Adaptive molecular evolution of the Major Histocompatibility Complex genes, DRA and DQA, in the genus Equus.

    Science.gov (United States)

    Kamath, Pauline L; Getz, Wayne M

    2011-05-18

    Major Histocompatibility Complex (MHC) genes are central to vertebrate immune response and are believed to be under balancing selection by pathogens. This hypothesis has been supported by observations of extremely high polymorphism, elevated nonsynonymous to synonymous base pair substitution rates and trans-species polymorphisms at these loci. In equids, the organization and variability of this gene family has been described, however the full extent of diversity and selection is unknown. As selection is not expected to act uniformly on a functional gene, maximum likelihood codon-based models of selection that allow heterogeneity in selection across codon positions can be valuable for examining MHC gene evolution and the molecular basis for species adaptations. We investigated the evolution of two class II MHC genes of the Equine Lymphocyte Antigen (ELA), DRA and DQA, in the genus Equus with the addition of novel alleles identified in plains zebra (E. quagga, formerly E. burchelli). We found that both genes exhibited a high degree of polymorphism and inter-specific sharing of allele lineages. To our knowledge, DRA allelic diversity was discovered to be higher than has ever been observed in vertebrates. Evidence was also found to support a duplication of the DQA locus. Selection analyses, evaluated in terms of relative rates of nonsynonymous to synonymous mutations (dN/dS) averaged over the gene region, indicated that the majority of codon sites were conserved and under purifying selection (dN

  4. Adaptive molecular evolution of the Major Histocompatibility Complex genes, DRA and DQA, in the genus Equus

    Directory of Open Access Journals (Sweden)

    Getz Wayne M

    2011-05-01

    Full Text Available Abstract Background Major Histocompatibility Complex (MHC genes are central to vertebrate immune response and are believed to be under balancing selection by pathogens. This hypothesis has been supported by observations of extremely high polymorphism, elevated nonsynonymous to synonymous base pair substitution rates and trans-species polymorphisms at these loci. In equids, the organization and variability of this gene family has been described, however the full extent of diversity and selection is unknown. As selection is not expected to act uniformly on a functional gene, maximum likelihood codon-based models of selection that allow heterogeneity in selection across codon positions can be valuable for examining MHC gene evolution and the molecular basis for species adaptations. Results We investigated the evolution of two class II MHC genes of the Equine Lymphocyte Antigen (ELA, DRA and DQA, in the genus Equus with the addition of novel alleles identified in plains zebra (E. quagga, formerly E. burchelli. We found that both genes exhibited a high degree of polymorphism and inter-specific sharing of allele lineages. To our knowledge, DRA allelic diversity was discovered to be higher than has ever been observed in vertebrates. Evidence was also found to support a duplication of the DQA locus. Selection analyses, evaluated in terms of relative rates of nonsynonymous to synonymous mutations (dN/dS averaged over the gene region, indicated that the majority of codon sites were conserved and under purifying selection (dN dS. However, the most likely evolutionary codon models allowed for variable rates of selection across codon sites at both loci and, at the DQA, supported the hypothesis of positive selection acting on specific sites. Conclusions Observations of elevated genetic diversity and trans-species polymorphisms supported the conclusion that balancing selection may be acting on these loci. Furthermore, at the DQA, positive selection was

  5. Inseminação artificial de éguas Percheron e Bretão com sêmen fresco diluído em água de côco e leite em pó desnatado Artificial insemination of Percheron and Breton breed mares with fresh semen diluted in extenders with skimmed powder milk and coconut water

    Directory of Open Access Journals (Sweden)

    Luiz Paulo Rigolon

    1999-11-01

    Full Text Available O experimento foi conduzido no Laboratório de Reprodução Animal e no Setor de Eqüideocultura da Fazenda Experimental da Universidade Estadual de Maringá, no período de setembro/97 a março/98, com o objetivo de testar os efeitos de dois diluidores na inseminação artificial de éguas das raças Percheron e Bretão. Foi utilizado um garanhão da raça Percheron e dezesseis éguas, as quais foram inseminadas com sêmen fresco, diluído em meios formulados à base de leite de vaca em pó desnatado (LD e à base de água de côco (AC. As inseminações foram realizadas quando se observaram folículos ovarianos com 3,5 cm de diâmetro. Utilizou-se o delineamento inteiramente casualizado, com oito éguas em cada tratamento. Para as análises utilizou-se o teste do qui-quadrado e análise de variância. A análise dos dados mostrou que não houve diferença (P > 0,05 dos tratamentos sobre o índice de prenhez das éguas no primeiro, segundo e terceiro ciclos estrais, no número de inseminações artificiais fecundas e não-fecundas, na prenhez/inseminação artificial (IA, no índice de prenhez total, na IA/prenhez e entre a motilidade progressiva e o vigor dos espermatozóides após diluição. Com base nos resultados, pode-se concluir que os dois meios foram eficientes na inseminação artificial dessas raças de éguas, utilizando-se o sêmen fresco.This experiment was carried out at Animal Reproduction Laboratory and Equine Section of the Experimental Farm of Universidade Estadual de Maringá, in the period of September 97 trough March 98. The objective was to study the effects of two extenders on artificial insemination (AI of Percheron and Breton breeding mares. One Percheron stallion and sixteen mares were used. The mares were inseminated with fresh semen diluted in two extenders formulated with skimmed powder cow milk (LS and coconut water (AW on the day ovarian follicles with 3.5 cm of diameter were observed. They. were alloted in a

  6. Profile of patients submitted to gastroplasty in the university hospital of Maringá - Paraná State during 2008-2009 - doi: 10.4025/actascihealthsci.v35i2.12019

    Directory of Open Access Journals (Sweden)

    Kazuyuki Hashimoto

    2013-06-01

    Full Text Available This study evaluated the profile of patients submitted to gastroplasty in the University Hospital of Maringá during 2008-2009. Clinical charts were analyzed to obtain clinical and laboratory data of all patients with morbid obesity submitted to gastroplasty. During the study period, 28 surgeries were performed, 57% of the patients lived in Maringá, 82% female, 40 years average age, with mean body mass index (BMI of 46.7kg m-2. It was verified that 39% of the patients maintained an usual non-hypocaloric diet, 25% had quoted dietary reeducation, 36% were sedentary, and 29% practiced some physical activity, and remaining 1/3 of patients presented no data about lifestyle. Regarding associated pathologies, 79% were hypertensive, and 71% of patients presented fasting glucose above 100 mg dL-1, but only 12 of them had diagnosis of Type 2 diabetes mellitus. The hospital stay length was 4 days for 89% of the patients, and 11% had surgery complications. In this group of subjects, there was a clear preponderance of females and high prevalence of other pathologies. Identifying the profile of obese patients contributes to more effective decision-making and emphasizes the crucial role of multidisciplinary approach to health promotion and prevention of early and late complications of morbid obesity and gastroplasty.

  7. Monitoring of toxic chemical in the basin of Maringá stream - doi: 10.4025/actascitechnol.v34i3.10302

    Directory of Open Access Journals (Sweden)

    Rosane Freire

    2012-05-01

    Full Text Available This study aimed to track the spatial and temporal variations of toxic chemical compounds, such as the metals Al, Cd, Pb, Cu, Cr, Mn, Zn and the pesticide glyphosate, in Maringá stream and in a stretch of Pirapó river. The results pointed out that, in the case of metals, one of the possible sources of these elements is associated to agricultural activities. For glyphosate, were not found concentrations above those established by the Brazilian Water Quality Legislation (CONAMA 357/2005. Concerning this, we emphasized that the impact caused by the agrochemical on water quality should be evaluated considering the adverse effects to the environment caused by its degradation, that produces recalcitrant and surfactant compounds that may be even more toxic for humans and aquatic environment. 

  8. Endometrial IL-1beta, IL-6 and TNF-alpha, mRNA expression in mares resistant or susceptible to post-breeding endometritis. Effects of estrous cycle, artificial insemination and immunomodulation.

    Science.gov (United States)

    Fumuso, Elida; Giguère, Steeve; Wade, José; Rogan, Dragan; Videla-Dorna, Ignacio; Bowden, Raúl A

    2003-11-15

    Endometrial mRNA expression of the pro-inflammatory cytokines interleukin-1beta (IL-1beta), interleukin-6 (IL-6), and tumor necrosis factor alpha (TNF-alpha) was assessed in mares resistant (RM) or susceptible (SM) to persistent post-breeding endometritis (PPBE). Eight RM and eight SM, were selected based on reproductive records and functional tests out of a herd of 2,000 light cross-type mares. Three experiments were done to study transcription patterns in (i) basal conditions; (ii) after artificial insemination (AI); and (iii) after administration of an immunomodulator at time of artificial insemination. Endometrial biopsies were taken during consecutive cycles: (i) at estrus, when follicles reached 35 mm and at diestrus (7 +/- 1 days after ovulation); (ii) at 24 h post-AI, with dead semen (estrus) and in diestrus; (iii) at 24 h after treatment with a Mycobacterium phlei cell-wall extract (MCWE) preparation and AI (with dead semen), and at diestrus. mRNA expression was quantitated by real time PCR. Under basal conditions, SM had significantly higher mRNA expression of all cytokines in estrus and of IL-1beta and TNF-alpha in diestrus, compared to RM. After AI, there were no differences between RM and SM in estrus; however, mRNA expression for all three pro-inflammatory cytokines was higher than under basal conditions. In diestrus, RM showed significantly lower IL-1beta and TNF-alpha mRNA expression than SM. When MCWE was administered at time of AI, no differences between cytokine induction from RM and SM were found. Globally, mRNA expression for all three cytokines correlated well among themselves when expression was high. The present study showed that (i) in basal conditions RM had lower mRNA expression of pro-inflammatory cytokines than SM with no effect of estrous cycle; (ii) AI upregulated mRNA expression for all three cytokines in both RM and SM, with persistance in diestrus in the latter; (iii) treatment with MCWE at time of AI down-regulated mRNA expression

  9. Estimation and management of genetic diversity in small populations of plains zebra (Equus quagga) in KwaZulu-Natal, South Africa.

    Science.gov (United States)

    Bowland, A E.; Bishop, K S.; Taylor, P J.; Lamb, J; van der Bank, F H.; van Wyk, E; York, D

    2001-06-01

    Plains zebras (Equus quagga antiquorum) occur in few large, but many small, isolated populations in KwaZulu-Natal. Problems identified in small populations include reduced striping patterns on hind quarters, smaller size, elevated mortality rates and high number of still-births. Inbreeding may be implicated. Population viability analysis (PVA) was conducted with a computer model (VORTEX), and DNA and allozyme analyses were conducted to test the findings of the model. Using standard methods, DNA (PCR-RAPD) and allozyme diversity was assessed in blood samples from 72 plains zebra from four KwaZulu-Natal Nature Conservation Services (KZN-NCS) protected areas: Umfolozi Game Reserve (UGR), Albert Falls (AFNR), Vernon Crookes (VCNR) and Harold Johnson (HJNR) Nature Reserves. Populations of the latter three, small-sized (9-110 individuals) populations were seeded from the same source population (UGR: current population of 2000) during the past 25 years. Information from PCR-RAPD and allozyme analyses were compared with each other as well as to that predicted by population genetic modelling (using VORTEX). Allozyme heterozygosities were consistently high in all populations (12.1-12.9%), with no observable losses associated with reduced population size. On the other hand, percentage loss of polymorphism (20-39%) calculated from the PCR-RAPD study appeared to be positively correlated with the loss of heterozygosity predicted by population viability analysis (PVA), and negatively correlated with population size. On the basis of the above results, a policy of translocation was advocated for small, intensely managed populations of zebras, whereby a harem should be translocated every five years for a population size of nine (HJNR), while for a population size of 110 (VCNR) translocations should take place every 15 years if heterozygosity is to be maintained at more than 90% within each population over 100 years.

  10. Influência da urbanização sobre as assembléias de peixes em três córregos de Maringá, Paraná Influence of urbanization upon fish assemblages in three streams of Maringá, Paraná

    Directory of Open Access Journals (Sweden)

    Almir M. Cunico

    2006-12-01

    Full Text Available O objetivo do presente estudo foi avaliar padrões espaciais na composição, estrutura e distribuição das assembléias de peixes e suas relações com características abióticas em três córregos urbanos da cidade de Maringá, Paraná, Brasil. Peixes foram coletados ao longo de um gradiente longitudinal utilizando pesca elétrica nos meses de maio e novembro de 2004. Temperatura, nitrogênio, pH, oxigênio e fósforo foram as variáveis que mais influenciaram a análise de componentes principais (CPA. Riqueza, eqüitabilidade, índice de diversidade de Shannon-Wiener e o primeiro eixo da análise de correspondência com remoção do efeito do arco (DCA foram diretamente correlacionados com características ligadas ao impacto químico urbano. Adição de espécies prevaleceu nas estações de amostragem do córrego Miosótis e entre a cabeceira e porção intermediária nos córregos Nazaré e Mandacaru. Substituição ocorreu entre as porções intermediárias e foz desses córregos. A dominância da espécie tolerante Poecilia reticulata Peters, 1859 indicou a influência do impacto do meio urbano sobre as assembléias de peixes.The aim of the present study was to evaluate spatial patterns in composition, structure and distribution of fish assemblages and their relationships with abiotic characteristics in three urban streams of Maringá city, Paraná, Brazil. Fish were collected along the longitudinal gradient by electrofishing in May and November 2004. Temperature, nitrogen, pH, oxygen and phosphorous influenced at most the principal components analysis (PCA. Richness, evenness, Shannon-Wiener index and the first axis of detrended correspondence analysis (DCA were directly correlated with abiotic characteristics related to chemical urban impact. Species addition prevailed in Miosotis stream sampling stations, and between headwater and intermediary reaches in Nazaré and Mandacarú streams. Replacement occurred between intermediary and

  11. Influence of the cardiac glycoside digoxin on cardiac troponin I, acid-base and electrolyte balance, and haematobiochemical profiles in healthy donkeys (Equus asinus).

    Science.gov (United States)

    Tharwat, Mohamed; Al-Sobayil, Fahd

    2014-03-12

    The effect of digoxin administration on the serum concentration of the cardiac troponin I (cTnI) has not been reported to date in equidae. This study was therefore designed to evaluate the effect of digoxin on cardiac cell damage in donkeys (Equus asinus) as assessed by cTnI, acid-base and electrolyte balance and haematobiochemical profiles. Ten clinically healthy donkeys were given an IV infusion of digoxin at a dose of 14 μg/kg. Blood samples were collected from the donkeys up through 72 h post-injection. Three of the donkeys exhibited increased heart and respiratory rates post-injection. In the other seven animals, the heart and respiratory rates were lower 4 h post-injection. The serum digoxin concentration increased significantly at many time points after injection. The serum concentration of cTnI did not differ significantly between pre- and post-injection. An increase in blood pH was noted at 3 h after digoxin injection. There were also increases in PO2 and in oxygen saturation. Decreases in PCO2 at 2 to 48 h post-injection as well as a decrease in blood lactate at 4 h post-injection were observed. The serum concentration of glucose remained significantly elevated at all-time points after digoxin injection. It is concluded that administration of digoxin to healthy donkeys (14 μg/kg) did not result in elevations of serum cTnI concentration, signs of digoxin intoxication, ECG abnormalities and did not increase serum concentrations of blood urea nitrogen and creatinine.

  12. Infertilidade associada a defeito microtubular dos espermatozóides de jumento (Equus asinus avaliados por microscopia eletrônica de transmissão Infertility associated with microtubular defect in a donkey (Equus asinus spermatozoa evaluated by transmission electron microscopy

    Directory of Open Access Journals (Sweden)

    André Maciel Crespilho

    2006-10-01

    Full Text Available Descreve-se um caso de infertilidade de um jumento SRD confirmada por meio de microscopia eletrônica de transmissão (MET. O espermiograma, avaliado sob microscopia ótica, revelou baixa motilidade e alta concentração de anormalidades espermáticas do tipo gota citoplasmática proximal. O material foi avaliado por MET, observando-se um acúmulo desordenado de microtúbulos causando protusões irregulares na região do colo espermático. O último teste realizado correspondeu ao de fertilidade in vivo, utilizando-se quatro éguas portadoras de bom histórico reprodutivo, nas quais não foi possível confirmar nenhuma prenhez. Frente aos resultados obtidos, associados aos achados da MET, estabeleceu-se o diagnóstico de infertilidade associada a defeito microtubular dos espermatozóides.A donkey infertility was described by transmission electron microscopy (MET. The spermiogram evaluated by light microscopy showed low sperm motility and high concentration of abnormal sperm with proximal cytoplasmic droplets. The material was evaluated by MET, where it was observed disarrangement of microtubules, causing irregular protrusions in the spermatic neck. The last test done was the in vivo fertility, using four mares, with a reproductive healthy historic, where no pregnancy occurred. Facing the results that we had in vivo, associated with the MET findings, we diagnosed infertility associated with microtubular defect of the spermatozoa.

  13. Age-related risk factors with nonfatal traffic accidents in urban areas in Maringá, Paraná, Brazil.

    Science.gov (United States)

    de Melo, Willian Augusto; Alarcão, Ana Carolina Jacinto; de Oliveira, Analice Paula Rocha; Pelloso, Sandra Marisa; Carvalho, Maria Dalva de Barros

    2017-02-17

    The present study aimed to analyze the factors associated with the occurrence of nonfatal traffic accidents regarding age. A retrospective, transversal, and analytical study was carried out in the municipality of Maringá, Paraná, Brazil, based on data from Boletins de Ocorrência de Acidente de Trânsito ("Police Occurrence Bulletins"; BOATs). Following probability sampling, the sociodemographic aspects, logistics, environmental conditions, and time of occurrence of 418 cases of accidents were analyzed. The age of the victims was considered to be the dependent variable. The data were analyzed using descriptive statistics and bivariate, multivariate, and variance analysis, considering a confidence interval of 95% and a significance level of 5% (P accidents (P accidents were being single, having over 8 years of education, having had a driver's license for less than 3 years, roads with low luminosity, and driving at night. Demographic, environmental, and logistical factors were associated with morbidity due to traffic accidents among young people. These results challenge society and policy makers to create more effective strategies to minimize this serious public health problem.

  14. In vitro safety assessments and antimicrobial activities of Lactobacillus rhamnosus strains isolated from a fermented mare's milk.

    Science.gov (United States)

    Aryantini, Ni Putu Desy; Yamasaki, Eiki; Kurazono, Hisao; Sujaya, I Nengah; Urashima, Tadasu; Fukuda, Kenji

    2017-03-01

    Safety and probiotic characteristics such as antimicrobial activities of three Lactobacillus rhamnosus strains, FSMM15, FSMM22 and FSMM26, previously isolated as potential probiotics from fermented mare's milk were investigated. The three FSMM strains were susceptible to ampicillin, gentamycin, kanamycin, streptomycin, tetracycline and chloramphenicol, whereas they were resistant to erythromycin (minimal inhibitory concentration (MIC) = 4-8 µg/mL) and clindamycin (MIC = 4 µg/mL); bioconversion of bile salts, hemolytic activity and mucin degradation activity were negative; enzymatic activities of α-chymotrypsin and β-glucosidase were detected, but those of α-galactosidase, β-glucuronidase and N-acetyl-β-glucosaminidase, were undetectable. Among the strains, strain FSMM15 was chosen as a safer probiotic candidate due mainly to the lack of plasminogen binding ability. Despite lower acid production of strain FSMM15 than others, its cell-free culture supernatant inhibited growths of Salmonella Typhimurium LT-2, Shigella sonnei, Listeria monocytogenes, and Escherichia coli O157 with comparable levels of ampicillin, suggesting a favorable aspect of strain FSMM15 as a probiotic strain. © 2016 Japanese Society of Animal Science.

  15. Il mare della fertilità Una analisi antropologica della tetralogia di Mishima Yukio

    Directory of Open Access Journals (Sweden)

    Giovanni Azzaroni

    2013-05-01

    Full Text Available Abstract – IT Neve di primavera è il primo romanzo della tetralogia 'Il mare della fertilità', il capolavoro dello scrittore giapponese, che si snoda in un Giappone caratterizzato sia da una cultura ancestrale sia da una invadente modernità e prelude a quel drammatico 25 novembre 1970 quando Mishima, scritte le ultime parole della tetralogia, si suicidò con l’antico rituale del seppuku. Neve di primavera è una narrazione polisemica costruita su opposizioni binarie strutturali, le vicende dei personaggi sono calate in un preciso contesto storico e culturale e per decodificarle è proposta una metodologia antropologica, nel tentativo, al tempo stesso, di coglierne le variegate e molteplici sfumature e, nel contempo, anche le interconnessioni con il tessuto ontologico che ne ha favorito il nascere e lo svilupparsi. Abstract – EN Spring snow is the first novel of the tetralogy The sea of Fertility, the masterpiece of the Japanese writer, which takes place in ancient and modern Japan. The novel is a prelude to the dramatic 25th November 1970: Mishima finished the tetralogy and committed suicide by the ancient seppuku ritual. Spring snow is a polisemic story which is constructed by binary and structural oppositions, the plot of the characters is drawn on a exact, historical and cultural context to catch either the variegated and various shadings or the relations with the ontological substratum, which helped its birth and development.

  16. Il mare della fertilità Una analisi antropologica della tetralogia di Mishima Yukio

    Directory of Open Access Journals (Sweden)

    Giovanni Azzaroni

    2012-01-01

    Full Text Available Abstract – IT Neve di primavera è il primo romanzo della tetralogia Il mare della fertilità, il capolavoro dello scrittore giapponese, che si snoda in un Giappone caratterizzato sia da una cultura ancestrale sia da una invadente modernità e prelude a quel drammatico 25 novembre 1970 quando Mishima, scritte le ultime parole della tetralogia, si suicidò con l’antico rituale del seppuku. Neve di primavera è una narrazione polisemica costruita su opposizioni binarie strutturali, le vicende dei personaggi sono calate in un preciso contesto storico e culturale e per decodificarle è proposta una metodologia antropologica, nel tentativo, al tempo stesso, di coglierne le variegate e molteplici sfumature e, nel contempo, anche le interconnessioni con il tessuto ontologico che ne ha favorito il nascere e lo svilupparsi. Abstract – EN Spring snow is the first novel of the tetralogy The sea of Fertility, the masterpiece of the Japanese writer, which takes place in ancient and modern Japan. The novel is a prelude to the dramatic 25th November 1970: Mishima finished the tetralogy and committed suicide by the ancient seppuku ritual. Spring snow is a polisemic story which is constructed by binary and structural oppositions, the plot of the characters is drawn on a exact, historical and cultural context to catch either the variegated and various shadings or the relations with the ontological substratum, which helped its birth and development.

  17. Estudo retrospectivo de janeiro de 1998 a maio de 2005, no Hospital Universitário de Maringá, sobre ferimentos por arma branca e arma de fogo = Retrospective study (january 1998 / may 2005 at the University Hospital of Maringá, on wounds caused by edged weapons and firearms

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Valadão Fagundes

    2007-07-01

    Full Text Available O objetivo deste trabalho é determinar as características dos pacientes atendidos no Hospital Universitário de Maringá (HUM, com ferimento por arma branca (FAB e por arma de fogo (FAF, quanto ao sexo, idade, às regiões corporais, órgãos mais atingidos, tempo de internamento, complicações e mortalidade. Após análise de uma planilhaelaborada para a pesquisa, observou-se que 68% dos atendimentos foram por FAB e 32%, por FAF, sendo a maioria homens (mais de 90%, adultos jovens (2ª e 3ª década, por FAF e FAB, respectivamente. As regiões mais acometidas foram abdome e tórax. e os órgãos mais atingidos foram intestino delgado e fígado, na lesão por arma branca, e fígado e intestino delgado, no FAF. A complicação mais comum foi o choque hipovolêmico. Concluiu-se que os FAB ocorreram em maior número no sexo masculino, na terceira década de vida.The objective of this study is to determine the characteristics of patients assisted at the University Hospital of Maringá (HUM with wounds from edged weapons (EWW or firearms (FW, in regards to gender, age, wounded body areas, most affected body organs,length of hospitalization, complications and mortality rates. After the analysis of a worksheet elaborated for the study, it was observed that 68% of admissions had been for EWW and 32% for FW. The majority were men (90% and young adults (20s and 30s, for FW and EWW, respectively. The most affected body areas were the abdomen and thorax, and the most wounded organs were, in order: the small intestine and liver for EWW, and the liver and small intestine for FW. The most common complication was hypovolemic shock. It was concluded that EWW had occurred in larger numbers than FW, withpredominance in males in their 30s.

  18. Production of bacteriocin by Leuconostoc mesenteroides 406 isolated from Mongolian fermented mare's milk, airag.

    Science.gov (United States)

    Wulijideligen; Asahina, Takayuki; Hara, Kazushi; Arakawa, Kensuke; Nakano, Hiroyuki; Miyamoto, Taku

    2012-10-01

    The purification and characterization of a bacteriocin produced by Leuconostoc mesenteroides strain 406 that was isolated from traditional Mongolian fermented mare's milk, airag, were carried out. Leuconostoc mesenteroides strain 406 was identified on the basis of its morphological and biochemical characteristics and carbohydrate fermentation profile and by API 50 CH kit and 16S ribosomal DNA analyses. The neutral-pH cell-free supernatant of this bacterium inhibited the growth of several lactic acid bacteria and food spoilage and pathogenic organisms, including Listeria monocytogenes and Clostridium botulinum. The bacteriocin was heat-stable and not sensitive to acid and alkaline conditions, but was sensitive to several proteolytic enzymes such as pepsin, pronase E, proteinase K, trypsin, and α-chymotrypsin, but not catalase. Optimum bacteriocin production (4000 activity units/mL) was achieved when the strain was cultured at 25°C for 24-36 h in Man Rogosa Sharpe medium. The bacteriocin was partially purified by ammonium sulfate precipitation (80% saturation), dialysis (cut-off MW: 1000), and gel filtration chromatography. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis revealed that the bacteriocin had a molecular weight of approximately 3.3 kDa. To our knowledge, this is the first report of the isolation of a bacteriocin-producing Leuconostoc strain from airag. An application to fermented milks would be desired. © 2012 The Authors. Animal Science Journal © 2012 Japanese Society of Animal Science.

  19. Reproductive efficiency of asymptomatic Theileria equi carriers mares submitted to an embryo transfer program

    Directory of Open Access Journals (Sweden)

    Luciana L. Bezerra

    2015-03-01

    Full Text Available This study aimed to assess and evaluate the effects of Theileria equi infection on embryonic recovery, gestation and early embryonic loss. Thirteen Mangalarga Marchador Theileria equi positive donors (diagnosed through nested-PCR and 40 embryos receptors were used. Donors were submitted to two embryo collections in two consecutive estrous cycles (GId; after, the same mares were treated with imidocarb dipropionate (1.2mg/kg IM. in order to collect more embryos in two more estrous cycles (GIId. Receptors were divided into two groups (control and with treated with 20 animals each, where one group was the control (GIr and the other one (GIIr treated with 1.2mg/kg IM of imidocarb dipropionate assessing the gestation rate at 15, 30, 45 and 60 days. After 52 embryo collections, the embryonic recovery rates were 53.84% (14/26 and 65.38% (17/26 (p> 0.05 for GId and GIId, respectively. The gestation rate was 70% (14/20 (p>0.05 at 15, 30, 45 and 60 days in group GIr and for GIIr was 85% (17/20 (p>0.05 at 15 days, 80% (16/20 (p>0.05 at 30, 45 and 60 days. The treatment with imidocarb dipropionate did not cause significant improvement in the reproductive efficiency at an ET program.

  20. Riqueza, composição e distribuição espacial da comunidade de aves em um fragmento florestal urbano em Maringá, Norte do Estado do Paraná, Brasil - DOI: 10.4025/actascibiolsci.v28i4.172 Richness, composition and spatial distribution of bird community on an urban forest fragment at Maringá, Northern Paraná State, Brazil- DOI: 10.4025/actascibiolsci.172

    Directory of Open Access Journals (Sweden)

    Márcio Rodrigo Gimenes

    2007-11-01

    Full Text Available Foi analisada a riqueza, composição e distribuição espacial de aves em um fragmento florestal urbano de 47,3 ha em Maringá, Sul do Brasil (23°25’S e 51°25W. Quatro hábitats foram categorizados neste fragmento: interior de floresta, borda de floresta, áreas abertas e lago. A borda e interior de floresta foram divididos em três estratos: inferior (abaixo de 3 m, médio (3-6 m e superior (acima de 6 m. Uma transecção abrangendo todos os hábitats foi percorrida quatro vezes por mês de janeiro a dezembro de 2003, totalizando 48 dias de amostragens. Foram registradas 86 espécies de aves no fragmento florestal, sendo os insetívoros e onívoros, respectivamente, as guildas com maior número de espécies. A maioria das espécies foi registrada no máximo em 25% das amostragens. O interior da floresta foi o hábitat que teve a maior riqueza de espécies e a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. O estrato médio apresentou a maior riqueza e o superior a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. Ressalta-se a importância de se manter os vários fragmentos florestais urbanos e a cobertura arbórea na cidade de Maringá, a fim de se minimizar os efeitos do isolamento e tentar suprir as necessidades de uma parte da comunidade de aves que possivelmente não se manteria caso não houvesse outras áreas florestais próximas ao local estudado.Richness, composition and spatial distribution of birds were analyzed on an urban forest fragment of 47.3 ha at Maringá, Southern Brazil (23°25'S and 51°25W. Four habitats were categorized on this fragment: forest, forest edge, open areas and lagoon. The forest and forest edge were divided into three levels: understory (bellow 3 m, mid-levels (3-6 m and canopy (above 6 m. A standard transect was ran throughout all pre-established habitats four times each month of January to December 2003, totaling 48 sampling days. A total of

  1. Some maternal lineages of domestic horses may have origins in East Asia revealed with further evidence of mitochondrial genomes and HVR-1 sequences

    Directory of Open Access Journals (Sweden)

    Hongying Ma

    2018-06-01

    Full Text Available Objectives There are large populations of indigenous horse (Equus caballus in China and some other parts of East Asia. However, their matrilineal genetic diversity and origin remained poorly understood. Using a combination of mitochondrial DNA (mtDNA and hypervariable region (HVR-1 sequences, we aim to investigate the origin of matrilineal inheritance in these domestic horses. Methods To investigate patterns of matrilineal inheritance in domestic horses, we conducted a phylogenetic study using 31 de novo mtDNA genomes together with 317 others from the GenBank. In terms of the updated phylogeny, a total of 5,180 horse mitochondrial HVR-1 sequences were analyzed. Results Eightteen haplogroups (Aw-Rw were uncovered from the analysis of the whole mitochondrial genomes. Most of which have a divergence time before the earliest domestication of wild horses (about 5,800 years ago and during the Upper Paleolithic (35–10 KYA. The distribution of some haplogroups shows geographic patterns. The Lw haplogroup contained a significantly higher proportion of European horses than the horses from other regions, while haplogroups Jw, Rw, and some maternal lineages of Cw, have a higher frequency in the horses from East Asia. The 5,180 sequences of horse mitochondrial HVR-1 form nine major haplogroups (A-I. We revealed a corresponding relationship between the haplotypes of HVR-1 and those of whole mitochondrial DNA sequences. The data of the HVR-1 sequences also suggests that Jw, Rw, and some haplotypes of Cw may have originated in East Asia while Lw probably formed in Europe. Conclusions Our study supports the hypothesis of the multiple origins of the maternal lineage of domestic horses and some maternal lineages of domestic horses may have originated from East Asia.

  2. Serological survey for Leishmania sp. infection in wild animals from the municipality of Maringá, Paraná state, Brazil

    Directory of Open Access Journals (Sweden)

    EM Voltarelli

    2009-01-01

    Full Text Available Leishmania sp. infection was investigated in wild animals from the Ingá Park, in the municipality of Maringá, Paraná state, Brazil, where American cutaneous leishmaniasis (ACL is an endemic disease. Sixty-five mammals, comprising Didelphis albiventris, Cerdocyon thous, Lycalopex vetulus, Cebus apella, Dasyprocta azarae, Dasypus novemcinctus, Procyon cancrivorus and Nasua nasua, were captured. Blood samples were collected for parasite cultivation. Antibodies were investigated by direct agglutination test (DAT using Leishmania (Viannia braziliensis as antigen. Flagellates were observed in blood cultures of 14 (35.9% Didelphis albiventris. Anti-Leishmania antibodies were detected in 31 (51.6% specimens of Cerdocyon thous, Lycalopex vetulus, Cebus apella, Dasyprocta azarae, Procyon cancrivorus and Nasua nasua. These results suggest that Cerdocyon thous and Lycalopex vetulus (crab-eating fox, Cebus apella (capuchin monkey, Dasyprocta azarae (agouti, Procyon cancrivorus (crab-eating raccoon and Nasua nasua (coati play an important role in the ACL transmission cycle in the northwestern region of Paraná, Brazil.

  3. Molecular detection of toxigenic potential of fungi in peanut samples collected in retail shops in Maringá/PR, Brazil

    Directory of Open Access Journals (Sweden)

    Alessandra Valéria de Oliveira

    2015-02-01

    Full Text Available Many foods are susceptible to fungal contamination. Grains, such as peanuts, are commonly affected, with consequences including compromised integrity and infeasibility for human and animal consumption. Furthermore, some fungi may pose a health risk, largely due the production of mycotoxins. Among these, aflatoxins produced by Aspergillus flavus and A. parasiticus produce various carcinogenic, teratogenic, immunosuppressive, hepatotoxic and nephrotoxic effects. Molecular techniques have been used to identify and distinguish fungal species in foods. The objective of this study was molecular detection of Aspergillus species in peanut samples collected in stores in Maringá-PR, by amplification of fungal genetic material with specific primers for the intergenic spacer aflR-aflJ and later cutting with restriction enzymes. Of the 50 peanut samples analyzed, 27 were positive for the intergenic spacer aflR-aflJ, seven of which were identified as Aspergillus flavus. Our results demonstrate that peanuts sold in retail stores in this region have potential for contamination with toxigenic fungi.

  4. Mapas de Significados Espaciais e Vivência Geracional de Homens e Mulheres Nikkeys de Maringá e Londrina, Paraná. DOI: 10.5212/Rlagg.v.6.i1.0005

    OpenAIRE

    Kataoka, Caio Shigueharu; Universidade Estadual de Ponta Grossa; Ornat, Marcio Jose; Universidade Estadual de Ponta Grossa

    2014-01-01

    Este artigo problematiza a relação entre os mapas de significados espaciais e a vivência geracional de homens e mulheres nikkeys no Norte do Paraná. Nosso recorte espacial refere-se às cidades de Maringá e Londrina, tendo visto o fato de apresentarem tanto considerável população relativa de japoneses, quanto expressiva manifestação cultural, organizada segundo Associações Culturais e Esportivas. O campo realizado evidencia os diferentes mapas de significados espaciais constituídos por homens ...

  5. A urbanização e o desencadeamento de processos erosivos em área de preservação ambiental na cidade de Maringá, Estado do Paraná

    Directory of Open Access Journals (Sweden)

    Lourival Domingos Zamuner

    2002-04-01

    Full Text Available O presente trabalho analisa os fatores físicos e hidrológicos da cabeceira de drenagem do córrego Cleópatra, as conseqüências advindas da urbanização e do lançamento concentrado de águas pluviais captadas pela rede de drenagem artificial em área de preservação ambiental - o Parque Florestal dos Pioneiros - Bosque II, em Maringá, Estado do Paraná, que gerou a implantação de sistema erosivo formado por ravinas e voçorocas.

  6. Eighty years of cooperative water science

    Science.gov (United States)

    Stone, Mandy L.

    2017-05-09

    The Equus Beds aquifer in south-central Kansas is a primary water source for the city of Wichita. The Equus Beds aquifer storage and recovery (ASR) project was developed to help the city of Wichita meet increasing current and future demands. The Equus Beds ASR project is a recent part of an 80-year cooperative water science effort with the city of Wichita. The U.S. Geological Survey (USGS) Kansas Water Science Center characterizes river and aquifer water-quality and quantity and evaluates changes that may or may not be related to ASR. The USGS data are used by the city of Wichita to make informed management decisions, satisfy regulatory requirements, and serve as a baseline to detect any subsequent changes that may be related to ASR.

  7. CONSIDERATIONS REGARDING THE BAIA MARE AREA METEOROLOGICAL CONDITIONS IN THE LAST 5 YEARS WITH HELP OF ENVIRONMENTAL INFORMATICS

    Directory of Open Access Journals (Sweden)

    B. Cioruţa

    2013-03-01

    Full Text Available Ever since “the environment” gained its place in the public international agenda (environmental legislation, sustainable development or disaster and hazard management it has been bundled with data, information, knowledge and information systems. Environmental Monitoring Systems (EMSs, Environmental Monitoring and Analyzing Systems (EMASs and especially Environmental Information Systems (EISs are integrated part of what we call Environmental Informatics (EI platform.In this context, as we speak, the are of EI is becoming more complex due to the current context and trend of making the EISs available to the public and end-users access; this phenomena is based on the assumption that public and environmental information end-users awareness, participation and acting is improved by the rate of access to the environmental information to solve the complex problematic covered by the research, engineering and environmental protection fields. The aim of the present paper is to introduce and describe an innovative possibilities of forecasting and monitoring the environment meteorological specific conditions in Baia Mare urban area using a specialized EISs software.

  8. Assessment of occupational exposure of dental professionals to mercury in dental offices of a public primary health care in Maringá, Paraná State, Brazil = Avaliação da exposição ocupacional de profissionais de odontologia ao mercúrio em unidades básicas de saúde de Maringá, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Christiane Minervino de Oliveira

    2012-10-01

    Full Text Available In order to evaluate the occupational exposure of dental professionals to metallic mercury in dental offices of a public primary health care in the city of Maringá, Brazil, samples of blood and urine were collected from 149 dental professionals (group exposed, and 51 healthy adults similar for age and gender of the exposed group (control group in September and October, 2008. Urinary mercury was determined using atomic absorption spectrophotometry, urea and creatinine in blood and urine by UV/VIS spectrophotometry and analysis of physical, chemical and microbiological characteristics of the urine by reactive bands. The program ‘Statistic��� version 7.1 and the software R version 2.6.2 were used for the statistical calculations. Urinary mercury was 2.08  2.11 µg g-1 creatinine in workers exposed to mercury and 0.36  0.62 µg g-1 creatinine in the control group (p Para avaliar a exposição ocupacional dos profissionais de odontologia ao mercúrio metálico nas Unidades Básicas de Saúde (UBS de Maringá, Brasil, foram coletadas amostras de sangue e urina de 149 profissionais de odontologia (grupo exposto e de 51 adultos saudáveis similares em relação à idade e ao gênero do grupo exposto (grupo controle, no período de setembro e outubro de 2008. Foi determinado o mercúrio urinário por espectrofotometria de absorção atômica, a uréia e creatinina no sangue por espectrofotometria UV/VIS, e análise dos aspectos físicos, químicos e microbiológicos da urina por fitas reativas. Para a análise estatística foi utilizado o programa Statistic versão 7.1 e o R versão 2.6.2. O mercúrio urinário foi 2,08 ± 2,11 µg g-1 de creatinina nos profissionais expostos ao mercúrio e 0,36 ± 0,62 µg g-1 de creatinina no grupo controle (p < 0,05. Os níveis de mercúrio urinário detectados estavam abaixo do Índice Biológico Máximo Permitido estabelecido no Brasil (35 µg g-1 de creatinina, 11% destes profissionais (n=16

  9. Physiological response to chemical immobilization: a case study of etorphine-azaperone in free-ranging plains zebra (Equus quagga in Kenya

    Directory of Open Access Journals (Sweden)

    Francesca Vitali

    2018-06-01

    Full Text Available Predictable immobilization of wild zebras is challenging and there is massive variation in opiate response within different species. Etorphine combined with azaperone is considered the protocol of choice, but no studies have investigated the physiological response to this procedure of immobilization in plains zebras.   Eleven free-ranging plains zebras (Equus quagga were immobilized in Kenya using a combination of etorphine 0.019 ± 0.003 mg/kg and azaperone 0.27 ± 0.05 mg/kg administered intramuscularly with a projectile dart. After recumbency, an arterial sample was performed for blood gas analysis and physiological parameters were recorded every five minutes. Descriptive scores were given to the exertion resulting from high-speed chasing and to the quality of induction, immobilization and recovery. Diprenorphine or naltrexone were used for opioid antagonism.   In all zebras, the combination induced quick inductions within 3.5 ± 0.8 minutes and provided reliable recumbencies without attempts to stand for the entire duration of the immobilization. The average heart rates, respiratory rates and mean arterial blood pressure recorded were 102 ± 42 beats/minute, 18 ± 4 breaths/minute and 145 ± 28 mmHg respectively. Arterial gas analyses demonstrated mild to severe and partially compensated metabolic acidosis and hypoxia, while electrolytes were within equids range. In particular, higher exertion levels during the chasing were significantly correlated to worse immobilization scores (p=0.008 and hyperthermia occurrence (p=0.0012 and non-significantly to more severe acidosis. Recoveries from anaesthesia were smooth, on average 121 ± 38 seconds after diprenorphine/naltrexone administration.             Etorphine-azaperone combination produced physiological alterations in free-ranging plains zebra such as tachycardia, hypertension, metabolic acidosis and hypoxemia. However, these preliminary results indicate that high-speed chase

  10. A mulher e o acidente de trânsito: caracterização do evento em Maringá, Paraná Women and traffic accidents: characterization of occurrences in Maringá, Paraná

    Directory of Open Access Journals (Sweden)

    Pedro Paulo Davantel

    2009-09-01

    Full Text Available Os acidentes de trânsito são atualmente a primeira causa de mortalidade no conjunto de causas externas entre as mulheres. A mulher atual, pelas mudanças em seu papel na sociedade, vem se expondo a novos riscos. Este estudo teve como objetivo caracterizar a mulher envolvida em acidente de trânsito, assim como os eventos. Foi realizado um estudo transversal, com dados secundários obtidos nos Boletins de Ocorrência de Acidente de Trânsito - BOAT, do 4º Batalhão da Polícia Militar de Maringá, Setor de Trânsito. Os dados foram categorizados e analisados por meio de testes não-paramétricos, de correlações (Spearman e teste de independência entre as variáveis (qui-quadrado. As mulheres envolvidas em acidente de trânsito eram em sua maioria solteiras (34,0%, com idade entre 21 e 30 anos (49,0%, nível de escolaridade acima do ensino médio (58,0% e predominantemente condutoras (65,0%. Os eventos ocorreram principalmente em dias úteis e nos período da tarde e da noite. As lesões foram mais frequentes em mulheres até os 20 anos e acima dos 51. Maior envolvimento em colisões com automóveis (69,%, com grande proporção de atropelamentos (14,2%, envolveram mulheres acima dos 50 anos e com menor nível de escolaridade. Foram mais atentas ao uso de dispositivos de segurança quando casadas e com maior nível de escolaridade. Estes dados sugerem novo perfil da mulher no trânsito, devendo o acompanhamento destas características e das consequências destes acidentes serem mais constantes em pesquisas, direcionando medidas e campanhas preventivas.Today traffic accidents are the first cause of morbidity in the group of external causes among women. Modern women have changed their role, exposing themselves to new risks. So, this study had as its purpose, characterize women involved in traffic accidents and to describe these accidents. A cross-sectional survey was conducted with information obtained from the Traffic Accident Report

  11. El Mare Nostrum digital: Mito, ideología y realidad de un imaginario sociotécnico

    Directory of Open Access Journals (Sweden)

    Francisco García García

    2012-04-01

    Full Text Available En el imaginario social de la Red ha aparecido con fuerza el dibujo de una nueva generación formada por jóvenes nacidos en un entorno esencialmente digital. Bajo términos contrastantes como el de ""nativos digitales"" se engloba a un vasto grupo poblacional relacionado estrechamente con las TIC y que ha hecho de las redes un espacio social y personal básico de su actividad, de su forma de habitar y relacionase con el mundo. Pero, ¿cuáles son realmente las características que los definen?, ¿son un grupo realmente homogéneo?, ¿disponen de competencias, habilidades y conductas similares?, ¿cuál es la frontera real que separa a los nativos y a los inmigrantes digitales? ¿Son estos términos apropiados para definir esta nueva realidad social? ¿Responde la realidad social de Internet a este concepto bipolar?Tomando como referencia los principales estudios realizados hasta la fecha, el artículo realiza un ejercicio metafórico dirigido a repensar los rasgos de este universo (nuestro Mare Nostrum Digital con la finalidad de acotar, interpretar y arrojar luz sobre este relevante fenómeno de nuestra actualidad.

  12. Valores de referência de alguns parâmetros fisiológicos de ratos do Biotério Central da Universidade Estadual de Maringá, Estado do Paraná = Reference values of some physiological parameters in the rats of the Central Biotery at the State University of Maringá, State of Paraná

    Directory of Open Access Journals (Sweden)

    Jailson Araújo Dantas

    2006-07-01

    Full Text Available O objetivo deste trabalho foi estabelecer valores de referência de alguns parâmetros fisiológicos (bioquímicos, hematológicos e urinários de ratos provenientes do Biotério Central da Universidade Estadual de Maringá, Estado do Paraná. Foram utilizados ratos machos, normais e saudáveis da linhagem Wistar, com peso de 200 a 220 g. Foiavaliado o perfil hematológico (leucócitos: totais, mononucleares e polimorfonucleares e a determinação bioquímica de vários constituintes plasmáticos (aspartato aminotransferase, alanina aminotransferase, glicose, creatinina, fosfatase alcalina, fosfatase ácida, uréia, colesterol total, colesterol HDL, triglicerídeos, teste de tolerância à glicose GTT e urinários (glicose, creatinina. É imprescindível que cada laboratório estabeleça seu conjunto devalores de referência dos animais normais, de acordo com a dieta, a linhagem, o sexo e a idade de cada espécie utilizada. Assim, através deste trabalho, o pesquisador pode identificar desvios dos parâmetros, facilitando a escolha dos animais para o estudo.The present work was carried out to establish reference values for some physiological parameters (biochemical, hematological and urinary in rats proceeding from the Central Biotery at the State University of Maringá, State of Paraná. Normal male Wistar rats weighing 200-220 g were used. The hematological profile (total leukocytes, mononuclear and polymorphonuclear cells count, theclinic chemistry (aspartate aminotransferase, alanine aminotransferase, glucose, creatinine, alkaline phosphatase, acid phosphatase, urea, cholesterol, HDL-c, triglycerides, glucose tolerance and urinary parameters (glucose and creatinine were determined. Each laboratory should establish a database of reference values for their animals, according to diet, strain, sex and age foreach species used. Thus, in this work, a database is provided regarding reference values of some physiological parameters in rats for use

  13. Thermal Demagnetization of Mare Basalts 10017 and 10020

    Science.gov (United States)

    Suavet, C. R.; Weiss, B. P.; Grove, T. L.

    2012-12-01

    unstable. The fact that the NRM and the ARM have similar behavior upon heating confirms that the magnetization is a TRM. We compared the AF demagnetization of a 0.1 mT ARM before and after heating a subsample of 10017 up to 250°C: there was no change in the coercivity spectrum, which shows that the demagnetization was not due to alteration of the magnetic carriers. The thermal demagnetization of a subsample of 10017 with a saturation isothermal magnetization (SIRM) does not show a Curie point at 250°C. Therefore, the low-temperature demagnetization of mare basalts 10017 and 10020 is real. It could be caused by a defect magnetization of troilite, interaction between troilite and kamacite, presence of cohenite, or an unknown phenomenon.

  14. O aproveitamento de madeiras das podas da arborização viária de Maringá/PR

    Directory of Open Access Journals (Sweden)

    Carlos Humberto Martins

    2013-05-01

    Full Text Available A pesquisa tem o objetivo de elencar formas de aproveitamento das madeiras das podas da arborização viária da cidade de Maringá/PR. Foram identificadas as três espécies arbóreas mais frequentes: Caesalpinia peitophoroides (Sibipiruna, Tabebuia avellanedae (Ipê Roxo e a Tipuana tipu (Tipuana que correspondem a 56,21% do total. Propõe-se a investigação do aproveitamento da madeira para fabricação de pequenos objetos de madeira (POM, elementos estruturais para a construção civil, e para a obtenção de carvão vegetal. Constatou-se nas análises laboratoriais: o Ipê Roxo com alta densidade básica, com resistência mecânica para a produção de elementos estruturais e com elevado padrão de aproveitamento em carvão vegetal, a Sibipiruna na classe de densidade média pode ser utilizada em móveis e também em produção de carvão vegetal e a Tipuana como de densidade baixa ideal para fabricação de POM.

  15. A southern African origin and cryptic structure in the highly mobile plains zebra.

    Science.gov (United States)

    Pedersen, Casper-Emil T; Albrechtsen, Anders; Etter, Paul D; Johnson, Eric A; Orlando, Ludovic; Chikhi, Lounes; Siegismund, Hans R; Heller, Rasmus

    2018-03-01

    The plains zebra (Equus quagga) is an ecologically important species of the African savannah. It is also one of the most numerous and widely distributed ungulates, and six subspecies have been described based on morphological variation. However, the within-species evolutionary processes have been difficult to resolve due to its high mobility and a lack of consensus regarding the population structure. We obtained genome-wide DNA polymorphism data from more than 167,000 loci for 59 plains zebras from across the species range, encompassing all recognized extant subspecies, as well as three mountain zebras (Equus zebra) and three Grevy's zebras (Equus grevyi). Surprisingly, the population genetic structure does not mirror the morphology-based subspecies delineation, underlining the dangers of basing management units exclusively on morphological variation. We use demographic modelling to provide insights into the past phylogeography of the species. The results identify a southern African location as the most likely source region from which all extant populations expanded around 370,000 years ago. We show evidence for inclusion of the extinct and phenotypically divergent quagga (Equus quagga quagga) in the plains zebra variation and reveal that it was less divergent from the other subspecies than the northernmost (Ugandan) extant population.

  16. Protocolul persan de la Cirus cel Mare până la Chosroes I

    Directory of Open Access Journals (Sweden)

    Orest TĂRÎȚĂ

    2017-12-01

    Full Text Available În articol se abordează unele aspecte - cheie ale protocolului și ceremonialului persan din tim-pul celor patru perioade istorice ale statalității persane începând cu anul 700 până la Hristos și finalizând cu anul 651 ale erei creștine. Prin prisma analizei este trecută domnia lui Cirus al II-lea cel Mare – fondatorul Imperiului Per-san, care a introdus la curtea sa protocolul și ceremonialul pentru a-i debarasa pe persani de obiceiurile barbare și a-i familiariza cu subtilitățile bunelor maniere. Un spațiu aparte este rezervat perioadei sasanide (224 î. Hr. - 651, când curtea regală este con¬dusă de șeful de protocol, situat pe primul loc la curtea șahinșahului, fiind urmat de succesorul la tron, șeful regimentului de „nemuritori” și alte demnități; este descrisă scena încoronării lui Șapur I și ordinea ierarhică a înalților demnitari regali de la curtea sa, primirea cu onoruri a ambasa¬dorilor străini la curte și alaiurile publice ale șahinșahului, care urmăreau nu altceva decât să perpetueze măreția Marelui Imperiu, atât în interior, cât și în relațiile cu țările vecine.

  17. Equus quagga

    African Journals Online (AJOL)

    FIGURE 3. 0. Family composition of 4 zebra populations. Solid line: total family size; .... stable, had a common sleeping ground where they stayed for the night and ..... because of a certain amount of segregation of stallion groups and families.

  18. Ocorrência de anorexia nervosa e distúrbio de imagem corporal em estudantes do ensino médio de uma escola da rede pública da cidade de Maringá, Estado do Paraná = Occurrences of nervous anorexy and body image disorder in middleschool students in the city of Maringá, State of Paraná

    Directory of Open Access Journals (Sweden)

    Daniele de Pinho Freitas Kneube

    2006-07-01

    Full Text Available Este trabalho investiga a ocorrência de anorexia nervosa e distúrbio de imagem corporal em 187 estudantes do ensino médio da cidade de Maringá, Estado do Paraná. O Índice de Massa Corporal (IMC e a classificação do estado nutricional foram utilizados para a avaliação antropométrica. A análise das respostas do questionário Body ShapeQuestionnaire (BSQ demonstrou que 66,1% das estudantes do sexo feminino apresentaram distúrbios de imagem corporal e somente 18,6% dos estudantes do sexo masculino apresentaram tal distúrbio. Com relação às respostas ao questionário Teste de Atitudes Alimentares (EAT, verificou-se que 10% do sexo masculino e 32% do sexo femininoapresentaram sintomatologia anoréxica. Os resultados sugerem uma elevada incidência da anorexia nervosa na população estudada bem como uma significativa presença de distorção da imagem corporal. As informações são relevantes para estudos clínicos voltados paraorientação nutricional dos adolescentes visando à reeducação alimentar.This study investigates the occurrence of nervous anorexy and body image disorders in 187 middle school students in the city of Maringá, State of Paraná, Brazil. Body Mass Index (BMI and the classification of the nutritional state were used to the anthropometrical evaluation. The analysis of the questionnaire BSQ answers demonstrated that 66.1% of female students presented the body image disorder, and only 18.6% of male students presented such disorder. Regarding the questionnaire EAT answers, the analysis showed that 32% female and 10% male sex presented anorexic symptoms. The obtained results indicated high incidence of nervous anorexy in the population studied as well as a significant presence of body image distortion.These results are relevant to clinic studies of teenagers, mainly those directing to future studies on nutritional orientation focusing on alimentary reeducation.

  19. Shedding of Clostridium difficile PCR ribotype 078 by zoo animals, and report of an unstable metronidazole-resistant isolate from a zebra foal (Equus quagga burchellii).

    Science.gov (United States)

    Álvarez-Pérez, Sergio; Blanco, José L; Martínez-Nevado, Eva; Peláez, Teresa; Harmanus, Celine; Kuijper, Ed; García, Marta E

    2014-03-14

    Clostridium difficile is an emerging and potentially zoonotic pathogen, but its prevalence in most animal species, including exhibition animals, is currently unknown. In this study we assessed the prevalence of faecal shedding of C. difficile by zoo animals, and determined the ribotype, toxin profile and antimicrobial susceptibility of recovered isolates. A total of 200 samples from 40 animal species (36.5% of which came from plains zebra, Equus quagga burchellii) were analysed. C. difficile was isolated from 7 samples (3.5% of total), which came from the following animal species: chimpanzee (Pan troglodytes troglodytes), dwarf goat (Capra hircus), and Iberian ibex (Capra pyrenaica hispanica), with one positive sample each; and plains zebra, with 4 positive samples from 3 different individuals. Most recovered isolates (4/7, 57.1%) belonged to the epidemic PCR ribotype 078, produced toxins A and B, and had the genes encoding binary toxin (i.e. A(+)B(+)CDT(+) isolates). The remaining three isolates belonged to PCR ribotypes 039 (A(-)B(-)CDT(-)), 042 (A(+)B(+)CDT(-)) and 110 (A(-)B(+)CDT(-)). Regardless of their ribotype, all isolates displayed high-level resistance to the fluoroquinolones ciprofloxacin, enrofloxacin and levofloxacin. Some isolates were also resistant to meropenem and/or ertapenem. A ribotype 078 isolate recovered from a male zebra foal initially showed in vitro resistance to metronidazole (MIC ≥ 256 μg/ml), but lost that trait after subculturing on non-selective media. We conclude that zoo animals belonging to different species can carry ribotype 078 and other toxigenic strains of C. difficile showing resistance to antimicrobial compounds commonly used in veterinary and/or human medicine. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Physic-chemical evaluation of leach and water from the Borba Gato streamlet within the catchment area of the urban waste landfill of Maringá, Paraná State, Brazil=Avaliação físico-química do lixiviado e da água do ribeirão Borba Gato na área de influência do aterro de resíduos de Maringá, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Carlos de Barros Júnior

    2012-01-01

    Full Text Available The physic-chemical characteristics of leach deposited in the landfill waste pond and of water from the Borba Gato streamlet are evaluated. Twenty-six physic-chemical parameters were analyzed from three collection sites, or rather, two in the streamlet, one upstream (P-01 and one downstream (P-02 of the landfill waste pond, and one in the leach deposit pond (P-03. The streamlet area under analysis was impacted due to being in an agricultural area and for its urban waste deposits. Parameter concentrations of aluminum, iron and mercury were reported above the quality standard of freshwater, according to Conama 357/2005 resolution (class 2. Further, throughout the rainy period, the ammoniac nitrogen content was above the resolution quality standard for fresh water. Moreover, landfill leach was above standards of effluent discharge established by Conama 357/2005. An efficient treatment for the effluent generated in Maringá is required since there is evidence of leach pollution of the Borba Gato streamlet.Este estudo teve como objetivo avaliar as características físico-químicas do lixiviado depositado na lagoa do aterro e da água do ribeirão Borba Gato. Foram analisados 26 parâmetros físico-químicos de três pontos de coletas, dois no ribeirão, a montante (P-01 e a jusante (P-02 do aterro de resíduos, e um na lagoa de depósito de percolado do aterro (P-03. A área do ribeirão estudada se apresentou impactada, por ser uma região agrícola e pela deposição dos resíduos de Maringá. Dentre os parâmetros estudados, registrou-se que, na maioria dos meses, concentrações de alumínio, ferro e mercúrio estavam acima do padrão de qualidade de água doce da resolução do Conama 357/2005 (Classe 2. Além disso, verificou-se que no período chuvoso, P-02 registrou teores de nitrogênio amoniacal acima do padrão de qualidade de água doce da resolução, assim como o lixiviado do aterro apresentou-se acima do padrão do lançamento de

  1. Modelo de gestão integrada de resíduos sólidos urbanos – estudo para o município de Maringá, Estado do Paraná - DOI: 10.4025/actascitechnol.v25i1.2231

    Directory of Open Access Journals (Sweden)

    Carlos de Barros Júnior

    2003-04-01

    Full Text Available Este trabalho apresenta um modelo de gestão integrada dos resíduos sólidos urbanos para a cidade de Maringá, o qual além do seu caráter tecnológico moderno, com base nos resultados obtidos nesta pesquisa, constitui-se em uma integração entre as várias fases, principalmente na coleta diferenciada, com as várias formas de tratamento/destino final, que levam a um menor impacto ambiental, social e econômico, buscando o resgate da cidadania, por meio da garantia de melhores condições de vida para os segmentos menos favorecidos da sociedade e de melhor qualidade de vida. O modelo consta de um sistema de gerenciamento integrado, composto por: coleta segregada, coleta seletiva, unidades de triagem, unidade de compostagem e aterro sanitário. O trabalho apresenta um enfoque sobre a situação atual na questão dos resíduos sólidos urbanos na cidade de Maringá e prevê uma ação de remediação e fechamento do lixão, iniciando-se com a formulação de um modelo tecnológico, da implantação do projeto e de seu monitoramento.

  2. Archeological Investigations in the Truscott Reservoir Area. King and Knox Counties, Texas,

    Science.gov (United States)

    1978-06-01

    postdate the deposit. Collections consist of an upper molar of Equus sp., two di’stal epiphyses of metapodials of Bison sp., a glenoid fossa of a...includes two lower molars of Equus sp., a fragment of a jaw condyle, and a rib fragment. Since very little material was found at any of these sites, and...Archeological Survey Report No. 6. Austin. 364 McCormick, Olin F. 1976 The Archaic Period in North Central Texas. In The Texas Archaic: A Symposium, edited

  3. Genetic variability of Hypostomus (Teleostei, Loricariidae from the Ribeirão Maringá, a stream of the upper Rio Paraná basin, Brazil

    Directory of Open Access Journals (Sweden)

    Suzana de Paiva

    2005-09-01

    Full Text Available Hypostomus strigaticeps and two morphotypes of Hypostomus were collected from Ribeirão Maringá, a small tributary of the Rio Pirapó, an effluent of the upper Rio Paraná. The three populations were analyzed by allozyme electrophoresis that allowed the scoring of 25 loci from 14 enzyme systems. Heterozygosity values (He were 0.028 in H. strigaticeps, 0.027 in Hypostomus sp. 1 and zero in Hypostomus sp. 2. Several diagnostic loci and fixed differences were observed for each population at loci Acp-A, Gcdh-A and Mdhp-A. Thus, all populations were genetically distinct, although there were many common alleles. The unbiased genetic identities of Nei (I were estimated as 0.780 for Hypostomus sp. 1 and H. strigaticeps, 0.357 for H. strigaticeps and Hypostomus sp. 2 and 0.322 for Hypostomus sp. 1 and Hypostomus sp. 2. The data indicate that the two morphotypes are distinct species from Hypostomus strigaticeps.

  4. Molecular phylogeny of equine herpesvirus 1 isolates from onager, zebra and Thomson's gazelle.

    Science.gov (United States)

    Ghanem, Y M; Fukushi, H; Ibrahim, E S M; Ohya, K; Yamaguchi, T; Kennedy, M

    2008-01-01

    Viruses related to equine herpesvirus type 1 (EHV-1) were isolated from an aborted fetus of an onager (Equus hemionus) in 1984, an aborted fetus of Grevy's zebra (Equus grevyi) in 1984 and a Thomson's gazelle (Gazella thomsoni) with nonsuppurative encephalitis in 1996, all in the USA. The mother of the onager fetus and the gazelle were kept near plains zebras (Equus burchelli). In phylogenetic trees based on the nucleotide sequences of the genes for glycoproteins B (gB), I (gI), and E (gE), and teguments including ORF8 (UL51), ORF15 (UL45), and ORF68 (US2), the onager, Grevy's zebra and gazelle isolates formed a genetic group that was different from several horse EHV-1 isolates. Within this group, the onager and gazelle isolates were closely related, while the Grevy's zebra isolate was distantly related to these two isolates. The epizootiological origin of the viruses is discussed.

  5. DNA sequences from the quagga, an extinct member of the horse family.

    Science.gov (United States)

    Higuchi, R; Bowman, B; Freiberger, M; Ryder, O A; Wilson, A C

    To determine whether DNA survives and can be recovered from the remains of extinct creatures, we have examined dried muscle from a museum specimen of the quagga, a zebra-like species (Equus quagga) that became extinct in 1883 (ref. 1). We report that DNA was extracted from this tissue in amounts approaching 1% of that expected from fresh muscle, and that the DNA was of relatively low molecular weight. Among the many clones obtained from the quagga DNA, two containing pieces of mitochondrial DNA (mtDNA) were sequenced. These sequences, comprising 229 nucleotide pairs, differ by 12 base substitutions from the corresponding sequences of mtDNA from a mountain zebra, an extant member of the genus Equus. The number, nature and locations of the substitutions imply that there has been little or no postmortem modification of the quagga DNA sequences, and that the two species had a common ancestor 3-4 Myr ago, consistent with fossil evidence concerning the age of the genus Equus.

  6. Adaptive changes in the appetite, growth and feeding behaviour of pony mares offered ad libitum access to a complete diet in either a pelleted or chaff-based form

    DEFF Research Database (Denmark)

    Argo, C.M.; Cox, J.E.; Lockyer, C.

    2002-01-01

    Seven, 3-year-old pony mares (similar to230 kg) were used in a cross-over study to compare the appetite, energy and nutrient digestibilities, growth rate and feeding behaviour, when a complete diet was offered ad libitum in either the original loose-chaff mix (C), or as a more convenient, milled...... provision continued for a further 4 weeks. Behaviour and apparent nutrient digestibilities were assessed in weeks 3 and 4 of each period. Pelleted food had a lower proportion of water (P, 0.12; C, 0.22), but relative proportions of oil (0.04), crude protein (0.08), crude fibre (0.29), neutral....... Following transfer from pellets to chaff, DEI decreased (P behaviour caused no detectable change in the appetite...

  7. Análise da produção e taxa de geração de resíduos sólidos de serviços de saúde do Hospital Universitário Regional de Maringá = Production analysis and generation rate of solid health-care waste at Maringá Regional University Hospital

    Directory of Open Access Journals (Sweden)

    Lucila Akiko Nagashima

    2007-07-01

    Full Text Available Os resíduos sólidos de serviços de saúde (RSSS representam reduzida parcela do total dos resíduos sólidos urbanos gerados diariamente por uma cidade. Considerando a própria origem, parte desses resíduos apresenta riscos e dificuldades especiais em seu manejo, devido especialmente ao caráter infeccioso de alguns componentes. Estasconstatações associadas à necessidade de conhecer a situação dos RSSS do Hospital Universitário Regional de Maringá motivaram a elaboração do estudo. A pesquisa buscou identificar as diferentes fontes geradoras, caracterizar qualitativa e quantitativamente osresíduos gerados determinando a taxa de geração diária. A caracterização foi efetuada mediante a pesagem dos resíduos, acompanhamento das atividades internas do hospital, quanto aos procedimentos de coleta, armazenamento interno e externo e transporte de seus resíduos sólidos. Constatou-se que do total de resíduos gerados, cerca de 53% são considerados contaminados, percentual creditado como não-satisfatório para uma parcela significante de bibliografia consultada.Solid health-care waste (SHCW represents only a small fraction of the total urban solid waste generated daily in a city. Taking its origin into consideration, part of this waste presents risks and special difficulties in handling, especially due to the infectious aspects of some components. The elaboration of study was motivated by these findings, associated with the need to find out the conditions of the SHCW from the Maringá Regional University Hospital. The research attempted to identify the different generating sources, quantifying and qualifying the generated waste, and determining the daily generated rate. The characterization was done by weighing the waste, observing internal hospital activities regarding collection procedures, internal and external storage and transportation of the waste. It was verified that from the total generated waste, around 53% is considered

  8. Geologic characteristics of the Luna 17/Lunokhod 1 and Chang'E-3/Yutu landing sites, Northwest Mare Imbrium of the Moon

    Science.gov (United States)

    Basilevsky, A. T.; Abdrakhimov, A. M.; Head, J. W.; Pieters, C. M.; Wu, Yunzhao; Xiao, Long

    2015-11-01

    We compared and assessed the results of measurements and observations by the Lunokhod 1 and Yutu rovers, both of which explored the northwestern part of Mare Imbrium. Both sites are within the distinctive Eratosthenian-aged lava flow geologic unit and our comparisons showed that the geologies of these exploration sites are very similar. As in the majority of other areas of the Moon, the dominant landforms in these sites are small impact craters, having various degrees of morphologic prominence and states of preservation, and rock fragments, mostly associated with the rims and interiors of fresh craters. The shape and the degree of preservation of the observed rock fragments in these two sites are similar. In both sites sporadic rock fragments were observed whose morphologies suggest that their source rocks had columnar jointing. Localization of these specific rocks on the rims of 450-470 m in diameter craters implies that the source rocks are at depths of 40-50 m. Regolith in the study areas is typically a few meters thick, but locally can be much thicker. The ground penetrating radar of the Yutu rover revealed the multilayer regolith structure, which is determined by superposition of crater ejecta; with some local variations, this type of the regolith stratigraphy should be typical of the majority of lunar mare sites. The physico-mechanical properties of the regolith in these two sites appear to be rather similar: the bearing capacity ranges from 0.04 to 1.44 kg/cm2, with a modal value ∼0.45 kg/cm2, and the shear strength ranges from 0.02 to 0.1 kg/cm2, with a modal value ∼0.05 kg/cm2. Both these factors decrease by a factor of 3-4 with an increase of surface slope from ∼2 to 12°. The chemical composition of surface materials determined by the rover instruments at these two sites differ from those derived from the remote sensing data for the Eratosthenian-aged basalts on which the two sites are located. This could be partly due to low measurement accuracies

  9. Cryptosporidium spp. infection in mares and foals of the northwest region of São Paulo State, Brazil Infecção por Cryptosporidium spp. em éguas e potros da região noroeste do estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Sandra Valéria Inácio

    2012-12-01

    Full Text Available The present study aimed to analyze the occurrence of infection by Cryptosporidium spp. in mares and their respective foals. This study was carried out in 11 farms located in the municipalities of Araçatuba, Birigui, Guararapes and Santo Antônio do Aracangua, in the northwest region of the State of Sao Paulo, from November 2010 to March 2011. A total of 98 mares and 98 foals of several breeds were analyzed; among foals, 59 were males and 39 females, aged from three to 330 days. Feces were collected directly from the rectal ampulla, purified and processed according to modified Kinyoun stain. Occurrence of Cryptosporidium spp. was 21.4% (21/98 for foals and 18.4% (18/98 for mares. Occurrence of Cryptosporidium spp. had significant association with breeds and age of animals. Results obtained led to the conclusion that foals older than two months and Mangalarga animals are less susceptible to the occurrence of Cryptosporidium spp.O presente estudo teve como objetivo analisar a ocorrência da infecção por Cryptosporidium spp. em éguas e seus respectivos potros. Este estudo foi realizado em 11 fazendas localizadas nos municípios de Araçatuba, Birigui, Guararapes e Santo Antônio do Aracangua, na região Noroeste do Estado de São Paulo, de novembro de 2010 a março de 2011. Um total de 98 éguas e 98 potros de diversas raças foram analisados, sendo que, entre os filhotes, 59 eram machos e 39 fêmeas, cujas idades variavam de três até 330 dias. Fezes foram colhidas diretamente da ampola retal, purificadas e processadas pela técnica de Kinyoun modificada. A ocorrência de Cryptosporidium spp. observada foi de 21,4% (21/98 para potros e 18,4% (18/98 para éguas. A ocorrência de Cryptosporidium spp. teve uma associação significativa com a raça e a idade dos animais. A partir dos resultados obtidos, conclui-se neste estudo que potros com idade superior a dois meses e animais da raça Mangalarga foram menos susceptíveis à ocorrência de

  10. Ancient feeding ecology inferred from stable isotopic evidence from fossil horses in South America over the past 3 Ma

    Directory of Open Access Journals (Sweden)

    Alberdi María T

    2011-06-01

    Full Text Available Abstract Background Stable isotope ratios (13C/12C and 18O/16O in fossil teeth and bone provide key archives for understanding the ecology of extinct horses during the Plio-Pleistocene in South America; however, what happened in areas of sympatry between Equus (Amerhippus and Hippidion is less understood. Results Here, we use stable carbon and oxygen isotopes preserved in 67 fossil tooth and bone samples for seven species of horses from 25 different localities to document the magnitude of the dietary shifts of horses and ancient floral change during the Plio-Pleistocene. Dietary reconstructions inferred from stable isotopes of both genera of horses present in South America document dietary separation and environmental changes in ancient ecosystems, including C3/C4 transitions. Stable isotope data demonstrate changes in C4 grass consumption, inter-species dietary partitioning and variation in isotopic niche breadth of mixed feeders with latitudinal gradient. Conclusions The data for Hippidion indicate a preference varying from C3 plants to mixed C3-C4 plants in their diet. Equus (Amerhippus shows three different patterns of dietary partitioning Equus (A. neogeus from the province of Buenos Aires indicate a preference for C3 plants in the diet. Equus (A. andium from Ecuador and Equus (A. insulatus from Bolivia show a preference for to a diet of mixed C3-C4 plants, while Equus (A. santaeelenae from La Carolina (sea level of Ecuador and Brazil are mostly C4 feeders. These results confirm that ancient feeding ecology cannot always be inferred from dental morphology. While the carbon isotope composition of horses skeletal material decreased as latitude increased, we found evidence of boundary between a mixed C3/C4 diet signal and a pure C4 signal around 32° S and a change from a mixed diet signal to an exclusively C3 signal around 35°S. We found that the horses living at high altitudes and at low to middle latitude still have a C4 component in their

  11. Estudo retrospectivo de janeiro de 1998 a maio de 2005, no Hospital Universitário de Maringá, sobre ferimentos por arma branca e arma de fogo - doi: 10.4025/actascihealthsci.v29i2.1084 Retrospective study (january 1998 / may 2005 at the University Hospital of Maringá, on wounds caused by edged weapons and firearms - DOI: 10.4025/actascihealthsci.1084

    Directory of Open Access Journals (Sweden)

    Ana Carolina Schiavon

    2008-03-01

    Full Text Available O objetivo deste trabalho é determinar as características dos pacientes atendidos no Hospital Universitário de Maringá (HUM, com ferimento por arma branca (FAB e por arma de fogo (FAF, quanto ao sexo, idade, às regiões corporais, órgãos mais atingidos, tempo de internamento, complicações e mortalidade. Após análise de uma planilha elaborada para a pesquisa, observou-se que 68% dos atendimentos foram por FAB e 32%, por FAF, sendo a maioria homens (mais de 90%, adultos jovens (2ª e 3ª década, por FAF e FAB, respectivamente. As regiões mais acometidas foram abdome e tórax. e os órgãos mais atingidos foram intestino delgado e fígado, na lesão por arma branca, e fígado e intestino delgado, no FAF. A complicação mais comum foi o choque hipovolêmico. Concluiu-se que os FAB ocorreram em maior número no sexo masculino, na terceira década de vidaThe objective of this study is to determine the characteristics of patients assisted at the University Hospital of Maringá (HUM with wounds from edged weapons (EWW or firearms (FW, in regards to gender, age, wounded body areas, most affected body organs, length of hospitalization, complications and mortality rates. After the analysis of a worksheet elaborated for the study, it was observed that 68% of admissions had been for EWW and 32% for FW. The majority were men (90% and young adults (20s and 30s, for FW and EWW, respectively. The most affected body areas were the abdomen and thorax, and the most wounded organs were, in order: the small intestine and liver for EWW, and the liver and small intestine for FW. The most common complication was hypovolemic shock. It was concluded that EWW had occurred in larger numbers than FW, with predominance in males in their 30s

  12. Effect of pregnant mare serum gonadotrophin injection on litter size in young Etawah-cross does

    Directory of Open Access Journals (Sweden)

    N.M Artiningsihi

    1996-03-01

    Full Text Available The incidence of twins and/or multiple births in 20 heads of young Etawah-cross does was studied following oestrous synchronization using intravaginal sponges containing 60 mg medroxyprogesterorle acetate (Repromap for 15 days . Twenty four hours priorto sponges withdrawal, the does were injected with pregnant mare serum gonadotrophin (PMSG at dose rates of 0 (Group A, 10 (Group B, 15 (Group C and 20 iu/kg (Group D body weight. Amature buck fitted with an apron was used to detect the onset of oestrus at every four hours. The oestrous doe was naturally mated twice, 12 hours after onset of oestrus and 10 hours later. About 3-5 days after oestrus, all does were subjected to mid-ventral laparoscopy to detect ovulation rate . Two months after mating all does were subjected to pregnancy test using diagnostic ultrasonography. Results showed that all does exhibited clear sign of oestrus. The onset of oestrus occurred 15-43 hours after sponges withdrawal or 39-59 hours after PMSG injection. Does injected with PMSG (Groups B, C and D showed oestrus 16-21 hours earlier (P0 .05 than that of control (Group A . However, there was no significant differences among the PMSG-treated groups . Ovulation rates increased from 1.0 in Group Ato 1.8 in Group B and 2.6 in bah Groups Cand D. Average litter size in Groups A, B, C and D were 1.0, 1.8, 2.4 and 1.0, respectively. It was concluded that injection of 15 iu PMSG/kg body weight gave the best result for increasing litter size in young Etawah-cross does .

  13. Factores Socio-Ambientales y su Influencia en la Flora Cultivada en Patios de la Región Metropolitana de Maringá (Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Fabio Angeoletto

    2014-11-01

    Full Text Available Resumen: Patios urbanos tienen un potencial considerable para la conservación de la biodiversidad y la mejora de la seguridad alimentaria. Sin embargo, estos espacios no son planificados, y existe poca información sobre la diversidad de la flora presente en los patios de las diferentes clases sociales. Hemos cuantificado y comparado la diversidad vegetal de los patios de dos barrios de la zona metropolitana de Maringá (Paraná, Brasil, mediante el cálculo de  índices de diversidad, correlaciones bivariadas y del potencial de plantíos, y trazamos directrices de planificación, con el objetivo de aumentar la presencia de la vegetación arbórea, fortalecer la seguridad alimentaria y contribuir a la conservación de la diversidad biológica, incluyéndose  la conservación de las especies de plantas en peligro de extinción.  

  14. Cloning, Phylogenetic Analysis and 3D Modeling of a Putative Lysosomal Acid Lipase from the Camel, Camelus dromedarius

    Directory of Open Access Journals (Sweden)

    Farid Shokry Ataya

    2012-08-01

    Full Text Available Acid lipase belongs to a family of enzymes that is mainly present in lysosomes of different organs and the stomach. It is characterized by its capacity to withstand acidic conditions while maintaining high lipolytic activity. We cloned for the first time the full coding sequence of camel’s lysosomal acid lipase, cLIPA using RT-PCR technique (Genbank accession numbers JF803951 and AEG75815, for the nucleotide and aminoacid sequences respectively. The cDNA sequencing revealed an open reading frame of 1,197 nucleotides that encodes a protein of 399 aminoacids which was similar to that from other related mammalian species. Bioinformatic analysis was used to determine the aminoacid sequence, 3D structure and phylogeny of cLIPA. Bioinformatics analysis suggested the molecular weight of the translated protein to be 45.57 kDa, which could be decreased to 43.16 kDa after the removal of a signal peptide comprising the first 21 aminoacids. The deduced cLIPA sequences exhibited high identity with Equus caballus (86%, Numascus leucogenys (85%, Homo sapiens (84%, Sus scrofa (84%, Bos taurus (82% and Ovis aries (81%. cLIPA shows high aminoacid sequence identity with human and dog-gastric lipases (58%, and 59% respectively which makes it relevant to build a 3D structure model for cLIPA. The comparison confirms the presence of the catalytic triad and the oxyanion hole in cLIPA. Phylogenetic analysis revealed that camel cLIPA is grouped with monkey, human, pig, cow and goat. The level of expression of cLIPA in five camel tissues was examined using Real Time-PCR. The highest level of cLIPA transcript was found in the camel testis (162%, followed by spleen (129%, liver (100%, kidney (20.5% and lung (17.4%.

  15. The albinism of the feral Asinara white donkeys (Equus asinus) is determined by a missense mutation in a highly conserved position of the tyrosinase (TYR) gene deduced protein.

    Science.gov (United States)

    Utzeri, V J; Bertolini, F; Ribani, A; Schiavo, G; Dall'Olio, S; Fontanesi, L

    2016-02-01

    A feral donkey population (Equus asinus), living in the Asinara National Park (an island north-west of Sardinia, Italy), includes a unique white albino donkey subpopulation or colour morph that is a major attraction of this park. Disrupting mutations in the tyrosinase (TYR) gene are known to cause recessive albinisms in humans (oculocutaneous albinism Type 1; OCA1) and other species. In this study, we analysed the donkey TYR gene as a strong candidate to identify the causative mutation of the albinism of these donkeys. The TYR gene was sequenced from 13 donkeys (seven Asinara white albino and six coloured animals). Seven single nucleotide polymorphisms were identified. A missense mutation (c.604C>G; p.His202Asp) in a highly conserved amino acid position (even across kingdoms), which disrupts the first copper-binding site (CuA) of functional protein, was identified in the homozygous condition (G/G or D/D) in all Asinara white albino donkeys and in the albino son of a trio (the grey parents had genotype C/G or H/D), supporting the recessive mode of inheritance of this mutation. Genotyping 82 donkeys confirmed that Asinara albino donkeys had genotype G/G whereas all other coloured donkeys had genotype C/C or C/G. Across-population association between the c.604C>G genotypes and the albino coat colour was highly significant (P = 6.17E-18). The identification of the causative mutation of the albinism in the Asinara white donkeys might open new perspectives to study the dynamics of this putative deleterious allele in a feral population and to manage this interesting animal genetic resource. © 2015 Stichting International Foundation for Animal Genetics.

  16. Caracterização dos traumas abdominais em pacientes atendidos no Hospital Universitário Regional de Maringá, 2006 - DOI: 10.4025/actascihealthsci.v30i2.1998 Abdominal trauma at the University Hospital of Maringá, 2006 - DOI: 10.4025/actascihealthsci.v30i2.1998

    Directory of Open Access Journals (Sweden)

    Josiane Miyaji Daniel

    2008-12-01

    Full Text Available De todas as mortes por causas externas por trauma, metade poderia ser evitada, e um terço delas é dito potencialmente evitável. Objetiva-se determinar as características comuns referentes ao paciente com traumatismo abdominal. Realizou-se um estudo de 57 casos de pacientes com traumatismo abdominal atendidos no Hospital Universitário Regional de Maringá, no período de janeiro a dezembro de 2006. Constatou-se que a maioria das vítimas é do sexo masculino; a faixa etária mais acometida é a terceira década de vida; o trauma abdominal aberto mostrou-se discretamente mais frequente, sendo o ferimento por arma branca mais comum; a maioria das contusões abdominais se deveu a acidentes de trânsito; a realização de intervenção cirúrgica supera o tratamento conservador nos traumas abdominais abertos; nos traumas contusos, o baço e os rins foram os órgãos mais acometidos, enquanto nos ferimentos abertos a víscera mais acometida foi o intestino delgado; a evolução para óbito predominou nos traumas abdominais abertos. Em virtude da prevalência, gravidade e importância do tema, sugere-se que mais estudos sejam realizados para que, assim, seja possível estabelecer condutas cada vez mais apropriadas à realidade do Sistema Único de Saúde.Of all the deaths due to external cause trauma, half could be avoided, and a third are potentially preventable. The objective of this study was to determine the common characteristics related to patients with abdominal trauma. A study was conducted of 57 cases of abdominal trauma at the University Hospital of Maringá, during the period from January to December 2006. The majority of victims are male; the most affected age group is in its third decade of life; open abdominal trauma proved to be slightly more prevalent, and wounds from cold steel weapons were the most common; most abdominal injuries were due to traffic accidents; the conduct of surgical intervention overcomes conservative treatment

  17. GONAD REMATURATION ON Pangasionodon hypophthalmus FEMALE THROUGH INJECTION OF PREGNANT MARE SERUM GONADOTROPIN AND HUMAN CHORIONIC GONADOTROPIN

    Directory of Open Access Journals (Sweden)

    Evi Tahapari

    2014-06-01

    Full Text Available The success of spawning is influenced by internal and external factors. One of the factors that affect the var iabi li ty of Pangasianodon hypophthalmus female reproductive is the change of seasons that cause disrupted continuity of the seed availability, especially in the dry season. In the present study, combination of PMSG (pregnant mare serum gonadotropin + HCG (hormone chorionic gonadotropin hormone injections was done to induce gonad development. The treatments in this study were without hormone injections as control (A, injection of PMSG 10 IU/kg + HCG 10 IU/kg (B, and injection of PMSG 20 IU/kg HCG + 10 IU/kg (C. Injections were conducted at intervals of two weeks as many as six times. The results showed that gonad maturation generally occurs 2-4 weeks after estradiol-17 peak. PMSG + HCG hormone injections gave a significant effect on increasing the quantity and quality of eggs production. The fecundity in the A, B, C treatments, were 233,700±220,676; 300,305±24,581 and 488,433±142,228; respectively. Number of larvae produced from the A, B, C treatments, were 156,979±170,838; 229,997±18,081 and 362,713±101,850; respectively. Combination of PMSG 20 IU/kg + HCG 10 IU/kg hormone injection gave the best result on fecundity and the number of larvae production.

  18. DETOMIDINE AND BUTORPHANOL FOR STANDING SEDATION IN A RANGE OF ZOO-KEPT UNGULATE SPECIES.

    Science.gov (United States)

    Bouts, Tim; Dodds, Joanne; Berry, Karla; Arif, Abdi; Taylor, Polly; Routh, Andrew; Gasthuys, Frank

    2017-09-01

    General anesthesia poses risks for larger zoo species, like cardiorespiratory depression, myopathy, and hyperthermia. In ruminants, ruminal bloat and regurgitation of rumen contents with potential aspiration pneumonia are added risks. Thus, the use of sedation to perform minor procedures is justified in zoo animals. A combination of detomidine and butorphanol has been routinely used in domestic animals. This drug combination, administered by remote intramuscular injection, can also be applied for standing sedation in a range of zoo animals, allowing a number of minor procedures. The combination was successfully administered in five species of nondomesticated equids (Przewalski horse [ Equus ferus przewalskii; n = 1], onager [ Equus hemionus onager; n = 4], kiang [ Equus kiang ; n = 3], Grevy's zebra [ Equus grevyi ; n = 4], and Somali wild ass [ Equus africanus somaliensis; n = 7]), with a mean dose range of 0.10-0.17 mg/kg detomidine and 0.07-0.13 mg/kg butorphanol; the white ( Ceratotherium simum simum; n = 12) and greater one-horned rhinoceros ( Rhinoceros unicornis ; n = 4), with a mean dose of 0.015 mg/kg of both detomidine and butorphanol; and Asiatic elephant bulls ( Elephas maximus ; n = 2), with a mean dose of 0.018 mg/kg of both detomidine and butorphanol. In addition, the combination was successfully used for standing sedation in six species of artiodactylids: giraffe ( Giraffa camelopardalis reticulata; n = 3), western bongo ( Tragelaphus eurycerus eurycerus; n = 2), wisent ( Bison bonasus ; n = 5), yak ( Bos grunniens ; n = 1), water buffalo ( Bubalus bubalis ; n = 4) and Bactrian camel ( Camelus bactrianus ; n = 5). The mean dose range for artiodactylid species except bongo was 0.04-0.06 mg/kg detomidine and 0.03-0.06 mg/kg butorphanol. The dose in bongo, 0.15-0.20 mg/kg detomidine and 0.13-0.15 mg/kg butorphanol, was considerably higher. Times to first effect, approach, and recovery after antidote were short. The use of detomidine and butorphanol has

  19. Effects of inbreeding and other systematic effects on fertility of Black Forest Draught horses in Germany.

    Science.gov (United States)

    Müller-Unterberg, Maarit; Wallmann, Sandra; Distl, Ottmar

    2017-10-18

    The Black Forest Draught horse (BFDH) is an endangered German coldblood breed with its origin in the area of the Black Forest in South Germany. In this retrospective study, the influence of the inbreeding coefficient on foaling rates was investigated using records from ten breeding seasons. Due to the small population size of BFDH, the level of inbreeding is increasing and may have an effect on foaling rates.The data of the present study included all coverings reported for 1024 BFDH mares in the years 2001-2009. These mares were covered by 32 BFDH stallions from the State Stud Marbach. Data from 4534 estrus cycles was used to calculate per cycle foaling rate (CFR). Pedigree data contained all studbook data up to the foundation of the breed as early as 1836. The level of inbreeding of the mare, stallion and expected foal along with other systematic effects on CFR were analysed using a generalized linear mixed model approach. Stallion was employed as a random effect. Systematic fixed effects were month of mating, mating type, age of the mare and stallion, reproductive status of the mare and stallion line of the mare. Inbreeding coefficients of the stallion, mare and expected foal were modelled as linear covariates. The average CFR was 40.9%. The mean inbreeding coefficients of the mares, stallions and expected foals were 7.46, 7.70 and 9.66%. Mating type, age of the mare, reproductive status of the mare and stallion line of the mare had a significant effect. The results showed that the mating type, stallion line of the mare, sire, age and reproductive status of the mare exerted the largest influences on CFR in BFDH. Inbreeding coefficients of the stallion, mare and expected foal were not significantly related with CFR.

  20. A Heavy Metal Atmospheric Deposition Study Around the Lead and Copper-Zinc Smelters in Baia Mare, Romania, Employing the Moss Biomonitoring Technique, ENAA and FAAS

    CERN Document Server

    Culicov, O A; Steinnes, E; Okina, O S; Santa, Z; Todoran, R

    2001-01-01

    The mosses Pleurozium schreberi, Pseudoscleropodium purum and Rhytidiadelphus squarrosus were used as biomonitors to study the atmospheric deposition of metals around the lead and copper-zinc smelters in Baia Mare. Samples representing the last three years' growth of moss or its green part, collected on the ground at 28 sites located 2-20 km from the source area, were analyzed by instrumental neutron activation analysis using epithermal neutrons (ENAA) and by flame atomic absorption spectrometry (FAAS). A total of 30 elements were determined, including most of the heavy metals known to be released into the air from this kind of industry. Obtained concentrations for As and Cu are comparable with those observed in Karabash, South Ural Mountains, one of the most polluted regions in Europe. Besides, these two elements correlate very well with each other. The mean values for Zn (136 ppm) and Pb (41 ppm) are substantially higher than those normally found in the literature. The highest value for Pb (175 ppm) was obs...